(data stored in ACNUC7421 zone)

EMBL: CP001804

ID   CP001804; SV 1; circular; genomic DNA; STD; PRO; 9446314 BP.
XX
AC   CP001804; ABTW01000000-ABTW01000045;
XX
PR   Project:PRJNA28711;
XX
DT   28-OCT-2009 (Rel. 102, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Haliangium ochraceum DSM 14365, complete genome.
XX
KW   .
XX
OS   Haliangium ochraceum DSM 14365
OC   Bacteria; Proteobacteria; Deltaproteobacteria; Myxococcales;
OC   Nannocystineae; Kofleriaceae; Haliangium.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-9446314
RX   PUBMED; 21304682.
RA   Ivanova N., Daum C., Lang E., Abt B., Kopitz M., Saunders E., Lapidus A.,
RA   Lucas S., Glavina Del Rio T., Nolan M., Tice H., Copeland A., Cheng J.F.,
RA   Chen F., Bruce D., Goodwin L., Pitluck S., Mavromatis K., Pati A.,
RA   Mikhailova N., Chen A., Palaniappan K., Land M., Hauser L., Chang Y.J.,
RA   Jeffries C.D., Detter J.C., Brettin T., Rohde M., Goker M., Bristow J.,
RA   Markowitz V., Eisen J.A., Hugenholtz P., Kyrpides N.C., Klenk H.P.;
RT   "Complete genome sequence of Haliangium ochraceum type strain (SMP-2)";
RL   Stand Genomic Sci 2(1):96-106(2010).
XX
RN   [2]
RP   1-9446314
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Saunders E., Brettin T., Detter J.C., Han C., Larimer F., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Lang E., Kopitz M., Schneider S., Goeker M., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Haliangium ochraceum DSM 14365";
RL   Unpublished.
XX
RN   [3]
RP   1-9446314
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Saunders E., Brettin T., Detter J.C., Han C., Larimer F., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Lang E., Kopitz M., Schneider S., Goeker M., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (21-OCT-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; c1a0eab16655bbddb5b55ba79824ec68.
DR   BioSample; SAMN00002596.
DR   CABRI; DSM 14365.
DR   EnsemblGenomes-Gn; EBG00001450763.
DR   EnsemblGenomes-Gn; EBG00001450764.
DR   EnsemblGenomes-Gn; EBG00001450765.
DR   EnsemblGenomes-Gn; EBG00001450766.
DR   EnsemblGenomes-Gn; EBG00001450767.
DR   EnsemblGenomes-Gn; EBG00001450768.
DR   EnsemblGenomes-Gn; EBG00001450769.
DR   EnsemblGenomes-Gn; EBG00001450770.
DR   EnsemblGenomes-Gn; EBG00001450771.
DR   EnsemblGenomes-Gn; EBG00001450772.
DR   EnsemblGenomes-Gn; EBG00001450773.
DR   EnsemblGenomes-Gn; EBG00001450774.
DR   EnsemblGenomes-Gn; EBG00001450775.
DR   EnsemblGenomes-Gn; EBG00001450776.
DR   EnsemblGenomes-Gn; EBG00001450777.
DR   EnsemblGenomes-Gn; EBG00001450778.
DR   EnsemblGenomes-Gn; EBG00001450779.
DR   EnsemblGenomes-Gn; EBG00001450780.
DR   EnsemblGenomes-Gn; EBG00001450781.
DR   EnsemblGenomes-Gn; EBG00001450782.
DR   EnsemblGenomes-Gn; EBG00001450783.
DR   EnsemblGenomes-Gn; EBG00001450784.
DR   EnsemblGenomes-Gn; EBG00001450785.
DR   EnsemblGenomes-Gn; EBG00001450786.
DR   EnsemblGenomes-Gn; EBG00001450787.
DR   EnsemblGenomes-Gn; EBG00001450788.
DR   EnsemblGenomes-Gn; EBG00001450789.
DR   EnsemblGenomes-Gn; EBG00001450790.
DR   EnsemblGenomes-Gn; EBG00001450791.
DR   EnsemblGenomes-Gn; EBG00001450792.
DR   EnsemblGenomes-Gn; EBG00001450793.
DR   EnsemblGenomes-Gn; EBG00001450794.
DR   EnsemblGenomes-Gn; EBG00001450795.
DR   EnsemblGenomes-Gn; EBG00001450796.
DR   EnsemblGenomes-Gn; EBG00001450797.
DR   EnsemblGenomes-Gn; EBG00001450798.
DR   EnsemblGenomes-Gn; EBG00001450799.
DR   EnsemblGenomes-Gn; EBG00001450800.
DR   EnsemblGenomes-Gn; EBG00001450801.
DR   EnsemblGenomes-Gn; EBG00001450802.
DR   EnsemblGenomes-Gn; EBG00001450803.
DR   EnsemblGenomes-Gn; EBG00001450804.
DR   EnsemblGenomes-Gn; EBG00001450805.
DR   EnsemblGenomes-Gn; EBG00001450806.
DR   EnsemblGenomes-Gn; EBG00001450807.
DR   EnsemblGenomes-Gn; EBG00001450808.
DR   EnsemblGenomes-Gn; EBG00001450809.
DR   EnsemblGenomes-Gn; EBG00001450810.
DR   EnsemblGenomes-Gn; EBG00001450811.
DR   EnsemblGenomes-Gn; EBG00001450812.
DR   EnsemblGenomes-Gn; EBG00001450813.
DR   EnsemblGenomes-Gn; EBG00001450814.
DR   EnsemblGenomes-Gn; EBG00001450815.
DR   EnsemblGenomes-Gn; EBG00001450816.
DR   EnsemblGenomes-Gn; EBG00001450817.
DR   EnsemblGenomes-Gn; EBG00001450818.
DR   EnsemblGenomes-Gn; EBG00001450819.
DR   EnsemblGenomes-Gn; EBG00001450820.
DR   EnsemblGenomes-Gn; EBG00001450821.
DR   EnsemblGenomes-Gn; EBG00001450822.
DR   EnsemblGenomes-Gn; EBG00001450823.
DR   EnsemblGenomes-Gn; EBG00001450824.
DR   EnsemblGenomes-Gn; EBG00001450825.
DR   EnsemblGenomes-Gn; EBG00001450826.
DR   EnsemblGenomes-Gn; Hoch_R0001.
DR   EnsemblGenomes-Gn; Hoch_R0002.
DR   EnsemblGenomes-Gn; Hoch_R0003.
DR   EnsemblGenomes-Gn; Hoch_R0004.
DR   EnsemblGenomes-Gn; Hoch_R0005.
DR   EnsemblGenomes-Gn; Hoch_R0006.
DR   EnsemblGenomes-Gn; Hoch_R0007.
DR   EnsemblGenomes-Gn; Hoch_R0008.
DR   EnsemblGenomes-Gn; Hoch_R0009.
DR   EnsemblGenomes-Gn; Hoch_R0010.
DR   EnsemblGenomes-Gn; Hoch_R0011.
DR   EnsemblGenomes-Gn; Hoch_R0012.
DR   EnsemblGenomes-Gn; Hoch_R0013.
DR   EnsemblGenomes-Gn; Hoch_R0014.
DR   EnsemblGenomes-Gn; Hoch_R0015.
DR   EnsemblGenomes-Gn; Hoch_R0016.
DR   EnsemblGenomes-Gn; Hoch_R0017.
DR   EnsemblGenomes-Gn; Hoch_R0018.
DR   EnsemblGenomes-Gn; Hoch_R0019.
DR   EnsemblGenomes-Gn; Hoch_R0020.
DR   EnsemblGenomes-Gn; Hoch_R0021.
DR   EnsemblGenomes-Gn; Hoch_R0022.
DR   EnsemblGenomes-Gn; Hoch_R0023.
DR   EnsemblGenomes-Gn; Hoch_R0024.
DR   EnsemblGenomes-Gn; Hoch_R0025.
DR   EnsemblGenomes-Gn; Hoch_R0026.
DR   EnsemblGenomes-Gn; Hoch_R0027.
DR   EnsemblGenomes-Gn; Hoch_R0028.
DR   EnsemblGenomes-Gn; Hoch_R0029.
DR   EnsemblGenomes-Gn; Hoch_R0030.
DR   EnsemblGenomes-Gn; Hoch_R0031.
DR   EnsemblGenomes-Gn; Hoch_R0032.
DR   EnsemblGenomes-Gn; Hoch_R0033.
DR   EnsemblGenomes-Gn; Hoch_R0034.
DR   EnsemblGenomes-Gn; Hoch_R0035.
DR   EnsemblGenomes-Gn; Hoch_R0036.
DR   EnsemblGenomes-Gn; Hoch_R0037.
DR   EnsemblGenomes-Gn; Hoch_R0038.
DR   EnsemblGenomes-Gn; Hoch_R0039.
DR   EnsemblGenomes-Gn; Hoch_R0040.
DR   EnsemblGenomes-Gn; Hoch_R0041.
DR   EnsemblGenomes-Gn; Hoch_R0042.
DR   EnsemblGenomes-Gn; Hoch_R0043.
DR   EnsemblGenomes-Gn; Hoch_R0044.
DR   EnsemblGenomes-Gn; Hoch_R0045.
DR   EnsemblGenomes-Gn; Hoch_R0046.
DR   EnsemblGenomes-Gn; Hoch_R0047.
DR   EnsemblGenomes-Gn; Hoch_R0048.
DR   EnsemblGenomes-Gn; Hoch_R0049.
DR   EnsemblGenomes-Gn; Hoch_R0050.
DR   EnsemblGenomes-Gn; Hoch_R0051.
DR   EnsemblGenomes-Gn; Hoch_R0052.
DR   EnsemblGenomes-Gn; Hoch_R0053.
DR   EnsemblGenomes-Gn; Hoch_R0054.
DR   EnsemblGenomes-Gn; Hoch_R0055.
DR   EnsemblGenomes-Tr; EBT00001604640.
DR   EnsemblGenomes-Tr; EBT00001604641.
DR   EnsemblGenomes-Tr; EBT00001604642.
DR   EnsemblGenomes-Tr; EBT00001604643.
DR   EnsemblGenomes-Tr; EBT00001604644.
DR   EnsemblGenomes-Tr; EBT00001604645.
DR   EnsemblGenomes-Tr; EBT00001604646.
DR   EnsemblGenomes-Tr; EBT00001604647.
DR   EnsemblGenomes-Tr; EBT00001604648.
DR   EnsemblGenomes-Tr; EBT00001604649.
DR   EnsemblGenomes-Tr; EBT00001604650.
DR   EnsemblGenomes-Tr; EBT00001604651.
DR   EnsemblGenomes-Tr; EBT00001604652.
DR   EnsemblGenomes-Tr; EBT00001604653.
DR   EnsemblGenomes-Tr; EBT00001604654.
DR   EnsemblGenomes-Tr; EBT00001604655.
DR   EnsemblGenomes-Tr; EBT00001604656.
DR   EnsemblGenomes-Tr; EBT00001604657.
DR   EnsemblGenomes-Tr; EBT00001604658.
DR   EnsemblGenomes-Tr; EBT00001604659.
DR   EnsemblGenomes-Tr; EBT00001604660.
DR   EnsemblGenomes-Tr; EBT00001604661.
DR   EnsemblGenomes-Tr; EBT00001604662.
DR   EnsemblGenomes-Tr; EBT00001604663.
DR   EnsemblGenomes-Tr; EBT00001604664.
DR   EnsemblGenomes-Tr; EBT00001604665.
DR   EnsemblGenomes-Tr; EBT00001604666.
DR   EnsemblGenomes-Tr; EBT00001604667.
DR   EnsemblGenomes-Tr; EBT00001604668.
DR   EnsemblGenomes-Tr; EBT00001604669.
DR   EnsemblGenomes-Tr; EBT00001604670.
DR   EnsemblGenomes-Tr; EBT00001604671.
DR   EnsemblGenomes-Tr; EBT00001604672.
DR   EnsemblGenomes-Tr; EBT00001604673.
DR   EnsemblGenomes-Tr; EBT00001604674.
DR   EnsemblGenomes-Tr; EBT00001604675.
DR   EnsemblGenomes-Tr; EBT00001604676.
DR   EnsemblGenomes-Tr; EBT00001604677.
DR   EnsemblGenomes-Tr; EBT00001604678.
DR   EnsemblGenomes-Tr; EBT00001604679.
DR   EnsemblGenomes-Tr; EBT00001604680.
DR   EnsemblGenomes-Tr; EBT00001604681.
DR   EnsemblGenomes-Tr; EBT00001604682.
DR   EnsemblGenomes-Tr; EBT00001604683.
DR   EnsemblGenomes-Tr; EBT00001604684.
DR   EnsemblGenomes-Tr; EBT00001604685.
DR   EnsemblGenomes-Tr; EBT00001604686.
DR   EnsemblGenomes-Tr; EBT00001604687.
DR   EnsemblGenomes-Tr; EBT00001604688.
DR   EnsemblGenomes-Tr; EBT00001604689.
DR   EnsemblGenomes-Tr; EBT00001604690.
DR   EnsemblGenomes-Tr; EBT00001604691.
DR   EnsemblGenomes-Tr; EBT00001604692.
DR   EnsemblGenomes-Tr; EBT00001604693.
DR   EnsemblGenomes-Tr; EBT00001604694.
DR   EnsemblGenomes-Tr; EBT00001604695.
DR   EnsemblGenomes-Tr; EBT00001604696.
DR   EnsemblGenomes-Tr; EBT00001604697.
DR   EnsemblGenomes-Tr; EBT00001604698.
DR   EnsemblGenomes-Tr; EBT00001604699.
DR   EnsemblGenomes-Tr; EBT00001604700.
DR   EnsemblGenomes-Tr; EBT00001604701.
DR   EnsemblGenomes-Tr; EBT00001604702.
DR   EnsemblGenomes-Tr; EBT00001604703.
DR   EnsemblGenomes-Tr; Hoch_R0001-1.
DR   EnsemblGenomes-Tr; Hoch_R0002-1.
DR   EnsemblGenomes-Tr; Hoch_R0003-1.
DR   EnsemblGenomes-Tr; Hoch_R0004-1.
DR   EnsemblGenomes-Tr; Hoch_R0005-1.
DR   EnsemblGenomes-Tr; Hoch_R0006-1.
DR   EnsemblGenomes-Tr; Hoch_R0007-1.
DR   EnsemblGenomes-Tr; Hoch_R0008-1.
DR   EnsemblGenomes-Tr; Hoch_R0009-1.
DR   EnsemblGenomes-Tr; Hoch_R0010-1.
DR   EnsemblGenomes-Tr; Hoch_R0011-1.
DR   EnsemblGenomes-Tr; Hoch_R0012-1.
DR   EnsemblGenomes-Tr; Hoch_R0013-1.
DR   EnsemblGenomes-Tr; Hoch_R0014-1.
DR   EnsemblGenomes-Tr; Hoch_R0015-1.
DR   EnsemblGenomes-Tr; Hoch_R0016-1.
DR   EnsemblGenomes-Tr; Hoch_R0017-1.
DR   EnsemblGenomes-Tr; Hoch_R0018-1.
DR   EnsemblGenomes-Tr; Hoch_R0019-1.
DR   EnsemblGenomes-Tr; Hoch_R0020-1.
DR   EnsemblGenomes-Tr; Hoch_R0021-1.
DR   EnsemblGenomes-Tr; Hoch_R0022-1.
DR   EnsemblGenomes-Tr; Hoch_R0023-1.
DR   EnsemblGenomes-Tr; Hoch_R0024-1.
DR   EnsemblGenomes-Tr; Hoch_R0025-1.
DR   EnsemblGenomes-Tr; Hoch_R0026-1.
DR   EnsemblGenomes-Tr; Hoch_R0027-1.
DR   EnsemblGenomes-Tr; Hoch_R0028-1.
DR   EnsemblGenomes-Tr; Hoch_R0029-1.
DR   EnsemblGenomes-Tr; Hoch_R0030-1.
DR   EnsemblGenomes-Tr; Hoch_R0031-1.
DR   EnsemblGenomes-Tr; Hoch_R0032-1.
DR   EnsemblGenomes-Tr; Hoch_R0033-1.
DR   EnsemblGenomes-Tr; Hoch_R0034-1.
DR   EnsemblGenomes-Tr; Hoch_R0035-1.
DR   EnsemblGenomes-Tr; Hoch_R0036-1.
DR   EnsemblGenomes-Tr; Hoch_R0037-1.
DR   EnsemblGenomes-Tr; Hoch_R0038-1.
DR   EnsemblGenomes-Tr; Hoch_R0039-1.
DR   EnsemblGenomes-Tr; Hoch_R0040-1.
DR   EnsemblGenomes-Tr; Hoch_R0041-1.
DR   EnsemblGenomes-Tr; Hoch_R0042-1.
DR   EnsemblGenomes-Tr; Hoch_R0043-1.
DR   EnsemblGenomes-Tr; Hoch_R0044-1.
DR   EnsemblGenomes-Tr; Hoch_R0045-1.
DR   EnsemblGenomes-Tr; Hoch_R0046-1.
DR   EnsemblGenomes-Tr; Hoch_R0047-1.
DR   EnsemblGenomes-Tr; Hoch_R0048-1.
DR   EnsemblGenomes-Tr; Hoch_R0049-1.
DR   EnsemblGenomes-Tr; Hoch_R0050-1.
DR   EnsemblGenomes-Tr; Hoch_R0051-1.
DR   EnsemblGenomes-Tr; Hoch_R0052-1.
DR   EnsemblGenomes-Tr; Hoch_R0053-1.
DR   EnsemblGenomes-Tr; Hoch_R0054-1.
DR   EnsemblGenomes-Tr; Hoch_R0055-1.
DR   EuropePMC; PMC3408162; 22661709.
DR   EuropePMC; PMC3535987; 23114762.
DR   EuropePMC; PMC6226438; 30413766.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   SILVA-LSU; CP001804.
DR   SILVA-SSU; CP001804.
DR   StrainInfo; 302596; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083008
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Haliangium ochraceum SMP-2, DSM 14365
CC   Culture Collection ID :: DSM 14365, JCM 11303
CC   GOLD Stamp ID         :: Gi02251
CC   Greengenes ID         :: 10654
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: Prodigal
CC   Isolation Site        :: Coastal sands from Japan
CC   Isolation Country     :: Japan
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 30C
CC   Salinity              :: Halophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Coastal, Marine, Sand
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..9446314
FT                   /organism="Haliangium ochraceum DSM 14365"
FT                   /strain="DSM 14365"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:502025"
FT   gene            109..1605
FT                   /locus_tag="Hoch_0001"
FT   CDS_pept        109..1605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: scl:sce0001 chromosomal replication initiator
FT                   protein DnaA; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12643"
FT                   /db_xref="GOA:D0LFK9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFK9"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACY12643.1"
FT                   /translation="MTDPWAEALRSLSSKLSPQNYEMWLRPIRCRDYRDEVLVLEAPNS
FT                   YVRLWFESNYLAIVLDEIKEQTGISYRVEFLPEPEDGAAAQPEADDVPGTDDVPAVLLG
FT                   GAAASASACAQGAAPITDISASRSARPRAASGQRAGASAGGLRVVEAPPEPVPPPPLNP
FT                   RYTFDSFVAGPSNQLALAASQAAASSHPPKYNPVFICGGVGLGKTHLLHSIGHSLHGLR
FT                   PDARILYLSGERFMNEYILAIRSNRMHEFRRRYREGCDLLLIDDVQFLAGKDGTQDEFF
FT                   HTFNALHDSQRQIVLTADRKPHEISDIADRLRSRFQWGLLADIEPPELEMRMAILRQKA
FT                   EAEHIELPDDVVLYIATAIRANVRELEGALIRLSAYASLSRKPITLAFARETLEGSLTR
FT                   KREHLTTEMVIKTVANYYGLKVSDIKSARRHKAIAGPRAVAMYLARAHTKDSYPDLGRA
FT                   FGGKHHTTVISAVEKITAKREEDLGLSGEIQAIESVLLRS"
FT   gene            2323..3420
FT                   /locus_tag="Hoch_0002"
FT   CDS_pept        2323..3420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: ade:Adeh_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain; SMART: DNA polymerase III
FT                   beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12644"
FT                   /db_xref="GOA:D0LFL0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFL0"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACY12644.1"
FT                   /translation="MEFRIQKSEFLKGLRIAQSIADRKSTMPMLANVLLRTSGKKKLLV
FT                   AATDLNVSISAELTSKNSAEGGLTVGAKALFDIVANMPEDDVVLRRTDNNWAEISCGKV
FT                   KYRLVGMPDRDFPKVPEHSEAEFKDVEAELMREMIDRTLFSVCNDETRFHLNGVLFESD
FT                   GSTARMVSTDGHRLSKVERTLEGAPALTAGIIIPKKGIGEIKKLLESGGKAAVAVKTPY
FT                   IFVHADSMILAVKLIESQFPPYEQVIPKEHTREVVIDRQRLLSALKRAQLMSSETRGVK
FT                   FNVSPDSLVITSDNPDIGEVREELEAQYDGEEVSIGFNPKYVIDLLSQMATDQVTLELN
FT                   GELDPGLLRPFSDDNYLGVVMPMRI"
FT   gene            3430..4578
FT                   /locus_tag="Hoch_0003"
FT   CDS_pept        3430..4578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: gem:GM21_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12645"
FT                   /db_xref="GOA:D0LFL1"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFL1"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACY12645.1"
FT                   /translation="MLVRALKLEGIRNLAPLTLTPGPRFNVFHGDNGQGKTNLLETIYV
FT                   VGALRSFRTQRLAELIAFERDRAYIGARIQRGGLERVYELVQRQRGRQVRLDGKAVRPI
FT                   SKYFGDFNVVLFAPEDLQVPRGSPAERRRFLDRAVFNRSPRYLGEVQAYDKVVKNRNAL
FT                   LRELGSGKRSLRQAGDFLAVFDQQLAELGALLMRYRVHFLDEIRPRFQEAFQSITHTGL
FT                   AVDVSYASAVDITQASDSAESGPGSEQLTRALAAAIAERRPRDLARGSSSVGPHRDDLV
FT                   FELDGHPAAAFASQGQLRALVLAWKTAEMQLLAHTHGEEPVLLLDDVSSELDATRNGYL
FT                   FEFLKARRGQCFITTTHPRHVLLSSEREDYRVEGGLVTPQRP"
FT   gene            4639..7104
FT                   /locus_tag="Hoch_0004"
FT   CDS_pept        4639..7104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="KEGG: scl:sce8166 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA topoisomerase type IIA subunit
FT                   B region 2 domain protein; DNA gyrase subunit B domain
FT                   protein; ATP- binding region ATPase domain protein; SMART:
FT                   DNA topoisomerase II; ATP-binding region ATPase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12646"
FT                   /db_xref="GOA:D0LFL2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFL2"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACY12646.1"
FT                   /translation="MADPTVTPANDATEYDADSITVLKGLEAVRKRPGMYIGDTDDGSG
FT                   LHHMVHEVVDNAVDEALAGYCDRVDITIHSDNSITVEDNGRGIPVAVHKDEGRPAAELV
FT                   MTVLHAGGKFNQNSYKVSGGLHGVGVSVVNALSRTLKLEIRREGKVYFQEYRQGIPVSD
FT                   LRSTGTTDRRGTKITFLPDPEVFKQTEFSFGALSQRFRELSYLNSGLTIAITDERESQQ
FT                   QVFCYEGGMASFVADLNANKNPVTEVVAFTDEREGVTVDIAMQWNDSYAEQINCFTNTI
FT                   KNKDGGTHLTGFRQGLTRTVNAYAAENKLLKELKGNNLSGEDLREGLVAVISVKVADPK
FT                   FSNQPKDKLVSSEVAGAVAAVVNDKLQSFFEHNPKDARSIIQKAVVAARARDAARKARE
FT                   MVQRKGALEYTSLPGKLADCQERDPSKCELFIVEGESAGGSAKQGRDREFQAILPLKGK
FT                   ILNVERARMDKMLSSQEIVTLITALGCGIGPEKDMGRLRYHRIVIMTDADVDGSHIRTL
FT                   LLTFFFRQYPEIIENNHLYIAQPPLFKVKRGKSETYLKNEHSLEDYVLDLVSKELVVRG
FT                   TSGDGAGGDDAGPEITGEALHAFIKDTNEYRRHYTQLDKRGDSRLFASFIEGGEFTEQD
FT                   LASEEGVERVRAGMRAYLEAHHKDLADLEFELVRDEEHSVYALRAPLEGGNVRRDTIIG
FT                   RDLLQTREVEEIARLTKSLDATLRGPYVLVHKGEDIGTVTTLDELAEAVEAVGRKGLSI
FT                   QRYKGLGEMNSDQLWDTTMCPDQRTLLQVRIDAREEAADVFSVLMGDLVEPRRHFIENN
FT                   ALNVRNLDI"
FT   gene            7226..8233
FT                   /locus_tag="Hoch_0005"
FT   CDS_pept        7226..8233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0005"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="KEGG: afw:Anae109_0005 3-oxoacyl-(acyl-carrier-
FT                   protein) synthase III; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) synthase III; PFAM:
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; 3-Oxoacyl-[acyl-carrier- protein (ACP)] synthase
FT                   III; chalcone and stilbene synthase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12647"
FT                   /db_xref="GOA:D0LFL3"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFL3"
FT                   /inference="protein motif:TFAM:TIGR00747"
FT                   /protein_id="ACY12647.1"
FT                   /translation="MAEIRSRVLAIGGYVPPNVVTNHDFKEKLGIDTSHEWIVERTGIE
FT                   QRHWATPEDSGAKMAANATREALEKAGREASDIDMIVYATLSPDHTFPGTGVFLQRELG
FT                   LGHIPCVDIRQQCTGFIYALSIADSFIRTGQYKTVLVIGSEIHSTGLDKTTNGRDVSVL
FT                   FGDGAGAALLGVADDDSHQILSSHLYADGSEAEILWTDKPGSRYHPRITKDDIDEGRHY
FT                   PAMQGRKVFKHAVTRMPEAIKAGLKANGLTLDDIDCIIPHQANLRINEFIAQSFKLPPE
FT                   RIHNNIQKYGNTTAASIPLCMREAIEIGKIKPGSLVCLVAFGAGLTWGSVFLRY"
FT   gene            8473..9663
FT                   /locus_tag="Hoch_0006"
FT   CDS_pept        8473..9663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Hypothetical protein CBG19013"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12648"
FT                   /db_xref="GOA:D0LFL4"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFL4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12648.1"
FT                   /translation="MSAQYQDLEQQNHELREENQALRAELERIEARAAKAAEARTRLMR
FT                   GSWRILVPLIDRQRVARSFGKLAQTASEFANPPAHWPTKEQILAEARDFMESCVRFTIR
FT                   RRTLLLVFSLLAAAIPAFQMYLVVQQNEMIENQNEFFGIQVYDIVSRTMTEGDRNARQM
FT                   TGALLANAKVEFLSGVVEEAFGAGGLGFQWGAYRRDDIDAQQRRLEDAAFRGHLIRSVV
FT                   RAVQHRGDGGKHEMDADELHAAIVPSIRQILRDTADRMPQVLRLGRQDGDIDPALLEQV
FT                   DYYLIQVGELLRVYGRIARSADEEAAFFDDIRPLFQRIGGRRDLEESRFAEVYRPVLQD
FT                   FLFELALQPKLDSPPVNLETAGTSPDEALNTGIERLRKGLGEQALNWNLFKRQVAQ"
FT   gene            9660..11042
FT                   /locus_tag="Hoch_0007"
FT   CDS_pept        9660..11042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12649"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFL5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12649.1"
FT                   /translation="MMRVTQMMRLTLLSLSLSALVACGGAAPTPVTPDSGSTKPDIGPI
FT                   PDEMPPERAFLEAEAEADSEEEAYAAAVSELEELVYGDEGWLREGALPVHEPGSDPMYR
FT                   TDSEGGGEGGLVRVVVGLERERVDALLQELSSQPMPSSVPATLAPSLESAYGLYIEALV
FT                   CERRRELLDDSSCHAPGEDEIRANLQRVADDIHIRTRFEGGVPLDRNRQPLRPLEVFVE
FT                   RVSGKTTRTPLPALPVSVQQPEGEDALSYAVAVTDEHGLARFSFREGARFSKGLRVSLD
FT                   LGDPLGPLAELWPDSEMVPLGREVGLRRWAVIAEERVQGSEVGDKVFVQSLDESMQAAG
FT                   GVARVSLPSAVRGEIEKAGSSALEAMLPAIAERLQGQVDVLVVAELDSEYASRMGAYRV
FT                   WYEARGRAKVYDMWTGALLAAVEHTVTATGVGDERADREARAKLGQQFAGSLAQVKAVE
FT                   QP"
FT   sig_peptide     9660..9740
FT                   /locus_tag="Hoch_0007"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.593 at
FT                   residue 27"
FT   gene            complement(11117..12625)
FT                   /locus_tag="Hoch_0008"
FT   CDS_pept        complement(11117..12625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0008"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17 leucyl aminopeptidase domain
FT                   protein; KEGG: mxa:MXAN_4963 cytosol aminopeptidase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12650"
FT                   /db_xref="GOA:D0LFL6"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFL6"
FT                   /inference="protein motif:PRIAM:3.4.11.1"
FT                   /protein_id="ACY12650.1"
FT                   /translation="MELRYLSSAFLSTKADAAVFCVARDFADDPLFQAVDGAVGGLLGK
FT                   LVRERNFVGKDIDQLSVRLDASAGLAAAHLIVLGMGARDPVSRCELRDLGARAIAAAQQ
FT                   LGARQVLFAAPHCEGVEPAAAVQLATEGALLGAYRFDKYRSSKRPPSSVKRFTVTVDRG
FT                   DGERDAALTRSARAELERARATAEAICMARDFVNEPASYQTPSQCASDARALAKKHGLG
FT                   IRVLGRKECERLGMGLYLAVARGSSEEPKFIHLTYKPKGKAKSKIALIGKGVTFDSGGY
FT                   SIKTASGMEDMKIDMAGSAAVIAAMGAIASIGSEHEIHAIAACCENMVAGNAYRPGDVI
FT                   RGMDGTTVEINNTDAEGRLTMADAIAYVRTKIKPDEILDFATLTGACMVALGLHTAAVM
FT                   SNDAAMSQRFLAAAEAAGEDMWPLPLRPRLKDQLKSPIADLRNTGERYGGAITAGLFLA
FT                   HFAKQSTWLHVDLAGPATATRARGATARGGTGFGVATIVEYLTR"
FT   gene            complement(12758..13594)
FT                   /locus_tag="Hoch_0009"
FT   CDS_pept        complement(12758..13594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce3707 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12651"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFL7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12651.1"
FT                   /translation="MSDITSPSLQIGCVELPPGMPRARYFGRLPYLETAATLRGIPRPP
FT                   VLQRWLADAGEDGRFGLAAPQTITHRAGRKGYARHIVELSRAELAQTGGFRDTELIRSE
FT                   VDALAQATSILGVDVVLFRSPADFAPSASNRDAMRRFFAELAPAERFSGALRVWEPQGL
FT                   WDLDVAARFAGELGLVLCCDPLTNDPMLDIDPGIFSRLPSDDAYFRVTGIGNARRRLDD
FT                   YALEPLFEAAEAYERVWVALGHDGKYPDALRLHRQLNGDPGDGEADGDGESAARED"
FT   gene            13717..14361
FT                   /locus_tag="Hoch_0010"
FT   CDS_pept        13717..14361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0010"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="KEGG: acp:A2cp1_4211 transaldolase; TIGRFAM:
FT                   transaldolase; PFAM: Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12652"
FT                   /db_xref="GOA:D0LFL8"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFL8"
FT                   /inference="protein motif:TFAM:TIGR00875"
FT                   /protein_id="ACY12652.1"
FT                   /translation="MKFFIDTADIDEIREVAAMGLVDGVTTNPSLVAKTGRRFREVLLE
FT                   ICDAVPGPVSAEVVSTTCDEMMKEARELAALKPNIVVKIPLLPEGLKAVRICSEEGIRT
FT                   NVTLCFSPAQALLAAKAGASYISPFVGRVDDISGDGMSIIADILQIYRNYGFATEVLVA
FT                   SVRHPMHVVEAAKMGAHVATCPKSVLMQLAKHPLTDIGLARFLADWEKVPQ"
FT   gene            14366..14800
FT                   /locus_tag="Hoch_0011"
FT   CDS_pept        14366..14800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0011"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: ank:AnaeK_2689 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12653"
FT                   /db_xref="GOA:D0LFL9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFL9"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACY12653.1"
FT                   /translation="MRRAFSVAVYARRGGEGGRVLVIHHRRLETWLPIGGEIEDGETPL
FT                   EAARRELREETGLEGAFLPLADAFEGVPPGYLGYEEHVAGSKGLHMNFVFVADVADDAE
FT                   VTPNHEFSEFRWVDSAALEQLSAPRNAVQFGLAALRARAR"
FT   gene            14890..15513
FT                   /locus_tag="Hoch_0012"
FT   CDS_pept        14890..15513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0012"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="KEGG: unknown metyltransferase; TIGRFAM: tRNA
FT                   (guanine-N(7)-)-methyltransferase; PFAM: putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12654"
FT                   /db_xref="GOA:D0LFM0"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFM0"
FT                   /inference="protein motif:TFAM:TIGR00091"
FT                   /protein_id="ACY12654.1"
FT                   /translation="MRPRVRQHVNPLNLVFTDFEGDMPELVPGREIELEIGCADARFLF
FT                   ERAEREPERMYLGMEIRKPVIDAVNLEAEERELPVYGVFCNANHHLRELLPAGSVQRVY
FT                   LNFPDPWFKRRHRKRRMIDSDLVRDIHRVLAPTGEVFFQSDVWTLALDTMDIFERLDDL
FT                   YENRAGAWSFWKDGNPFGARSWREANCYEHGLPIWRLRYRPRGG"
FT   gene            complement(15541..17559)
FT                   /locus_tag="Hoch_0013"
FT   CDS_pept        complement(15541..17559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0013"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="KEGG: scl:sce0664 excinuclease ABC subunit B;
FT                   TIGRFAM: excinuclease ABC, B subunit; PFAM: helicase domain
FT                   protein; UvrB/UvrC protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12655"
FT                   /db_xref="GOA:D0LFM1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFM1"
FT                   /inference="protein motif:TFAM:TIGR00631"
FT                   /protein_id="ACY12655.1"
FT                   /translation="MEDRLFEIVSPFTPTGDQPEAIRQLIEGLGRGDRHQVLLGITGSG
FT                   KTFSVANVIAETGRPALIIAPNKILAAQLYGEFKELFPKHAVHYFVSYYDYYQPEAYVP
FT                   TTDTYIEKDSLINEEIDRMRHAATYALLSRQDVIIVASVSCIYGIGAREMYASMTCDIE
FT                   SGTEVARDDVLRRLVELQYERNDVDFHRGTFRVRGDVVEVFPAYEADTAIRIEWWGDDV
FT                   ESISEIDPLRGKVKRSLGHVSIFPASHFVTPSDQLRRAIEGIRVELRERLEELSQQNKL
FT                   VERQRLEQRTMYDLECLEQMGFCSGIENYSRHLTGRDSGLPPPTLIDYFPEEFILFIDE
FT                   SHQTVPQLQAMYRGDRSRKQTLVDFGFRLPSAIDNRPLRFDEFNERARQYIYISATPAD
FT                   YELEQSQGVIVEQIIRPTGLLDPEIEVRPVGEQVDDLLSEIRLRIERRERVLVTTLTKR
FT                   MAEDLTEYYADLDVKVRYLHSDVDTLERIEIIRDLRRGVFDVLVGINLLREGLDIPEVS
FT                   LVAILDADKEGFLRSTRSLIQTIGRAARNVNGRVLLYADRITKSMRDAIDETERRRALQ
FT                   GEYNQTHGIVPRSTTRAILDIQPTNADGSLTRAPLTEAVPTDVLDELSVDNAAELRKAI
FT                   EKLRGEMRAAAAELDFERAAKLRDRARELESLELAVG"
FT   gene            17611..18288
FT                   /locus_tag="Hoch_0014"
FT   CDS_pept        17611..18288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0014"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: ade:Adeh_0075 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12656"
FT                   /db_xref="GOA:D0LFM2"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFM2"
FT                   /inference="protein motif:TFAM:TIGR00693"
FT                   /protein_id="ACY12656.1"
FT                   /translation="MRWQQRLTGFYSILDSDDEQLARLLVRPVEQGGAGATVMQVRVKP
FT                   PEPVSVAELLKVARMARSVTARAGALLVVDDHIDVALSVDADGVHLGQDDLPLVEARAL
FT                   VERWRPERPFLIGVSTHNRAQVEAAVRGGADYLGFGPVYATSSKRNPDPVQGIPGLQEA
FT                   VQAAGATPIVAIGGITPERAEQVAAAGAAAACCISAVNRDAEPAQAGARIGAAWTPLRQ
FT                   PPR"
FT   gene            18507..18812
FT                   /locus_tag="Hoch_0015"
FT   CDS_pept        18507..18812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12657"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFM3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12657.1"
FT                   /translation="MKKIALLALTFASAAVFSLSAPHEASAGDPCVRKEFKTKLIAEAC
FT                   KKGGQAEAKKVMKKQLSKLKAKSDKVKTCKSCHTSLAPKYELTADGLELYKQAGGK"
FT   sig_peptide     18507..18590
FT                   /locus_tag="Hoch_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.598 at
FT                   residue 28"
FT   gene            complement(19010..19891)
FT                   /locus_tag="Hoch_0016"
FT   CDS_pept        complement(19010..19891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_3542 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12658"
FT                   /db_xref="GOA:D0LFM4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFM4"
FT                   /inference="protein motif:COG:COG1729"
FT                   /protein_id="ACY12658.1"
FT                   /translation="MILTKEADVPNARLQRLKRGCALLIWGALLTSLSGCFWVTTKREG
FT                   EKLRAEVDSLDSRVAEREEDLQSKIQQLEQVLAKATAVLQRNSADLGADVAALSEDIRT
FT                   MQGLASEASQIAEEVRADVTRMQAEQAAERTAVEERLILLEERLAKLEVQAAKPPSPDE
FT                   LYSQGRAAFERGDYGGAQTLLRQLVTQYPSDTRADDAQYYRGEAYYREQDYGAAIREFQ
FT                   KVFDKYEDSSLADDALFRAGEAAQTLRRCSEARAYFGVLRQKYPRSNLVNKSKSKDQEL
FT                   KRDLKDPEKCSS"
FT   gene            complement(19888..20652)
FT                   /locus_tag="Hoch_0017"
FT   CDS_pept        complement(19888..20652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0017"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: mxa:MXAN_5152
FT                   OmpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12659"
FT                   /db_xref="GOA:D0LFM5"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFM5"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ACY12659.1"
FT                   /translation="MVTRRTQSLWIALLAALCVLAGCSDKKVDDATCKGDDDCEEGLHC
FT                   VNQQCLVCGDDSHCPEGQSCQSGACVATEPICSSDADCPAGQACVDGGCRACDSDDQCG
FT                   LGGKCNNGECERATACTQDTDCADDEDCVDGYCQKPWLGEAPDVECALPTVYFDFDEAG
FT                   IRDDAREVLTQAAECIRQAPADSGVYVEGHTDGSGTEEYNVALSERRARTVTEFLERLG
FT                   IDPGRFSVIAKGEGVPSGEGTDKDRRVEFQWR"
FT   sig_peptide     complement(20572..20652)
FT                   /locus_tag="Hoch_0017"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.610 at
FT                   residue 27"
FT   gene            20714..22099
FT                   /locus_tag="Hoch_0018"
FT   CDS_pept        20714..22099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0018"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; response regulator
FT                   receiver; ATPase associated with various cellular
FT                   activities AAA_5; SMART: response regulator receiver; AAA
FT                   ATPase; KEGG: afw:Anae109_3404 two component, sigma54
FT                   specific, fis family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12660"
FT                   /db_xref="GOA:D0LFM6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFM6"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACY12660.1"
FT                   /translation="MGPLMARSTLLVIDDEPNILTTVRRALELEDYRVEVAGSGAIGLE
FT                   KLAESDIDLVLLDVVMPGMDGLEVLRQVRERHPGVFVVMMSGNASIETAVQATKGGAHD
FT                   FIEKPLSSDKLLLTVQNALSFAELSRENARLRARAHGEFAMIGSSSVMRSIFDKIGKTA
FT                   PTMGRVLITGENGTGKELVARAIHEHSKRAGGPFIKLNCAAIPSELIESELFGHEKGAF
FT                   TGATQQRRGKFELADGGTLFLDEVGDMNPSAQAKVLRALQENEIERVGGSQVIGVDVRV
FT                   LAATNKNLEEEIAAGRFREDLFYRLNVVPIELPPLRERRVDIADLVEHFLSVVCEANDR
FT                   KRKRVEPSAVSMLMQYEWPGNIRELKNVVERLVILTGEEECIGEADVQDALPRVKTVKA
FT                   GHRAGVALKELVAAAERTIILEALQANENHISNTAKDLQLERSHLYKKMKALGIDPRAG
FT                   ESE"
FT   gene            22306..23013
FT                   /locus_tag="Hoch_0019"
FT   CDS_pept        22306..23013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12661"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFM7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12661.1"
FT                   /translation="MIPKSRNRIALCAAAFTMLGALSAAEVQAEEERKSVADKDEAKIG
FT                   IGARLRYIHIPAQAIELFVEQSAGSASHPGVGVEFIREKGDMVFTIGVEYESISPRDGV
FT                   YIDKGDSIPQDAVDYVEFEDFKWLALDISFIGQQPIFDDIIRLRYGAGIGIGMLMGEMR
FT                   RTDYVCTSSDVDSCRQDPNAEQIDDPEDLPPVLPLLNVLLGLQFRPFDNVAINFEGGIR
FT                   TAPFVGTTMAVLF"
FT   sig_peptide     22306..22380
FT                   /locus_tag="Hoch_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.635 at
FT                   residue 25"
FT   gene            complement(23070..24242)
FT                   /locus_tag="Hoch_0020"
FT   CDS_pept        complement(23070..24242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0020"
FT                   /product="Saccharopine dehydrogenase (NAD(+),
FT                   L-glutamate-forming)"
FT                   /EC_number="1.5.1.9"
FT                   /note="PFAM: Saccharopine dehydrogenase; KEGG: scl:sce3726
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12662"
FT                   /db_xref="GOA:D0LFM8"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFM8"
FT                   /inference="protein motif:PRIAM:1.5.1.9"
FT                   /protein_id="ACY12662.1"
FT                   /translation="MADKRDFDVVVFGATGFTGRLVAEYLTRKAMPELRWAIAGRSRDK
FT                   LERVRAELAKIDPGAADIGVLEADARDWASLAVMANKTRVVLTTVGPYIDDGIQLVRAC
FT                   VASGTDYVDITGEPLFVNEVVSKYDAPAREQGVRIVNCCGFDSIPHDLGVMYTIDQLEA
FT                   KGPVEIEGFVRVRGNFSSGTIRSAIKSMAQMNKLKGDASVRPQPSTEGRRVRKLRARLH
FT                   HDPRMQSWTMPMMTIDSWIVRRSAAMLDSYGSDFAYAPYICQTKLSSVGKLTLGVGAVM
FT                   LLSQFRPTREMLLARFPSGKGPSEEDIAHGRFELTFFARSGDSELITRVSGGDPGYGET
FT                   SKMVAESALCLAFDRDRLPERTGVLTTATAMGQPLLERLQAAGIDFEVVG"
FT   gene            complement(24316..26331)
FT                   /locus_tag="Hoch_0021"
FT   CDS_pept        complement(24316..26331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce2090 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12663"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFM9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12663.1"
FT                   /translation="MATSEVEAALESALAEGTLGLARRATQECRALLRLAEAGAREGDP
FT                   RWDEVFATRAAWGPLLYGLLDKAEGRLPPLMQALLIFALEPVDTTILVVLWGLAGSASL
FT                   RQRAQRIERAWEQDRVDELFADRTDDDDDDDGDADADADADADDDSEVDVGIGSAPDDA
FT                   ADADAEMVLGHSAEFIVRLCYPDLRRQRKALAALRPQGSLRRFVLVRSSDVRSADPRSE
FT                   RFELDPDLASALLNAWRPPSGLEGVVRSGVGAGRALHPSQTAQASALAQVLQPPQQRVA
FT                   LLGRPGAGKRTLIRAVAASAGMPLIELTLDALERAPQKRRHLLRRLQRDALLSRGILYI
FT                   QLDGPLPPPVLREVFAAVPGRLVLGVPVDATAAPAHGEALRAHWPDIHLQPLPSIAVAS
FT                   QPALWRACLSERGLPVDAAGLDAQLEAHVCRPGLVLGDFVHACEIVRSVYPAGEFASAG
FT                   ADDTSAGARLARALSGALSSHLHHELGALAEALWLPGMDLMDEDQAASAPALPPEWAEV
FT                   VDAIRAGTTRLSPWAVPEHRNYPAPRVARVASSDMRAVAAGARALASAAQMPLYRVDLG
FT                   YFLAAEPAAGRAACARVFAAAERAGAMLLLVPVDRLALQHADSLQLANALAAQLADATI
FT                   PVVLAGALAALPVAIESRIDHVLGDIGSAAPSDVPA"
FT   gene            complement(26379..27113)
FT                   /locus_tag="Hoch_0022"
FT   CDS_pept        complement(26379..27113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0022"
FT                   /product="General secretory system II protein E domain
FT                   protein"
FT                   /note="PFAM: General secretory system II protein E domain
FT                   protein; KEGG: mxa:MXAN_4667 general secretion pathway
FT                   protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12664"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFN0"
FT                   /inference="protein motif:PFAM:PF05157"
FT                   /protein_id="ACY12664.1"
FT                   /translation="MARKRIGEILVQAGVLDAEGLKTALLEQRRWGGPLGRTLVDLDLI
FT                   TEEALVDALSKQLNFPTVDLDTVDVAPEVLELVPGELSVQHHMMPFKREGKFLDVAMSE
FT                   PTNLGIIDELRIRTQLNVRPYLAGPKMIERALQRYHGDILPDKSDNPRTATGAPAAQAR
FT                   SANRRGEADAVQPHTGSNPALRHQYGPRSAQAREEEIRSLQERISQLEALLSRDEDVLR
FT                   KVLSLLVDKGIATREEILERLG"
FT   gene            complement(27201..33902)
FT                   /locus_tag="Hoch_0023"
FT   CDS_pept        complement(27201..33902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0023"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mfa:Mfla_2392 OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12665"
FT                   /db_xref="GOA:D0LFN1"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFN1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12665.1"
FT                   /translation="MVRSRRVSIIAALSPPTAQPPHPDACALRGERAVGRVRKRAPRAS
FT                   ALGPRASVLAFAFAGALVLLLTGATAVAAPITGRVYDAATGKPAPNIRLSLEYDQDDTA
FT                   SPGQRVAAADLAQGQQDQLTGATGRYRFDVEEGRRYRLRLDTSASSFVAPSQRLPPSDG
FT                   FAPAGELAPSDQPDPAAAHPYYLRFDIDKLDEQVRNNHIAVDRLRDIVTMRLEADRRAV
FT                   TTGDIVTVTARVRNQSPRDLDAASGRPVSLLLTPPHGLALRRGRAVVRIEGSRGVRTLE
FT                   AGRDFDATYENPGSRRLLRLGPFDLESGELLTAAFFLTVTGDARPGTQELRATLRDAGG
FT                   VVLAPVGRVRFDVGRDATLETGMVLGRVYCDDDDGRRGRDEAGVLGARVYLDTGSYAIT
FT                   DSEGGYHFSRVPAGSHAIKLDPGTLSGGALRGSPTRLLLLGAGLPGRADFPVECRSVEV
FT                   ALGGSEPASTPARAAPVTLSGSTRAASEGGPDFVVQMDDQPVAVPEARLSIAGGSARPA
FT                   VPEGGFAAEQQIEFLLDWSAPPGVAAERWTVSVRDAAAGAAPLRTWSGTGAPPARLRWD
FT                   GRTESDGAPVPAGSSLLAQLAVAGDARDAFAASALVPLQLGTAASTRSYTLDGALFAGT
FT                   PRAPEATEALRRELGELLAAQPAPAAITAVDIAAHAAADQERLSALVATTRQAELVATL
FT                   LAEAGVARDRITARGRGSLEPRGDGAADDRRVVITVTAEGGAADADSERPALSPRARVA
FT                   DAEIAVSAEGAFITELLASELRAPTPTQIDLSAASGARARIALPAPADRADDSTPAVAD
FT                   SDSAAVVWNVEQPALRAGSRELGGEAFAVALSHRPASTDAAADDNNGDSAATGSDGGGA
FT                   GIAFDLAVPSALAVNAWTLIVRDADSGAELHRDAGTGAPPATLTWVPARAAPSPAASGR
FT                   YLYQLEVEAAEGLRIWSPPGGLRIAGGPQQHSVAAPFADDGRITAEARQQLAEQLTPPP
FT                   APGACEIVAEVASLPTGSAVETQLARAARAAALRKVLAELGVADGACSTEVRAGDADIV
FT                   RLALTAPAALVGSFTPPPATPELRIDGSDGGAVHSQTSGRLALPAGETVAITMITSSGA
FT                   RVALDLAVPRAAAAPPRALLATVRLPARNARIGRHGLAITGHAQPGTRILAGAEGGPLR
FT                   ELPQRRDGRFAGSVPVPAGRDEVIVRAVDQHGHSRDLRWPVQVDENQFFFMAFGELGAS
FT                   SMRVRESAADIGERSGLSAAHSIVDSAIAGQTQSSSVALGPVRVHGRLALYLKGVFSAG
FT                   SLAPRVDLTAHLDTARESGTGAFFEDLSDPRSSAPVYGDSATEVRDVNTRGKIYVRAET
FT                   DGMRAAYGSVHTDLEGRSLFRYERTIQGAVVQVDHRGEVVRLEGRAFATEELGGLAQAV
FT                   LWYRATGGSLYYLRHGHVLEGSERVRVVVRDARSGLTRSERVLVRGDDYRVDYAGGRLM
FT                   LTDPLPSNERSSWVVDAAGVGTAPLTGNPVFVEVRYEHAEPGASDESAAGVYGRVTLGQ
FT                   PDRHVAVGAGVVGEQRAGAGYHLWGTDLALQAGARSRVSLEVAGSRRQAAGGFLSVDGG
FT                   LGFLRLGDDDDDDALGLGDAGAQRGRAWRMIQDWHLGDLLGPGWAERTRVELYAQNVEH
FT                   GFSAGDAVFEQGRRKAGAQITHSLRNRDTLALRHESQRAHLPRVGPSAELLATAEPALV
FT                   RTDTHDTALQWARQRDRWRLRVEGVHHYAAADADDLGDVSEAAAAAAAVRVRRLGLGTA
FT                   AAYALDQRFTVRAGQSVVIDGGDADPQLAPVAADGSRSSEPLAGVTTNLGADLQLADEL
FT                   ALSADWYQRWNGDSAAQVGLRNSLSETGAVYVREQVQLRAGRATSTTVVGAEDQPAELA
FT                   GGRSYGEYQLENGVLGQRNRAVLGLGYRFRPVAGVQLGLGFEHQDLRGGVLPDGTPLGD
FT                   LRRELGYLGASYLLRDRLVATARAELRLDDSDGGAMVIEDLRPGVVAGGYADHGGVVPG
FT                   IRSGIPAGKRLQGIMEAGLDWTWTNSHTLFARGYFARTAAAAPDQRLSASSFVEAEDRL
FT                   LTLGWAYRPPVDDWLQVIARYSHLRELRTLAQGGTAPASLSIGLDNEQSTSSSHVFSIM
FT                   PIVELPYRLRLSGKLAGKRTLVRLSGDQGEDQLEQHSATWALLWVTRLGYRLWSNWDAG
FT                   VELRGLRMSTPEQHRLGAAFELGYWIHGHVRLGIGYDLSRFSDDELGALERDARGAFIR
FT                   VTGQY"
FT   gene            complement(33933..35303)
FT                   /locus_tag="Hoch_0024"
FT   CDS_pept        complement(33933..35303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0024"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: scl:sce0883
FT                   polysaccharide polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12666"
FT                   /db_xref="GOA:D0LFN2"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFN2"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ACY12666.1"
FT                   /translation="MFTLPGLSALVTFIYLRPQEFVLILQKLPLLYIFFAAALGGLVID
FT                   LKLRLIKPIPARTLLIATLFFGWILLNIGVKVPAASKVSEIITFTIVFVTYVLIAQGIQ
FT                   SFRALRVMAWVLLFSFLFLTYTGIRQAHGPMGCLMIENYMARLGTPDGRSCETALDCGG
FT                   VEAEPGEAYDCQRIGPFGTTALNERVRYRGSLQDPNELSTVICGGVALIIGLVAMSRKL
FT                   RWRVLAVIGAVAIFMCVIYTQSRGGMLAYMAVIGVYFIRRYGVKYAVIGVLCMLPLMAL
FT                   GGRGGEAASASTEGRYEAWRSGLDMLKMDPVFGVGKGMFTEYHHLTAHNSHVLTFAELG
FT                   LLGMFLWVSTLYLAFKPSVVALRDFADDPSAGSVRTWALAVLAMGMPLIVQMMFLSLTY
FT                   HFMTWVWVGMTGGFYSAVKSHVPDWEVKFGLFDIFIIAGIAYGFIAVLPFFLLLKGF"
FT   gene            complement(35385..37943)
FT                   /locus_tag="Hoch_0025"
FT   CDS_pept        complement(35385..37943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0025"
FT                   /product="UvrD/Rep helicase family protein"
FT                   /note="KEGG: scl:sce0567 UvrD/Rep helicase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12667"
FT                   /db_xref="GOA:D0LFN3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFN3"
FT                   /inference="similar to AA sequence:KEGG:sce0567"
FT                   /protein_id="ACY12667.1"
FT                   /translation="MSKPVQPSTPGAEIVAEEERLHGRVQARVAMGQEDIVDRVGTDEF
FT                   DEELIRLRDMIAEAKPEDLPPLVEQMTRLAAIRSRLGGSRSLPADPASPYFAHMVLSEN
FT                   GRRRDVLVGKRGFIDRKHNVQIVDWRNAPVSRIYYRYDEGDDYEEEIAGRPTQGMVEVR
FT                   RNVSIIHSKLRRIGAPQGTFVRDSHEVWHEAVGEAMPVLRGGQGKAVRVPRALKPESRD
FT                   AQDDKGGRGKGKGRGKGGRGQPRAAQRATLGVHGDDLHRADKSLPEIAALIDGEQFDLI
FT                   TQPESGMVVIQGGAGSGKTTVALHRIAYLNFADRSRFRPQNILFVVPSASLARYVAGVL
FT                   PALGVSGVAALTYERWARDLRIRLLRGSSGKYNHDTPEAVSRVKKHPALLGVLDRYVAA
FT                   QAASFGDEILAAAREAGDRRAAEILQQAWAERAELPLAVRLAKLGGWLRSRDARLPSPV
FT                   RQAAESAVKRLRRRAGDVLADWSELMSDPRALGEGFAGWDDLSAADLRRTVEWCAQQAA
FT                   GPVELAVNPDGQPIDAIDGRAIEEDGPGGRFDLEDDPILLRLIQLKRGRLLGAGGAEVS
FT                   YEHVAIDEAQDRSAIEVKVLIEATRAHEDSRGRPQRSITIAGDTAQRLVFDNSFHGWQS
FT                   LLDNTGQAAVVRPLRLSYRSTAEVMYFAREVLGPELAPDEPLVARSGEPVELHMFGDIG
FT                   EAVAFLADALRALVGREPSASVAVLARHSEQADAYYAGLMRAEVPSLRRVRNHDFRFVP
FT                   GVDVTDVTQVKGLEFDYVIMVDVNASSYPSNVESRHLLHIGATRAAHQLWLISTSTPSN
FT                   LLPEELRERGSLGAPPPADADDNDGGGTGDEADAETAASS"
FT   gene            38081..40033
FT                   /locus_tag="Hoch_0026"
FT   CDS_pept        38081..40033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0026"
FT                   /product="arginine decarboxylase"
FT                   /note="TIGRFAM: arginine decarboxylase; PFAM: Orn/DAP/Arg
FT                   decarboxylase 2; KEGG: mxa:MXAN_2742 arginine
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12668"
FT                   /db_xref="GOA:D0LFN4"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFN4"
FT                   /inference="protein motif:TFAM:TIGR01273"
FT                   /protein_id="ACY12668.1"
FT                   /translation="MARPKSVSSSPDPLRRWSIADSLETYSISRWGSGYVSINDKGNLL
FT                   ITPRGPEHGSIDLKALVEEIKLRGIPTPILLRFSDILRSRIELLNQAFGSAIAEYEYRG
FT                   QYRGVYPIKVNQSRIVVQEIIEFGRPYHYGLEAGSKPELLAVMAVHDDPDALIICNGYK
FT                   DDEYIETALSASRLGRKVVLVIEKPDEIDHIHSVAQSLGIRPTVGMRARLSARGAGRWE
FT                   QSGGDRSKFGLSPAEMLQAVDKLRSWGQLDGLELLHFHLGSQISSIRSIKTALREAGRL
FT                   FVELHKLGCEGLQYFDVGGGLGVDYDGSQTNFASSMNYTVQEYANDVVFTIQEICDEAE
FT                   VPHPNIVTESGRAVAAHHSVLVVDVLAVSEFQDFPVPAEIEDEDAPQLLRNLHETFQAI
FT                   SVKNVHESYHDALEYKEQVLQLFNLGHLSLEHRVLCEQIFWATCQRLLAIVRNLPHVPE
FT                   ELESLNRALADTYFCNFSTFQSLPDSWAVGQLFPIVPIHRLDEEPTRRGILADITCDSD
FT                   GKIDQFIDMRDVKRYLELHRPGADEYYLGMFLVGAYQEILGDMHNLFGDTYTVHVSLDE
FT                   DGNGYSIDEVVPGDTVSEVLRYVGYEPSELLRRVRQRVEHAVRQNWITLEEARQLIARF
FT                   SEGLSGYTYLEPTTR"
FT   gene            complement(40061..41116)
FT                   /locus_tag="Hoch_0027"
FT   CDS_pept        complement(40061..41116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12669"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFN5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12669.1"
FT                   /translation="MAARHARARLAAGVFVALLTAGSSSGCDRDPIDVKSNSASVPYGR
FT                   DELLAAVERFANGEHTPENYRVLAAEIERLQPRFNSEVAREAERNLVFLAIGPLEQYLD
FT                   ASPTEQLEALGLTVWPTALGYTPLPDEDAWTYTERLCGGPLNGSCKQIVPEHRASILAQ
FT                   LALSRFKERARTALLECEDCGKDPHFSSTMGRFVSRADELLASSGIDARRAHPKLWPIS
FT                   GSKAEPWSQLRVLRLRPDGTATLEGEPVPPEERVSMLKAQRDEAKALGLRAEPATPLAR
FT                   IRGAARDARAAGYSQLALQARVPEFPYELREYRVQLAEKATLKLRDEDSLQLLINSIDA
FT                   KLSAGTPPPVL"
FT   sig_peptide     complement(41036..41116)
FT                   /locus_tag="Hoch_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.995 at
FT                   residue 27"
FT   gene            complement(41148..41690)
FT                   /locus_tag="Hoch_0028"
FT   CDS_pept        complement(41148..41690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0028"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: mxa:MXAN_3988 FHA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12670"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFN6"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACY12670.1"
FT                   /translation="MSQRNRIPDTDRPKATTLHALLQEMRQGYTLYKPILIQVDEGTRI
FT                   GPEATLDRTMTLRKPLDWAEQYGREYAQHRFLVLGPNTLSAGMETPVTIGRSRRCDVRV
FT                   ENDSVSKVHGSVLFDRGSGEYYIVDENSRNGTCINGETLAPGVPTAVWSGAYVSFGDAV
FT                   FVFIDPPTLRKLAKIAL"
FT   gene            complement(41687..42781)
FT                   /locus_tag="Hoch_0029"
FT   CDS_pept        complement(41687..42781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0029"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: smd:Smed_2571
FT                   cobalamin synthesis protein P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12671"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFN7"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ACY12671.1"
FT                   /translation="MSSPTPTPQVPVIVLTGFLGSGKTTLLNRLMRTRPLGRGKLAIVV
FT                   NEFGEVGIDGELLPSDMTRQVELPGGCICCLLNDDLDTTLLEILDSNEALDAIIIETTG
FT                   IAEPMPICWALEREPLSERVRLAAVITVVDAVNFETSRADNPSVDAQVEYADILVLSKL
FT                   DELGISEPPAALVSALREENPNATLLAGTPEEVSASLWRSLADPEQSLRRAGEPSRAHE
FT                   HEHEHGNGHGHSNGHEHGDRVAASAAAHGFDTLWLPIEATLDFEELASQLEELPGNWVR
FT                   IKGIAHAADGSTGDSTPRWIAFHRVGTRVSWEPLAAASSPQPRIVALGRELDRSRLAAC
FT                   LDAAVLVSERSGGSRSPFRGTEEE"
FT   gene            complement(42905..44995)
FT                   /locus_tag="Hoch_0030"
FT   CDS_pept        complement(42905..44995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0030"
FT                   /product="exported nucleotide-binding protein"
FT                   /note="KEGG: scl:sce1024 exported nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12672"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFN8"
FT                   /inference="similar to AA sequence:KEGG:sce1024"
FT                   /protein_id="ACY12672.1"
FT                   /translation="MNYAIHKRSNRGLRALSPTLFVAVLTVAAGCSGGSNSGADAGSLE
FT                   CGDVPALLQANCGGSGCHGPVESQSDLDLESPNVAARLSERSAKSSNLVLIRPGRPEDS
FT                   AVYDRVLESPTTGQRMPPVGDPLSDDDIQCLRDWIAGLSVVQPGGPDAGPDCPECECPI
FT                   NEVESCFSGTAAALGEEGPVGVCTAGMRTCRATPTGSYWDVCEGEVFPTPEDCTTAEDE
FT                   DCDGITTACSETWSFALATATDSQAVRSVDIDSAGNVYIAGDYTGKIGLGGEVSSLASN
FT                   IKDDVFLAKFDKFGVHQWSQFYGDSSTQNATQVIVDDNDNVILLGRAFGKIDFGNGMEQ
FT                   DATGTDDFFVAKFNSDGVLQWADIFGGVGPDRAERMAVDSQGHIWIAGTFSDSAVFNGQ
FT                   YDTTGIRDAVVLQLNGASGAIITEVVFGGGTGEGDNRTGDNYAFGIDTYLDGGQEFVYV
FT                   TGHFSETADIGLGTPGSVTSNGKQDVFVAKLTTNGEHVWSQRFGGAEDDTAYDLVVDPS
FT                   DGSVVITGFFAGSINFGGGALTSAGADDIFLVKLDADGGHVFSKAFGDAEDQQGFDTFD
FT                   TNTWTSLDMDAAGNIYLGGPLVGSATFGLSPISSPNGRMDAFVAKFTSAGTHRVSNRYG
FT                   DGGTQIALDLAADDNGHVVLVGRFYSSTMDFDPASGSIQGIGVNGGVSSGGDGFVVKLA
FT                   ID"
FT   sig_peptide     complement(44876..44995)
FT                   /locus_tag="Hoch_0030"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.324 at
FT                   residue 40"
FT   gene            45148..46860
FT                   /locus_tag="Hoch_0031"
FT   CDS_pept        45148..46860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0031"
FT                   /product="Protein of unknown function DUF1592"
FT                   /note="PFAM: Protein of unknown function DUF1592; Protein
FT                   of unknown function DUF1588; Protein of unknown function
FT                   DUF1587; Protein of unknown function DUF1595; KEGG:
FT                   scl:sce1022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12673"
FT                   /db_xref="InterPro:IPR011478"
FT                   /db_xref="InterPro:IPR013036"
FT                   /db_xref="InterPro:IPR013039"
FT                   /db_xref="InterPro:IPR013042"
FT                   /db_xref="InterPro:IPR013043"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFN9"
FT                   /inference="protein motif:PFAM:PF07631"
FT                   /protein_id="ACY12673.1"
FT                   /translation="MKTRTTMSKLGSVILTPVLFAAVGCSGGGDSTGGDRPASCTSEIS
FT                   PGPAPIRRLTREEYNNTVFQLLGDSTFPANAFAPDEEANGFSNQASALVVSPLLAEQYM
FT                   GSAEALAASHADTLLQRNMAQCASGADTQTCEEEAEAFVRGFGKQAFRRPLSEDEVQAH
FT                   VALFLMGSEGGADGYAPAAGVELVVQAMLQSPHFLYRVEFGREGTEKNGIVELSSYEVA
FT                   SRLSYLFWGTMPDAALFEAADRDELRTPEQIEVQARRMVNAPRARDAVKNFHRQWLNLD
FT                   EIPGIAAIGRNREIYPDYRESLLPLLQRETEEFLDYAIFEANASVEDMYTAPYTMMNAE
FT                   LAEFYGIENGPTGSEFERVDLDGERYSGLLTHAGILALHSRFDSSSPVHRGLFVRTQLL
FT                   CQPPPPPPDFVPEPPVVDPNVTTREQYRQHSDDPGCSRCHQLMDPLGLGFEHFDALGRY
FT                   RETQSGLAIDDSGTIVDADADGTPAAESIDGPFDGPVELGARLGNSSTVRECVSAQWFR
FT                   FAYGRAETEADDCSMDTINQRFADSGYDIKELLVALTQTDAFRYRPITTEVSE"
FT   sig_peptide     45148..45234
FT                   /locus_tag="Hoch_0031"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.435 at
FT                   residue 29"
FT   gene            46857..48230
FT                   /locus_tag="Hoch_0032"
FT   CDS_pept        46857..48230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0032"
FT                   /product="protein of unknown function DUF1552"
FT                   /note="PFAM: protein of unknown function DUF1552; KEGG:
FT                   scl:sce1021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011447"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFP0"
FT                   /inference="protein motif:PFAM:PF07586"
FT                   /protein_id="ACY12674.1"
FT                   /translation="MTRRSNGKGLSRRAMLRGLGGSMVALPFLDAMVGIGRRAEAQTLA
FT                   FPKRIVMWYTPNGTVPKNFWPEAPGSLADSALSPILQPLSEHRNDMLVLGGIDLMTSYD
FT                   GPGDAHQKGTGTCLTGMPLQDGDFAGDAGASAGWADGISLDQHIANEIGGDTMFRSLEA
FT                   GVLVQGSSVRSRVSYRGPAQPLPPENNPYTLYRRLLGDPSLTPEDIARQNQRRQLVLDT
FT                   LSDDYKKLRGQLSGDDSYKLENHLEALQSIEERLSKSQVEFGGECQRYAQGDPINVEAV
FT                   GNMPDLGTLQMDLVAMAFACDLTRVSTIMWSQSTASHLYKWVDDEIREGHHLLAHKGDQ
FT                   DTKKVEQNTAINRWHAEQLAYFVSKLKSIPEGDGTVFDNTVIFWTNEQSKGNVHSRAEM
FT                   PYVVMGSAGGYFQTGQYVQYPSETPHNKLLVSLMNAMGVPGDSFGSQEYGTGSLTGLT"
FT   gene            48302..49774
FT                   /locus_tag="Hoch_0033"
FT   CDS_pept        48302..49774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0033"
FT                   /product="Spore coat protein CotH"
FT                   /note="PFAM: Spore coat protein CotH; KEGG:
FT                   afw:Anae109_3499 spore coat protein CotH"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12675"
FT                   /db_xref="InterPro:IPR014867"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFP1"
FT                   /inference="protein motif:PFAM:PF08757"
FT                   /protein_id="ACY12675.1"
FT                   /translation="MKYALGVLGWLPFSLGVGALGVAALATGCTVVEDPTFVGGEAVGG
FT                   EEAAAIGGSDSVTLAANEPLPPDAEGCPGLYAQDLLPEFHLTISEAVMSTLYEDWVHGR
FT                   ERNSLDDDDTPYHPVSEFRYGDIAVQNAMIRLRGNPNFWLEQNKMQFQVSFDEINKNGR
FT                   FMGQRKMLFDAATFNRHFMRDRLSLWIFRQAGVPAPCANNARLYINDEYYGLFTSIEKL
FT                   DNVFLKRVFPNNDHGDLFERRGYEQKTNEDTSDDTRLDQMRTYADAFPSSTNPDAGDGL
FT                   NPNLEGLAAYMDFEQVLRLYAVDAILPNSDGPWAGGLNYYFYDHPGQNKFFILPWDLDN
FT                   TFTRLTPDVQPYTYSKPSPYHGRPYFNAILSDDVWLDRYVEIIEEVVNEIYNTDTLWAL
FT                   TGTNATIPLENLSDQDRQLLGVWSGQIRDSAFADINKPYTNRRMEDRRAFFANFLAERE
FT                   TCLRQWLECVHGSDTTRQGVETCVCDVDLLSE"
FT   sig_peptide     48302..48382
FT                   /locus_tag="Hoch_0033"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.922) with cleavage site probability 0.303 at
FT                   residue 27"
FT   gene            complement(49955..54601)
FT                   /locus_tag="Hoch_0034"
FT   CDS_pept        complement(49955..54601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0034"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce7447 capsule biosynthesis protein CapB,
FT                   (pXO2-58)"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12676"
FT                   /db_xref="GOA:D0LFP2"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR008337"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFP2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12676.1"
FT                   /translation="MLAKLFRSRQQRRIEAETFDPSTAPHRPLVAEILRAHMPPMQLRL
FT                   RQRWIDELALRVLEFMPAPEPLQVADEVSRRVLLVSRTQQAILQLLADVQHLERQFDSL
FT                   SSLLRETEDEDEQRLLMAEYLTQTVANPRKRQQDIKALRRFLDYDALRERDERERRKVV
FT                   MCIELGAHFIATVIAALIAGERGEGALVESDSDSSSEVFRGALARLCREVHTPRFLAEV
FT                   VRDNQRWQTRLPAARGLAALCGWAQRQDGPISSLIDSDTRSEIVAITSETATSDEENPW
FT                   VRAAGLAATLGCDEQRGEQLLVESLRGRDAPLDFLYRRLILPLVSRALAPGHAVNVFDA
FT                   LIEPPKEREHVRLGAIGISRPEPSEHVRLGLAEVVLSLAPGEAITRLRRLAGLDGHDEA
FT                   SPKVRTKALLSARKLAAGALDLAVRDAASAVLVDALAAEVHSLPLRTICEELSDLAAEL
FT                   VLIDAEDHLDQLAPSWLDALHELLRHPRCAPPIAEAAANAIENIERERSHERRLVTQAL
FT                   RELSLLTETGRSRTFRLSKLPESVAEMVRDPQRIGRVLADLGRDGFGLGIRATRWSMTL
FT                   WRGDYTTRRLWRILHELRNPQPNKRQAFLHTIGRTYRSTVRAHPGRLDEATATTVPGER
FT                   VFVESEGSWGRHLPTVDDVLDLPLFRRRPVHICSSHGMVTMRPSRSFFRRLYARLAIHW
FT                   RYTEWVTLRQSSIASDEPQQRRRFLERVQKRFDVDIEMSGYHDQAARNQALALNPAVAN
FT                   LFPAKALERTSAAMMALGAPLLAPFQAVRDWLDSNMPYFTSLTQNSQTALAVFLGAAAT
FT                   HYVGTAYTKRRFMDRARASFPLCIGGWGTRGKSGTERLKAALFHGLGFDVFVKTTGCEA
FT                   MMLHAPPGQKPLEIFVYRPYDKATIWEQYDLVSLAHKLEPDVFLWECMALNPRYVNLLQ
FT                   HAWMRDDLITLTNAYPDHEDIQGPAGINVAEVISQFIPKHSTLITSELNFLPLFEEVCR
FT                   QRKTRMIAVRERVGDLIADDMLAIFPYNEHPRNIAMVARMADELGVEPMLAIFAMAENV
FT                   VADLGVLKAYPQIRVRSRLVAFVNGCSANERTGYLNSWRRMGLDAIDPDEQPESFVVTV
FT                   VNNRADRISRSEVFARVLVRDVDVDRHVLIGTNVNGLMHFIDVALGSYLDDVSIIREDD
FT                   FGGDGPVEQPFKRLRTQLKRLRIPKPTTEAAMRRLDLYAAGVNCVVADEQREAIEAAVT
FT                   KTLSADVKATVAVSEVQRNLEGNRALRTTLEAALQAAPVGRASDEDIDSQLLSIETLEP
FT                   AAKADAIEHFLRQLATLAVRARLEARLASLIERRATGELGEFDTAFRTAWRELFESKLV
FT                   PIEAPETTGDQIIDRCARSIPPGTSARIMGTQNIKGTGLDFVYRWIAIESVVLALRALQ
FT                   SERSDRRLSALRELEAFSDHGMFDAGLARGMLAMQPVRQPSAEEISLRERIRSKLEAVC
FT                   AARLTLLKTQMTRDSLDRVAGVVEGSVDYLDAIRRYRSSRRIMKDLAETRISHGRAAQE
FT                   MRTLVARQKGGWLAKTLRKQLAALKRES"
FT   gene            complement(54601..60483)
FT                   /locus_tag="Hoch_0035"
FT   CDS_pept        complement(54601..60483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_3854 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12677"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFP3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12677.1"
FT                   /translation="MLSLTSIRSLTLYSVALAVLCAQPQHPLAAPDASADANAAATPDA
FT                   RAAAAPWVAAVWRAHPVRYPVAPEQVRPDKPYVPAEIPSTRGVIELGPQRAAALWLDAL
FT                   EVVRVRRLPAPRAERDADADVDVAMRAGDDSDEARLIVHRVLDAGRAPGTSSRGLLEEF
FT                   PAALAPGTGFLAQRPGGGDVWVLSASAPMRVVVEHAQPRDAAKLWEDLRTAVLRWIARG
FT                   GAAPAVPRAPGAAELALGLRADHALARLFIEQRPEDARFRRAVRAWRSASALLRLERVG
FT                   MRRQPYHRLFDHTEELQPAAGGDALPLVALGERHYAQLDDGASAVELTVSGPGTLELDV
FT                   RALLGADADNTGSSDNGDNGHDDDRDDGDSHKDDIDALVIAVGERSLAVQRFARRQAYV
FT                   RAPDAPERTRSFPRRVPLRTPAGRGVGAPERVRVPLLAGEHTYTLSVRGGPSLVRARVR
FT                   RRRPRLAEVVAARSHPGDYLDAAEARLRDDDSAAAALLSHLVADLRGRTDDRIHGLAAR
FT                   LPDDAARLAMVAELAALRAGSASPEALAELLARIQALLADADADAGTSEGAGEISDEIS
FT                   DETSDYERYPAERDAVELAQVGRDPALLWMLLGELAELAAAAPEADAVLAALLRDAPAL
FT                   PPSQAARLAELAGFAWRSRDDAPRALARAVTLVHDAWRRDPLDASIRRTYRRLWRYADD
FT                   WTPAHRLPLTAPTEPDVADTGTSPEPPPATLARVALPRQRFLEPVPTDLNAAIEPDELD
FT                   PDAVIEDAPERRDPRRLWMLPDNGVHRVYAPPSPVDARRPLILHVYVVAPDDADEAIHV
FT                   RVDERVFTSLPLARVEMLAVAVAPGVHEVALESPAGARAFVSLAPDPGRPSRLVNARLR
FT                   SQRPAWRDGHAARYAVPGAPLGLPLRLTLRVTTTPGSSPDSASGPARIVLRTDAGHRRE
FT                   LHIDVDTPDPERVPVNDIGQLSGVVQAHLRLPPNTGWFWLEPADAGAGPKIERIWVSPS
FT                   FRGPGALPAAAESSAAGPADPTRDQHRDQVRDSAAAAGDAAAANAQNTDAPAAIAGVRA
FT                   WGPSDPAWSQIVAEIAELSRALNQRPDDPALRLRRTELLLDIAEPGRTRLDWAQLSALG
FT                   ADALTPEQRQTRAQLARRLRAWRDPGYLPAPPPGPEQAEAAASGPTVLLPAEAALLVGQ
FT                   PGGASSAEPLAPWLAAARRVRAQQDRAPLFALAAEGDTSLARFFQAEAKLRAGRPADAA
FT                   LMLRALYDEHREPALALAALRAFEVAFAQGGGASEARAETVDELASLAYGMALLVYEQF
FT                   PHPDVRRVLYAAAQLSQWQPLRGTQASAGYERVIVDEELVAPDADAELERALLAPPWPA
FT                   AEARTLRPGRGVHLSLSLLAPVRVAPQVWCRHVRPAASPTPERCAVRWRVDGAPATALE
FT                   VPHGEVATLGEVTLRRGAHQVEVVLADPDPSLRMAVRFSSDRALDAAAQAGDPAISVVR
FT                   PGRMYVADAAHPVEVSVLGPTAIRVEARRDAEAAAVALQVEARVLAPAADAGDPADPGN
FT                   ARNPAPALQRRLVLDAGRDPSARGDAERSLALSRATTTVLVLPAQATYRIRVVPERGRA
FT                   MVRLWHRRDDPDARLEAVAAAQRAADEAARRDAAETALSSRDAAEAEAALSLVGRRSGW
FT                   PGLFDARAVHAVAPERDQHALWPTLSLGLSFRRDDVAERDFEPLENRFQFDAAWRRELS
FT                   PSRLWLRLEAAVRWPPGHPAAYGLAADVAWRRLPLDLRVDLGARIFAQSVGDATEWAGH
FT                   TRLRLGRRFRLTPSLTATPLLSAHARTHSLATGPADNAVDPLVYSTYDADHAYGLRAET
FT                   SLYWRPLQDFVGMLRPRYVSNSDLHSPDRVEVEVAARGIAGWPSIGAPRFDLSYRPGYR
FT                   FADDHRSEGYLRHDLALKLDWSIWNGLAGRWYLELSDAVYLSTTLENRNVFLIGIRYDA
FT                   VDGRGLRDMLPIEYRFDDLIEPSPWFP"
FT   sig_peptide     complement(60394..60483)
FT                   /locus_tag="Hoch_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.882 at
FT                   residue 30"
FT   gene            complement(60579..63356)
FT                   /locus_tag="Hoch_0036"
FT   CDS_pept        complement(60579..63356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0036"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce7533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12678"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFP4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12678.1"
FT                   /translation="MRPRRLLPHLTLAFVALAIAGLCIWVVYQGRLPRTAMAQKLASAQ
FT                   RLSYHVITPTQGPRFELYGSERRIKIVSHPVLDPSLDYDPRRTINYGLRLELHHANRLL
FT                   WHHEVNLETRQSKLDWSDGLWMHENAFTSRLDLELGDDRMVIVHLPEDFPPGSQLAVRL
FT                   LGDPERGLVRVYQRVPREESARENVLKRLDESGGNALVDHNSYEPWTLLDVDEKLDRLH
FT                   HTYQRLAPVGEPGFDFTSLSVFYTGFRTAVEELEGDRGLLLERQQGLVVNVLGPTSVRV
FT                   ELRRGARDSDRVDENLAAEGSDSAASDASAAVVRVRAVSEYARAPGQQSGTRPAAMRWE
FT                   LPVPGTTRPSFHELSLPTGLHSLHFFTDARTPVRLDISGPPLSQFGTMPYLDYDEHDRR
FT                   LLPDERRLAVFETGPGQLPVEGGFFAPDDPRAQIVRIDVRTLLTSTPRGVADEPPLANA
FT                   HFETGLAIEFLDGQGKVMSAEQQVVRAPYTPFERIERTDDSVVSVTEPVGLRLIAPPST
FT                   HSVRVSASRDVALRLYRFLEGEDVFQAPYDLALSDTLWRYAPRDRRQWFHTTPSNAPAL
FT                   LEAEQRALLVAQVRLIPHGSGSGDGEGDGDGGRDGRPPPSYALKPIGRPAQHEIHEPVP
FT                   PRRFVELMRRWPPGMSTKIPAARTMRLRSDGRARPRLDYLVPTAALGDEVTVRVDGDVV
FT                   DTRRFTTTRGHWRLPRLSRGDHAFTIETSARSATFLIDQPPAPAAAGGPARFSLVRRRT
FT                   VYALGTQPLEVEVRKPAGQSVRVTMVVYAPWTEDRDDISVHAIIGGGVPKRVPRTPFAR
FT                   ITVAERSETLPASEATAPATFADREHPLVGYPRFISVPLGDDLLPGNHRVGFSLRNSQP
FT                   LWARFYVTHVAPQPSEEALQWRFAAEMGDPLGATPEPSAPATAAPADDAIAPRP"
FT   sig_peptide     complement(63240..63356)
FT                   /locus_tag="Hoch_0036"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.862) with cleavage site probability 0.328 at
FT                   residue 39"
FT   gene            complement(63360..67004)
FT                   /locus_tag="Hoch_0037"
FT   CDS_pept        complement(63360..67004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0037"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce7534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12679"
FT                   /db_xref="GOA:D0LFP5"
FT                   /db_xref="InterPro:IPR008338"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFP5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12679.1"
FT                   /translation="MLNNGILEIFPPHGLDQSILVAVMVGMLLLLFLTEVFGWVFVGLV
FT                   VPGYLSSVAIIQPASAFSVVFESVLTYVLARSLSDFLARSQAWSPFFGRERFVLIVLVS
FT                   VFVRQNSQIWMLPWVLRQVDAQFGTTMYTDLDFYSIGLVLIPLTANMFWKLGMWRGSLQ
FT                   VAVPTLITYAVLRLVLLPYTNLSFASLALTYENVALDFLGSPKAYIILLTGAFLAAQYN
FT                   LRYGWDYSGVLVPSLLALAWFAPITVVVTLGESLVLFLFTRLVTVLPGIRQLNFEGARK
FT                   VTLVFALGFLLKYIGGWSLYRWLPDAKVTDFFGFGYVLTSLLATKMLTKRVVARVLLPT
FT                   AQVSLMAFILGSAIGFVLEWVAPNKTNAPVLAERPQTITQMLVREPLGVMALAEVRARP
FT                   AMPLALRDGRESSALRAYGMLWRDIDRWLEGSGSVSEVYLDAKGLGFDLRRLERGYQPG
FT                   QPAFALFEREEILARQTGWDTALLVPGAPGPYIEVPAPRSESPSALAAALLCESLRCRA
FT                   ILASGGDARDGSAADALSNPDANFHIAHDQLRAASVVQLRADAQVPRGRPVLHLQHTLP
FT                   ADIFLDRLWPSEITLQWSAPPGRVQQWDSERDVVVFRVHPEDLRARLFLAAPPLPEPVE
FT                   DQGLLSFVAPLVEHSLDVLDEDVRDFVLPSESELRFLETMLAAPLLAADLPKPASAPAD
FT                   ADGDSADGDNTPDDATADDATADDATADDTTADKLAAPGDGEPGATASDANIGRVAQNA
FT                   ELAWLHRLAQLVDYEVRPVTDCAGDNAGCWVLLPDHAPARYTLGVLAVRAGDAEPIAIE
FT                   IPRPQRENGTFRIGAELWRSVRGRVLAVNPDEKLAGPGMRLDPTVIGSPATPFQALHQA
FT                   IHQSLAADIPEVLLELDSGFDLTPGFDLDFDFSDDEPAAPADGNNAGGSSDAGSESAEP
FT                   ADTAPASAEGSGPRPANTPADADADSAEAMFRAPLIVQVRGFAGWRPIVEDLVIGLGPP
FT                   VMQTWQIPARLDAILAPQGPLGWLNDALRYADGSDELITLSGQGSPQMSYSQSVGAVDF
FT                   ALLWLSENARERYRPASRSRYREHFDRVGLTLVDRSVVDALRFPELEVSGARLSPSAQA
FT                   RFERIETWARHYALTRDVHMLRALQREAASSEDLSFDALWSNALGLPYLRIQLSDGDAI
FT                   ERMLVLMHPLRSDECTEYAPLKPGFDSTAASQQFRRCGILTVQGTLER"
FT   gene            complement(67184..69268)
FT                   /locus_tag="Hoch_0038"
FT   CDS_pept        complement(67184..69268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0038"
FT                   /product="transmembrane sensor domain-like protein"
FT                   /note="KEGG: hch:HCH_05010 signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12680"
FT                   /db_xref="GOA:D0LFP6"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFP6"
FT                   /inference="protein motif:COG:COG4252"
FT                   /protein_id="ACY12680.1"
FT                   /translation="MFVLAAVLALIWLMGRAGLLDIGDRYLRSLYYALSETDTVSDEVV
FT                   FVAMDEHTGAAWGPPPWSWQRYEDMLAAIIEAQPRAVALLEPGPRVAPGEPPNFGPLVA
FT                   NAIGAGRIVLPPPNAGLGQPSLVLDEAHGIEAVELGLADDSLRPGVTRMLIRAATLPMP
FT                   PGDTLWVHYLGGPRSLPTVPAHRIATGEIPGNTFEDRIVVIGLRGERFAPQVPTPVGAL
FT                   SPAEVHAHAIRGLARDSVWLPLPTWARWLLSASLGLFSLLLVPRLGLRRSMGLVGAVML
FT                   LLVVLDYTMFALGLLRVGATAPMLVVGFAAGASWLGERRMVLVELELMSRWSARRLALE
FT                   NTDQERAGFVERWDRFAHTSRTFAKFESTLLGELSENNWHLDFALALGVEPERIQEMRR
FT                   DVRREPYKSAIMMHRPIWSDRFMDTELQQKSLLVPLSSFNRVLGLWVVNFRKGVEVPND
FT                   TLDMLKLFAEQLALSMERQRIQRLRHERAAVRESLLLRPLQEVRNTLQFLAHEQSSMSK
FT                   TFESLPVGILVATLWGEVSYINATMRHFLGALHVDNAKATSLPDLLAAVTGSSDEEIQA
FT                   TVSRLFAGRPYVELNCKTDSALGSSFQLTLSALSETPLLTELDAAPEAAIEDPGSADAA
FT                   QGKAADEQPAPSAAPRGDAAALSHVVLTVTRRARADATRSDADADADNHAVRHSAISGR
FT                   "
FT   gene            69717..70760
FT                   /locus_tag="Hoch_0039"
FT   CDS_pept        69717..70760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0039"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce4804 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12681"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFP7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12681.1"
FT                   /translation="MGSRASIGTSTGASVRTRTVSAARALALLWPKPARGQPRPSSPGE
FT                   HAHLSELVALLGRGVAVGALPQAAAVAARRAGFALELWTVPGAEGTGRDYWVVREPAGQ
FT                   RRGVGCYVFRAGCAGAGAAHGPGTRALIVQAPHAYFEFGTGALAAEAMFLFGGLLSPPP
FT                   LALMGNSLHRNRGRQGEEHAASEPADGDAGARAPGQRVRGFGPADVCHQRAHPFQTATA
FT                   ALAELGPAVFVQVHGFAGAGERSGRERYPDLVVSAGERAASRPTSTALAREFAAQLEGV
FT                   RVRRYPEEFSALGATTNVQGRLLRGRAGIDFVHLEHSASLRRALLASDELRQRWVRALG
FT                   AAVGAGS"
FT   gene            70810..71487
FT                   /locus_tag="Hoch_0040"
FT   CDS_pept        70810..71487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0040"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mxa:MXAN_0627
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12682"
FT                   /db_xref="GOA:D0LFP8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041483"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFP8"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACY12682.1"
FT                   /translation="MTLTKQRARGRAEKAQRRQDILTAARALLDERRFNEIKMIDVARA
FT                   AELAKGTVFSYFPTKEALFLELLEQLLAEWLDALVSAFDSAGAEHGDNRWSGERVARLF
FT                   ADTLATREPFIQLLTLLTSVLEQNVDLARVSAFKRRLGTLLMPAGERIEQRLDFVPAGA
FT                   GATLLMRLYAIVVGLRQLCDPGEVAARALEEPELAPLGFDFERELMAMLTAYLRGLESA
FT                   TVA"
FT   gene            complement(71474..72382)
FT                   /locus_tag="Hoch_0041"
FT   CDS_pept        complement(71474..72382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12683"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFP9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12683.1"
FT                   /translation="MRFWLLSFLILAACRGDTDAPAQASGAQTSAQAPSDSAETPADAE
FT                   DTAPALPDEPPRLEDLMALPQTEGAEGEAEALSRIDAVPAWDAVVERGRYMARRGERGA
FT                   IIGQVGEFLEGSEPAQRWLIDTAQGEGALRVRLALDPRLELASGRRVVVWGAWKTDAER
FT                   RWYWAGERVAALPERDPAELPVAEPFGILELAEAPEQAVPVSQLEGDGEILFQLARRPR
FT                   VATDGWEIADPGSRRAVARLLLPGDDRSYGAQDYRSGDEYWQLEPGTVYTVVTAGARGG
FT                   GEDELPTMRARGVPRRVLKRP"
FT   sig_peptide     complement(72332..72382)
FT                   /locus_tag="Hoch_0041"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.662) with cleavage site probability 0.226 at
FT                   residue 17"
FT   gene            complement(72504..73787)
FT                   /locus_tag="Hoch_0042"
FT   CDS_pept        complement(72504..73787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0042"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_3917 TPR repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12684"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFQ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12684.1"
FT                   /translation="MTDQLSTSAAPGSELLDAGEAALARGRAEEGFSLLMQAARAGASS
FT                   AEMPRLVLALSAAGHYCNRAREVLDWLSGALSPEAPPAVRAVALRAQVALWRSFDVRRV
FT                   EELAAEAMAAAEAAEDEESFAAVLSCAAGAAYRRGRVREASDYAELANGRKIASRPAQV
FT                   SAFRTNMFAAMALGDLEQALHCAIKARAIARELGLTGDIADESNNVARIYLDLGCPIEA
FT                   RACAEEGIRTAAVCGFEKAGIAGHMLAAAAAAESGDIDWAIERLEGLPYEATPRLYVDA
FT                   IEAHAYWLLERGAEGDSAAAEELARRGIERAQVQGMANLLTPLYGSLARSLARRGLREN
FT                   AREALELARQAADRTEPKARLLLALAAAEVLPAADSKRKMVLNQARARILRTAGRREDP
FT                   LAYCAEVRINRRLLELSGGVPPDLPRAQ"
FT   gene            74659..75573
FT                   /locus_tag="Hoch_0043"
FT   CDS_pept        74659..75573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12685"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR025859"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFQ1"
FT                   /inference="similar to AA sequence:KEGG:MXAN_5416"
FT                   /protein_id="ACY12685.1"
FT                   /translation="MFSLNFDYASCIANSEKIAWKIDEVMPVGTDLDFSRPFLPEELVM
FT                   LGAIECLNADEKRQLNQIVGNAYLNLFGFVEEYILATVVQHANAEMFGDRVAVRALCRF
FT                   AEEEVKHQQLFDRYREAFNRGFGQDCGVLDSAVDVAQVIMSKSPVAVMVLTLHIELMTQ
FT                   QHYTECIKDNTNVDPFFASLLKYHWLDEAQHAKIDALELEKLVEMATKEEIEKSVDEYL
FT                   EILTAFDGLLRAQGDMDIVSLEGKTGRSFTDAEKAEIMKGLITSYRKTFIIYGMTNPGF
FT                   VKIMGKMTKDGQTRIADTVTAYN"
FT   gene            75587..75808
FT                   /locus_tag="Hoch_0044"
FT   CDS_pept        75587..75808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12686"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFQ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12686.1"
FT                   /translation="MGNEIVLRKLTNAMGVEKGQRLMTEVLGHLGLQALTTPNDRYNFG
FT                   SELIRRGGVGKLIGQSITMQARLHGAKV"
FT   gene            76248..77075
FT                   /locus_tag="Hoch_0045"
FT   CDS_pept        76248..77075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0045"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; KEGG: gur:Gura_0094
FT                   ECF subfamily RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12687"
FT                   /db_xref="GOA:D0LFQ3"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFQ3"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACY12687.1"
FT                   /translation="MDTSRRRNLVKGAIAEHWQPLFNFAFRMTLDRERAGKATEECFLR
FT                   AYVGAEDLPEDAERAETWLLRICSHILEQQLPRQPEVSFDILDETLRSEATRTDVVRSL
FT                   TDPQRDFMLWELKQGCMTAVINCLSPGERAAFIMANILHKSDADASKALGISKSAYKVR
FT                   LSRARKKVVDYLAPRCEHVDPMNPCRCPARVGVAMHKGFIRGPGEVQLRKPVTPFGRYG
FT                   AGPKNEDVPLRDVSSIYRNLPEPESSPGFVERMQQKIDSGLWDQVLEKKQQRK"
FT   gene            77247..77555
FT                   /locus_tag="Hoch_0046"
FT   CDS_pept        77247..77555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12688"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFQ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12688.1"
FT                   /translation="MKPFLAAVFLSVFGLALPSASAGSGPAPASQPFTSAADSDCARAK
FT                   QHNRPCRLVFDTGDEIDGDRASVGHDEITGRVALPFSNLIQVRESFRAEVLRSAEAL"
FT   sig_peptide     77247..77315
FT                   /locus_tag="Hoch_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.800 at
FT                   residue 23"
FT   gene            77625..77900
FT                   /locus_tag="Hoch_0047"
FT   CDS_pept        77625..77900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12689"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFQ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12689.1"
FT                   /translation="MRILAYALSAFMGFALVACSSSRSPRCKQICQQESKCIRELGRVD
FT                   MHFDEAECIAACTVLDRDGEGRRIVDEHAQCVSSAAGECSTLLRCR"
FT   sig_peptide     77625..77687
FT                   /locus_tag="Hoch_0047"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.461 at
FT                   residue 21"
FT   gene            complement(78121..79302)
FT                   /locus_tag="Hoch_0048"
FT   CDS_pept        complement(78121..79302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0048"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="KEGG: mxa:MXAN_1519 adenosine deaminase; TIGRFAM:
FT                   adenosine deaminase; PFAM: adenosine/AMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12690"
FT                   /db_xref="GOA:D0LFQ6"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFQ6"
FT                   /inference="protein motif:TFAM:TIGR01430"
FT                   /protein_id="ACY12690.1"
FT                   /translation="MGTELSLEFIEKLPKTDLHVHLDGSLRLDTIIELARQHRIKLPTF
FT                   DREELFSLIYAGEICESLDDYLKAFDITLAVMQTEDSLERAAFELAEDAWREGVRHIEV
FT                   RYSPMLHTREGLRLATVVEAVLRGLRMAKRTYGIRYGLILCGIRSMSAETSIRMAELCI
FT                   AFKNRGVVGFDLAGSEVNNPAALHREAFQLILSNNINCTAHAGEAYGPESIAQAIHKCG
FT                   AHRIGHGTRLIENGDLLNYVNDHRIPLEVCPSSNLQTKAAKSWDAHPIDFFVDYGLRVT
FT                   INTDNRLLTDTTVSKELWLCHLHYGWPLETIKDVLVAGFKSAFITYRERADLLKAITAE
FT                   LDAIEAPQGTEDKPENGEIVYELREARETRDAKTPGSVPAVEEPLDGSEISSH"
FT   gene            complement(79402..80355)
FT                   /locus_tag="Hoch_0049"
FT   CDS_pept        complement(79402..80355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0049"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="KEGG: scl:sce7568 glutathione synthetase; TIGRFAM:
FT                   glutathione synthetase; PFAM: glutathione synthetase
FT                   ATP-binding; RimK domain protein ATP-grasp; glutathione
FT                   synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12691"
FT                   /db_xref="GOA:D0LFQ7"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFQ7"
FT                   /inference="protein motif:TFAM:TIGR01380"
FT                   /protein_id="ACY12691.1"
FT                   /translation="MRLLVILDALDKLDLAGDTSYALMLEAARREHEIWTCEVGDLGLE
FT                   HDAPVACAQPTQVRAAQTPAEAFACEPATYIPLDAFDVVMMRKDPPVDMNYLQATWLLE
FT                   RARGRTVLVNDPRGLRELNEHLAILDFPELIPPTLVTRSPARLRRFLDEQGGTIVVKPV
FT                   EGFGGLGIFMVKDGDPNTSSILETATRSGTQWTMAQRYLPAAVQGDKRILLVDGEPIGA
FT                   VLRVPPANEARGNLHVGGRAVKTEIDERDREIIAALAPMLASYGQIFVGIDVIGGMLTE
FT                   INITSPTGIRHIDTLENRNSSAPVLDCLERKAAALR"
FT   gene            complement(80380..81927)
FT                   /locus_tag="Hoch_0050"
FT   CDS_pept        complement(80380..81927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0050"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; response regulator
FT                   receiver; SMART: response regulator receiver; AAA ATPase;
FT                   KEGG: scl:sce6174 sigma-54 dependent DNA-binding response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12692"
FT                   /db_xref="GOA:D0LFQ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFQ8"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACY12692.1"
FT                   /translation="MTQHADYPILVVDDEQDNLDAFRFNFKRAFRLLCASSGEEALEIL
FT                   RDNEVAVIVTDQRMPRMTGLELLLKAAEIQPDAVGIILTAYTDLDVLVDAINLGQIYRY
FT                   VTKPWEAKELRGILTHALERYALLRENQRLMAQLREYTGYLNQEIHGAFDFGNIIGDSA
FT                   ALGEVLSKVEQVAPTNSTVLLRGETGTGKELVAHAIHINSSRENQPFVRVNCAALAPGV
FT                   LESELFGHEKGAFTGAVAQRPGRFELADGGTLFLDECGDLPMEVQIKLLRALQEREFER
FT                   VGGTQTIKVDVRVISATNRDLEAMIEAGSFREDLYYRLNVFPIHLPPLRDRLEDLPALV
FT                   AHFIAKFARSGMTRTPGVRGAALDKLRSYTWPGNVRELENIIERAMILARGRELDADHL
FT                   DFGRRAQNATPVSGTPSVISETASHSPPLIGDESKPLAERLLDSERREIIAAVEKSNNN
FT                   IASAARMLGINRSTLYYRMRKHGLEHLLPTKVGLGGSAGGGSSPTRDSSGADSTDAD"
FT   gene            82219..84060
FT                   /locus_tag="Hoch_0051"
FT   CDS_pept        82219..84060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0051"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gsu:GSU1489 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12693"
FT                   /db_xref="GOA:D0LFQ9"
FT                   /db_xref="InterPro:IPR021280"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFQ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12693.1"
FT                   /translation="MPLLAALITFALYAWTASPALGWLDAPEFVAASVALGVPHSPGHP
FT                   LPVLLGRLGAMLPLGDLAFRVNLMSAFAGAGAAATMTAAARRILGRLAPTVAYPARALA
FT                   SLAAGLIFALSWSAWFQGVRAEVYALEAALHGLVLALVIVELSRVREDHLLAGNARRLY
FT                   AAGLWAGLALATHPFIALTVVLPAMAAVLIWRRPSLPGGARVALIGIIGLTPLLQTAVR
FT                   AARYPLVNWGAPHTAERFAWTVSVRAFQKTASAEHVSPPVEDLVQATAVMAEQMSGPLA
FT                   LLAVLGLYVGIRRGGPARRWTLLLVAILGMALGGRTLLGFDPQVPDDHGYLLPALSAMV
FT                   LLAVIGVATVAEALAQTVRPAPAGALLAGVLVAFVPWQLLRFGPEADVSDARTSEVMAA
FT                   WQLESLPPRTLLLSAYFETRFRLWALSATEGARPDIDVLDRSFLSYPGMDEDARHANPE
FT                   LSALIDAPLRVGAPLPVSELRTQARERPVRVELHINLDEPGDPWLLPDGAFAALVPTVP
FT                   DDDTRRAAERHDRESLDALAERLRAVSPTSDSIGLLSIETVRVNSALLWLDMARLHLYC
FT                   RQRRQQAAQETLDSAVSLAPEDLLLRDIARRCRLRVR"
FT   sig_peptide     82219..82287
FT                   /locus_tag="Hoch_0051"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.818 at
FT                   residue 23"
FT   gene            84060..84407
FT                   /locus_tag="Hoch_0052"
FT   CDS_pept        84060..84407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12694"
FT                   /db_xref="GOA:D0LFR0"
FT                   /db_xref="UniProtKB/TrEMBL:D0LFR0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12694.1"
FT                   /translation="MFMDLWTIIATLALLVSTAAACWRLRGEEPGDIEPAAGIAAAALH
FT                   FFGIGAVPMALALAVLTSTAAVATAVADILAHLHLGADYPVWFPLDALGCGLGAGLLCT
FT                   RLLAAAYPRAR"
FT   sig_peptide     84060..84125
FT                   /locus_tag="Hoch_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.916 at
FT                   residue 22"
FT   gene            84573..85007
FT                   /locus_tag="Hoch_0053"
FT   CDS_pept        84573..85007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12695"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGE9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12695.1"
FT                   /translation="MRRPVVIPRRMPMRRALRISLFERQVSVRLSEAAIEILFRTASVL
FT                   SEGQIDRDRHFGSTMITIDLERAGRRLAEVCDAHAAREVERLLCEDPRIHARAEHIAVA
FT                   EAQRLAGRALGASQVDLRIHRSDRHLHLDIDVESVIEDMP"
FT   gene            85004..86137
FT                   /locus_tag="Hoch_0054"
FT   CDS_pept        85004..86137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0054"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: regulatory protein MerR; Tetratricopeptide
FT                   repeat; KEGG: scl:sce3861 MerR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12696"
FT                   /db_xref="GOA:D0LGF0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGF0"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACY12696.1"
FT                   /translation="MNENELFSIKDVARIFELEVSRLRYWAQTGFVNPSERRGGRMFYT
FT                   FRDLVALRTAKGLLDAGLSLQKVRKNLETLRLVLPEVADPASKMRICSDGETVVAVDQG
FT                   VAFEPATGQVVMSFTVDGLSHELSELSELKPAGPGALEDDLSGPKLAPVAALEAEVDSG
FT                   PNPSLAGDDDGDMDGDEDGEPSAYQCFVFGCEAEERGELGLAEQHYRQAVSLQISLAAA
FT                   STNLGNLLYRRGALSEARAAYENALEYEPAQAEARFNLGNLLEDLGETDQAIAELRRVC
FT                   WTHPSFADAHYNLGLVLARVGGVRQACIHLERFLELEGESEWAERAAEFLEALKSASAD
FT                   ASERAPETAEGGENADAGRKGAGTLKDRRSKNRSARR"
FT   gene            complement(86097..87347)
FT                   /locus_tag="Hoch_0055"
FT   CDS_pept        complement(86097..87347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0055"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap; SMART:
FT                   peptidase S1 and S6 chymotrypsin/Hap; KEGG: GJ12687 gene
FT                   product from transcript GJ12687- RA"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12697"
FT                   /db_xref="GOA:D0LGF1"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGF1"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ACY12697.1"
FT                   /translation="MPPRSASSPVAPSTSLALAALLALAAGSSACAEGSIFGADKFCGD
FT                   TRTAPKVYYGTLLPSLVPLTPEQLLSVGSFRLCSGTLIAPTWVLTAQHCGLAVGANFCM
FT                   GDSPSDPDVCIRSSAVYNHPDADITLVELSADARGAVPGVVPLPYMDESLGQEWIGRRA
FT                   EAAGYGQTETGALGTRYFTAEPIVALDSGFATIDGEGQRGVCFGDSGGPLLIIADDGTV
FT                   RVAGVLSNGDDTCVGRDNFTRADSYRDWIAKYAGEPQLGEGDQSCVQLGRVGRCETERA
FT                   VWCGNERVQTEVCAAGTACGWDAGDGGFRCIAGEDPCGGVDAVGTCDGEIARWCDNGVP
FT                   QARDCGVCGEICLPSVNGVGAYCVPDNCNGLDYLGQCEGDVVVWCDAGQRLERDCAALG
FT                   QVCKLIDEQIGFYCADP"
FT   sig_peptide     complement(87249..87347)
FT                   /locus_tag="Hoch_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.884 at
FT                   residue 33"
FT   gene            complement(87461..87877)
FT                   /locus_tag="Hoch_0056"
FT   CDS_pept        complement(87461..87877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12698"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGF2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12698.1"
FT                   /translation="MRVPVKTHAGTTFFVEVDAAAPDAPSAPGLPDASDASELAPDGAA
FT                   MGAPRIDTALFARAVEVVQSVSQDLSEGLLATEPRPSSVELALDLGFDAQGNVWIFRGG
FT                   AKASLKLTLRWNLPPSDGGDGSGGTGGTGAGGGA"
FT   gene            87935..88168
FT                   /pseudo
FT                   /locus_tag="Hoch_0057"
FT   gene            88165..89424
FT                   /locus_tag="Hoch_0058"
FT   CDS_pept        88165..89424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0058"
FT                   /product="7,8-didemethyl-8-hydroxy-5-deazariboflavin
FT                   synthase, CofG subunit"
FT                   /note="KEGG: eba:p2A350 FO synthase; TIGRFAM:
FT                   7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG
FT                   subunit; PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12699"
FT                   /db_xref="GOA:D0LGF3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019939"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGF3"
FT                   /inference="protein motif:TFAM:TIGR03550"
FT                   /protein_id="ACY12699.1"
FT                   /translation="MSAAGPGVIARAAERPLSDGELSALAELDAAALERRTGDLMRAAA
FT                   ERRDRAWGRALSFSPKVFLPLTNLCRDACDYCSFRRSPKQAGAWTMTPREVDTWLRRGR
FT                   AQGCVEALFCLGDTPESAFPSYRAQLAGWGHESTVAYLVAAGERALEMGLLPHTNAGVL
FT                   GCTEIALLKRVNASQGLMLESVSPRLCAKGMPHHRAPDKRPEKRLAMLESAGALRVPFT
FT                   TGILVGIGETERERIDSLVAIRDLHRRFGHIQEVIVQPFRARPAVPMAAAPEAGDRELL
FT                   RAIALARLILDDEVAVQTPPNLGASHTATAAEVSALRGAGINDFGGISPVTPDYISPGH
FT                   PWPQLDVLASACASAGATLVPRLPVYPRYLEESDFISGAVRAHLADASARLATMRITFG
FT                   VASPDPSLPAEAGAEAGVRR"
FT   gene            89421..90782
FT                   /locus_tag="Hoch_0059"
FT   CDS_pept        89421..90782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0059"
FT                   /product="7,8-didemethyl-8-hydroxy-5-deazariboflavin
FT                   synthase, CofH subunit"
FT                   /note="TIGRFAM: 7,8-didemethyl-8-hydroxy-5-deazariboflavin
FT                   synthase, CofH subunit; PFAM: Radical SAM domain protein;
FT                   KEGG: cps:CPS_4048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12700"
FT                   /db_xref="GOA:D0LGF4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019940"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGF4"
FT                   /inference="protein motif:TFAM:TIGR03551"
FT                   /protein_id="ACY12700.1"
FT                   /translation="MSEAPGGTPPAKSDNMTNSSSAESVRASELRAEAALARAPRAERA
FT                   ILAACMGDGCPSWQQAAELFAVRDAGLDALVAVADAVRQRQVGEAVSYVVNRNVNFTNV
FT                   CVKKCQFCAFSRELRSEQGYYLARDQVIARVREAHALGATEVCLQAGLAPSAEGRQYIE
FT                   LCRAVKRAVPAIHVHGFSPEEVRYGALRAHMSVRAYLEELLDAGLGSMPGTSAEILDDE
FT                   LRARISPGRITTAQWIDVVTTAHALGIPTTSTIMYGHVEDAGHRARHLALLRDIQADTG
FT                   GFTEFVPLSFIPTHAPMYALSTVPGVRPGPRPDDVVRMHAIARLMLGASVRNIQVSWVK
FT                   EGMDMAARLLGCGGNDLGGTLINESISTAAGAGHGQRQSPRALRQCIRAAGRVPVQRDT
FT                   GYRVLRRFGDAESDAESGADTLDAAGGDERFGSFEALIGDRRHRYRGIGAPGGD"
FT   gene            complement(90807..91787)
FT                   /locus_tag="Hoch_0060"
FT   CDS_pept        complement(90807..91787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0060"
FT                   /product="LPPG domain protein containing protein"
FT                   /note="TIGRFAM: LPPG domain protein containing protein;
FT                   PFAM: protein of unknown function UPF0052 and CofD; KEGG:
FT                   eba:p2A344 LPPG:FO 2-phospho-L-lactate transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12701"
FT                   /db_xref="GOA:D0LGF5"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010115"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGF5"
FT                   /inference="protein motif:TFAM:TIGR01819"
FT                   /protein_id="ACY12701.1"
FT                   /translation="MSRAPRIVALSGGVGGARFVHGLAAALAPAAAAADASASAGAAEQ
FT                   LTVIVNTGDDFRWWGLAISPDLDTVMYTLAGLSDDERGWGLRGESFAALSMVAAYGGET
FT                   WFQLGDRDLATHLQRSEALARGDSLSAVTARLCARLGVGPRVLPMADAPRQTRIDTAEH
FT                   GSLLFQEWFVRERTRPRPERIWFEGTTTPAPAAMEALAEADLVLIGPSNPYVSIDPMLG
FT                   LDGVREALARVPVVAVSPIVGGRAVKGPLAEMIPQLAGRPASAAAVCAHYQERWDGLLR
FT                   GFVVESDDASEITELPVLGTDTIMRDHAARARLARATLAFAESLR"
FT   sig_peptide     complement(91686..91787)
FT                   /locus_tag="Hoch_0060"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.630 at
FT                   residue 34"
FT   gene            complement(91784..92659)
FT                   /locus_tag="Hoch_0061"
FT   CDS_pept        complement(91784..92659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0061"
FT                   /product="F420-dependent oxidoreductase"
FT                   /note="TIGRFAM: F420-dependent oxidoreductase; PFAM:
FT                   protein of unknown function DUF129; KEGG: eba:p2A347
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12702"
FT                   /db_xref="GOA:D0LGF6"
FT                   /db_xref="InterPro:IPR002847"
FT                   /db_xref="InterPro:IPR008225"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGF6"
FT                   /inference="protein motif:TFAM:TIGR01916"
FT                   /protein_id="ACY12702.1"
FT                   /translation="MSEVCTPELTLRALPDIPVIAPGDDLAALALAGLRAAAITPAPGD
FT                   VLVFASKLLSRAEGRFVDLATVTPSPTAEELAARVGNDPRLVELVLGESEAVSRAAPGV
FT                   LIVRHRLGFVSANAGIDRSNALPPGAAADSGPWALLLPTAPDAAAARLRSAMTERCGVE
FT                   LGVVISDSMGRPFRLGTVGVAIGAAGLPALVDGRGDADLCGRTLEDTFTALADQLACAA
FT                   DLVAGQGGEGRGVVHLRGLRWPFPAAPGAATQPDVPGAAAAASADPDSGNDDDPGARVL
FT                   VRARERDLYA"
FT   gene            complement(92656..93390)
FT                   /locus_tag="Hoch_0062"
FT   CDS_pept        complement(92656..93390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0062"
FT                   /product="NADPH-dependent F420 reductase"
FT                   /note="TIGRFAM: NADPH-dependent F420 reductase; PFAM: NADP
FT                   oxidoreductase coenzyme F420-dependent; KEGG: eba:p2A348
FT                   oxidoreductase, F420-dependent NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12703"
FT                   /db_xref="GOA:D0LGF7"
FT                   /db_xref="InterPro:IPR010185"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGF7"
FT                   /inference="protein motif:TFAM:TIGR01915"
FT                   /protein_id="ACY12703.1"
FT                   /translation="MRIAIVGGTGNEGRGLGLRWARAGHDVRLGSREATRAEACAAELA
FT                   ERLGAGADADANRDTAAAPAIAGGSNIWAIEGADAVVLSVPYRAHASTLAALAEALAGK
FT                   LLIDITVPLVPPRVRVVHLPEGRAAALEAQERLGAEVRVVAALHHVSAGHLADLDHAVD
FT                   CDVLVCGDDEHARNTAVAVIGDLGVRALDAGPLRNAIALEALTPVLLHLNRRYRGGGAG
FT                   LRITGLRLSGDGDGSGGGASRS"
FT   gene            complement(93497..93910)
FT                   /locus_tag="Hoch_0063"
FT   CDS_pept        complement(93497..93910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0063"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: mxa:MXAN_0633
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12704"
FT                   /db_xref="GOA:D0LGF8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGF8"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACY12704.1"
FT                   /translation="MGSSKSREYEMDKELAQSIGTAARKARHELHLTQEDAAERIGVSV
FT                   EFYSRIERGAALPGLTTFVRIAYVLNLSSDVMIGRRLEDRDAKVSSTLLPQQREERPEV
FT                   RRVVRRLRNASSGTLRFVALLLKEMERLQDDDE"
FT   gene            complement(94140..94868)
FT                   /locus_tag="Hoch_0064"
FT   CDS_pept        complement(94140..94868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0064"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: reh:H16_A2259
FT                   transcriptional regulator, TetR/AcrR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12705"
FT                   /db_xref="GOA:D0LGF9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGF9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACY12705.1"
FT                   /translation="MASEKETETPDQIASSQPTKGGEENPDTSLFPQSARRFRQARARK
FT                   TYEALIAAAAKLFAERGFDATQTPDIAQKAGVSVGTFYRYFSDKKEVYIEAVRRQLTLA
FT                   HGHVMDRLTPDRFVGKARRATTQEAVRVLLDQVLNHRQQQRVFVEMSLRDEDVAALKVE
FT                   YDNAARQRLAELFRAICEPEVVPDAEATAYIVYTAVTECAYHIARVTADGTPVSQKRAL
FT                   AALTDLVTRALFADADANAA"
FT   gene            95005..95838
FT                   /locus_tag="Hoch_0065"
FT   CDS_pept        95005..95838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0065"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: acp:A2cp1_0877 formate dehydrogenase family accessory
FT                   protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12706"
FT                   /db_xref="GOA:D0LGG0"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGG0"
FT                   /inference="protein motif:TFAM:TIGR00129"
FT                   /protein_id="ACY12706.1"
FT                   /translation="MRDGSATCQRRVQRIAVDGARETLRDAIAVEEPLELRTQGRPLVV
FT                   VMRTPGHDRELARGLLFGEGLIARQERLPQLAAPADLRPEERGNVLETGLPASSGDAPR
FT                   WLAASACGVCGKRALADLALRAQPLRTSLAVAVALIASLPERLRAAQEVFARTGGLHAA
FT                   GLFDTAGALLVAREDIGRHNAVDKVIGWALETAQDGDEGDEGGGFFAGVLLCVSGRVGY
FT                   EIVQKAIVAGIAIIVAVSAPSSLAIDLAERFRVTLCGFTRAGRFNVYSHLSRIAD"
FT   gene            95846..99292
FT                   /locus_tag="Hoch_0066"
FT   CDS_pept        95846..99292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0066"
FT                   /product="Lantibiotic dehydratase domain protein"
FT                   /note="PFAM: Lantibiotic dehydratase domain protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12707"
FT                   /db_xref="InterPro:IPR006827"
FT                   /db_xref="InterPro:IPR023809"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGG1"
FT                   /inference="protein motif:PFAM:PF04737"
FT                   /protein_id="ACY12707.1"
FT                   /translation="MSKSPNSPPVSADARFVLRTPLLPLQSFLDWTAAGTGVSVEAVRN
FT                   ARAHLRRLIDQPVVREALYLASPGLVGDIPLWEREPHSVRGQKIERALVRYVSRMSTRA
FT                   TPFGLFSGVAVGHVGENTQLACVDAGAYRRSTRLDNDYLFALCSALREIPALREALHWR
FT                   PNSSLYSLAGRYRYAEARLRGTLRSYHLVAIGSMSYIADTLERARGGASLQALARALVA
FT                   DDPEIEMGEAEAFIDELVESQVLECDLEPAVTGLEPLAGLLAILEAIAPSARVTGVLRG
FT                   VSARLAALDERGVGCDIAAYEDIEDSLRELPAAIDKARLFQVDLIKPAPEAVLGRGLVD
FT                   TVARGVEVLRRLTPQPGSGLLDRFREAFRERYESRELPLVEVLDEESGIGFGTSDDPAA
FT                   SGAPLVADLRFAPRAGDGQETWTDFHHELLRRLEHIWAEGGRELVLGDDDIDALSASQP
FT                   ARQPDAFSVLGAVRASSPQALAEGDFEVDLRSAAGPSGARLLGRFCHGSEPVHELVRAH
FT                   LRAEEALRPEACFAEVVHLNEGRLGNILCRPVLRSYEIPFLGRSGAPPERRLPVQDLLV
FT                   SVRGERIVLRSRSLDREVVPRLSTAHNFSRRSIGIYRFLCALQAQDGDAVSWSWGPLAR
FT                   ARFLPRVRWGRVLFTRARWLLDERALAPLAEAVRTRRHKRAKPDTRTDAKPGEAAAAEQ
FT                   RALAEQRALAEQRSIFEALLGLREALGLPRHVRLGEGDNELAVDLDNPLSALSFAHLVA
FT                   KRSSATLYEFDPEPARQPARGPEGRFTHELVLLFTRDPSAARTGAREDMKTAPALASAA
FT                   VEDDVPARGTPARGVPARGTPAVGTPVVAAAASAVPRSFAPGGPWLYLKLYTGVSTADT
FT                   VLRDVIAPVRELAFDSGAAQQWFFLRYHDTGPHLRVRFRGPPGRLYSEVLPAAHAALQP
FT                   LIEDGSVWRVQIDTYERELERYGGAAGIELYEEIFWHDSDAVLDIVELLEGDAGADARW
FT                   RLALRGADMLLDDFGMSTRARRELMARARDSFRAEFRADTAMFKKIGERFRAERGELER
FT                   LLGADPADDAASDLAPGLELLARRSERVRAAIGAYLDRVSNRDSAIHMLERCASSVVHM
FT                   HVNRMLHVSQRAQELVLYDFLHRWYAARSARKTTLTKSTEK"
FT   gene            99292..100563
FT                   /locus_tag="Hoch_0067"
FT   CDS_pept        99292..100563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0067"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: bja:bll6537 putative
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12708"
FT                   /db_xref="GOA:D0LGG2"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGG2"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ACY12708.1"
FT                   /translation="MTDSRDAAKPATSAAGAPIFNPLDPAFLRNPYPVYRGLQDQAPVL
FT                   LTPLGVYVVTRYQDVQQVLRGPGMHHRFEDMARRRVGDKAKTSPAFRSLGQWILTGNPP
FT                   DHTRIRGLMVKAFSAARVESMRPRVQQLVDDLIDQMLAAADSAAPRADLVGALARPLPV
FT                   TVICELLGIPREDWPRFTGDSYLPRFLVEPRPLSPSELDAVDSVVSEIGEYLGALCDSR
FT                   RAAPQDDLISALVQASEGDDGKLTHEELVANLIMLFFAGHETTVNLIGNGMLALLGHPA
FT                   ERDKLIADSSLIPNAIDEMLRYDNSVQLAGVRCNEAAVTLSGVEVPAGSQLIPIIGAAN
FT                   HDPRAFDEPERFDVSRSFANKPVSFGGGIHFCLGAQLARLEASIAVETLLRRLPDLRLA
FT                   EGYEPAYFPSFVLRGLRSLEIAWS"
FT   gene            100792..103797
FT                   /locus_tag="Hoch_0068"
FT   CDS_pept        100792..103797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0068"
FT                   /product="cysteine-rich repeat protein"
FT                   /note="TIGRFAM: cysteine-rich repeat protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12709"
FT                   /db_xref="GOA:D0LGG3"
FT                   /db_xref="InterPro:IPR000998"
FT                   /db_xref="InterPro:IPR011936"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGG3"
FT                   /inference="protein motif:TFAM:TIGR02232"
FT                   /protein_id="ACY12709.1"
FT                   /translation="MTHNRALARGLSVAALLAFAAADDAPTAHAFTGADTPGIAGVEHA
FT                   AEPGLEVAEGPRARAQPAVTWNRPPAQRAAAWERFVADTGTAWTPMWDADTAMPLRIAG
FT                   AGMAMPGSVASADKAADYARAFLAEYIDLLAPGSRPESFHVVGNDLSDGVRAVGLYQYH
FT                   EGMRVLGGQLSFRFKNDRLILVASEALPDIALPAVSYTTAEAVVRDAALSWVAGEVGKA
FT                   WVTETSGPYVLPVISTGRVSYHTVMQATVEGRAPTSRYRVYIDASSGEPVAREQMLLYA
FT                   DAQLLYNVPARYPEGDRADLPASFTEVVYEDESYFTDGAGVFSWDGEGAASVSASVSGE
FT                   LVTVSNQRAPDESTVFEVALTPAGTGVWDARDDEFVDAQLTTFVHSNIVKEYVRVFAPG
FT                   LKYLDEQLLARVNIDDTCNAFSDGTTINFFRASGQCANTGRLPDVVYHEFGHSMHWQSL
FT                   VPGVGAFDGAFSEGLSDYLAATITGDPAMARGFFYGDEPLRHLDPEDFEHSWPRDIAGV
FT                   HYTGLIFGGAMWDLRKELVALYGEEEGVAVANRLYYAAVLRASSIPATYFELLAADDDD
FT                   GNLANGTPHECLINDAFGALHGLREIGNEHIPLGIQPPEREGYSLSARLQGTNARCAGD
FT                   EVLSVIVRWQRRGSEVGEDLEATLQDGGDGVYEATIPAQPAGSTVRYQVVVEFANGGVI
FT                   TFPDNPAWEYYEFYVGELIELYCTDFESDPYAEGWSRGQTRGVATGGANDWQWGRPLGK
FT                   AGDPAAPYSGAASMGNDLGDEGFDGFYQPQKGNYFESPVIDVGDYSDVRLQYRRWLTVE
FT                   DSRWDDAIIYVNGRPAWRNRQTPSGKVHHIDKQWMFHDVSLSGQILGDTAQLRFALETD
FT                   GGLQFGGWNIDDVCIVAAPDAICGNGTVEGTERCDAGDANSDTESDACRTNCRTAFCGD
FT                   GVRDRYEQCDDGNDDPDDGCTPACFLPLPERGCSVRPGGAGDGGAAGLALLALLGLVGR
FT                   AYHTRRRGRARA"
FT   sig_peptide     100792..100854
FT                   /locus_tag="Hoch_0068"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.619 at
FT                   residue 21"
FT   gene            complement(103817..105514)
FT                   /locus_tag="Hoch_0069"
FT   CDS_pept        complement(103817..105514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0069"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; SMART:
FT                   serine/threonine-specific protein phosphatase and
FT                   bis(5-nucleosyl)-tetraphosphatase; KEGG: scl:sce7747
FT                   putative protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12710"
FT                   /db_xref="GOA:D0LGG4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGG4"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACY12710.1"
FT                   /translation="MLKFSNDPDLAEQQMCAIIFYLTAFGYIDGNFDLAEKTFVRGYIR
FT                   KLVEYRALDAMPDENQEVRDEIVGKFTSHFHEVFEAINREIRALFTEVVADDEKVEEFV
FT                   YARLKLRSYEAFKSFDKDNQQELLATVDELIYADGTIHPAEARFREEIQNLLKVEVPDL
FT                   PASVPAGGKSAALLIDDPVYLPPSRDDHPFFSESEYHYSADPVRIRKQADNDHNIIVRT
FT                   MALLDEQRGRGKGKLTGAHSVTEFQGQDPFLDGHVYVHPVEDGQSYELTVLGDLHGCYS
FT                   CLKGALMQADFFAKVEAYRLDPKHNPNPKLVLLGDYIDRGHFSYHGILRTAMQLFTAMP
FT                   EHVYMLRGNHEYYIEYGGRVYGGVKPAEAINTLIGYMPSEMFTSYMNLFEALPNVLLFD
FT                   RMFFVHAGIPRDSAIEDKYKDLSSLNDSDLRFQMLWSDPSHTDFIPRELQEQNARFPFG
FT                   RTQFENFMDRVGCTTMIRGHEKVAEGFRAVYPGNRVALLNLFSAGGADNDDLPADSSYR
FT                   EVTPMALTIRIDDGNTKVTPWAIDFRPFNDPRRNAFYASRPEIEHKQG"
FT   gene            105888..107264
FT                   /locus_tag="Hoch_0070"
FT   CDS_pept        105888..107264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0070"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; Thrombospondin type
FT                   3 repeat; KEGG: mxa:MXAN_5598 OmpA domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12711"
FT                   /db_xref="GOA:D0LGG5"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGG5"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ACY12711.1"
FT                   /translation="MSVAAGASTAGEARADAETERPLALGGFVGGNYISDQVELGNAYF
FT                   AEQVPGSAFLLGARGSYELLSWGGSLAPRLSAEAELKLALSSTGAAPGSMRSSYFAPVL
FT                   GWRAQAVLDLWSEYRAHPHVSLGFGGETVFSSSPFVASGDSDATMYWGVGGSYALASSY
FT                   GVRADLRLGITAGRFDASASTVELQFGFYYAFGPGEPAAPRTRRAEPVPYALASEPVDE
FT                   DDDGVPDFSDACPSEPELYNRMDDEDGCPERDPDGDGLFGAADECPEEAEDFEGFEDED
FT                   GCPDVDNDGDGNPDSADECPNRAETDNGFEDEDGCPDEVPTRVAEYIGVLEGIRFPSGS
FT                   AKIRDRRSRRILGDVAATLAEYPSVRVRISGHTDDRGRAEKNVQLSRERADAVKWFLVD
FT                   KGIEHTRIVTAGYGPERPLADNGTRAGRAKNRRIEFELLTGPIEIEANPADADADEASE
FT                   "
FT   gene            complement(107795..108859)
FT                   /locus_tag="Hoch_0071"
FT   CDS_pept        complement(107795..108859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0071"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: eba:ebA3150 2-oxoglutarate ferredoxin
FT                   oxidoreductase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12712"
FT                   /db_xref="GOA:D0LGG6"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGG6"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ACY12712.1"
FT                   /translation="MSASTSNKSGNGKLIKLSKKDFESDQDVRWCPGCGDYAILATVQR
FT                   ALANLKVERENTVFVSGIGCSSRFPYYMNTYGFHSIHGRAPAIATGLKVARPELSVWVI
FT                   TGDGDGLSIGGNHLMHAMRRNVNLNIILFNNQIYGLTKGQYSPTSQVGKKTPTSPLGSV
FT                   DLPVNPLALATGAGTTFMARVGDTDAKLFLKILERAQAHEGTSLIEVLQNCPVFNDGVW
FT                   NEVTDRKTMADRQLVLEHGKPLVYGKNKEFGIRMRKDFTPEVVEVGEGKVPESELVVHD
FT                   ETGSPAYTHMLALMNYPEFPIPVGVFRAEPRPSYDSMAVAQVKTAVESQGPADLKALLY
FT                   SGMTWEVSPDGIKH"
FT   gene            complement(108914..110794)
FT                   /locus_tag="Hoch_0072"
FT   CDS_pept        complement(108914..110794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0072"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: afw:Anae109_1891 pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12713"
FT                   /db_xref="GOA:D0LGG7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGG7"
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /protein_id="ACY12713.1"
FT                   /translation="MPQTDSQAKNLAKVVIRFAGDSGDGMQLTGTEFTKAAAIAGNDIS
FT                   TFPDFPAEIRAPAGSLAGVSGFQLHFSSNEIHTPGDAPDVLVAMNPAAFKTNVGDLNTG
FT                   GILIVNTGAFVETNLKKAGYDANPLDDETLADRFRLHSIDISELTVAALEESELSTKEK
FT                   GRCKNFFALGLLYWMYSRDPELQIGNIQAKFAKKPQVADANIKVFKAGYHYGETAEVFQ
FT                   DVYEVPPAKFQPGIYRNITGNEATSLGLLTAAHLAEKQLFYSGYPITPASSILHSVARY
FT                   KNYGAVTFQAEDEIAAVGAAIGAAYGGSLAVTASSGPGIALKGEGLGLAVITELPMVII
FT                   SVQRGGPSTGLPTKTEQADLLQTLYGRNGEAPLPVLAAKTPGDCFYCAIEAVRIAVKYM
FT                   VPVMVLTDGYLANGAEPWLVPNVDDLPKIDVQYRTDSENYQVYRRNPETLARDWVIPGT
FT                   PDMQHRIGGLEKDFFTGNVSYDPDNHERMTRVRAEKVERVTQEMGPLDILGEEEGDVLV
FT                   IGWGGTFGALRQATGLLREQGKRVSHVHLRWMFPFNPRLEPLLKNFRHVLVPELNMGQL
FT                   RMVLRAKYLVDAQGLNKVRGLPFKVQEVVDSVERLLAGKPAAMEAPAALA"
FT   gene            111132..111208
FT                   /locus_tag="Hoch_R0001"
FT                   /note="tRNA-Arg1"
FT   tRNA            111132..111208
FT                   /locus_tag="Hoch_R0001"
FT                   /product="tRNA-Arg"
FT   gene            111277..112134
FT                   /locus_tag="Hoch_0073"
FT   CDS_pept        111277..112134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0073"
FT                   /product="General secretory system II protein E domain
FT                   protein"
FT                   /note="PFAM: General secretory system II protein E domain
FT                   protein; KEGG: mxa:MXAN_3836 general secretion pathway
FT                   protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12714"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGG8"
FT                   /inference="protein motif:PFAM:PF05157"
FT                   /protein_id="ACY12714.1"
FT                   /translation="MPKRLAEIAIDGKLASREQVIRATREAESQGVPLIVELVRSLGID
FT                   ELALVAAIRRQARVPLIDPGDPALADIDSEALRELPQDVCRRLRLMPLAVSVYESGTRV
FT                   LRLAMADPTDTIALAEIEYLTGCQVEGQLMSLSAVEELVPRSYRSFVTKVIRREPAADS
FT                   ADIAAAPARLAGSASGDGGGGGHGLEVEVLLPPSEDPVPSDLAQSSDTRRVIIAPADDR
FT                   GGMAQASGGEQPTTVPFHRITDEASLELRHSALLQLLLRKQLITEAEYDEEIRTLMKQR
FT                   AEEP"
FT   gene            112151..115054
FT                   /locus_tag="Hoch_0074"
FT   CDS_pept        112151..115054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0074"
FT                   /product="serine/threonine protein kinase with TPR repeats"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   serine/threonine protein kinase; tyrosine protein kinase;
FT                   Tetratricopeptide repeat; KEGG: ank:AnaeK_0122
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12715"
FT                   /db_xref="GOA:D0LGG9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGG9"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY12715.1"
FT                   /translation="MPTSPQSTVCTHCGLALDHDALFCPKCGTARSKDLNGDPLMGTVV
FT                   GDRFLILERLGHGGSGTIYRAEHVTLRRKVAVKVLHHELSRDDLAVERFRREATTVSEL
FT                   DNDHIVGIYDFGRTNDGRLYLAMEMLEGETLQDVLARDRELPPVRAVDVLLQLGEALSE
FT                   AHAIGYVHRDLRPRNIWLTERRGRENFVKLLDFGLAKLVENEGRAATTSLGMTFGDPKY
FT                   MSPEQARGDVVDRRADIYSMGCIAYEMLVGAPPFDGQVFEILSQHTNAAPMAPRELRPE
FT                   LPEWLSQVVLQMLAKRPDERFSTVMALIEALRQRTESPAMPAPFPLADEDAESADDEGE
FT                   GAPSKSRARTGTISYGEGGGEDGDDDGESDGDRPTTGARGRRAVTASGRAKSRNTRTAR
FT                   KTSPGVPPASSSASHLPAMAIPAVPMPSVEGGRGASAGGAEDAAGTPAHTPETSAPSAK
FT                   SGRADENVAAGTDGAVSAPHKHESTAPIGVPAASEAAPAKTPAVSAKTPAAPAKTPGAS
FT                   TGAEATAASRSASPEPERSARSRPPTPVPGAGRAATPSAPAAKSSEAGAGKSRSPVSES
FT                   TVELPAAASAKPAASAKPAASAKPSESPAKPAASAKPAASAKPAASAKPAASAKPAASA
FT                   KPAAAASPKTGTGTEPEGGDLSGDWFMDAGGDTGAAASAAREPGDGDSGVLADDVASFT
FT                   PRSKRQRQAFLAVGGIVLLLLIVGLLWASGGDDEGGDEGAAVAVDAGAPSAAEILSAQA
FT                   EAAATAEATADAGASPADAAPADAAPAASSATPSPPTSPEPSPEAGGDQNPERTAARTS
FT                   ERTTARDERPSRPARPAAGSSDEGDEGDDAPADDNARQAAFYVKLGNSKLKGGNPLGAA
FT                   GDFKKALDLDPRNVDATLGQAQIAYNQGLYGKAIPLFEKAARMRPRSAEVQILLGQAYL
FT                   AAGNKSKAASSFRRALQLRPGDARAERGFTEATGNPP"
FT   gene            complement(115596..116570)
FT                   /locus_tag="Hoch_0075"
FT   CDS_pept        complement(115596..116570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0075"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: dma:DMR_15820 sec-independent protein
FT                   translocase protein TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12716"
FT                   /db_xref="GOA:D0LGH0"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGH0"
FT                   /inference="protein motif:TFAM:TIGR00945"
FT                   /protein_id="ACY12716.1"
FT                   /translation="MAEPRRVIEPEPVLDDGATMPFTEHLRELRVRLRNAILGLIGGFS
FT                   VCYFFKEEIALLMLRPYQSVWATMQSKHTGDPSETPFQEASMYFTSMLEPFWAFFTNSL
FT                   WAGLFVASPIVFYQIWQFIAPGLYSHERRYGIVFALASAVCFISGGLFSYEFVLEPVYE
FT                   FLLGFATSNLAEMAELTGAGAGAGAGAGAAPVGLKPLLTIQEYLSLARRLILAFGLVFE
FT                   LPLLISFLALIGAVTHRGLLKFNRWWIVLSFVISAMLTPPDLFSQVLMAGPLVVLYNLS
FT                   IGLAWIITTRRERREAALIRQEDEAAAKAEAAATAAKSSDDAP"
FT   gene            complement(116563..117132)
FT                   /locus_tag="Hoch_0076"
FT   CDS_pept        complement(116563..117132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0076"
FT                   /product="twin-arginine translocation protein, TatB
FT                   subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatB
FT                   subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: ade:Adeh_0060 sec-independent
FT                   translocation protein MttA/Hcf106"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12717"
FT                   /db_xref="GOA:D0LGH1"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGH1"
FT                   /inference="protein motif:TFAM:TIGR01410"
FT                   /protein_id="ACY12717.1"
FT                   /translation="MFGMGFGEIVIIVVVALLFLGPERLPQAAKSISKGIRDIRKQTRA
FT                   LRETIEDDNEIGDAVRELQSALRGDEQYNTMAARRRAALNRANAATDAESAVATAEAAR
FT                   GGATQSAAVAGATAAGADAEAAGADPSAPEAASASADADKPAADGPPTPVLASPAGSIA
FT                   RGDGGGDESASAGESASKSPAEQVHG"
FT   gene            complement(117256..118713)
FT                   /locus_tag="Hoch_0077"
FT   CDS_pept        complement(117256..118713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0077"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: tbd:Tbd_0208
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12718"
FT                   /db_xref="GOA:D0LGH2"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGH2"
FT                   /inference="protein motif:PFAM:PF04892"
FT                   /protein_id="ACY12718.1"
FT                   /translation="MDAHSGAGGAVSDVERTASRWFLLLIVMYVGFIGAATFSVDAGSV
FT                   SLERGLDKLGGLASGSATQLVTIHDLRDVATNLLLFLPLGVLVALRRGVQHLRPLSLWL
FT                   AFGTLVSLGVEIGQSFTDRWADPVDLLTNTTGYLLGFGLTFVALRRFAFAPQALLGLSE
FT                   VHSDDQVRTVAGLSFLYLCVYAALQLVPFDVSVRLSHLHAKLLAPPGYARIILDPFAHL
FT                   SEGTDGFFALLYAAAGIAPAAALKFHLDVLRKRGSVVVTVWYGICVAAALEFAQIFIMS
FT                   RTADVAAVLLAPPAAVLGWLLATGWERLQGVRAAEGRSARRDRIYGIALASVLYIVVLA
FT                   LMAWAPFDYESDLRVVRDKVREETNLIPFRLHFSTHSLGAVRDIVKESSQFAPLGLMTM
FT                   LFLQARGRAESPLRASLFAGAVCTLVGVGLESGQAFFAGRYVDITDVLLAGAGGIAGSA
FT                   LWSVFRKSNPREQGRRGRTKSDSSGPR"
FT   gene            118939..122010
FT                   /locus_tag="Hoch_0078"
FT   CDS_pept        118939..122010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce0202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12719"
FT                   /db_xref="GOA:D0LGH3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGH3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12719.1"
FT                   /translation="MQMSRRVKRDATQWSAWLCAALMTGGLLGCDSGSDGSMDAGLDDG
FT                   YDWDCPDYIGPGYRPTTCGGRGGPDIPFVDDRPWSLDPVFDMLRADELARFESGGVTLS
FT                   EDDFTASEIPNSVAAQFERIYAVLGAERGSGSAAPDTEFQARAENMPFRAHPSDVKLYR
FT                   GNNERRAIVPLGGSIDVPGNEVAIVDLETQSVTRVAVGLRPQRVAVLDDAGLALVCNQY
FT                   SNYISVIDLLENDLLIDPDGGPETLLTSTYCSDIALVERRPGVGRIDELYLYVLSEYDA
FT                   KVMRYRIDIVRDINNAPVDVIISNGVENVAPVPVPEREAFGIGDSPHRLQFSEDGTRLL
FT                   VTNDRGSDLALVDAETLEVLARRDVGAPTLAAASIGGQFLATTTTPYRGLLRAGDEVPE
FT                   EVSAEPRLAEGVDGHMYEVHPGAQFDATASYNYEDVRSGILVFDADLADEPVYYTDDNE
FT                   ADALFAEENKLLAGALPWDIARDNAGAFAYVALLGSDLVQELAVTRENGLRLAASGRSF
FT                   ATSELPAAVALDEGADALLVATRGGGFLEVFDRTSGERTAQIDLGYASPRYPATAVEAG
FT                   EYFFASATWSNDGRKSCVSCHLSEFITDGLSFSQGTTAPTSANAVQPVHNLLRSNTFGW
FT                   SGSAVQDEMVRFSVQAQTRSNCELLLYGLVDGLGVAPAERGGDPANFTAELDTTGCVAD
FT                   TANQINGLPAPLANADRNGDGAVDFLDIQAAIAAQDELASEAVSAAVQPQLERVGLYDA
FT                   GDAAGNREAVIRALWFYSVSQQRLPPNPYAQRMRLGLYGPAESEYYQAGRDVFLNKAEC
FT                   DACHIVAAEGATSPFTDGRRHGAGGDFAERFTRVFEFDPLLAEIPGFDSGFPQQLKLAS
FT                   AYGDSKQEQSFVQAEVDSWKPLCFDTSRCLDMGNPLSAGPGSDEEFERMYRLGVIGFAQ
FT                   PGGFGFVPGFLFGEVAFDTPSLRGLWMRPRLLHHGRARSTREVILPPGDGLLDVGEAGY
FT                   GINRFHERYRHGWDTDALSEADLQALSFFLRAIE"
FT   sig_peptide     118939..119028
FT                   /locus_tag="Hoch_0078"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.922) with cleavage site probability 0.904 at
FT                   residue 30"
FT   gene            122081..123742
FT                   /locus_tag="Hoch_0079"
FT   CDS_pept        122081..123742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0079"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mxa:MXAN_7148 putative long-chain fatty acid-- CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12720"
FT                   /db_xref="GOA:D0LGH4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGH4"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACY12720.1"
FT                   /translation="MTRESPDSKPSIESAAESAAESANNAAAGGAFARLMRVFAERPDA
FT                   TALSFDGRSYSYATLDRRARAHAGGLQDLGLQPGDRVAVLAAPSFRVVVALLAHYWAGL
FT                   VHVPINTRYRAAEVAHILRDSGARAVLVDSDSVPVLDEVVAAEPALASVQRILVAGDVV
FT                   AAQALDFDWVSEPLQHERGHGDDEVALMIYTSGTTGPSKGVALSMRAVVAAMDALTGAW
FT                   GFSASDVLVLALPLFHVHGLCIGVHGGLLQGTAIELLPRFSPAAVVSAMQGGGTIFMGV
FT                   PTMYRKLLEHLEESPRDAEPLRRARLFTAGSAALPAADFARFEALTGHRILERYGMSET
FT                   LITLSNPLEGERRPGSVGLPVPGFEVRVVDEDGEDAEPDTPGEIWVRGVGLMNGYWNQP
FT                   EATAQAFRDGWFATGDVAARAPDGYLRILGRRSVDIIKSGGFKISAREIEDVLMEHPAV
FT                   AEVAVIGVPDDTWGQAIAAAVVLDARAPAASAPAPEILPELLAELAAWTGERLADFKKP
FT                   RALVAVSELPRNALGKLQKAQLAQAIERGELTLCRG"
FT   gene            124038..126788
FT                   /locus_tag="Hoch_0080"
FT   CDS_pept        124038..126788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0080"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: scl:sce0682 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12721"
FT                   /db_xref="GOA:D0LGH5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGH5"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY12721.1"
FT                   /translation="MEPIDLAELEKRLGPGASVDLRAEYERFRHFTDQPDLGHFVAYLS
FT                   AQGLISGTLERELSDGSTVGDAAAASGFDLLLAEAATAITADTRDTRAADDGSVELRPI
FT                   ASHELDAAELSAAGYDPLGRVGRGAMGDVYAVRDRELQRPVAFKRLNAASAARPNTVAR
FT                   FLNEVQVTAQLDHPNVVPIHSLVINRHGLPAYTMKLVDGRTLSEVLREARKQAQSGGMR
FT                   GESRRLTQRLEYFLKVCDAMSYAHSKGVLHRDIKPDNVMIGHFSEVYVMDWGVCCSLEQ
FT                   QRQLAQGSGGATAATAADADAEQGSDNGAKTAGNSDGKSDTASSAAPIPQARAGCDGDP
FT                   AAPAGPGPGTAAGAAWALSVVGDSIDTGTEPLSGKTWQSNVLEEWGDADPSSVSRRSTA
FT                   LSMGSSGERYTRQGAIVGTPAYMSPEQSRGEPLDQRSDVFSLGLLLFELISLRPGLAGG
FT                   GAEATLLRAAKGKTHPLVHHNPKLAIARELRAIVAKALAPAREDRYPDVDTLAEDVRAY
FT                   LRGDEVKARPDTLPQALVRWLGRHKLLAMLVMAAVLLASAALVIVVLLQKESALRAARH
FT                   KEERVQTFLLAVSRHSHAIDSHFATFESGLAELSGRLHELLTRTDAGTPTLYHSDDYKY
FT                   MDRSPADWSLAPRYNQPVSFDHPVFKLAPGVSAEQVTADMARVRRLAPAMRSFMLESAG
FT                   LDASALSRSEQRRVLASVGVPAIRSFVGLENGVYMSYPGQGGYPPAFDGRLRPNYRLAA
FT                   HREGIVWGNPYLDRYGLGVVLSAATGLYDDDGEFVGVVGLDMLFDWLTENLLALPEAPY
FT                   VELHYLVDAEGEIIIQNENGKAATGLVRGGDTGHDLHGNRAIDLAPLPFAAVREALAQR
FT                   SAGSVAFREGGRRKLAAFYPIDSLGWSYVVIADVEALLASRASAE"
FT   gene            126986..129286
FT                   /locus_tag="Hoch_0081"
FT   CDS_pept        126986..129286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0081"
FT                   /product="capsular exopolysaccharide family"
FT                   /EC_number="2.7.10.2"
FT                   /note="KEGG: mxa:MXAN_1025 capsular exopolysaccharide
FT                   family protein; TIGRFAM: capsular exopolysaccharide family;
FT                   PFAM: lipopolysaccharide biosynthesis protein; ATPase-like,
FT                   ParA/MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12722"
FT                   /db_xref="GOA:D0LGH6"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGH6"
FT                   /inference="protein motif:TFAM:TIGR01007"
FT                   /protein_id="ACY12722.1"
FT                   /translation="MSPPSTHSPARQETAASPPGAILEDERPALDLARYWRVVRKRAWL
FT                   IAAVVAVGVTASVLYTRSLPKIYQATASVVIDPTPPQVFGSQVQEVIQLGAQSYWSNQE
FT                   YYNTQLEIFTRFDLVERTLARHPELIDLVLATEIPGARSAGGDRDGGDSDGVADDPLSL
FT                   ATERLAALLTATQTRESRVVRLRAQHTEPAVAEQLANYHVDTFLAYHRNLRGENTEQIT
FT                   EFLDQELVTSADDLENAERALLAFKKDNDILSVSIEDRQNILAADIARYNAALSDARIE
FT                   RIELGTILARARALEGEAIMESPIFALASSTDMVEELKAQYIREKHKLAELSQELGPRH
FT                   PAYQAQNEKVEQQYAAIEAEARRALRELSERHQAALARERQLGAELERLKAEAFELGDK
FT                   TAVYKQLERKQHSEEEKYNLVLSRLGASQLSERNTASNVHLHMRARSAELVYPRVAVNL
FT                   GLGGVLSLLLGLGLAFLLDFFDRTIKSPEQVEQATGAPLLGMIPAVEAAGEGADADRDR
FT                   ARDLFVFDKPRSAVAEHCRSIRTNILFSTAMRPTKVLTISSPRQGEGKTTTAIYLGTIM
FT                   AQSGQRVLLVDTDMRRPRLHQSLGTGTATAHGLSELLLPETRIADKLDQVIVETAVPGL
FT                   FLLPCGAVPPNPAELLLTERFGEVLDALRERFDRVLLDSPPLMLMNDAVVLSRRSDGVV
FT                   MVARAGRTAVEDLSRSGRMVRDVDAPVLGVILNGASTARGRYGGYERYGYAGDDEDGGE
FT                   LRSSGRDGAERAA"
FT   gene            129283..131265
FT                   /locus_tag="Hoch_0082"
FT   CDS_pept        129283..131265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0082"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: polysaccharide biosynthesis protein CapD; Male
FT                   sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; short-chain
FT                   dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase; NAD-dependent epimerase/dehydratase; KEGG:
FT                   ank:AnaeK_4411 polysaccharide biosynthesis protein CapD"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12723"
FT                   /db_xref="GOA:D0LGH7"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGH7"
FT                   /inference="protein motif:PFAM:PF02719"
FT                   /protein_id="ACY12723.1"
FT                   /translation="MSGIGSTPGRARLPARSGVAGAVGNRRQARAAAVILDIFIIGFST
FT                   MAAYAIRFGFVGMVQAKYLYQMMMLVPTLIAARLLLNAALGVYRMMWRYVGLREALRFM
FT                   RSAAVGSALVSVVLLFLRYATSERYEFLQVPIGIIILEGTFTFGAIMGSRFLPRILAER
FT                   TNSTGDGAQPTLLVGAGRGGLAIAREAALNPALGFEARGFIDDDPSKHGREVHGLRVYG
FT                   GLDALEDAIHELAVSAVIVTTSAIAPAQLLRIVDTARALGIQVRTVSRAFELLDHRVDA
FT                   DTLREVRIEDLLSRDPVPPSLSMDDLVGAYGGKRILVTGAGGSIGSELCRQLARMGPAQ
FT                   LLLVERDETNLFEIERELSSDVARSDENATSSGAEPAGDALWVPILADICDAKAMNEVF
FT                   ARHRPEVVFHAAAYKHVPMMERFPHEAVRNNVFGTLRLAEMADQHGVDSFVMISTDKAV
FT                   RPSSVMGASKRLAEMVVQQLAARSRTSFSCVRFGNVLGSRGSVVSIFRAQIQQGGPVTV
FT                   THPDAVRYFMTVGEAAHLVIQAGTLGSRGEVYLLDMGEPVKILELARQMISLSGATEAS
FT                   IAIEIIGTRPGEKLFEELKTDSEELEQTPLRKVYRCSLGAIDEPALRATLERLTFLVRA
FT                   KDGDGVRDCLAALDIDYRRPPAAMV"
FT   gene            complement(131354..132241)
FT                   /locus_tag="Hoch_0083"
FT   CDS_pept        complement(131354..132241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0083"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcj:BCAL1692 iron-hydroxamate transporter
FT                   permease subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12724"
FT                   /db_xref="GOA:D0LGH8"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGH8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12724.1"
FT                   /translation="MTAPQQTSESPTIYRDNADALRAEAARLRRRHEQALAAVATRAAS
FT                   VYGARGARLGAGIVLLCAALALPITALSGGAEIHREGFPPLSSLLLAGWLAAIVVYLVA
FT                   RPLMALRYRSLARRPLAPSSDVHADLEAMRRFDPGRHATGLVTAIERLSSSAFLTGVSL
FT                   LTPFALHAIGALVIGTDLDSFQEWLMVSMIIVGHCHIVLAVMAWRHGGRLAKQPMNELV
FT                   QAPARAGWRVYRIVLMTSLIPGALLFCMPVALVAVTGLFVPLLFRWLTLRLADERDALA
FT                   VTRLDALAATTPQG"
FT   gene            132392..133102
FT                   /locus_tag="Hoch_0084"
FT   CDS_pept        132392..133102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0084"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; KEGG: scl:sce3432
FT                   1-acylglycerol-3-phosphate O- acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12725"
FT                   /db_xref="GOA:D0LGH9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGH9"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ACY12725.1"
FT                   /translation="MGLLLSLQTVLAAARVTVPSFAEAMAGRLQRDDADRRLRWFGDHV
FT                   VRLTRMQLEVEGRERVPVDQPYVYMSNHQSHYDIPVLYATVPTPTLRMVAKAELFRIPL
FT                   WRRPLTAAEFVEVERGNPEQALESLRRAEDSIRRGVSIWIAPEGTRSLSGALGPLKKGG
FT                   FHLAKETGVAIVPVAIDGTRAVLPSGALTTTPDCPVRVVFGAPIAVEGRSIAALMDEVG
FT                   AFLQTHLETPASPH"
FT   sig_peptide     132392..132460
FT                   /locus_tag="Hoch_0084"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.785) with cleavage site probability 0.668 at
FT                   residue 23"
FT   gene            133272..135794
FT                   /locus_tag="Hoch_0085"
FT   CDS_pept        133272..135794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0085"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; HI0933 family protein; KEGG: lch:Lcho_1553
FT                   4Fe-4S ferredoxin iron-sulfur binding domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12726"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGI0"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACY12726.1"
FT                   /translation="MAIVAIRNARKGAHPDRHHQKPQAQPENQQARILVHAINDDRCVG
FT                   CDACVAVCPTNVLDLISNKSRVLRFQDCIQCEQCMWACPTEALVMHLEGTEPPRIKMPD
FT                   INENFETAVEGQYLIGEVAGKPLVKNAANLGRAVVEHMLRKGGLQAGAHGGDVLDVAIV
FT                   GSGPAGLSAALTCIRNGLSYAVLEKEQMIASTVSRYPKGKWVMAEPYDVRNLSYLPVFD
FT                   SSKEQMVPIWQQVVDGAQINLKKAEPVEEVKKADDGLFDVRTTQGAYRAQRVVLAIGTR
FT                   GKPRTLGVPGENLPKVESLLEDPDDHRGKSVLVVGGGDSALEAAMALADAGSRVVLSYR
FT                   GRSFNRAQKKNQAAIESYDAQKRIKVLYESNVTQFTEDTVTIKLKDGQDKSYPNEAAFM
FT                   LIGAEPPVKWLQKVGVHVVDRPHSFSLGKTDEVLLSLCGEDGMVDCPEDAQAAVHLARE
FT                   GSLPAAVVEQQAEMAANKTMMFTGQPLTGPKGWLKSAKTMFTQALRIDQPMSLSEFANR
FT                   GGARAHSHNGRRDSLSASERTRVLRMLRDEGGRLADEDTKMLRVGDVRPDLVPPPAQPA
FT                   QQGFGQTVRGTGGKAPAQSATMFAHGAPAPKQPAPQPQPLGQQPAYQPQAQPPGQPAYQ
FT                   PQAPSPSAPQRPGLPAYQPEAQQPPVRSSHAAATMLARPEQQQAPQSRAAKPPVPVRSS
FT                   QAHAAYQPPQPAASGGGGAFDDEPTRQVDSEEALAAFLEAENHDDANATRTMDVGYHRA
FT                   LDARATKYGGFGSAAPRGDSDFPSDDVQEPTRAVDPFLRSSGEGDATGNLNQGAPTQAI
FT                   NLNQMGRMPSGGTSTNQHVKRRKDESKE"
FT   gene            complement(135901..136479)
FT                   /locus_tag="Hoch_0086"
FT   CDS_pept        complement(135901..136479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Nopp140; CG7421 gene product from transcript
FT                   CG7421-RB"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12727"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGI1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12727.1"
FT                   /translation="MKPRHVALTVLAIATLLALAVLFVKARAEPSIELPEDALAQARSA
FT                   FQRAQSRSESMRTPRATPTRATPPPPPSAPADTDDEEGDPDAPQPLRPSVSQVRKRSTG
FT                   RTAASDDPVREEREEIRSAYDTGDFATALALAEPLLQSHPDQAYIRRVAVVSACALGDT
FT                   PTVERHNAELSRPDKRIVRRRCERLGFSF"
FT   sig_peptide     complement(136393..136479)
FT                   /locus_tag="Hoch_0086"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.766 at
FT                   residue 29"
FT   gene            complement(136541..138643)
FT                   /locus_tag="Hoch_0087"
FT   CDS_pept        complement(136541..138643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0087"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: acp:A2cp1_0133
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12728"
FT                   /db_xref="GOA:D0LGI2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGI2"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY12728.1"
FT                   /translation="MSSPERTYLCRRCDASFTTPSRFCGRCGAAMDAPLDAAGDPSASP
FT                   ALQLAVTAADVDPLLAPQRRASDVQDRWLGRLVDDRYRVLESIGRGGMGAVYKIEHVRM
FT                   GKIAAMKVLRPEYSREPAVIERFRREAAAVSRLTHPNTVQVFDFGSAHGALYLVMEFVR
FT                   GPDLNALLKRDGPMPFGRVAPMLAQICAALDEAHAQGIVHRDLKPENVLVTRTHRGRDF
FT                   VKVLDFGLAKLGAGEERSDVTDRGAIIGTPYYMSPEQIRGEPVDARTDIYALGAMLYRM
FT                   LTGTYAFSAGTPVGVLTKHLTDPLEPASVRAPSCNIPPRVDAILARAMAKEREQRYPDV
FT                   GALLDEVGAAWVELTDVSAAHASSLDMPQEAFWQLRTMSGRIRALTRDDSDEIDYGIDS
FT                   AIRLRRSDLDSYERSLRRRRRVRVASLPLLLAIALGVGYYALWMRPQAPRRAEHEPNNE
FT                   MDAATVIAPERAVSGYLGKRLGKTEPDRDYYRLDLPETPQGPLVVSAHLSGLPNIDSKL
FT                   SLLDPTGKVLAQVDEFGVGGDEWLRRVRVQAAVFVLVTEAMDVPRLPVENVSDTYQLSV
FT                   SFAAESESRESEPNDNPSDAHPLRLGQPVTAYLDRRGDVDVYRFEGASGRYRLRFEGPE
FT                   ELPLTWRVGDQDTRSERELELELATGQVLHVGRADAAPVNADPAQIAARGLPGAALPYT
FT                   VSVLGE"
FT   gene            complement(138763..140271)
FT                   /locus_tag="Hoch_0088"
FT   CDS_pept        complement(138763..140271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0088"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: ank:AnaeK_3515 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12729"
FT                   /db_xref="GOA:D0LGI3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGI3"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ACY12729.1"
FT                   /translation="MSGFSEYTRYDGVGLGELVRAGEVQASELVEAAIAAIEAVDPQLN
FT                   AVVHRFFDRARQAAQAAAQAPLPKGPLAGVPVLAKDLLFLLEGLPMSAGSHAVHGFVAP
FT                   RDSTLARRYRDAGMLILGRTNTPELGLSPVTEPALFGPTANPWDLGRSPGGSSGGSAAA
FT                   VAARLVPIATGSDGGGSLRIPAAACGVFGFKPSRGRTPSGPERGDLWAGLAVEHVLTRS
FT                   VRDSAAVLDLTAAPEPGAPYAAPTQTRPYLDEVTTAPGRLRIAFTAQPLVGSRVDADAA
FT                   AAVESAARRLEELGHTVEEAAPDIDRAAFMRAYLSVVSVQIAAELDEVEAVVGRSVGHK
FT                   VEPTTRAMQLFGRHLSAPEYEACVRHLHRVTRDIAGFFGERDVLLTPTLPGAAGVTGAL
FT                   QPTRSEHALLRAVHTLRAGSLLKHLRLIDLLAPRVFDLVGFTALFNATGQPAMSMPLHW
FT                   NAAGLPVGVQFAARYGDEATLFRLAGQLEAACPWAQRRPPVCAS"
FT   gene            complement(140268..141443)
FT                   /locus_tag="Hoch_0089"
FT   CDS_pept        complement(140268..141443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0089"
FT                   /product="FMN-dependent alpha-hydroxy acid dehydrogenase"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; KEGG: scl:sce7671 (S)-2-hydroxy-acid
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12730"
FT                   /db_xref="GOA:D0LGI4"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGI4"
FT                   /inference="protein motif:PFAM:PF01070"
FT                   /protein_id="ACY12730.1"
FT                   /translation="MESLIESLPAEPIHVADFERLARARLAGSAWDYYASGANDELTLR
FT                   ENQAAFARLALHYRVLVDVSERSTRTQLQGHPLSMPVILAPSAFHRLAHRDGELATARA
FT                   AGEAGTVMVLSTLSTTRVEEVTAAATGPVWFQLYVYRDRAVTRALIERVEAAGCEALVL
FT                   TVDAPLLGRRDRDVRNRFQLPADLHLENLQPAGLEDLPRDVHDSGLAAYFATLLDPALS
FT                   WDDIEWLRSITRLPLYVKGIVRADDAARAMAAGVDGIWVSNHGGRQLDTSPATIDVLPD
FT                   IAEAVAVRGGSRQVAIILDGGVRRGTDVIKAVALGASAVALGRPVLWGLAYDGQAGLSK
FT                   LLGLLRDEIDLAMALCGCPSVGDLAAMAGELVRPMPSGGGPQLSALLRNDR"
FT   gene            141686..142213
FT                   /locus_tag="Hoch_0090"
FT   CDS_pept        141686..142213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0090"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12731"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGI5"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ACY12731.1"
FT                   /translation="MAKYDASTAECLVFTYKDGLLSRLGHDLKLRVTSFEVEADEAAPS
FT                   VSASFDASSLRVDCAVVDGEENPHLLTGVDQKKIAGQIAHDVLHAEKFPEVRFTSSKLS
FT                   KRDDGGYDITGTLTLHGVAKEISIRSQPEDGKQVVDFTLHQPDYDISPYRAVMGTLKIK
FT                   PEVRVRLALPVA"
FT   gene            complement(142325..144628)
FT                   /locus_tag="Hoch_0091"
FT   CDS_pept        complement(142325..144628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0091"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   mxa:MXAN_3713 M16 family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12732"
FT                   /db_xref="GOA:D0LGI6"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGI6"
FT                   /inference="protein motif:PFAM:PF00675"
FT                   /protein_id="ACY12732.1"
FT                   /translation="MRRIPPSAPARAAFALLLSVSLSALALSACGAPSGTVDLAGVTPR
FT                   LPGDGSANVSDPVASARPVASASEPSAEPDPWAGRDDLIEAPAPQPPAPLEMPAIQRFT
FT                   LPNGLPVVVVSKRDVPVVGVQLMVRAGNGAVPVDQSGLAQFVGAMLPKGTRTRNATAIA
FT                   EAIESVGGRLAVEPGYEATLLSCQVLAAEQNTCLSIIADIAAQPTFPEDELGRVRRELL
FT                   AGVRQRLDSASLLANAHFQNLLWGDEHPRGRPTSERSIEALSRADLVAWHKRWFVPQNA
FT                   VLVIAGDVDPKGLRFRLGRAFNTWRRTGKAPAQPSVPAPAPDSPRIRLVDKPGQTQTHI
FT                   RVGHMGIAHDAPDYFATLIFNHVLGSGGFSSRLMQVIRSQAGKTYGASSRFERSRQPGA
FT                   FVVRTFSRNAEALATVELLLAEVARMQQEGPREAEVASAIANLAGQYAISMQSAADIAG
FT                   ALLAAELYGFDQSYVRDYPMKLAEVNKESATQAAAAHLRPDRVAIVLVGDARALEPQLE
FT                   SRGLPYDKVNYLTPVAAADRETAQVSAESAAAGKALLAKALAAKGGAKRLAAVRTMHIE
FT                   ATGVIHSGGQKIDATLERRFLAPDKLRLDLNLTVPGGTAELLTVLNGKRAWTKQPSGVV
FT                   ELPPEGVAELHKQVWRDQEFLLLHASEPGVQVQAAGQSNRDGKTYELLRVIRDDGVSVD
FT                   ILLDPKTHLIAGLTYDEAPGRSVFEQLDDYRTVEGIQIAHQRRTKSVEADLEVRIDSVA
FT                   INEKLTSDVFEQPK"
FT   sig_peptide     complement(144533..144628)
FT                   /locus_tag="Hoch_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.491 at
FT                   residue 32"
FT   gene            complement(144664..146112)
FT                   /locus_tag="Hoch_0092"
FT   CDS_pept        complement(144664..146112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0092"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   azo:azo0765 Zn dependent peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12733"
FT                   /db_xref="GOA:D0LGI7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGI7"
FT                   /inference="protein motif:PFAM:PF00675"
FT                   /protein_id="ACY12733.1"
FT                   /translation="MTMPDSMTNGSGRARRRIPGPALPRRALLAAALALALTATALALP
FT                   AQAQPAARAGAQASAESQLALPALDTWQLDNGMQVAFLRIADAPVLSVQVWYHVGSKDE
FT                   PRDRRGLAHMFEHMMFKGTENLRSEEHARFIDSLGGYTNAVTSEDATRYINVIPKQYLD
FT                   FVCQLESERMRKLLFRDSMIRTEREVVKEEVRQQENNPLTVGLLRFLATAYTKHPYAWT
FT                   AGGTIADLDAASTADLKRFYDTYYVPNNAMLVVVGDASADAVKAAAERWFAPIPRGQEP
FT                   PRPADDATEPKQTSKRREVVAPGQVGVLLAGYHVPSASDDDSYPLQVASLVLGAGESSR
FT                   LTQRLVRGDELAVQAGALLLAREHPGMLWTFAIFLSPGAADDIESALAAEVARLASEGP
FT                   SADELRKAKHQLQAGLAFSLENVAGLAEQIGMSWILSGDPGRWRNDLARYRAVTADEVK
FT                   RAAAAYLVDSNLTVVVVPPAGAPQ"
FT   sig_peptide     complement(145966..146112)
FT                   /locus_tag="Hoch_0092"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 49"
FT   gene            complement(146452..146643)
FT                   /locus_tag="Hoch_0093"
FT   CDS_pept        complement(146452..146643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afw:Anae109_1379 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12734"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGI8"
FT                   /inference="similar to AA sequence:KEGG:Anae109_1379"
FT                   /protein_id="ACY12734.1"
FT                   /translation="MKLTGVRVFSATKAKEREGLGDEVTRWIRDNPGAEIIDKIVTQSS
FT                   DSEFHCLTITIFYNQGSK"
FT   gene            146909..147130
FT                   /locus_tag="Hoch_0094"
FT   CDS_pept        146909..147130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0094"
FT                   /product="ribosomal protein S21"
FT                   /note="TIGRFAM: ribosomal protein S21; PFAM: ribosomal
FT                   protein S21; KEGG: pca:Pcar_2255 30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12735"
FT                   /db_xref="GOA:D0LGI9"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGI9"
FT                   /inference="protein motif:TFAM:TIGR00030"
FT                   /protein_id="ACY12735.1"
FT                   /translation="MEPLFGKPVEVEVRDGALEKAMKILKQKMSKEGILQELKRRRFYE
FT                   KPSVKRKRKAREARKRLRREMKRRVGSR"
FT   gene            complement(147216..148097)
FT                   /locus_tag="Hoch_0095"
FT   CDS_pept        complement(147216..148097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0095"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   cvi:CV_0663 ParA family chromosome partitioning ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12736"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGJ0"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ACY12736.1"
FT                   /translation="MSTAARPRTIVIANQKGGVGKTTTAVNLAAGLALQGFRTLLVDLD
FT                   IQASATVSLLGREALDGERQNVADCLEREQPLDEVLCETDTPGLLVAPSGESMATADLV
FT                   LANAMARERVLARCLAGTRPGEIDVVIIDTAPYLGLLTLNALVAADHVLVPVTCEYLPI
FT                   LGLKLFNEMLTKIRARVGARAQLLGYVLTMYDLRESITREIEAMLRKSFGEAVFEHPIR
FT                   VSTRHKASASHRQTIFQYDRKGSRGRVDYERLTTAVIERAALERISGDNAAGDAESDVD
FT                   ADTARAASASIV"
FT   gene            148233..149144
FT                   /locus_tag="Hoch_0096"
FT   CDS_pept        148233..149144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0096"
FT                   /product="ribosomal L11 methyltransferase"
FT                   /note="PFAM: ribosomal L11 methyltransferase;
FT                   methyltransferase small; KEGG: gem:GM21_0225 ribosomal
FT                   protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12737"
FT                   /db_xref="GOA:D0LGJ1"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGJ1"
FT                   /inference="protein motif:PFAM:PF06325"
FT                   /protein_id="ACY12737.1"
FT                   /translation="MSEWVEIIIPVNASSADEVASLVADIVPEALRGTQVRGSEVVIWV
FT                   AAKRRDEILGTIGQALSNMAECGLEVDAAGVRAREAAPEAEWRDLWKEFFHTTYLTEHV
FT                   VVVPSWEKHEAKPGEIVIHLDPGQAFGTGAHASTRLVLGELEALRARGVEVQRCFDVGC
FT                   GSGILFIAAAGMWPACSGVAVDIDPLAADATLENCERNGLSERVAVSTTPTEEVDGVFD
FT                   LVLANIQADVLRSLAAPLTARVAPGGHLVLSGLLSHQAEAVGRDLAAAGGLELLHTRPD
FT                   DSDPEWSSVLLARPGAAASAAE"
FT   gene            149147..149899
FT                   /locus_tag="Hoch_0097"
FT   CDS_pept        149147..149899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0097"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   gur:Gura_4289 16S ribosomal RNA methyltransferase RsmE"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12738"
FT                   /db_xref="GOA:D0LGJ2"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGJ2"
FT                   /inference="protein motif:PFAM:PF04452"
FT                   /protein_id="ACY12738.1"
FT                   /translation="MSSRLFVEPASLRAGAVEVCGDDHRYLFRVRRLRVGDAVTLFDGA
FT                   GREADARVAAIDGERAQLEVAEPRAVVAPSPCRVSVLPALIKGDRMDFCVQKLVELGVH
FT                   EIAPVTSARTVVKLDGARAARRRERFVDIARAAARQCERATVPEIAAIAPLEQALASRA
FT                   QTPLKLILWARERSRMLRDIVAQPLPAGVCVAVGPEGGFAPEEIEAAVAAGFEPVGLGG
FT                   HVLRAETASLAAAALLMLAAPLPAAAAI"
FT   gene            149932..150546
FT                   /locus_tag="Hoch_0098"
FT   CDS_pept        149932..150546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0098"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; KEGG:
FT                   mxa:MXAN_1131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12739"
FT                   /db_xref="GOA:D0LGJ3"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGJ3"
FT                   /inference="protein motif:PFAM:PF06271"
FT                   /protein_id="ACY12739.1"
FT                   /translation="MSQREPSDERGHKDGDAAPGTAEETPKNTEASRPAAASRKRAPTQ
FT                   GGRAAAPRFHAGGLWRRLGAAMVDLAVIVPVALILAWFAGQLTGVHLPDSRNYGVDFWL
FT                   DLMLGNDPALLGFFGLLLATALIYVAIFQVTWAATPGMRVLGLGIIDLYGDAPSVTRVV
FT                   ARTAGYLAATATLGLGFLWIGFDRERRGLHDWISGTHVVKV"
FT   gene            150550..152856
FT                   /locus_tag="Hoch_0099"
FT   CDS_pept        150550..152856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0099"
FT                   /product="General secretory system II protein E domain
FT                   protein"
FT                   /note="PFAM: General secretory system II protein E domain
FT                   protein; PBS lyase HEAT domain protein repeat-containing
FT                   protein; KEGG: ank:AnaeK_0259 general secretory system II
FT                   protein E domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12740"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGJ4"
FT                   /inference="protein motif:PFAM:PF05157"
FT                   /protein_id="ACY12740.1"
FT                   /translation="MPSRLSSLLVSDGVVSVKRMEHAFQRQVIYGGSLDTILLEMNLVS
FT                   EARLVQYLSKATSLPPATPQETAGTDTAAAERCLAAVADRYRVVPLCFSDSALRLLVHD
FT                   PVEMAGLEELANELGVAVQPLVVPEYRFHLTHVRVFGGTPDARYETLARRADESRPLQP
FT                   VGKARSVIVDAGGGGGGDTERTAAAPTTIEAAAEVFELPAPKRREKRTMEMASAALARR
FT                   SELDLGNASPVAPTREQRLGHLDTAPVAATDSGRESPANARARAAGPDTEALSAEQAIA
FT                   ALPEAEDRDIIFNLLLRAVRHWSEYAALFTVQGQSAIGRIAIDGDRVDRMAIARAVLPL
FT                   DMASPFRTVAQSLTPYAGPLRIELPGMNSMLADLGIAPTTTVVLVPVILRGRVVAIALG
FT                   HGGAEPVSDEASGALMPVTVAAADAISRLIVKAKSQRQTAVTAVAPPPGQEPAAAPAPD
FT                   AEADTDRYEGPRRRPERSTQVMAHPPIDSVLSAVQSENPEEADYGRASALARPDETLSA
FT                   LAARFPGTLWVERFELEGQPLPPAEHGPLLALTIELGPLATELLIEKLADPDRETRYYA
FT                   ALCLAETRPREALEPFVEHLFDSDYGIRSLVIDALSDYPAAQLEKALARVRQALHSDQG
FT                   GRVQAAGNALAKLGDTHAVPVLIDVMAEGGSGAEHARRTLISLTRQDFASSVRKWRSWW
FT                   NKHQEQHMIEWLIEALGHKDENLRGAAAEDLRQRTGEYFGFHHDLSKREREQAQQRWRE
FT                   WWRQTGSMKFAGPRA"
FT   gene            complement(152984..155392)
FT                   /locus_tag="Hoch_0100"
FT   CDS_pept        complement(152984..155392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0100"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; glycoside
FT                   hydrolase family 13 domain protein; SMART: alpha amylase
FT                   catalytic sub domain; KEGG: nmu:Nmul_A1401 glycogen
FT                   debranching protein GlgX"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12741"
FT                   /db_xref="GOA:D0LGJ5"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGJ5"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACY12741.1"
FT                   /translation="MLTRRTTFPGLCKTLSAVLVAGLAGSGCVAEDLDQLDYDPITEEQ
FT                   EQEQEPEQGLDKAGPSSLGLGAHYSAAGDKVDFRVFSSRATRIEVHVYSEAFGEDAVAA
FT                   YLMTKNSSTKVWSASVSTSELASLGISGHVYYGYRAWGPNWPYTSSWSEGSSAGFITDV
FT                   DSQGNRFNPNKLLTDPYALELSHDPATPLNPDETIYASGPSYRHIDSGPEGSKSVAFPE
FT                   DNTSVGTRPTRAFKDDIVYEVNVRGLTKQDSSIPAAYRGTYKGAGLKAAALKNLGITAV
FT                   EFLPVHETLNDVNDVTPNSTAGDNYWGYMTINFFAPDRRYAYDQSPGGPTREFKQMVKA
FT                   FHDQGIKVMIDVVYNHTAEGGPFAADNPETAKLFNYRGLDNPTYYSLTADRKFNYDNTG
FT                   VGGNFNTFNPVAQDLIIDSLRYWYEEMGVDGYRFDLASVLGNTCEHECFNYSKTNPGTA
FT                   LNGIWNELNPRPAAGGAGVDLVAEPWAIGGNSYQVGNFPSGWIEWGASFRDSLRKDQNE
FT                   LGVESVTPGELATRFAGSSDKFGDDGRKPWNSVNFMVAHDGMSLRDLYACNSKNNNQPW
FT                   PYGPSDGGEDHNRSWDQGGNAAQQRRAARNGMAFMMLSAGVPMITGGDEFLRTQFCNNN
FT                   VYNLDSEKNWLNYNLDTNAQNFRTFTQRLMAFRKAHPALRPQNFYSGADGNGNVMEQLR
FT                   WFQPNGAQASGAYMDNAQNHAIAWRLDGTELGDSAKAIYVAYNGWQSAVDFKLPWTGQQ
FT                   ASNWYRVLDTCDWAEGPNQVRQPGSYDFIGGENTNYQVCGRGLIVLVAQ"
FT   sig_peptide     complement(155300..155392)
FT                   /locus_tag="Hoch_0100"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.978 at
FT                   residue 31"
FT   gene            155933..156508
FT                   /locus_tag="Hoch_0101"
FT   CDS_pept        155933..156508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_3164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12742"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGJ6"
FT                   /inference="similar to AA sequence:KEGG:MXAN_3164"
FT                   /protein_id="ACY12742.1"
FT                   /translation="MNLRYLTIALSFLFLSAPLAAQAQSREARQDRKEARQDRKEQRDD
FT                   RRDLVEFENLLRDFDAARSRRDMGAMRDVDARLRRAMRAQAKESRREVRRDNREVKRSR
FT                   REARRDGTRDDRRDLRDDRRDARKIKTVQQRYEDVRRALEPLYDRYDGRSLSKKRTLVV
FT                   ELVDLARTELRLNRQERKEDRRERRERN"
FT   sig_peptide     155933..156004
FT                   /locus_tag="Hoch_0101"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.908 at
FT                   residue 24"
FT   gene            156696..160565
FT                   /locus_tag="Hoch_0102"
FT   CDS_pept        156696..160565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0102"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: scl:sce5133 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12743"
FT                   /db_xref="GOA:D0LGJ7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGJ7"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY12743.1"
FT                   /translation="MDPGVVIAERYRVERLAHEGGMGVVYLGRDLQSDERVGIKLLRTA
FT                   DDPISTARFWREAYALSSLRHAGIVRYFTHGMTPTSSPYLIMEWLEGEDLACRVRRGPL
FT                   DVVDTLRLGIRVCEAMAAAHRHGIVHRDIKPANLFLPGGRIDDVTVVDFGLARVGQTLR
FT                   DATPGGELMGTPGFMAPEQVRSDPNLDHRADLYSIGASLFACLAQRPPFVGDHPMATLA
FT                   KVLFDDAPRVSTLRPAVPPRLDEFVARLTAKEPDERPPDAAAAASELLDILEHLGAEAP
FT                   SRQQVAAAITAGEQRFLTVLLVQSDTAGQARREALDRAAATYGAQLEELADGTIAGIFS
FT                   EHGRPVEMAERAARGALSMQSELGGGSLVLATGRGIVDGRLPVGQVIDRAVAMFLGDAD
FT                   TLPPGGEMEEAGAGNGIIIDDVTAGLLDRSFAVKPVGSRRYLLTGREEADEIAPRLVGI
FT                   PTPCVGRQRELAALEGLLDECLEEERARVALVTAPAGGGKSRIRTEFLQRMDTRYRDVA
FT                   VWLGRGDWLRSGASCGLLAEVLRDAVNLTEGQPLAERRARITARVGGIVAEEDVDRVSV
FT                   FLGELVNATFDDTGRVQLAAARQDHQVMHDQMRRAFLDWLDAELQRMPVLIVLDDLHWG
FT                   DLPTIRFLDAALRRLKDRPLMILGLAQPHVHKLFPDIFATRDLEEIRLRPLSQRACRTL
FT                   VQHVLDVPEQVVKQIVARSEGNAFFLEELIRSVADGGDALPQTVLALAESRLSALPAPA
FT                   RRVLRAASIFGRTFWRGGVAALLGDAMSADELVDLFDMLVEREFIAERVGARFTDEREY
FT                   RFGSELTREVAYGTLTEDDLAHGHVRAGSWLEEAGESEAVVLAEHYRRGGATAHAVEWY
FT                   RRAAADALEAKDTDAVMQRIQQAIACGASGRALGELRLLQAEVHNWQSEAALAQQCGLD
FT                   AMELLPRGSDTWAEAVEQASWAAATLGNFDEVERFIELLILHLGDAPSERYLVAMAHIA
FT                   THLAVSGRYEQARTVESLIVELPPASGRDNLQVTAAVKHMQGFLTYFNDELDRACDLLA
FT                   ETAEIWLTLGSSHNWLMNLGNAGSAQMELGEYEQAAATLATVIEGSTRLGFDNLSGVMS
FT                   VNRANRALALAHCGQFEEAKLLCREAFTASGLARHELVALVYLARILERASDYAQSLAH
FT                   AERALELSNPFPVYRAQALGIQSRLLLKLGRADDALVAAREGMRLLAELGNIESGEGIL
FT                   RLAHAEALYATGIIEEAKAAVYEAANRLRARAEHIADPERRHSFLANVPEHAETLALER
FT                   AWAAH"
FT   gene            complement(160621..161481)
FT                   /locus_tag="Hoch_0103"
FT   CDS_pept        complement(160621..161481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce7113 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12744"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGJ8"
FT                   /inference="similar to AA sequence:KEGG:sce7113"
FT                   /protein_id="ACY12744.1"
FT                   /translation="MFLMVGMTACLVTEDATFETDTAENAALSINALSINALSINALSI
FT                   NALSINALSINRLDADTLAFNTLQNPEITATEEGRMVLRYIARCALKDGDVLRVEHSDQ
FT                   IWEYPGVLGVAAGWETEALDIDGQERVSACLLAHVNAFGIEVPISLRGPGLAEADVLES
FT                   ERFYYGDGAFYGNLNAEHPTKFSCEIRGNRYLGGDGNVHTPSSPDADLRVCGAADTAED
FT                   CGFEFTGYCDEICNEIERDGDQWRFSACLGADGERYDNVFTVWLRGSGAESCEQAPAGY
FT                   SCSPL"
FT   gene            complement(162582..163574)
FT                   /locus_tag="Hoch_0104"
FT   CDS_pept        complement(162582..163574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12745"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGJ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12745.1"
FT                   /translation="MHGLFDREESLLIDRALAAVERKAPSDAALLRHQIDQLATLVAVL
FT                   SAERRLDRPTQLAGEQRDRQTLLDHLCHLDGLSGDLVLPLKAILSRTFLLSKIMFLRGF
FT                   VKATSALAEEGAEYPLLSHQLREEMAQSIYTQLAEELLMALLRKPDVHQRIKRRAAGQL
FT                   VAVWDNAQIEIDDFCPLLESAWHARNRITSGYGCLLGTTEYFRLVCEDCPPQFLNFFAR
FT                   DEMSLAEGQAFEEFLFNMTFEELSTLREGMREQSLDVVSPEWASQILGRQIDALDDSGE
FT                   IDPMALYRSYYRRQLAADYRIIAGSKGPRRTAEAYLMIFLLDQQADPLS"
FT   gene            complement(163676..165043)
FT                   /locus_tag="Hoch_0105"
FT   CDS_pept        complement(163676..165043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0105"
FT                   /product="PEGA domain protein"
FT                   /note="PFAM: PEGA domain protein; KEGG: bba:Bd3374
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12746"
FT                   /db_xref="GOA:D0LGK0"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGK0"
FT                   /inference="protein motif:PFAM:PF08308"
FT                   /protein_id="ACY12746.1"
FT                   /translation="MPSETYDQMLRYRLAVVTSDKRLQREIKRVTAATNARASFASSAD
FT                   VLDPSEETNLVVFDARDEAPAANHLAGLPRDLALAYIVDGDSLFERVSLLGDRRVESIL
FT                   AREERLDDSEFIVSATKSLGHDLFGLHKYFPWGVTVFSMTVKSYAEKSDGLDVIMAYAE
FT                   ASGMRGPVRDRIQLVSDELMMNALYHAPTDEQGKERYRDKTRKELAQLSEVSAVQVQYG
FT                   CSGRYFGISVRDNFGSLTREKIVDYLTRIRQGVGAQIESKTTGAGLGIVSVAQSVSKLV
FT                   FNIVPGVSCEVIALFEVDLISRGKVGARSVHVFVDPAGDLVSRSGIRPPAPAGDDDATE
FT                   HAFATEPAAPSGLPLPWLVVGLLASVLSALAIAYLFTRDAAPAERPHISVIAQPADATI
FT                   EINGSPIDGSGAFDLPEADSYVITVEKDGFAPWNQTFSADELRGELRMFVTLPPNE"
FT   gene            complement(165240..166316)
FT                   /locus_tag="Hoch_0106"
FT   CDS_pept        complement(165240..166316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0106"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG:
FT                   bmn:BMA10247_2927 histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12747"
FT                   /db_xref="GOA:D0LGK1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGK1"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ACY12747.1"
FT                   /translation="MSLPIRPHIRAMRGYVPGEQPAAGSRLIKLNTNENPYPPSPRVAE
FT                   AIRAELAATEVAGERLRLYSDPNGSALLDAAAEVTGFPRDGILAGNGSDELLAVLARAI
FT                   LGPGDAVAYPYPTYLLYETMARIQDARTTTFDFPADFSLPETLFGCDARMVFVANPNSP
FT                   SGTQQSNQELTRLASSLPDSLLVIDEAYAGFADANALALAQELPNVVVLRTLSKSHSLA
FT                   GMRVGLLFGSAEIVGELRKVRDSYSLDRLAIVAGAASLRDTAWVDDTTARILRTRERLV
FT                   EALRALGVETLPSRANFVFARMGSAARASAAQQFLRERHILVRYFAMRLLDDGLRITVG
FT                   TDDETDALLRALEEFVQS"
FT   gene            166410..167324
FT                   /locus_tag="Hoch_0107"
FT   CDS_pept        166410..167324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0107"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   pseudouridine synthase; RNA-binding S4 domain protein;
FT                   KEGG: scl:sce0011 ribosomal large subunit pseudouridine
FT                   synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12748"
FT                   /db_xref="GOA:D0LGK2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGK2"
FT                   /inference="protein motif:TFAM:TIGR00005"
FT                   /protein_id="ACY12748.1"
FT                   /translation="MADADAGKALAGFVRERLSLPWSRARQLVGTGKVFIDGSRCTDAG
FT                   QRLRAGQEVGLHMSAPRPQTRGARVRIAYEDAHVVVIDKPVDVSSVPYERRETGTAMDL
FT                   LREAWRKLRPDAGRTPLHVVHRIDKATSGLLAFAKTKRAELGLAAQFRQHTLERAYLCV
FT                   AHGAVRAQRIESRLVRDRGDGLRGSTRAPNQGKRAVTHVEVLEELARASLCQVRLETGK
FT                   THQIRIHLAERGHPLVGERVYKRDAEFRGHTLIDAPRLMLHAATLGFAHPITGERVFVE
FT                   SPLPENFAAVLARLRAESGQRGG"
FT   gene            complement(167347..167919)
FT                   /locus_tag="Hoch_0108"
FT   CDS_pept        complement(167347..167919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0108"
FT                   /product="Inorganic pyrophosphatase"
FT                   /note="PFAM: Inorganic pyrophosphatase; KEGG:
FT                   ank:AnaeK_4224 inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12749"
FT                   /db_xref="GOA:D0LGK3"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGK3"
FT                   /inference="protein motif:PFAM:PF00719"
FT                   /protein_id="ACY12749.1"
FT                   /translation="MNLLHDLQHRDKHGHVRVVVEVPRGSSVKLKYDEHTRTFVWSRTL
FT                   TLGVVYPYDFGFLPQTLAGDGDALDALVFAEASSYPGVVVPGRPLGALRVEQQRPGQAV
FT                   RRNDRILVAPLYAHRQDALEDIDRVAERVRDEIQAFFAASLALTGKTVRFCGWADAAEA
FT                   EKIVDEAHARYSQRRQRRQANRRRPRN"
FT   gene            168326..169687
FT                   /locus_tag="Hoch_0109"
FT   CDS_pept        168326..169687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0109"
FT                   /product="Glutamate dehydrogenase (NADP(+))"
FT                   /EC_number="1.4.1.4"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   pag:PLES_49711 glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12750"
FT                   /db_xref="GOA:D0LGK4"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGK4"
FT                   /inference="protein motif:PRIAM:1.4.1.4"
FT                   /protein_id="ACY12750.1"
FT                   /translation="MTTLEKETSRAVDTFMDDLVRQNPNQPEFHQAVREVVETLMPFVL
FT                   ERPEYQKAKILARITEPDRVISWRVAWEDDRGDVHVNRAWRVQFNNAIGPYKGGLRFHP
FT                   SVTESVLKFLGFEQIFKNSLTGLPMGGGKGGSNFDPKGKSNSEVMRFCQSMMTELQRHI
FT                   DSDVDVPAGDIGVGAREIGFLFGQYKRIQARFTGVLTGKGLSYGGSLVRKEATGYGCVY
FT                   FIDEMLKTRGDSVSAKTCSISGSGNVALYAAEKVIQLGGKVVSMSDSAGTIHDPAGIDV
FT                   EKLAWVKELKEIRRGRIREYADTFSGSTYHENKRPWHIPCQIALPCATQNELDVDDAAA
FT                   LIGNGVIAVGEGANMPSTLDAAKRFVDKGVLFAPAKAANAGGVAVSGLEQSQNAMRLSW
FT                   SPEEVDTKLKGIMHDIHQKCLEYGQDESSVNYIKGANIAGFVKVADAMLAYGIY"
FT   gene            complement(169681..170526)
FT                   /locus_tag="Hoch_0110"
FT   CDS_pept        complement(169681..170526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0110"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /note="PFAM: dTDP-4-dehydrorhamnose reductase; NAD-
FT                   dependent epimerase/dehydratase; KEGG: sfu:Sfum_1538
FT                   dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12751"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGK5"
FT                   /inference="protein motif:PFAM:PF04321"
FT                   /protein_id="ACY12751.1"
FT                   /translation="MLFGASSIVGWSFVRALPEVQAFCNRHTRLPAGRPWGRVNLQDRD
FT                   RVAALFAREQPDMVLHCAGVCDVAKCEESPDFAHLVNVLSMDILLDHLPAHTRVIYLSS
FT                   DHVFSGDSGPYTESTPPDPLSVYGRTRVQAERILLDRRPDSLIIRGGLWIGPSYNGRLG
FT                   HLDWLRYRHARGLPMTVITDEHRSAVWADDAVARVMALAEAGVSGTRHLSATRVVTRPL
FT                   LATYLNRRFAIGARFTTRSRAQLARPHLGRMDLRTEFEGPLAAPLASVIPDGAPELLAQ
FT                   "
FT   gene            170592..171281
FT                   /locus_tag="Hoch_0111"
FT   CDS_pept        170592..171281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12752"
FT                   /db_xref="GOA:D0LGK6"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGK6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12752.1"
FT                   /translation="MSGDKRPRGRCVAGTVCRGCGVRWLHERLVRCGARHSGQSAASAM
FT                   LSSAGGGQQLARATDLARRRPCPNRRMGELLANSWRGRGFGSVLAGAAERAGDALGGGR
FT                   GVGWALACGRASERSVVRVEELPGRPRKSLGHLGRGAPEQKYIPSSRPAMRPGILCWSK
FT                   LGCFLGIMISVVYLFSRKKAGKGFHPAAAVVEVSSLPDERPDGAASKAKRHENFFETFL
FT                   DTRNRNR"
FT   gene            171442..172985
FT                   /locus_tag="Hoch_R0002"
FT   rRNA            171442..172985
FT                   /locus_tag="Hoch_R0002"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            173102..173177
FT                   /locus_tag="Hoch_R0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            173102..173177
FT                   /locus_tag="Hoch_R0003"
FT                   /product="tRNA-Ala"
FT   gene            173404..176410
FT                   /locus_tag="Hoch_R0004"
FT   rRNA            173404..176410
FT                   /locus_tag="Hoch_R0004"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            176556..176672
FT                   /locus_tag="Hoch_R0005"
FT   rRNA            176556..176672
FT                   /locus_tag="Hoch_R0005"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            176916..177017
FT                   /locus_tag="Hoch_0112"
FT   CDS_pept        176916..177017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12753"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGK7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12753.1"
FT                   /translation="MSGAGYRELTTPNANERHGAGVTKHRPEHGFDS"
FT   gene            complement(177749..179047)
FT                   /locus_tag="Hoch_0113"
FT   CDS_pept        complement(177749..179047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0113"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="KEGG: hypothetical protein ; K01866 tyrosyl-tRNA
FT                   synthetase; TIGRFAM: tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib; RNA- binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12754"
FT                   /db_xref="GOA:D0LGK8"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGK8"
FT                   /inference="protein motif:TFAM:TIGR00234"
FT                   /protein_id="ACY12754.1"
FT                   /translation="MSSKMTIIDELETRHLLQDVSHREELGELLQGEAISVYAGYDPTA
FT                   TSLHVGNLIPTIILARLQRIGCRPIALVGGATGMIGDPTGKSDERNLLDEDTLQANVAA
FT                   IRAQLGRFFDFDDSATGAKLVNNLDWFRDIGFIPFLRDIGKLLTVNYMTAKDSVRSRLE
FT                   DRATGISYTEFSYMLLQAYDFVHLAKEHGCRLQVGGSDQWGNITAGIELQRKLGRESVY
FT                   GLTGPLLLDSSGEKMGKTASGMRIWLDPERTSPYAFYQYWLNTPDDDVARLLRVFSWRS
FT                   LDEIDELVRAHGEAPQKRLGQSALAEDLTDWVHGEEAKRNALAASQVMFGGSLENLNDA
FT                   ALQPLTADLPTTSLPRQQLESGIPLLELLAQTKLAASKGAARRLVQGGGVYVNNIRVAD
FT                   VNKTLLPEDLGTETIMILRAGKKNYHLVQFPNA"
FT   gene            complement(179070..180632)
FT                   /locus_tag="Hoch_0114"
FT   CDS_pept        complement(179070..180632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0114"
FT                   /product="metal dependent phosphohydrolase"
FT                   /EC_number="3.1.4.16"
FT                   /note="KEGG: glo:Glov_3500 phosphodiesterase; TIGRFAM:
FT                   YmdA/YtgF protein; metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; K Homology,
FT                   type 1, subgroup; Metal-dependent hydrolase HDOD; SMART:
FT                   metal-dependent phosphohydrolase HD region; KH domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12755"
FT                   /db_xref="GOA:D0LGK9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGK9"
FT                   /inference="protein motif:TFAM:TIGR03319"
FT                   /protein_id="ACY12755.1"
FT                   /translation="MQFLYVILAILGGITVGVGIARLAGIGRNAAAERAAEAEARRIIT
FT                   AAEAEVEEIKKAAEVEGKELAFRLKADVEEGTRKRRAELVQQEEALLAREREMERKQKD
FT                   ARRLEGELEKRERSIDGRAKAAEAMARKAEASQDKAKAMLEEIAALTAEQARERLEDQI
FT                   REQAREAAAAEVKLIEENAAKEADSRAKEIVATAIQRYASELVQERTVSVIPLPSDDMK
FT                   GRLIGREGRNIRALEAATGIDMIIDDTSEVITISCFNPVRREIARLAISKLVADGRIHP
FT                   TRIEEVVKKAEAEIERTCKEAGEQAVFDLGLHRVSPELIVQLGRLKYRASYAQNLLMHS
FT                   VEVGFLAGLMAAEVGLNVKQARRAGLLHDIGKSVDHELEGSHAQVGAQMARKFGESAKI
FT                   CQAIAAHHGDPEPSSVLDHIVDAANRLSSARPGARRELLASYVQRLEKLEHICNGFGGV
FT                   TKSFALQAGREVRVMVENDKVDDAQALMLSKDIARKIETEATYPGQIRVVVVRETRASD
FT                   YAR"
FT   gene            complement(180690..181370)
FT                   /locus_tag="Hoch_0115"
FT   CDS_pept        complement(180690..181370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0115"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="TIGRFAM: 5-formyltetrahydrofolate cyclo-ligase;
FT                   PFAM: 5-formyltetrahydrofolate cyclo-ligase; KEGG:
FT                   afw:Anae109_1096 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12756"
FT                   /db_xref="GOA:D0LGL0"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGL0"
FT                   /inference="protein motif:TFAM:TIGR02727"
FT                   /protein_id="ACY12756.1"
FT                   /translation="MTTSLSRPGEEQPSAKQALRDRVCRLRRAISREAGLCAARAAAEL
FT                   VLSLPELESARAVGLYAALPGELSTDELAEALRQRGVVVAYPRIVPGTRALCFHRVADP
FT                   AAMIAGPFGITQPAADAPEIAVVELDLLVVPGLAFDLHGGRLGWGKGFYDTTLATPGGP
FT                   LRVGFAHACQIVEAVPCMAHDVPMDIVVSDTGILRVREPNSPPAPSSSQPQRGARDRRE
FT                   EPPA"
FT   gene            complement(181459..181737)
FT                   /locus_tag="Hoch_0116"
FT   CDS_pept        complement(181459..181737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0116"
FT                   /product="protein of unknown function DUF710"
FT                   /note="PFAM: protein of unknown function DUF710; KEGG:
FT                   ppd:Ppro_3315 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12757"
FT                   /db_xref="GOA:D0LGL1"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGL1"
FT                   /inference="protein motif:PFAM:PF05164"
FT                   /protein_id="ACY12757.1"
FT                   /translation="MKVTVAGQTLALRTDAKEAYLNELAALVTERIDEVRSSGRTATTQ
FT                   SYALLAALNIADELLRLRDHHETLKHQVRTRLERILRHLDREAEFLA"
FT   gene            181960..182032
FT                   /locus_tag="Hoch_R0006"
FT                   /note="tRNA-Lys1"
FT   tRNA            181960..182032
FT                   /locus_tag="Hoch_R0006"
FT                   /product="tRNA-Lys"
FT   gene            182079..182152
FT                   /locus_tag="Hoch_R0007"
FT                   /note="tRNA-Glu1"
FT   tRNA            182079..182152
FT                   /locus_tag="Hoch_R0007"
FT                   /product="tRNA-Glu"
FT   gene            complement(182237..183115)
FT                   /locus_tag="Hoch_0117"
FT   CDS_pept        complement(182237..183115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0117"
FT                   /product="SpoIID/LytB domain protein"
FT                   /note="TIGRFAM: SpoIID/LytB domain protein; PFAM: Stage II
FT                   sporulation D domain protein; KEGG: gbm:Gbem_2437
FT                   SpoIID/LytB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12758"
FT                   /db_xref="GOA:D0LGL2"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGL2"
FT                   /inference="protein motif:TFAM:TIGR02669"
FT                   /protein_id="ACY12758.1"
FT                   /translation="MRAFRVGCCAAAFAIAFALAACSDEDPVEIERDGLDEAYCQALVT
FT                   GYPLVDVESEYLPRVVQCENGNAGFEALKAQAVAARAYLYYKLDQAGEIADGPQDQVYG
FT                   CGRAPSPRVHAAVRATSGEILTYRGFQVAGFYVAGAKLRPPSCTTDDKLPSRLAVEDPF
FT                   GTEHYVTYNEGRSGEDIEQTTLGLVNPANRSNRGAKSQNGAACLAAKGWNYEEILRFYY
FT                   GADIELVQTSGPCVVPAAERSVRPGSRGSAWIGAAAMVLALVIGWMLIATALRTRSPGG
FT                   RSRRRGRARRR"
FT   sig_peptide     complement(183044..183115)
FT                   /locus_tag="Hoch_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.876 at
FT                   residue 24"
FT   gene            complement(183172..185247)
FT                   /locus_tag="Hoch_0118"
FT   CDS_pept        complement(183172..185247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0118"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_1623 ASPIC/UnbV domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12759"
FT                   /db_xref="InterPro:IPR011519"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGL3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12759.1"
FT                   /translation="MKRTLPGGLAIVSSFFLFTSYASADDQIYFVDVTDQPNMGLSSYQ
FT                   RTGTPAHVAAAEELHQRSLIEPATPADIAAGPMMPRGLAGVAIFDYDNDGDFDIYATNG
FT                   AGSSNSLFRNRLAQTGELGYDDVAAQAGVAATAQDSFGTCFGDIDNDGDHDLMVLGRAE
FT                   ANRLFENQGDGSFVELPGAGVGGGARSSTSCSMGDIDNDGRLDIVVANAFDMRHSFAIF
FT                   AVPYALNEHNQLLRNLGGNTFEDVSESSGITLNLGYPEAAAGITWTAAMADLNRDGATD
FT                   IVFMDDQGGILAERVGGEDRAYIHVFLNDGAGHFADQPLILNEYSASEWMGVTFGDLDC
FT                   DGDVDMFATSFGDYENPIFGLPYLRGGSTSRPYYNNGDGSFTDGVFQFGVAATPFGWGA
FT                   AIFDYDNDGDNDILYHGGLDAANMIVLASNPGVVLENQGCSGVFEPDTTAITTDHLRRN
FT                   VRGVAVGDIDRNGFVDVVTAANFRVPDEVELEPLPVQYGDAYDGTALYVAVMELINGDF
FT                   SNPLRVWTGFENQLGNLKLELNGGNGNHWLRVRALGSAGVLPAGEVNRDGIGAQLSFTP
FT                   QGGQRSTQIVVGGSSHSSQHALEKVFGLARAKKGTLEVLWPGGTRNRLYGVRAGDDVLL
FT                   PELPCSFDADWAHFSDYKRCVSQALNGLVDAGVLSRGDRGQFQSSALRAYHEHRGQ"
FT   sig_peptide     complement(185173..185247)
FT                   /locus_tag="Hoch_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 25"
FT   gene            complement(185650..186078)
FT                   /locus_tag="Hoch_0119"
FT   CDS_pept        complement(185650..186078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0119"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163; KEGG:
FT                   gme:Gmet_3202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12760"
FT                   /db_xref="GOA:D0LGL4"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGL4"
FT                   /inference="protein motif:PFAM:PF02590"
FT                   /protein_id="ACY12760.1"
FT                   /translation="MKISLYVCGRLKERYLQAAEAEYLKRLRPYCKLEVAEFRSDAALL
FT                   AAVPAQAHVYAFDERGDDLSSVEFSELLAWEEQHGGGAQVIAAIGGADGHSDALRARAR
FT                   KLLCFGRMTIAHRLVRILVLEQIYRGHRILRGEPYHRD"
FT   gene            186218..189052
FT                   /locus_tag="Hoch_0120"
FT   CDS_pept        186218..189052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0120"
FT                   /product="putative CheA signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: protein of unknown function DUF349; KEGG:
FT                   hch:HCH_02188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12761"
FT                   /db_xref="GOA:D0LGL5"
FT                   /db_xref="InterPro:IPR007139"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGL5"
FT                   /inference="protein motif:PFAM:PF03993"
FT                   /protein_id="ACY12761.1"
FT                   /translation="MGLTDLFRPKYRHSDADKRVEAIREMGLDEAALLARIAREDRVAE
FT                   VRRIAIDKLEEPSLLAEISADESDSALREHTRSRAAALWISAACSASGAAVAEAAIAGL
FT                   VRLGDQRALAEIAAKAEADSVRDAAMGEISEQRAFADLARNSSAHVGTRRAALAQIRDD
FT                   DTLRAIATDEQRKDLAILAVERIAADEALDAVAGKAKNKAARTRARKILSERAAERAEA
FT                   EAAAEVEVGNRAAEPAPPLVETEISEDKRRHAERVQLLQQISALVGGTTDWEAAAEELG
FT                   ELEQRWQALGTPDDAQRTRFDKARRQILSRRDAQRDEAAEAAAPAAAPVAEAPAPAPAE
FT                   ATGEAEGDEVVASAAEAADAAPAAAEQPGDEAAAPMAQDRAKGEAARESDEARSARRIE
FT                   DQNKFSELVAELEGLAADAKIKLIDRTLQRAEKALKKLDLATSDEIKALRKRYDDARRA
FT                   AFVKLKELREAEDWERWANVPRQEALIAKVKALLASDEVQKLGAQLKELQQEWKTIGPV
FT                   PRNKSQELWDQFKSACDEVYQQVKQQRSQVNEEMQANLARKEALCERVEVLAESSDWDA
FT                   TAEEIKKLQSEWKAIGPVPRKQSNAVWKRFRGACDRFFERRKPHLEKRLAEQTQNLAKK
FT                   IAMCEEAERLAESIEWKETAARLRDLQREWREVGLVPRKDAGAINKRFRAACDTFFKRR
FT                   ENRFEAERQAHARLVEGLRATLRAIIDGAPLPASEPDAAAEGELAEGELAAAAAEGDAG
FT                   EAQADAAEAADAGEDAAADADTAADAGETAAAASPSERLLQVREQVRELSLSAADEKSF
FT                   YELCDRAARACLEREPEAFRGTELDPATSRQRKHKLCARAEELAPAQQGEDAGAKQAST
FT                   PEEMAERLRAALAQNALSTSLASSTDGRSTAETIADLELSWLRLGPVLGDEGKDLEQRF
FT                   RAACERARQAVGQS"
FT   gene            189148..189447
FT                   /locus_tag="Hoch_0121"
FT   CDS_pept        189148..189447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12762"
FT                   /db_xref="GOA:D0LGL6"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGL6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12762.1"
FT                   /translation="MLLTLFGLLSCVYFVFAFKFVRSEYGRRSHPFQPTLPRAVLRHNA
FT                   PCMGRRWVRGRRRQQSLVCARQVQIGIVAIGMTAAFVMFLCMAGIMLTVLIGTL"
FT   gene            complement(189466..190557)
FT                   /locus_tag="Hoch_0122"
FT   CDS_pept        complement(189466..190557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0122"
FT                   /product="phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /note="KEGG: dps:DP1933 phosphoserine aminotransferase;
FT                   TIGRFAM: phosphoserine aminotransferase; PFAM:
FT                   aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12763"
FT                   /db_xref="GOA:D0LGL7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGL7"
FT                   /inference="protein motif:TFAM:TIGR01364"
FT                   /protein_id="ACY12763.1"
FT                   /translation="MRLVSDRIYNFSSGPATLPEPVIRQAQDALWSLGDTGIGVMEHSH
FT                   RSAAFTDVLERAEAACRELAGIPDDYRVLFLQGGASSQFFMLPMNFLQPGRCADYWDTG
FT                   VWSTKAMREAQRFGEVHVAASSAEHGFTRIPERAQYSDAPAYVHITSNNTIYGTQFAKP
FT                   PAIPEGSWLACDASSDIFSRPIDIGAYGVLYAGAQKNLGPAGITLVVIREDLLERANAE
FT                   LPSMLRYRTHADAGSRFNTPPTFAIYVLGLVLEWLRERGGLAEIDAYNREKAQLIYDAI
FT                   DASELFRGTVRREDRSLMNISFRSDSEELDAAFAAEAERRGLSGLRGHRSVGGMRASVY
FT                   NAFPREGCEALVAFMSEFERTRA"
FT   gene            complement(190610..190834)
FT                   /locus_tag="Hoch_0123"
FT   CDS_pept        complement(190610..190834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0123"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12764"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGL8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12764.1"
FT                   /translation="MSSAVGRVSFTEDRAFNGVKVFSATMVSDREQLGDKITNWIQSND
FT                   HCEVREIVVTQSSDEAFHCIAITVFYWEK"
FT   gene            complement(190867..192141)
FT                   /locus_tag="Hoch_0124"
FT   CDS_pept        complement(190867..192141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0124"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   scl:sce8174 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12765"
FT                   /db_xref="GOA:D0LGL9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGL9"
FT                   /inference="protein motif:PRIAM:2.3.3.13"
FT                   /protein_id="ACY12765.1"
FT                   /translation="MSEATEFNESELIYDWNSVEKDAPLASGRQVSFLCETLRDGIQSP
FT                   SVVDPDIGDKLRLVELADSLGIHHIDIGLPGAGNRAVEDCTTIATFIRDNKLRIRPACA
FT                   ARTHKNDVGAIVDISQAVGIEIEVLTFIGSSPIRQYAESWDLERMLNFSSEAIDLAARH
FT                   NLPVTFVTEDTTRSRPEVLDQMFRNAIEHGANRLCLCDTVGHSTPDGIHNLIRFTRNLL
FT                   EAMGRPDVGIDWHGHNDRGLGVVNTIFAIEYGASRVHGTAMGLGERVGNAALDQVLLNL
FT                   KLLGELPEQDLSKLLLWCKVAAKACHVAIPPQYPLAGSDAFRTATGVHAAAIIKAEKKG
FT                   HEWLADRIYSGVPAGMFGREQEIEIGHYSGESNVIYWLRKRGFDPTPELVRTVLSAAKR
FT                   GHRVLSTEEILQVIKEHNHASGSSA"
FT   gene            complement(192326..195721)
FT                   /locus_tag="Hoch_0125"
FT   CDS_pept        complement(192326..195721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0125"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: acp:A2cp1_3455 tetratricopeptide
FT                   TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12766"
FT                   /db_xref="GOA:D0LGM0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGM0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACY12766.1"
FT                   /translation="MLTRATRSPSIRDLDSPPPTDREAMPTVLIVDDDKYTQTVLHTAL
FT                   STDTALTELDIHAITADDGAGGLAAFRKHRPAVVATDLRMPRMDGVALCRAIRAEPGGA
FT                   EVHLVAMSGTSRDAAAADTVRQEYGAEVFAKPYQLRDMATYIAALLTGATPPGAAHATP
FT                   HPEQAGELGQRPLPAVLFDFLEARATGKLTLRRGRVEKQVDLLVGHPLSVWSSAREEAL
FT                   GAFLQILGIIREGDLKRALQWAARRRGKVSEALIALGIVTPEDMVSHITMHTCHKLVQS
FT                   LRWSDGTWAFQPHTQPDGGSRGNPIDMVPLVLQGLRHTVNFDGLPERVRGLEDKPLTLT
FT                   PRGQRMLPSVRQHLSSKLADEWAEGNTTGALLAAGVERGELFATLDAMLLCDAVSVYDH
FT                   PIQLESGPIVMRDTGDFSIEELSEHSQLQRAGRGTEEAARELYAMLFDDPGLMSPVHVG
FT                   ELPIEFPDDDDFDASAADSGVIEVAALQRSVGAATAESESNYARRLVLKEYLRIQGRDY
FT                   YDIFELEHDAAHDAVLRAVEKRRTKFSLDWFARYDLGRDYAKLEEIHAAYDRAEGVLCD
FT                   PAKRTAYHRSLSFGEQPSDGKRPLAAEIAYLAGIDLLQHGSYADAVAKLQAAIAASPDE
FT                   ADFHATLGWACYLDGQRSAQAADEARPHLNQGLAINPDHALSHQYKGLISAEHGTDEEE
FT                   AIFHLERALLSDPSADEALYALEAIWKRRGELRPLEREYRRLIYRIARSDPQQECRLWL
FT                   KLANLYRDELQEPENARIAYESAARLAPEDESVYAALGELQQHTPERFAERREFLRRQW
FT                   RRSPLSAKPGIDMVHAALAANQPDPAFLAASALVARGCADDETEAFYMRYRPRFVIRAQ
FT                   RPLDAQIWQYLRHAHDSLELGALVALLTPAVIHSFPLSFDDLEVDPTMAVDEEDLPEAF
FT                   RRVRAYVAHMLGVPIPRVFIRPDFGHQIHIGALHPPVLLAGDDALTSPERSELSFRLGR
FT                   AMSYLLPGRAIAASRPARLLKAAVLAVFSHAAGNKAAVEDPAGLVAQMREGLGRVPPES
FT                   LAQARDLVTRITSQSQSLNLSRWVRAQGRTANRVGLLLCGDLPAAVRFARDSGTTAGID
FT                   DMIDFAVSGVFASLRAQIGLSIDV"
FT   gene            complement(195725..196768)
FT                   /locus_tag="Hoch_0126"
FT   CDS_pept        complement(195725..196768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0126"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bja:blr1357 peptide ABC transporter ATP-
FT                   binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12767"
FT                   /db_xref="GOA:D0LGM1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGM1"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACY12767.1"
FT                   /translation="MSSATQPILSLRGLTKHFETLISWPKGERVALPSRVRRAFTRKRA
FT                   VVRAVEDVDLEVMAGETLGLVGESGCGKSTLGRMVLRLLEPTRGSIEFEGQDITRTPQR
FT                   ELGPMRRQMQMIFQDPYASLNPRMSIGAIVAEPLEVHELGADAAERSQRVAALLTKVGL
FT                   PSSAAQRYPHELSGGQRQRVGIARALAVEPRVLVCDEPISALDVSIQAQIVNLLQDLQR
FT                   AEALTYLFISHDLRIVQYICDRVAVMYLGRVVELAGAELLYREPQHPYTRALLAAVPKL
FT                   EAASASESKRPPVLLEGDVPSPLAPPSGCPFHPRCPVADKPRACFSELPRLRTLANGSQ
FT                   AACHVAE"
FT   gene            complement(196765..197826)
FT                   /locus_tag="Hoch_0127"
FT   CDS_pept        complement(196765..197826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0127"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: mxa:MXAN_4665 oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12768"
FT                   /db_xref="GOA:D0LGM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGM2"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACY12768.1"
FT                   /translation="MSQAGDVSEAGVDSLLEVEDLVTEFRSDRGPVRAVDGVSFAIPRG
FT                   QTLGVVGESGCGKSVTALSIMGLIPSPPGRIAGGSVRYGGRDLLTLSEAELRGIRGNRI
FT                   SMIFQEPMTSLNPVYTVGEQVAEAVRLHQKKSRREAMEVAVDMFRLVGIPSPEERVRNH
FT                   PHQMSGGMRQRVMIAMALACQPDLLIADEPTTALDVTIQAQILALLRSLQQELGMSILL
FT                   ITHDLGVVAETCDQVVVMYAGRVVERAATRDLFSHPRHHYTAGLLRSVPSFDSGERERL
FT                   REIPGMVPGLHELPAGCTFQDRCPAVGERCRSQEPALALHPIGGSDDDSDGSGDDNGHG
FT                   HWARCHFPVETAP"
FT   gene            complement(197823..198662)
FT                   /locus_tag="Hoch_0128"
FT   CDS_pept        complement(197823..198662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0128"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_4668 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12769"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGM3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12769.1"
FT                   /translation="MSRPALLALALASATLGASIAFGAGCGGHDPIPRSYPEPSADEVL
FT                   GHLAERQRNAQSFRAESVMDYWIGDERVKGTVLLMGRQGARVRINALSPTGDNVAADLA
FT                   CDGIGFEYIDYNNNCQLSGLCTKDSIAELLRISLEPDDFLLMVMGTTPVIPDAQGTVNW
FT                   DDRNAREVVELVSPDNRFTQTIVLDGRDHTWDVISSEIRDLRGNVLWRLRNKGFSAVTA
FT                   ADGTVFRVPGKSQLEQPSENADLLVDWKQRALNIELETAKFDMEIPPGLPVCRGERG"
FT   sig_peptide     complement(198591..198662)
FT                   /locus_tag="Hoch_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.955 at
FT                   residue 24"
FT   gene            complement(198659..200839)
FT                   /locus_tag="Hoch_0129"
FT   CDS_pept        complement(198659..200839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0129"
FT                   /product="Prolyl oligopeptidase"
FT                   /EC_number="3.4.21.26"
FT                   /note="PFAM: peptidase S9A prolyl oligopeptidase domain
FT                   protein beta-propeller; peptidase S9 prolyl oligopeptidase
FT                   active site domain protein; KEGG: scl:sce8590 prolyl
FT                   oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12770"
FT                   /db_xref="GOA:D0LGM4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGM4"
FT                   /inference="protein motif:PRIAM:3.4.21.26"
FT                   /protein_id="ACY12770.1"
FT                   /translation="MTVPPSPSERAFPPEQHATQDEEVELVYPETRREDTRETIHGVEV
FT                   ADPYRWLENADDRMVASWMLAQDGLARSYLEALPARDGLAARLRELNYYDAISVPAKRG
FT                   ERYFFTRRHADKEKSILYWRQGQGQEQVLIDPNTLSDDGSTSLGGWFPNRDGTKLAYKL
FT                   NPNNADAATMYVMDVASGETSTVDVIDGAKYASAAWKPDGSGFYYTRLPSDPDIPIADL
FT                   PARAEIRYHELGSDPAGDELVYPATGDPGTFLSVSLSRDGRYLMVSVQHGWNSSDVYFK
FT                   DLRRGRDAGFEPLVTGEKAHFSVRAWRGDFYVLTNHEAPRYRIFKVDPRRPRMSRWREI
FT                   VPESEAVIDSFNIVGNRLVVTYLSNAYSRMEVRSLSGQRIREVTLPEVGSVSNMAGNED
FT                   ADEAFYAFTSFTSPPQIYRTSVATGESELWFEFDLPVDTSQFTAEQVWYPSRDGTQISM
FT                   FLIRRKDLSSDQAHPTILYGYGGFNVNLTPAFSTNIVAWVERGGIYAIPNLRGGGEYGE
FT                   EWHKAGMRLNKQNTFDDFLAAADFLIETGWTSPQRLAIWGGSNGGLLVGAAMTQAPEKF
FT                   AAVVCAVPLLDMLRYHLFGSGKTWIPEYGSADDAAEFSVLSGFSPYHRVVEGTAYPALL
FT                   MLSADSDDRVDPMHARKFTAAVQWASSSDEPAIMRIEHNSGHGGADMVRQLVERNADSF
FT                   AFVADELGMAAAPPPAPAETDLVSDGAEGAAQ"
FT   gene            complement(201016..202140)
FT                   /locus_tag="Hoch_0130"
FT   CDS_pept        complement(201016..202140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0130"
FT                   /product="Beta-ketoacyl-acyl-carrier-protein synthase I"
FT                   /EC_number="2.3.1.41"
FT                   /note="PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein; 3-Oxoacyl-[acyl-carrier-
FT                   protein (ACP)] synthase III; KEGG: cvi:CV_1096
FT                   3-oxoacyl-(acyl carrier protein) synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12771"
FT                   /db_xref="GOA:D0LGM5"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGM5"
FT                   /inference="protein motif:PRIAM:2.3.1.41"
FT                   /protein_id="ACY12771.1"
FT                   /translation="MSTGTAITGTGIHVSENVVSNEELCAIFNAYVQRENQRNAAAIAA
FT                   GEAQPLAESSPAFIVKASGIERRHVVDAEGILDIDRMTPNIPDRPDDELCVQAEYAVRA
FT                   AEKALAAAGRAAEEIDLVILATSTLQRPYPSISVEIQHALGARGYAYDMTMGCSSVTYG
FT                   IRAASDAIRCGHAKRALVVNAELCTPFADFRDRDCHFIFGDAGTAVLVEPCDDVARAGA
FT                   FEILSSRAFASYSNNIRNNIGHINRCDPDNQHARDKLFYQQGRRVFKDIVPLASRFILD
FT                   HLEAHELAPQDIARFWLHQANSNMNDLIAKRVLGHEPSTESAPLVLAEYGNTASSGSII
FT                   AFDQHHEDLAAGSYGFLCSFGAGYSIGSALLRRM"
FT   gene            202428..202504
FT                   /locus_tag="Hoch_R0008"
FT                   /note="tRNA-Met1"
FT   tRNA            202428..202504
FT                   /locus_tag="Hoch_R0008"
FT                   /product="tRNA-Met"
FT   gene            202721..202794
FT                   /locus_tag="Hoch_R0009"
FT                   /note="tRNA-Gln1"
FT   tRNA            202721..202794
FT                   /locus_tag="Hoch_R0009"
FT                   /product="tRNA-Gln"
FT   gene            202874..203230
FT                   /locus_tag="Hoch_0131"
FT   CDS_pept        202874..203230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12772"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGM6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12772.1"
FT                   /translation="MNLDKSGRLFFGCKIDSKLRDAMEQATPSKKRYFEGTEFLTICTA
FT                   GEERWIGKIVDGGMTASTTEDIQRNVVSILRNITTNVRISPSSVKVFVVAAERELEPQE
FT                   PLERESRGPYIANY"
FT   gene            complement(203268..204203)
FT                   /locus_tag="Hoch_0132"
FT   CDS_pept        complement(203268..204203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0132"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: scl:sce1705
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12773"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGM7"
FT                   /inference="protein motif:PFAM:PF02541"
FT                   /protein_id="ACY12773.1"
FT                   /translation="MNASPTSSGRRVAVIDIGTNTLLLLIAEQQPDGSLAALHDACSFG
FT                   RLGQGLDRSGALAAEAVERSLGFLREYRVLMDAHGVSEVAAVGTQALREAANRDAFVVP
FT                   AREILGAPLEIIAGEREAELVYRAVAASFPDLAREPFVVADVGGGSTEIIAAGPEGVSS
FT                   STSVPIGSVRLSERHLADDPPTEAQRRALVADIDAALEPLALPTQVRLVGTAGTATTMA
FT                   SIKLALEHYQRERIHGLVMTPAEVEQQLERLFALSVTERRALPGLEVQRADVITAGATI
FT                   FARLLRRLEGRDFLVGDCGVRWGLAYERLG"
FT   gene            complement(204206..205543)
FT                   /locus_tag="Hoch_0133"
FT   CDS_pept        complement(204206..205543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0133"
FT                   /product="WD40 domain protein beta Propeller"
FT                   /note="PFAM: WD40 domain protein beta Propeller; KEGG:
FT                   gsu:GSU0025 TolB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12774"
FT                   /db_xref="GOA:D0LGM8"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGM8"
FT                   /inference="protein motif:PFAM:PF07676"
FT                   /protein_id="ACY12774.1"
FT                   /translation="MDMFQISVLASRRAVAALAVLLMALTLGPARSSAQQSGVVIELEN
FT                   PKRGLYPIAIPRSVAADAAQAEEAQKVMDFDLAVSGWFEVLDPRSFLADLRTEGLGIQP
FT                   QKWKDVGAFGVIKHRISRSGNQYTFEGRLYEVEKGSAAVLIKTYRGGDLRALVHNFCND
FT                   VVEHYTGERGFFGSKMAFVTRGSGGKQVMAMDFDGHGVRSLTRNSSLNILPSWSPDGSK
FT                   VAFTSYMRNNPDLYVVGAGGGRPNRISKQSGMNTGASWSPDGSKIAVTLSKDGNPEIYI
FT                   ISASSGAILQRLTNDRAIDTSPAWSPDGREIAFVSDRHGGPQIFVMSAAGGSPRRVSRN
FT                   GSYNTTPVWSPRKDKRMLAYTTRDGGTFDIVTLDLGTGDMVRITQGQGSNEEPSFSPNG
FT                   RAIAFASERREGAGIYIANADGSGTQRRVYSGVATSIDWGPAPRGQ"
FT   sig_peptide     complement(205439..205543)
FT                   /locus_tag="Hoch_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.834 at
FT                   residue 35"
FT   gene            complement(205516..206268)
FT                   /locus_tag="Hoch_0134"
FT   CDS_pept        complement(205516..206268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0134"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tmz:Tmz1t_0783 protein TolA"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12775"
FT                   /db_xref="GOA:D0LGM9"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGM9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12775.1"
FT                   /translation="MDAPRTAGLLMTVMVHGSVIAAMVLFSSWSSADEGPKLGDMVTIE
FT                   AALAYKSKDSKTQQPQKPSRRRPQPPAPREDLTKVSRDENQASPEPKDREEPPEPKPQE
FT                   EPEEDFLEQFEKYKEQRQTEESDEGEFGPGESDERTGGAFDGSEHGFAESNRGDPYMRE
FT                   LAAQAHQFWSVPTLEQGSGHAVGCVQLGKDGRILNTQLLPPSQNATVDAAVRRALKQVT
FT                   ELRADEAQPVPAHLMEATTQWICFKFPY"
FT   sig_peptide     complement(206203..206268)
FT                   /locus_tag="Hoch_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.619 at
FT                   residue 22"
FT   gene            complement(206276..206746)
FT                   /locus_tag="Hoch_0135"
FT   CDS_pept        complement(206276..206746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0135"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   mxa:MXAN_5754 transport energizing protein TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12776"
FT                   /db_xref="GOA:D0LGN0"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGN0"
FT                   /inference="protein motif:PFAM:PF02472"
FT                   /protein_id="ACY12776.1"
FT                   /translation="MGMQVGGSQGGDGLNSEINVTPFVDVMLVLLVIFMITAPMLNTGV
FT                   DITLPQIAAQNIEDPEGKLILSIDKNQRLLLGKSPVQWAELSDKLSTNRRVQTEKELYI
FT                   EAEQSLPYGVVVTAMATAKSAGVERVMMLTDPSEQLDLSELDRAVGNAAPTE"
FT   gene            complement(206778..207476)
FT                   /locus_tag="Hoch_0136"
FT   CDS_pept        complement(206778..207476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0136"
FT                   /product="protein TolQ"
FT                   /note="TIGRFAM: protein TolQ; PFAM: MotA/TolQ/ExbB proton
FT                   channel; KEGG: dol:Dole_2213 Tol-Pal system TolQ"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12777"
FT                   /db_xref="GOA:D0LGN1"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGN1"
FT                   /inference="protein motif:TFAM:TIGR02796"
FT                   /protein_id="ACY12777.1"
FT                   /translation="MLDFLHILAAAGQLDLASLILQAHWVVKAVMALLALMSIIGWYII
FT                   GSKHIHIRRATKESNKFLESFWRTRDIEQIYKQAKGLQNSPISAMFLAGYTELAKLEAD
FT                   ERPTRDKEADLENVERALRRTQTIETTKLENMIPFLATTGSAAPFIGLFGTVWGIMNSF
FT                   TSLGSGAANIQTVAPGIAEALFATAIGLVAAIPAVMAYNYFTRRIRIQVSHMNTFEQDY
FT                   LNIIRRHFLS"
FT   gene            207576..208106
FT                   /locus_tag="Hoch_0137"
FT   CDS_pept        207576..208106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12778"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGN2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12778.1"
FT                   /translation="MTRWDAKVFAAFVSDRRPRARARTHLRGLALALGLVLLALGGCVE
FT                   VGGGAAEFSWTLRNFAGDRALSCEGVGMSWVQLNWRTVAEGDPNPALEAEGSKRFPCAD
FT                   DRGITEFIIPSGRKMLWVEPLCQDGEAFTRYEVPPPVVRNVADGAVLTLDSLLIVVDPA
FT                   CTCAAECAAFELR"
FT   gene            208201..208971
FT                   /locus_tag="Hoch_0138"
FT   CDS_pept        208201..208971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12779"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGN3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12779.1"
FT                   /translation="MTMAWKHSDTRTAPAAMSLAAMSLAAMSLAGSGCVVVTDMADEDD
FT                   SRLSITWGLQAGDDNAPAACPPGATVAVISEPLDDGDYGLGDGDEIYDLYDCVDRAGVT
FT                   GPLPPGSYDVWIDVIDESGERLLAQSNFETATLGFGELRALDYDISLDRGSFYVTWELA
FT                   DDVRALSCAEASAGELRVDSRPELAPGASFEDFFSCSDGQALTPGLPLGDYRVVLGLVD
FT                   DKRESVAAPEVLDGAIEFGNAFVDLGHFVFTLAD"
FT   sig_peptide     208201..208293
FT                   /locus_tag="Hoch_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.495 at
FT                   residue 31"
FT   gene            209147..209878
FT                   /locus_tag="Hoch_0139"
FT   CDS_pept        209147..209878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0064 rhomboid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12780"
FT                   /db_xref="GOA:D0LGN4"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGN4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12780.1"
FT                   /translation="MSKGRKLGGQRMSLATMRITRGALYLLFVEVGFSLVYLLSNEQVQ
FT                   AQFVAWVATSSEHVFQHYRVWTLASAALFELDFVSLLFHGLMLWMFLPTLERWWGTKKF
FT                   LLFALWTLLAGNLGGVLAGLVFGPVPLAGLDPFIFASIIAFGILYANQPVQFFGVLPLT
FT                   GKQMMIGISAFVALFVVLGQQWVVGASYVAAMLTAAALVSGKLHPRLLYLRWKQRRARR
FT                   HLAVLRGGAQRPGRKRDEWIN"
FT   gene            209921..211423
FT                   /locus_tag="Hoch_0140"
FT   CDS_pept        209921..211423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0140"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; Forkhead-associated
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; SMART: Forkhead-associated protein; AAA ATPase;
FT                   KEGG: mxa:MXAN_0353 sigma-54 dependent trancsriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12781"
FT                   /db_xref="GOA:D0LGN5"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGN5"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACY12781.1"
FT                   /translation="MQPSSPTESRPGGSGARADAGLTTVFAGERATRRRLRKAKVVVAA
FT                   GPDAGREVELDKARFTGGRSIINDLVLTDKAVSGTHFEIVADDAGYRLRDLDSSNGIFV
FT                   GELRIREVYLQPGTVFRLGHTHLLFQPLQDVVEIDLSEQDRFDRVIGASPIMREIFARL
FT                   EKVAQSELTCLITGETGTGKELVARGIHAASPRRDKPFVVLDCGSIPRELIESTLFGHE
FT                   KGSFTGAVGQHQGCFEQADGGTIFLDEIGELDVTLQPRLLRVLEQREITRVGGSRPIKV
FT                   DVRVLAATNRDLRAGVNTGSFREDLFFRLSVVHVELPPLRVRHEDIPLIAQHVLREVSS
FT                   RRGISLAFGQDAMNALQVHSWPGNVRELRNVVERAAALGDGPVLSRADLVFGRDPGPSA
FT                   MVAHDLAQAGTRAAQGAMARMAGREHEHEQGDGPARFDPALFVAGYGFKDAKQAVVDAF
FT                   ESAYLEALLTRNEGNISRSAQEAGLTRYHLRELLKRHNLSPR"
FT   gene            complement(211456..212649)
FT                   /locus_tag="Hoch_0141"
FT   CDS_pept        complement(211456..212649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0141"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12782"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGN6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12782.1"
FT                   /translation="MTLQPHTVTRQGIALLGPMLLALGLGACSVKSAQLPETHTPPPGG
FT                   YAGYAGGHATVQPTRAVVSAPTVHYTQGYPPAPLHETVPTSSYGDQVWIDGSWHWNGYE
FT                   WMWIDGRWVEDDPELVYIQPYYDYYDTGHVYQPGYWSPRAQVPATVVVSPRQRYRGGYY
FT                   DPGHGHASKPRIGGGPKRPVTGYHPKRPSRRVPGAGHARSPVVRDHRHGDRRQPGARVP
FT                   SRPGNQAPDRAGRPPVTRRPPPVVSSPRGRGAAAGNAALRRRPPRMIPGGSPQARGGGA
FT                   KSPARPAPSVGLPPARVGATGPRPRVGGSAGARIPPRPTAPPPGAGMGGPVGGPIGGGV
FT                   KAGPRPRSGGVRHGGGAKHSAGAVGGGAKHRSGGVRHGGGVKRSSGAIGGGVKRGPR"
FT   sig_peptide     complement(212551..212649)
FT                   /locus_tag="Hoch_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.905 at
FT                   residue 33"
FT   gene            212898..213881
FT                   /locus_tag="Hoch_0142"
FT   CDS_pept        212898..213881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0142"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: geo:Geob_3016 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12783"
FT                   /db_xref="GOA:D0LGN7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGN7"
FT                   /inference="protein motif:TFAM:TIGR00233"
FT                   /protein_id="ACY12783.1"
FT                   /translation="MKTLFSGIQPSGELHLGNYLGAVRNWVELQETYFCYFCIVDYHAI
FT                   TQSYERSEMRKRVFDMAVDLLACGIDPERSVLFVQSSVPEHTELCWVLNTVAQFGDLGR
FT                   MTQFKDKSKRQEDNINVGLFDYPVLQAADILLYKAAAVPVGKDQEQHIEFTRRLARGFN
FT                   NRWSKVFAEPEARFSAVPKLLGLDGKAKMSKSLDNTIPLAATEKQIRKKLAQAVTDPKR
FT                   ETREDPGNPDDCNLYTLHTFFSSEDEQQWVRQGCTTAGIGCVDCKKKLSDNVIDHLADY
FT                   HKRREALLATPAQVDEILAKGAEKARATAQKTMAEVRKKLGLWQQP"
FT   gene            213878..214342
FT                   /locus_tag="Hoch_0143"
FT   CDS_pept        213878..214342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12784"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGN8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12784.1"
FT                   /translation="MKPRRSLPWLRRRAVAAAASVLAAMALAVAMAGRGCEMEGDGPIG
FT                   AVRAFAAAAQTDDHQQLYELLGPKTRAQLASAAARATELAGGARRFAPIDMLSIGRVEA
FT                   APMRDVRVLANDGERATVAFTGEGGRSMQIETVLVGDGDGSGWRVELPSP"
FT   sig_peptide     213878..213964
FT                   /locus_tag="Hoch_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.490 at
FT                   residue 29"
FT   gene            complement(214382..214840)
FT                   /locus_tag="Hoch_0144"
FT   CDS_pept        complement(214382..214840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0144"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: mxa:MXAN_4732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12785"
FT                   /db_xref="GOA:D0LGN9"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12785.1"
FT                   /translation="MSDSATPHPEPHTVPPPEIEAQFSDLHDGSLGADEARALESHLQG
FT                   CDACRAAYDEFCSAVDALAGMHKMSAPQHFEREVEETIRRRSGGRFFGRKAFGERVPFE
FT                   LIAVVVLVFGLVIFFAIRSSQTGSLRYEQPSEEPAIDPAAADVLLPRM"
FT   gene            complement(214935..215513)
FT                   /locus_tag="Hoch_0145"
FT   CDS_pept        complement(214935..215513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0145"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 4 domain protein; KEGG:
FT                   scl:sce7897 ECF family RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12786"
FT                   /db_xref="GOA:D0LGP0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGP0"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACY12786.1"
FT                   /translation="MSRRERALIRKLRDRDERAFRELVTQFGDRIFNLTFRMLGSREEA
FT                   EDISQEVFITVFKSIDSFRGDAKFSTWMYRIAVNHCKNRIKYLARRHDRSRDEYDDMSG
FT                   QQQAAGATAVPSTPARPDLQLEGVQLEQIMQRCIASLDEEHRVLIVLRDIEDLSYEEIC
FT                   TITNLPTGTVKSRLHRARLALRKKMLTKI"
FT   gene            complement(215559..216485)
FT                   /locus_tag="Hoch_0146"
FT   CDS_pept        complement(215559..216485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afw:Anae109_3577 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12787"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGP1"
FT                   /inference="similar to AA sequence:KEGG:Anae109_3577"
FT                   /protein_id="ACY12787.1"
FT                   /translation="MKLAALHPGRRASWAGLGLIASALLAAAPALADSPSDYLGAREVA
FT                   MGDGLRADARGAAAATLNPAGLALNRELVFEGSYGYLADDPDAHVVAASGCDSTVPIPG
FT                   CFQYRYFRRSPVDGEARFRVHEFSTSLARAFGQVASAGVTIKYIDEAGPEGDDSGIAVD
FT                   GGILLRAHSVAQLAVVGYNLVTFDETNYARAVGAGLAVRPLPALAVTADGLWQLGQDGS
FT                   TGRYGGGAEYFISTTNGQSGYPLRAGVVHDVAEDATYVSAGLGIASSSVGIDLGGRKQI
FT                   GGDGFDIVANLRIFGPRMAQDGNRYYQ"
FT   sig_peptide     complement(216387..216485)
FT                   /locus_tag="Hoch_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 33"
FT   gene            complement(216531..217211)
FT                   /locus_tag="Hoch_0147"
FT   CDS_pept        complement(216531..217211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0147"
FT                   /product="DNA repair protein RadC"
FT                   /note="TIGRFAM: DNA repair protein RadC; PFAM: DNA repair
FT                   protein RadC; KEGG: gur:Gura_4138 DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12788"
FT                   /db_xref="GOA:D0LGP2"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGP2"
FT                   /inference="protein motif:TFAM:TIGR00608"
FT                   /protein_id="ACY12788.1"
FT                   /translation="MALLNLYDIADLPRERFLAYGGERVSNAELLALILGTGTRGRNVL
FT                   ELAEHLLHALGGLPQLARAAPSELLEVPGIGAARASRVAATFHLGRRALEASAAAPVVV
FT                   RNPRDLYERLRLRLRGLSQEVFLVIALDPRNVIIEEIEVARGCLTGVDVHPREVFRPLI
FT                   RRGAAAAVVAHNHPSGDPAPSAEDIALTRRLCEAGDLLGIPLLDHLVLGACNCASVFEL
FT                   LGMR"
FT   gene            complement(217497..218927)
FT                   /locus_tag="Hoch_0148"
FT   CDS_pept        complement(217497..218927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0148"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17 leucyl aminopeptidase domain
FT                   protein; KEGG: tgr:Tgr7_1858 leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12789"
FT                   /db_xref="GOA:D0LGP3"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGP3"
FT                   /inference="protein motif:PRIAM:3.4.11.1"
FT                   /protein_id="ACY12789.1"
FT                   /translation="MEPLSYLIDPNSSLETNQTAATAAIPITLITAAELGQWLGAQDAN
FT                   TRAWVESTGFRAEPHSVLRIPGPDGAIARVLCGVGKDRDMWSLSTAAAKLKQGVFRIDA
FT                   ELEPALATRLSIGWVLGTYRFRRYKSKSDDALASLVWPETADRDAVRRTVVAIFQVRDL
FT                   VNTPANDLGPGELAQAAAAMGKGFGAELRVIEGEELVAQNYPAIYAVGKGSARPPRLID
FT                   MRWRPEDSDKKHLSRLTIVGKGVVFDSGGLDIKPVNGMKLMKKDMGGAAHALALARMVM
FT                   MAELPVQLRVLVPAVENSISGNAFRPLDVIGTRKGLTVEVGNTDAEGRLVLCDALAEAC
FT                   TEKPDLLIDFATLTGAARVALGTDLAAMFCNDDALATELLACSLDQDDPMWRLPLYQPY
FT                   AKSLASKVADTNNVADSGYGGAIVAALFLEKFVTPKIPWLHFDVFAWNLGSRPGRPSGG
FT                   EAFALRAVFELLRRRFAV"
FT   gene            219135..219575
FT                   /locus_tag="Hoch_0149"
FT   CDS_pept        219135..219575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0149"
FT                   /product="Class I peptide chain release factor"
FT                   /note="PFAM: Class I peptide chain release factor; KEGG:
FT                   noc:Noc_0430 class I peptide chain release factor"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12790"
FT                   /db_xref="GOA:D0LGP4"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGP4"
FT                   /inference="protein motif:PFAM:PF00472"
FT                   /protein_id="ACY12790.1"
FT                   /translation="MSEIVINHRLSIPDSELSVAFARAGGPGGQNVNKVATKVELRWLP
FT                   EASQALSAALREGERAYLLRRLASKLTSAGELLVTSTKTRDQGKNREDAEAKLGEIVRA
FT                   ALERPKPRRATRPTRGSRERRLSAKKQRGQRKQSRRRPTRDD"
FT   gene            219719..220435
FT                   /locus_tag="Hoch_0150"
FT   CDS_pept        219719..220435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0150"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afw:Anae109_3014 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12791"
FT                   /db_xref="InterPro:IPR021212"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGP5"
FT                   /inference="similar to AA sequence:KEGG:Anae109_3014"
FT                   /protein_id="ACY12791.1"
FT                   /translation="MSRVSMAFRCFFGLLFGGSLPSKAAAYLPEEARAALPERAQSEGD
FT                   GEAADAELVADAAEEARKAEEARKAEEARKAEEAARKAEEAARKAEEAARKSAAQASAR
FT                   KSASLAEQHTEGALALLALLQREGRLVDFLQESLDDYDDGDIGASVRDIHRGLRKVITE
FT                   YLSVEPVMPGEEDDDVSVPKGFDPGEVRLIGEVSGEPPFRGVLRHHGWRVIETKLPQLS
FT                   EGVDRHVLAPAEVEVS"
FT   sig_peptide     219719..219793
FT                   /locus_tag="Hoch_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.866 at
FT                   residue 25"
FT   gene            220432..222300
FT                   /locus_tag="Hoch_0151"
FT   CDS_pept        220432..222300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0151"
FT                   /product="molecular chaperone"
FT                   /note="KEGG: reh:H16_A1624 molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12792"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGP6"
FT                   /inference="similar to AA sequence:KEGG:H16_A1624"
FT                   /protein_id="ACY12792.1"
FT                   /translation="MSAARYVVGIDLGTTNCAVAYAELAAASERPDGLAGALEPFAIPQ
FT                   LVAPGEVAERPTLPSFLLLPTAHELAPEAMSLPWAGAPGFAVGELARERGAELPQRVVA
FT                   SAKSWLSHTGVDRNAAILPWRGAVSGEDGSGDGEGEAGRVSPVEASTRYLAHVRAAWDA
FT                   AHPESPLAEQEVLLTVPASFDAVARELTAAAARQAGLLQVTLLEEPQAAFYAWLAEHGG
FT                   GPDAAPGSDWREQLAAGDVVLVCDLGGGTTDFSLIAVQEDEGGTLALERVAVGDHILLG
FT                   GDNVDLALAHVVSQRLGGKAKKLKQRQQRALVHACRRAKETLLGADAPDSVPISILGAG
FT                   SRLIGGTLRSEVLQSDIDSLVLGGFFPEVAADAEPQSRRTVGLVELGLSYAQDAAVTRH
FT                   LASFLSRHGRAPSAVLFNGGVMKSQRLQERVAAILRSWQPEGSAPLRVLSGTSLDLAVA
FT                   HGAAYYGLVRRGAGIRIRGGTARAYYIGVESAMPAIPGFPPPIKALCVAPFGMEEGSAV
FT                   DLPGEELGLVVGETAEFRFFASSERKDDHAGTICDPDEEELRELDPVETTLPPFTEGGA
FT                   EHAAGDTVPVNLRALITEIGTLELWCVTRDRAHQWKLEYSVRDAED"
FT   gene            222311..225274
FT                   /locus_tag="Hoch_0152"
FT   CDS_pept        222311..225274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0152"
FT                   /product="Heat shock protein 70"
FT                   /note="PFAM: Heat shock protein 70; KEGG: ade:Adeh_3032
FT                   DnaK-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12793"
FT                   /db_xref="GOA:D0LGP7"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR021030"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGP7"
FT                   /inference="protein motif:PFAM:PF00012"
FT                   /protein_id="ACY12793.1"
FT                   /translation="MASPQQGKRARFLIGIDLGTTNTAVAFVDTRSAEQRVEIFPVPQL
FT                   VAPGELEPRRQLPSFLYLAGSHDLGEAETALPWNSDGGGEGRRVVGELARSQGARVPGR
FT                   MVASAKSWLCHGGVDRKAAILPWGDSGEDAETAGAQVEKLSPVAASAAVLRHVRESWDH
FT                   ARASASDALFAEQDIVVTVPASFDEAARELTLEAAKLAGYPDVVLLEEPQAAFYAWIDA
FT                   HPAGSRARTIDAGDHVLVFDVGGGTTDFTLIQVGGEAGGDDERDSFQRTAVGDHLLLGG
FT                   DNIDLTLAKQVEARLVAKRKKKLDPVQWHGLVHACRMAKETLLGDSDTDEVPIVIAGRG
FT                   SKLIGGSMKDRIARGELETTLMDGFFPLVARDDAPRRSRGGLQEFGLPYAADPAVTRHL
FT                   AGFLARHPSARIDAVLFNGGAMTPPSLRARVLEQIAAWQSEAGAPRELANELPELAVAK
FT                   GAAYYGLVRRGFGARIRGGTPRAFYIGVGAAAVAGTAEAGELAVCLAPKGLEDGARIEL
FT                   ARDFSLLTNRPVSFKLFSSSSRDDVAGAIVPVGDGRPETVDDGSDLLELPPIVTALRAR
FT                   GRSQVKVRLEVHITELGALEIWCKDTEASGEAEGERWRLSFDMRAGGAGASAGAGDESG
FT                   DESGAAGLSPELEAQLAEAKALIAETFSGPASELPRLMKKLEKIVDTRRDEWSMTVARA
FT                   FFDATLEVEEQRKRSADHEQRWLNLAGFCLRPGTGAPLDQWRAKQMWRIFNEELQHPKV
FT                   EAGRLAWWIVWRRIAGGLTKGQQEQIYDRLAQLFLPSQKQKKKWYQVKPTKQEAVEMIR
FT                   TLANLERLAPSFKSKLGAELLRRILEESSTKKDQDVPLYFWGLGRLGARMPLYGPLNAV
FT                   VPPQSAAQWIKALLALPAWPEKAAFPMAQVGRRTGDRSRDLADGVRESLVARLRTMAGG
FT                   ERTARLVEEVIELEAREERVALGDTLPAGLRLVHDADEADSDAADAGASDAASGADS"
FT   gene            complement(225366..228122)
FT                   /locus_tag="Hoch_0153"
FT   CDS_pept        complement(225366..228122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0153"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="PFAM: TonB-dependent receptor plug; TonB-dependent
FT                   receptor; KEGG: slo:Shew_2718 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12794"
FT                   /db_xref="GOA:D0LGP8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGP8"
FT                   /inference="protein motif:PFAM:PF07715"
FT                   /protein_id="ACY12794.1"
FT                   /translation="MRRYPVNKRYVSAAALVAAALMASPAIAQTTLEQSVPEPPPAPVT
FT                   QGSITGTVVSETTGIPLSGAQVTIPDTQFGVFADENGQFTITGVPAGTYTVSVSLGGYL
FT                   ETTAQVSVSAGGTADAMFTMPDDPSSGEVIVIVGSRTQRTITESPVPIDVISADAIEES
FT                   GHSEANQILASVAPSYNATHQTIADGSDHVNPAALRGLGPGQVLVLINGKRRHASALMH
FT                   VNGTYGRGTVGVDLNAIPTSAIERIEILRDGASAQYGSDAIAGVINIVLKDYKELLTAQ
FT                   ARSGITAYGDGFEIKLGANYGIRLGEDGVLNISGEFLQRNPTDRSGPWEGSFYPGVDGY
FT                   DETTDALAEQGLSREDVSMDIGQSRATVGSLMLNAELPMGEGEVYAFGGATYRDGKAAG
FT                   FYRRPEQSDRSVPEVYPNGFLPEIHTDILDWSAAAGYRHDFGTWNLDASVNHGGNFFLY
FT                   TIENSINASIGPTSPTDVYAGGPLFNQTTVNVDAVTELPVAGIEKLGLAAGAEYRLDNY
FT                   RLFAGKAASWKCGRFAPEKACGIQVFPGFQPDNEVDVYRYSGGGYLGLESQLHEQFFVD
FT                   VAGRFEAFEDFGPTVNGKVAARWNMKDNMAMRGAVSTGYRAPALHQIYYNTIGTQFVAN
FT                   PVTGDLEPKQVLTAKNTSNIARAFGIPELEEETSINVSAGIAARPRDDVSITIDAYRIA
FT                   IDDRIVLTSRFADTDASIGDQVRMLLPDEVSQVQFFTNAVDTVTRGIDVVADHTRVVGE
FT                   GTLGLTLSGSFTLTKVEDVNVPQGVADRFGDGNIESVRTIIFNREEQNRLENVVPHAKA
FT                   TAAARYRLGPLTTSLRANYYGGVSFRSTNASLDEYFGPKVIFDLDVGYNLGNGIKVSAG
FT                   AQNLLNTMPDEHALDANRFNEQFIYSRGISQFGMNGGFYYLQLQYLM"
FT   sig_peptide     complement(228036..228122)
FT                   /locus_tag="Hoch_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            complement(228201..229460)
FT                   /locus_tag="Hoch_0154"
FT   CDS_pept        complement(228201..229460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0154"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce0971 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12795"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGP9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12795.1"
FT                   /translation="MRLLIANLDCEAAFAEAAGVSRYHLSQPVARRIAALGALLGALGR
FT                   VDDALWLPAELDPARLHPSLPQRLRSGPLSPAESASAVLAWGETRDTAALRARLRRVRA
FT                   PARAAAIPAPTPPTPTPELPVTPPEPAWQRRLWTLAADAAANAEASWRVNDRRFCVPLQ
FT                   ESLGCRLPGAALIDSLDELRQHLAELATAGALSDDDAWVLKAPFSASGRLRVRRRGADI
FT                   SPDIATRIERLLARFGTLCFEPWVTRERDLGCLGLVTGADAWEIFPPHGLECDRAGVFR
FT                   GIEVHAAAAAAATTDADDTPWLQPEHARALQRAADHAASALASAGYRGAFGIDAFLYRP
FT                   PDADAGAALRLQPLCEINARLSFGFVAHALAAGTGAERLWLRVGEDLPDALPDARLLPL
FT                   VRAGSEGIAAWAEIWNSPGR"
FT   gene            229648..230922
FT                   /locus_tag="Hoch_0155"
FT   CDS_pept        229648..230922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0155"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12796"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGQ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12796.1"
FT                   /translation="MRTTLLTLALFIAPAVASAQTFDDQGFAVGGEFDASLNADFDDGA
FT                   PDADYVWVDGYVLEDGQEVEGFYRERNRNGFRWIDPGYRNGVWIDGHWEPLQVSSNNVV
FT                   VRGHRGGDGFFIPDYLRPKHRNGYRWVDGRWHGNRWHHGYWEPLRRRAGYDWVPGYWTY
FT                   DGQWIDGYWRDVRRNGYEWVDGYWAYGRWHAGYWRPIQRRVGYIWVPGYHTHNGYVEGS
FT                   WRPERRSGFYWVDGHWNGHRYISGHWERGNRKVVKRRYDRVRRVPAQRKIRHGHRNVWR
FT                   GGRAQPVRRGTPPRHRAPDNRRDHRQDRREDRRDNRRDRREDRRDNRRDHREDRRDNRQ
FT                   DRRDNRQDNRQERRDNRQERRDNRQDNRQERRDNRQDNRQNRRDARQDNRQNRRDARQD
FT                   NRQNRRGARQDNRQNRRDDRRGNRP"
FT   sig_peptide     229648..229707
FT                   /locus_tag="Hoch_0155"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 20"
FT   gene            complement(230939..233515)
FT                   /locus_tag="Hoch_0156"
FT   CDS_pept        complement(230939..233515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0156"
FT                   /product="Trypsin-like protein serine protease typically
FT                   periplasmic containing C-terminal PDZ domain-like protein"
FT                   /note="KEGG: cja:CJA_2585 MucD"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12797"
FT                   /db_xref="GOA:D0LGQ1"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGQ1"
FT                   /inference="protein motif:COG:COG0265"
FT                   /protein_id="ACY12797.1"
FT                   /translation="MIRAMNLPKLTAQLELAASFSDRQALVEAAAAEASPAELKEIARL
FT                   LNHRVLAVRLGAIEILERARFRPVLPILAAATRQRRGDERVLAARAVSRLAQREDRETL
FT                   EPLARAWLGGADKYLHGHGQALLAALGVGGDASPASASPASASPGASADRPGAAASATN
FT                   HDLAGITAPDRVQRARALSLLLARSGAGAALVQGLLASKHAGVRVDLLQALASLGGQAL
FT                   VAAAPHLLERGDSDVVALIGRALLGHLGELAEAPHTRLRTAIERAQRRLSGDELAISAL
FT                   HECLLELEVESAIDTLAAQVDTLAVDTVQRIATHIAALPPERRRPLLPKLLAAFEYAPR
FT                   RALLFADSLHAAWPELRPPRRAALREILSSAAGSALPRGLPDASLRAIGQLYALALEPG
FT                   ARPPEAVLLALDRSDDAAVLSTAVAIHETLATEAAARRLAAYLDEPDEAVRAAAHQALL
FT                   RLSEDAEAPYRVRFRDDGKAEIAPDYRTPEGEALRAEHGSLRSDSGEAYLLDARGRPVA
FT                   ERDTEWRGCRCCERPRVLVREGDERPTCPVTGEAHLLEDGRTVLERDHPLGGCDECESV
FT                   APLLRHGNEVRCETCETTHVQRRGRYRAQRRPREHAEIAEPLPQDQPLAPQPQTLPTPP
FT                   SASDLELVEPAIARAMAANVFVLGSGLEQSWTGSGVIVARDGNELAILTNRHVVEDVDA
FT                   GGRSHVASVRVYTISGELKRARVVWRAERGMDLALLSIRIDEPERVTVTELQAGPCVVG
FT                   ERLFSIGNPLGLSWSYASGTLAAFRTFTSKAGLEVRFVHSHVNMSHGSSGGGLYHEKGH
FT                   LVGINSFIGGTAVGPGGVQSFSIAMPSALDALRREGVRFAGKPLVP"
FT   gene            233568..234503
FT                   /locus_tag="Hoch_0157"
FT   CDS_pept        233568..234503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0157"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: gme:Gmet_0041 HSP33-like
FT                   chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12798"
FT                   /db_xref="GOA:D0LGQ2"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGQ2"
FT                   /inference="protein motif:PFAM:PF01430"
FT                   /protein_id="ACY12798.1"
FT                   /translation="MTDTIVRGLLRDPPVRVIAVASTEVAREAARRHQSVGGAQVALGR
FT                   AAACGLLLATLTKSGEQVTLQFMGDGSLGGILADAYDGGKVRVSVKNPSALLPGPHGQR
FT                   VSVAEGVGRSGVVRVIRDMGKNFQTSGQSTLLSGEIDEDVEHYLRTSEQIESAMGCEVL
FT                   LGSSEVTAAAGVLVQCMPDGDATALVAQVRSKLSGGALLELLRAHEADLASASEADSAA
FT                   LLVSLVRSLLGEHGADFEHLDSRPVSFHCPCSKDRVMTSLSMLEPEALEEMLREDRGAE
FT                   VTCNFCREVYQVSESELAELVAQRSSRSPS"
FT   gene            234644..235423
FT                   /locus_tag="Hoch_0158"
FT   CDS_pept        234644..235423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; PFAM:
FT                   conserved hypothetical protein; KEGG: afw:Anae109_3061
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12799"
FT                   /db_xref="GOA:D0LGQ3"
FT                   /db_xref="InterPro:IPR011737"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGQ3"
FT                   /inference="protein motif:TFAM:TIGR02206"
FT                   /protein_id="ACY12799.1"
FT                   /translation="MFAKEITEPFDLFGPAHLIAMLLVAVVCIGFPLWMRGRPPRWQQR
FT                   VAYGIAALMLLYRMCAPFIYNYYDDLPLIWNLPLQICGMLAVLNAYMLITRSYRVYHVA
FT                   YFLTLAGAMQALITPDSFRAFPHVTYLLSVLTHGLIVLAVSYATLVFRFRPTWRSVAIV
FT                   FVFGNLYMLALFPINKLLGTNFMYVMHKPPSASVLDYFGPWPWYLIVAELIGVVLFLFW
FT                   YAPFAIKDWVKGRKPTYEQISGQAYEKALAADRAAHS"
FT   gene            235473..237014
FT                   /locus_tag="Hoch_0159"
FT   CDS_pept        235473..237014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0159"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase;
FT                   aminotransferase class V; KEGG: similar to predicted
FT                   protein ; K01634 sphinganine-1-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12800"
FT                   /db_xref="GOA:D0LGQ4"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGQ4"
FT                   /inference="protein motif:PFAM:PF00282"
FT                   /protein_id="ACY12800.1"
FT                   /translation="MSTSDSQTPPAAEERAPEAGAPEDARIPAHGVAAEELLARMNARR
FT                   GEDADWRHGRVFSLVYHLGDEHEELLEQASSLYFSSNYLNPLAFRSLKRMEAEVVRMSA
FT                   DLLGGDGEVVGTMTSGGTESILMAVKTYRDRARKRRPWIRHPEIVAPSTVHAAFRKACH
FT                   YFGIKLVTVEPGDDYRADVAAMARRIGRNTILLCASAPQYPQGVVDPIEELGALAQEKK
FT                   LPLHIDACIGGFLLPWVERLGRPVPRWDFRVPGVTSISADLHKYAYAAKGASVVLYRDM
FT                   SYLQHQFFVATDWSGGIYASPTMAGTRPGGAIAAAWAALHALGEDGYLDSARQIMEATD
FT                   RFVAGIHTIDGLQIFGAPHMSLVCFGARDPELDIFAVADALERRGWHIDRQQSPNSIHV
FT                   TLMPQHLEVLERYLSDIAEAVDEVRADPSLRTQGQAAMYGMMAKMPFARITRRGVVELM
FT                   KQMYAARGSGVPDLAAPGGDDKLLGWLTQRGPQVLELVDGVRAAASKLGEKFGRR"
FT   gene            complement(237078..238652)
FT                   /locus_tag="Hoch_0160"
FT   CDS_pept        complement(237078..238652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0160"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce5595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12801"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGQ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12801.1"
FT                   /translation="MSHSLRSTTKPSACLWAAAALSLGALGCGDNLEPPGAEPDAGTPE
FT                   VDAMAPANSVCSAPIELLGVQAESGSATGDTASSTLSPVDLGDCVTAGDTAIAQQVVAY
FT                   TVPGSGRTGVEFSLVNDGTPASFDTVVQVRSACEMTPEELATSCFDNASFAERRSRGTF
FT                   FAEGGDTVYFVITGDPEPGDGRVSEGAWRLEVFSDAASTPSIDSARVTILQTFLDIAVS
FT                   GGDSGADASGVRVLPYIDEDTIYDTNFDGMGDQRDRVIFPLPEVSGETSFSRGVRQEAF
FT                   GNLYSGDVVAAEVSIVDRFGDESERIRVDVLEPDLRGPDASCDQDVDFCAVDLACEEQV
FT                   CTVPTAVSDACDAATAIAIDTPAGDTVTTATQALSLPAGSGVFTATCTETGSAEVLFTV
FT                   EVPAGGPFDLLATTALEATGEIDTVLYARTSCVDPTTEVTCNDDADRANDVYQSTIVIE
FT                   EAAAGSYTLVVEDYAFAFDPLPADIELQVSLRPVLSSGASCDDAEVENRCADGACTDGT
FT                   CPEPLSR"
FT   sig_peptide     complement(238569..238652)
FT                   /locus_tag="Hoch_0160"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 28"
FT   gene            complement(238705..239220)
FT                   /locus_tag="Hoch_0161"
FT   CDS_pept        complement(238705..239220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce7546 PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12802"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGQ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12802.1"
FT                   /translation="MTTGTSGPSLAARLAPCALALGSATAALAGCDDASSGPGETVDAA
FT                   PADAASPDAAPADAAVRSYESDIAPIWQLHCMPCHGPDERFDLLRLDIGRENLVDQSSQ
FT                   QVIEWLLVSPGDPEASYLWLKIEGRQDELNTSFPMPPPNLGGTFEPIPASERERIRAWI
FT                   EAGAGDTW"
FT   sig_peptide     complement(239140..239220)
FT                   /locus_tag="Hoch_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.575 at
FT                   residue 27"
FT   gene            239271..240731
FT                   /locus_tag="Hoch_0162"
FT   CDS_pept        239271..240731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0162"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: slc47a1;
FT                   hypothetical protein LOC100125051"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12803"
FT                   /db_xref="GOA:D0LGQ7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGQ7"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACY12803.1"
FT                   /translation="MRAGPARMRQAVGAPRLRAAERSGNRSGFMAHRKKKAFVREARHL
FT                   IALGGPAALTQLGAMLLGVVDTLMVGRLGVHELDAVSLGNVWVHGTLIFGMGMVLGLDP
FT                   IFAQAHGARDGKRVGLTLQQGLVVALLASVPIAACWTVTEPVLKSLAQLPSLAAASGEY
FT                   LLPQIPSIPAFLFFMVLRQYLQGRGVVMPALIITLVANGFNVLANWVLIFGNLGMPAMG
FT                   LTGAALATSATRIFLLVGLVGYILWRRLYRDAWVPWSRRAFARGDLWLILKSGTPVALQ
FT                   YMLESWAFQVATLMAGTIGAVPLAAHTVALTLAATSFMVPLGLSIGAATRVGHLIGAGK
FT                   HRQAQQATYVALVLGAAVMVVSAAIFVGLRWHLPRLFTQDAGVIALAATILPIAGAFQL
FT                   FDGVQAVGAGILRGMGNTLPAALFNFAGYYLLGLPLAAVLLAYTSLELVGIWWALVLSL
FT                   AAVAAGLAIWLWRRGPARRRGPRVGVPA"
FT   gene            240791..241747
FT                   /locus_tag="Hoch_0163"
FT   CDS_pept        240791..241747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0163"
FT                   /product="dienelactone hydrolase"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: tgr:Tgr7_0661
FT                   dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12804"
FT                   /db_xref="GOA:D0LGQ8"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGQ8"
FT                   /inference="protein motif:PFAM:PF01738"
FT                   /protein_id="ACY12804.1"
FT                   /translation="MNQSVSKSPRHGVRALRARILGVAGAALLLAACGGKGGEGAEEPA
FT                   MDPNAEMVGKDMGAMDESGKPMAAIDDIDMDGIVGEEVAYEADGITMQGYLAYDENADG
FT                   KRPGVLVVHEWWGHNDYARQRARMLAKLGYIAFAVDMYGEGKNTEHPQEAGAFAMAAKS
FT                   NLEGARVRFEKALEVLASNEHTDVEDMAAIGYCFGGGVVLEMARMGVELDGVVSFHGSL
FT                   DTDNPAQPGQVKASVLVLNGDNDPYVKPEVVSAFKEEMDAADVDYQFVGYDAVHSFTSP
FT                   DADRYGEEHGLPLAYDEEVDRASWKAMQDFFNQIFAD"
FT   sig_peptide     240791..240904
FT                   /locus_tag="Hoch_0163"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.615) with cleavage site probability 0.267 at
FT                   residue 38"
FT   gene            complement(241781..244672)
FT                   /locus_tag="Hoch_0164"
FT   CDS_pept        complement(241781..244672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0164"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide repeat; KEGG: scl:sce1684 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12805"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGQ9"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACY12805.1"
FT                   /translation="MMGRRSAAPQRGRRIAAAAVFAAALALLAQPAAADLASGKRKLLR
FT                   GDYAAARADLADVGGRDRAAAQLALARVEQRVGAYDAAEKRARGLLGRGDAIATDARVF
FT                   IAELQRLTGRYADARRELEAVVFPGGAPAAPAAGNAAAGGALAGKTPSAHLRGRYLLGL
FT                   VYADLGQQQLSDALFETFFDDWNSGRIDAKDAPGLLYLAQAARYRESFQEANDVFREAV
FT                   GIDPQLLEANLAWGDMGLEKYAVALAEQSYDEVLKIDPNHPDAHSGMARVKLEQSYDLA
FT                   AAFDHLEKALASNPRHLRSLLVRASLEIDQNQWDAAQATLAEVFAVNPMNFEGRALLAT
FT                   VHWLRDDSAAYEAERERVLAANPGYAAFYHIVARSAVREHRYREAIALEEQAVELDPDY
FT                   HEAMQALGTGYLRLGDEERGLRWMRKSWQGDEYNVRTYNTLELFENELPKEYGFVQSKY
FT                   FKYRYPNEERTMLRRYVEPLLERAFEDMVARYGFRPEAPLIIELFHNPEHYSVRTVGLP
FT                   NLGALGVCFGHVITAMSPAVGEINWGMVLWHELAHVFAIQMSNSRVPRWYTEGLSEYET
FT                   LRARPEWRRENDADLYAALADGTLPSVAELNYSFMRPSMQQVMVAYYQSAVTMEYIVET
FT                   HGFDKVLEGLRLFGQGKETPEVIELITGHSVADFDTAFRAYLRHRLAPYRGSFRVPTEG
FT                   FDDLDALRAAARAAEDDADAQAALALGHFYQGDAPGALQAAGRALELMPAHHLALYVSA
FT                   EVALRQRDVDTALEHFRALIRAGGDSFDVRGRLGMIARLQDDLDEAIRQLCAAKRLDPE
FT                   RSYPYSELYDVYKEAGRMDEALAELETYVMLEQMQYGPLRELVGAYAERARWDKVRVYG
FT                   EMAVHINPSDAELFLMLGQAYLETGDPAQALFTFDSALLAKPALRRPALAHIGKARAHL
FT                   ARRQRRPAAAELRSALQLEPENAEALELRRTMR"
FT   sig_peptide     complement(244568..244672)
FT                   /locus_tag="Hoch_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.936 at
FT                   residue 35"
FT   gene            244805..245329
FT                   /locus_tag="Hoch_0165"
FT   CDS_pept        244805..245329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12806"
FT                   /db_xref="GOA:D0LGR0"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGR0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12806.1"
FT                   /translation="MSTEQTRSPQSDADKHRGFSIYDDFDSFLKVGIREYYDRGWAKRR
FT                   GNFIALLIASGQTAFALARDSMVEGKGTRKVAIGAAAVVALQVGLRYAVGGPLGLVLTV
FT                   AAGASMVSYFIRNQKDIVRKVGIYKRVIQDTSKRYEDAQNGWRDGKYDLSERNLMLDGL
FT                   MKRFLEQIDEA"
FT   gene            complement(245393..247372)
FT                   /locus_tag="Hoch_0166"
FT   CDS_pept        complement(245393..247372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0166"
FT                   /product="aconitate hydratase domain protein"
FT                   /note="PFAM: aconitate hydratase domain protein; KEGG:
FT                   scl:sce8685 3-isopropylmalate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12807"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D0LGR1"
FT                   /inference="protein motif:PFAM:PF00694"
FT                   /protein_id="ACY12807.1"
FT                   /translation="MATRRTFSLTPGKRVLFLTKDPALIRKQLAGELDLTMDDVAPEDL
FT                   LDDINTDAMTPAWVCFDYDPEKIATNAYAGLVVEGERLLGENALRSGDFEVIVAGAQKG
FT                   VGSSRETAAQAEVYSGSRLAVASSFAPIHARNNINIGQLMADHDTLRRLQAGEEIDFEE
FT                   FTAGHDPITRLIIEHGGLFPFCQALSLGDLRLPTVDTSVRSMNIAEKILARHLLPGQGA
FT                   YVQPGDAVLVRVDGGYSHEFTSAQVHFFLQREYGEDYAIKDPAKFAVFEDHLIYADGVE
FT                   KMRPFSAKIEELRRMQRVFQEHTGVRNFNAVDGVSPGICHQVAREQIIEPGDFIQATDS
FT                   HTCMGGASGALSWGVGATEYAALIYWGFTPISVPESIRFELTGSLPPGVTAKDVMLHIL
FT                   DTYAKREDTLNRVMEFGGEGLFALSPDERATLANMATECSARGAVMECDDTMLEWIASR
FT                   REDVSAAALKSKAVAPDPGASYAGGVHVIDLAEIAPMVATPGDPDRGIASDPKNGARIS
FT                   GLDQVAIDIAYGGSCTAGKRDDIDFYAKVMEEAERAGKRVAEGVSFYLQFGSREVAEYA
FT                   RERGYLGLFERTGVEIIEPGCGACIGCGPGVSTQPDQVTVSAINRNYKGRSGPGKLYLA
FT                   SPLTVAASAVVGRIVEYREGMFAE"
FT   gene            247628..251113
FT                   /locus_tag="Hoch_0167"
FT   CDS_pept        247628..251113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0167"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: scl:sce3530
FT                   ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12808"
FT                   /db_xref="GOA:D0LHE6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHE6"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACY12808.1"
FT                   /translation="MDVPTAKTSFFADLHTHSKYARATSKLSDLEHLAYWGAKKGISVV
FT                   GTGDFTHPAWRGELRDKLVPAEPGLFRLREDIEREVRARLDVPVRGLPRFLLSVEISTI
FT                   YKKGDKTRKVHHLIYAPDFDSVDRMVESLAKIGNLRADGRPILGLDSRHLLEIALSAGE
FT                   GCYLVPAHVWTPWFAVLGSKSGFDAVADCYGDLAEHIFAVETGLSSDPPMNWCLSSLDR
FT                   YTLVSNSDAHSPPKLGREANVFTCDMDYFAMRRALETREGFAGTVEFFPEEGKYHLDGH
FT                   RKCEVVLDPAETKALEGRCPSCGKPLTVGVMHRVQDLADRPLGYRPADAPDFRSFVPLS
FT                   EIVAEIVGAGVNTKAVGRAYESLLARLGSELFILEHAPIEDLRRGGHGQLGSRLAEAVT
FT                   RMREGRVIRQAGYDGEYGVIRLFEARELRRPAAVSLALALPEPPAAEASAPAPEPVPAS
FT                   PASVASAPGTAAEFDPPPSEIPRPSPETLRDGAASSLLSALDPEQRRAAECVHGPLLIV
FT                   AGPGTGKTRTLTHRIAHLVEDIGVEPAACLAITFTNRAAGELRERLDALLPGAGAGVAV
FT                   HTFHSLALRILRENRVRAGLHRGFRVAAESECVALLADALGCLPAKARSVLARLRRASV
FT                   AASVAAGAGQGAAEQPPEASAESLDDELARAHRVYRQALEEAARLDFDELLGRAEALLR
FT                   EDDIGLAYRARFRHLSIDEYQDIDAQQYRLIALLSGDVGAAGMRDGGQDEAGGSRSLCA
FT                   IGDPDQAIYGFRGADVGFFLRFREEYPRTREVQLTRNYRSTATIVDAALQAIAPHSLVA
FT                   ERVLEAADAGEGAASLPVHVVSAASARAEAETVVHSIEALIGGTSFFSMDSGRLDDIGV
FT                   GVGVGAAPGERGAAPTENDESDDLSFSDFAVLYRTDAQSGLLCEALARSGIPFQKRSHH
FT                   RLGDDPLTVALLGEMRDATAAAAAEDAESPPPGALQAFLDAASIRLRARLETAVAAGPT
FT                   PDATAAEATTSAVTGDPALDPARIAAVADLLRPLAARCDDLDSFANELALEAEVDLWDA
FT                   RADRVSLLTLHAAKGLEFRVVFLVGCEDGVLPLRWGSGRAEDLGEERRLFFVGMTRARQ
FT                   RLYLLHARKRRWRGELCELPVSPFVRDIEDQLLARGSSRPRKKPVVLHEQLGLF"
FT   gene            complement(251160..253613)
FT                   /locus_tag="Hoch_0168"
FT   CDS_pept        complement(251160..253613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0168"
FT                   /product="Alpha-tubulin suppressor and related RCC1
FT                   domain-containing protein-like protein"
FT                   /note="KEGG: scl:sce5367 BNR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12809"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHE7"
FT                   /inference="protein motif:COG:COG5184"
FT                   /protein_id="ACY12809.1"
FT                   /translation="MNEQQRQQRYTTMHSPITARPRAGACERLRRGGLRRGRLRRGRLR
FT                   HGIAFASLLVLALCALGCDAEGDHSSESVTLQVRFHGDEVAEQSLRGLHALLAPIERSD
FT                   VSEILVDVRYASNGQPFVLNFALTREGSTNAWQGTLPFLPRDEELRFFAKAYDSADILL
FT                   FTGETLATLTIVNQSVVIPLAPLQDEETFDLPRLVRIVYPSEVIAGQEVQIIFTIEGNA
FT                   GETLDYTIAGDDGSAPFTPFSGSVTLASSVADFIALYTAPEVDEVSDFHHQMVLSSVDA
FT                   LSSVAVATDFTTRVIPRDQGIPGVTGTRPSVRFNPVVLRMVANGSAIPGEVELFADVSD
FT                   DTDEAELVYQWGFEANDGTPAASFADAGANNPGRLQSYTGAHQGTITLAVTDEAGGTTT
FT                   LYYEMLPAQFTHIVDHDAANGLRRIVAGSAHTCVLTGEGKVRCWGENQYGQLGYGNLQD
FT                   IGGAATHLPYTAGDVPLPEPARQLVAGYDHTCALLESGLIYCWGKNNFGQLGYNRDDNV
FT                   GDGEPVTSAGYVTLGGLATKIAAGGNHTCAILEGGFLRCWGENTYGQLGLGHSNPIGDN
FT                   ENVFAAGNVELGDGVVVEDIALGFSHTCALLAGGGMRCWGYNGHGQLGYGHDDNLGDNE
FT                   SLETQGNVAVPGPVRKIVAGGQHTCALLQNNKLRCWGDGGDGRTGYGERNGTNPAYGDD
FT                   PGELPNGSLDDIDTGADVTDVVAGGAHTCALLSNGALKCWGTGSNGRLGYSDTGNRGTP
FT                   PALGVDLDGVSAYQIAAGEEHTCALRSNGTARCWGRGLSGRLGSGSEADILSPAAASDI
FT                   QVFEP"
FT   gene            254325..257948
FT                   /locus_tag="Hoch_0169"
FT   CDS_pept        254325..257948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0169"
FT                   /product="regulator of chromosome condensation RCC1"
FT                   /note="PFAM: regulator of chromosome condensation RCC1;
FT                   KEGG: scl:sce5367 BNR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12810"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHE8"
FT                   /inference="protein motif:PFAM:PF00415"
FT                   /protein_id="ACY12810.1"
FT                   /translation="MGEAHVVRPSGKPGRTGMAARPRGRAPGVIAACLLSMGGLGCALD
FT                   GSPSDGETQVRLQVRLHGTAGSAAATGAVLAERHATPGAALQSLLAPAPIEFDQIDEIL
FT                   VDVRREVDGQALLTDFPLVQSEPGVWGAELPFLPRNQQLRFHAEAFDASEEMGFVGDTL
FT                   VTLSADAEDVVVPLSPLQDGETFAMPRVEAIRYPAEIAAGQEVQIVFSLAGNQDQRITY
FT                   SIDTEPGQGSFQPAAGSLTLNGALTDFIVLYTAPEVTEDATLAHAITLHADQGLSSVDI
FT                   ETNFDTAVRATEPGTVVDTSVYVRFNPVVRTLTLNGTSAPGSVILTADVSDDGPAESIS
FT                   YAWTYTPDEETPAASFANAGAGNPGILEGYTVAHQGVLTLEVSDADNGVTTLYYELVPN
FT                   QFADVITDDPAAGLARVLAGRAHTCALTGDGRVRCWGDNTYGQLGYGDSVNVGDSVQRL
FT                   PYAAGDVPLGEPVKQLAVGDDHTCALTLAGAVYCWGKNHFGQLGYGTTQNLGDSEPVLS
FT                   FGYVSLDGLATRIAAGGDHTCAIVNSASMSGGLRCWGRNDAGQLGVGDTFALGDDEEVF
FT                   GLRDIPLGGPVADVVLGGSHTCALLESGAVRCWGENAYGRLGYGHTLRLGDDETLDELT
FT                   DVLMPGPVRKLVAGEAHTCALFESGGVRCWGQGNYGALGHGTTSHWGDGAGETPAALAA
FT                   DVATGGQVVDIAAGAQHTCALLTSSEVTCWGAGSAGRLGYGNVSTRNTPGPELDLGQSN
FT                   AFQIAAGGAHTCVIDNAGAVRCWGEGGAGRLGTGTPAAVLAAADALIAPVLAEGPGCTD
FT                   TGEDSNEDGVPDACNSVTAVVAGSAHTCALLDTGRVRCWGRSNYGQLGYASTATVGASN
FT                   HPASMGDVDVGGRVIQLVAGNYHTCALLDAGSVRCWGQGANGLLGYGNTNNIGDTETPA
FT                   SAGDVDVGGRVIQLAAGVAHTCALLETGSVRCWGYGAQGRLGYGNTDDIGDTESPASAG
FT                   DVDVGGAVAEIAAGGGHACAILSDGRLRCWGYGTYGQLGTGNSTNIGDGETPASVSPVA
FT                   FDVPVVQVVAGEYHTCARLRGGAVRCWGRSNQGQLGYHSTSTLYSPGGDVNLGAPALRL
FT                   STSNDHTCAVLEGDVVRCWGYGSNYQLGYGNNNHVGDNEYPYQAGPVNLGGPAYGVAAG
FT                   GSHSCAVVSGTVRCWGSGNYGQLGYASTSTRTTPGGAVQLF"
FT   gene            258066..258935
FT                   /locus_tag="Hoch_0170"
FT   CDS_pept        258066..258935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0170"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: scl:sce5059
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12811"
FT                   /db_xref="GOA:D0LHE9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHE9"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACY12811.1"
FT                   /translation="MLWLAAPLARPCLVKLYAISDLHVGHPDNRGVLERTPAYPDDWLI
FT                   LGGDIGETARHLAYTLNILRERFARILWVPGNHELWTIPGRETLRGRAKYEALVEICRH
FT                   FDVITPEDPYVVWPGEGGPHLLCPLFLLYDYTFGPDGVAPEQAVDWARETGIECADEVV
FT                   LHPDPYESRAAWCAARCDETERRLERAVAEHDCPLVLINHFPLRRELAVLPRIPRFSVW
FT                   CGTRRSEDWHTRFRADIVLYGHLHIRRTQHIDGVRFQEVSMGYPRQWQHRIAEEGAHLG
FT                   AFLCPILP"
FT   gene            259301..260440
FT                   /locus_tag="Hoch_0171"
FT   CDS_pept        259301..260440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0171"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12812"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHF0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12812.1"
FT                   /translation="MPSLDPSVLDGPLRAVSPGVIDLAVEDSSVHRVSQLAHRGEVIEA
FT                   AQQAEALLADRVYDMRLIGYFLFGVFLERGLAYLPDLLYRIRDLLMDDFAALGPNRRKP
FT                   RVVDAVLLWLFQSIDARARFHADFQDETWQAWLDDSGSGLSKRIVASVAEVQQAATTRL
FT                   DEPQCAPALLRLRLWIENDFARALVRQHQPAASVTTRPLERARASERPVARAPERLRQS
FT                   ERPRQSERAHAGERPREFDRSGEPSVPLSATEEAAPARPARTTLVGTAPGPMPANPLPA
FT                   EVGEVSPAMQELLRKLRGFSNLVQRGDYAKAAVIANDLRQIIENFDPVVFLPRLFVDYF
FT                   RNLNGSIAEILPHWEAMGSPSWKALEQFYRVDLESFLDE"
FT   gene            260850..262601
FT                   /locus_tag="Hoch_0172"
FT   CDS_pept        260850..262601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0172"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: sbp:Sbal223_3594 outer
FT                   membrane adhesin like proteiin"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12813"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHF1"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACY12813.1"
FT                   /translation="MRLLASAALVGGCAAEQTPRDYDLADIDVSVQEVRTGRSAGKNLL
FT                   SLDMLSTYQGRALGCDDGTLDISVGIGSSPDGPFEELPGDAYEVRCTASEAPDVALVID
FT                   NSGSEQGYLEWLQEAAHVMTDAVMGRDGRSSLVRVSTDSDIRLGLTEDEEAIRGAIDEL
FT                   YILNGWTALYDGIRLGNETLGAAAATHSDYDSMDDFCDTDRKLAVVAFTDGNENNSANE
FT                   RLRSDEYPGDGIDTTLEDLHDLRVADVRTPIYTVGLGDEVDHGGLEELAGYTGGRHHRI
FT                   DSAADLPATFEVISEYLASSVKVCTEISADICGHHYVRVEYTWAPCDDGTCDEVRDSYL
FT                   QEIHVECPPAPPAGKVATVLLTLSNPGIDRDLAKTLASNTVNWVSPSADPRVIVVKDEN
FT                   HHGEFSQDADFVYELLSEAGFQVDFVDEPVGGISAADTAGYDVVWMSNPGYPFDDQSSM
FT                   NALASFGQDGGGYVLQSDDGTRLSGDLAFAMSSFTGLLYENNGTSFCGRHIDNNATPDK
FT                   YQVMISDSAHPVIAGLEGASFLYGNDIDVSSPADAGEEILAWANGVDASGEVFCEREIP
FT                   VISVRTP"
FT   sig_peptide     260850..260897
FT                   /locus_tag="Hoch_0172"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.811) with cleavage site probability 0.668 at
FT                   residue 16"
FT   gene            262694..263386
FT                   /locus_tag="Hoch_0173"
FT   CDS_pept        262694..263386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0173"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce3413 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12814"
FT                   /db_xref="InterPro:IPR009218"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHF2"
FT                   /inference="similar to AA sequence:KEGG:sce3413"
FT                   /protein_id="ACY12814.1"
FT                   /translation="MSNSEDDGGAAGDALAPGDALAPPPGPPLPPGLWEALRRCYETPP
FT                   RFYHDAAHVSEVARQYCAVERELGWAQPREVYWAVLFHDAVYEVGARDNEARSAALAVE
FT                   WAARWLVGEHAFCAPGFRAQEASRLIELTARHGALTAADVDDQSARFLDCDMAILGAPP
FT                   EQYAIYERDVAREYLPHYGEADYQRGRAAFLAGMLARPRIFLSDYFHERLDAQARDNLR
FT                   SALAGLGD"
FT   gene            complement(263564..264010)
FT                   /locus_tag="Hoch_0174"
FT   CDS_pept        complement(263564..264010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pla:Plav_0106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12815"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHF3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12815.1"
FT                   /translation="MNKPTHNPAHTPDNGKGEITQNHRTQSQRKEENIDEALDESFPAS
FT                   DPPPWTPGPAPVRHERKREGDTPDKQQRPKAERTPEERKTSGHGPGKRFEELDERERQA
FT                   QAEPHRRDAQCGPRTDMPGRRVVPQGPHEAFPGERPSVPEHSQR"
FT   gene            264121..265707
FT                   /locus_tag="Hoch_0175"
FT   CDS_pept        264121..265707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0175"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   scl:sce1996 NADH:flavin oxidoreductase / NADH oxidase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12816"
FT                   /db_xref="GOA:D0LHF4"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHF4"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ACY12816.1"
FT                   /translation="MAEVMWQPPERIKHSLPETRWPTRDEAAAALLYQPLRVGAIEIAQ
FT                   RTWVPAMVPWRASPEGMVTDEVLDWYRRFAEGRPGVLVVEATGIREVPSGPLLRIGHDR
FT                   YVPGLRRLVDTVREASQGQTRLFIQCIDFLRIRRRPTRADYLQRFLLLRRAHRARLAAL
FT                   TGDSAIEEHTLWSEEAVRSLLLALDEHRLAEVLSTRELEDLNYGYRERVTDMQLEHVAA
FT                   LPATLPGLFADAAERAAQAGFDGVELHYAHAYTMASFLSARNLRDDGYGGSREQRVRLP
FT                   LEVIGAVRARVGKRLALGVRFLGDEVIAGGSRIDDAAYFGVRFAKAGVDFLSISKGGKF
FT                   EDAKQPKVGAAAYPYTGRSGYECMPTVFSDERGPFGRNLPLAAAVREAVRANDLEIPVV
FT                   AAGGIATFEQAEALLQRGDADIVAAARQTLADPDWFHKVRIGRGDEVRRCEFTNYCEAL
FT                   DQKHVPVTCKLWDRLERDAPDVTLDATGRRRLIAPPWSDAVPRPTPEFDEDAGDADADA
FT                   DADADSELGDD"
FT   gene            complement(265720..268053)
FT                   /locus_tag="Hoch_0176"
FT   CDS_pept        complement(265720..268053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0176"
FT                   /product="SNF2-related protein"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   SMART: DEAD-like helicase ; helicase domain protein; KEGG:
FT                   pmy:Pmen_3239 non-specific serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12817"
FT                   /db_xref="GOA:D0LHF5"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHF5"
FT                   /inference="protein motif:PFAM:PF00176"
FT                   /protein_id="ACY12817.1"
FT                   /translation="MLASSSPRVRRPVTDSASCVPCIRLFRESLLFDSGDGWSADYQEV
FT                   DVAVIQLGFEYSGVRVRMGDPVDRVFRASGKGTSWLDRDRRAEAQAQYLLESFGAVEIG
FT                   CLHDCAAPPDSAADYLVHPSGDVHALCSFSAYALPQLRSMGWRIDVDAAYPYQLVPAEA
FT                   PWYAEIEPDAQTDWFELELGVEVEGRRLNLLPALLDLLDRSADIDHLGDLSRASGRCVA
FT                   LPTGDGRYMPLPHERLHNLVCTLLELYRGEEDRAALRFRIDAAAALEHLDDAIAPMWHG
FT                   AQEVRERGRRLARRGSMETLKATPPAGLQATLRPYQEAGLAWLQSLREHDAGGVLADDM
FT                   GLGKTLQTISHLVAEKEAGRLDQPALVVAPTSLVGNWMREMARFAPSLRCLAMHGSGRH
FT                   ALWKRVAESDVVVTTYGLLIRDLERFRERSYHLLILDEAQAIKNRRSQAHRAVKAVDAR
FT                   FHLCISGTPVENDLEELWSLFDVLMPDLLGSAEQFRSLFRYPIEKQRSQSRLEALRERV
FT                   APYILRRMKEDVAPELPPKTEIVRPVALTGLQRELYESIRMSAHADVRSIIRKKGLAGS
FT                   AIAILDALMKLRQVCCDPRLVTVPSARRVKESAKYALFFDLLSTQREQGRRILVFSQFT
FT                   SMLALLSQGLEERGVAHSVLTGATANRQRAVDEFQEGRTEVFLISLKAGGTGLNLTRAD
FT                   TVVHYDPWWNPAAQAQATDRAYRIGQTRPVFVYNLITAGSVEERMLALQQRKRHLADTI
FT                   LGQGGPSSSFDEGELDELFAPLSD"
FT   gene            268205..268987
FT                   /locus_tag="Hoch_0177"
FT   CDS_pept        268205..268987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0177"
FT                   /product="protein of unknown function DUF152"
FT                   /note="PFAM: protein of unknown function DUF152; KEGG:
FT                   hypothetical protein ; K05810 conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12818"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHF6"
FT                   /inference="protein motif:PFAM:PF02578"
FT                   /protein_id="ACY12818.1"
FT                   /translation="MSQLVPDGEIRLYRSRLIDDTLFLHGFPERTGGVSSGLRRSLNMG
FT                   VRWGDDYAAVERNRALLAEHAGYPPEALVATKHVHGNAVWVVGEPLPEPAEFDGLVSDQ
FT                   PGQILGAFAADCIPIVFADPEARVCGAAHAGWRGTLSGVAGNVIARMLERGSKAADVRV
FT                   ALGPSIGPCCFEVGPEVVAAFREVWGDLAGMVVAGPRREHIDLRVVSRAVLERAGVSRE
FT                   HLDDTPPCTMCHEERFFSYRRDGREGGMHMGFIGLRAS"
FT   gene            complement(269034..271394)
FT                   /locus_tag="Hoch_0178"
FT   CDS_pept        complement(269034..271394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0178"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gbm:Gbem_2063 NHL repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12819"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHF7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12819.1"
FT                   /translation="MLINLPERRNPFGYWLGAGLAIAALALPACGDDGGDGDGNEPDAA
FT                   APDANIGDGVAPTVRISFPPPSSLTDSDSVIVRGTAADVDGIAELRINGTAVQTSDNFA
FT                   NWTATITLSHGANAIAVESEDIYGNSDASAAAISVVQSKNFLDAPLAIAADPANGRALV
FT                   MDELASALLSVNYTTGERVIVSDDATGAGPEFGRPSAIALDSAGNRAFVLDGLSVLQVD
FT                   LTSGERKLVTDEDTDTDDPLVEPRDLVYDPTGARLLLLDVDDPDQPVTVLYAVDIESGD
FT                   RTALPEEIVPAGALPPVDTLRQPQSMAIDATGNRIILAATDVETDPERPSRALFSVDLE
FT                   TGLATVFSTNATADQGPLLNPLPSIAYDASITPGRVLALSDSNDTVLSIDTQSGIRTVV
FT                   SDDDATPGQKLSVPTALALDAPEGGTARVLVVDRGIDMVLAVNIATGERTVLSGSLMGE
FT                   GPQMVEPIAVALDNAFDPAGRAIVLDRAEDAAFVIDLGTSERTLLSDADNGTGTEFDVP
FT                   DSLGLPVAAELTVQQESLGEVLVADPGAGLLFRVDLATGERRVLSGGPAGSGPELGAPR
FT                   GVVFDPGVASDVPEEVVPARYLVVDEDLNALLAVDPDSGARTVVSDDATGQGPSLDEPR
FT                   SVILELDDKGRTGRAIVVATAPAGLIAVDLATGDRTEITGENIGDGPDLVAPTQVMLEL
FT                   RRAPAGSANDFEPTGSALVVQTSSDYLVAVDLSTGRRTPIRNGEDGSGPELDTATRGVW
FT                   FDAENGRLAVTDQGVSALFMVDLANDQRVIISR"
FT   sig_peptide     complement(271299..271394)
FT                   /locus_tag="Hoch_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.986 at
FT                   residue 32"
FT   gene            271580..272389
FT                   /locus_tag="Hoch_0179"
FT   CDS_pept        271580..272389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0179"
FT                   /product="protein of unknown function DUF540"
FT                   /note="PFAM: protein of unknown function DUF540; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12820"
FT                   /db_xref="GOA:D0LHF8"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHF8"
FT                   /inference="protein motif:PFAM:PF04401"
FT                   /protein_id="ACY12820.1"
FT                   /translation="MLRGVFAALGGLRAALGNRAVYAVYFRFTLTLLVLSLVLLGGLGA
FT                   LVWWLTEPASAQGAAASAQGAAAADQGGLLAEYGLDALVGGGLWVLRVLGLLIAALASP
FT                   LIAFLLIGIVFPVFAETLFFAGLRVMAPKRAHELEAAPGLAFLPSLWKSLRLLLHLLGY
FT                   TVIALLLGIIPVVGVVLGPVVQFWGTGKVLGWELLDPYFSKRSMRYPAQREYVGARGFA
FT                   FVGFGLPWMLVLAIPVIGPLLFGLAQASAPALLVRVLEPPQSAAESE"
FT   gene            272433..272834
FT                   /locus_tag="Hoch_0180"
FT   CDS_pept        272433..272834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0180"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12821"
FT                   /db_xref="GOA:D0LHF9"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHF9"
FT                   /inference="protein motif:PFAM:PF01152"
FT                   /protein_id="ACY12821.1"
FT                   /translation="MTLYDKIGPDALRAVIVDFYERIFADVMIGFLFLGKDRARLIEKE
FT                   FEFTARFLGGDVRYTGRPMRAAHAASPIMGGHFDRRQQILRETLAAHEVDPEVREAWLA
FT                   HTQALRKQVTTDAEGACQDVAAARFTGAR"
FT   gene            273116..274537
FT                   /locus_tag="Hoch_0181"
FT   CDS_pept        273116..274537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0181"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number="5.4.3.2"
FT                   /note="KEGG: scl:sce2448 lysine 2,3-aminomutase; TIGRFAM:
FT                   lysine 2,3-aminomutase YodO family protein; PFAM: Radical
FT                   SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12822"
FT                   /db_xref="GOA:D0LHG0"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHG0"
FT                   /inference="protein motif:TFAM:TIGR00238"
FT                   /protein_id="ACY12822.1"
FT                   /translation="MVKLPTVANAIDDAIVHLKAPVDPATLAHRHLLDGPFWQRIPAYK
FT                   EVSEEQFLDHKWQAKNSITKPAKLLAALQEIVPQSFYDDVAAGFRKSPMSVRVSPYLLS
FT                   LIDWDHPYEDPLRTQFIPLGSRLTQDHPKLSFDSLHEQADAPVPGLTHRYVDKALFLTL
FT                   DTCPVYCRFCTRSYAVGIDTEDVEKVSLKAREDRWDQAFRYVAARPELEDIVISGGDSY
FT                   QLKARQIRHIGETLLGMDNIRRIRFATKGPAVMPQKLITDTEWLDALTGIVELGRKLHK
FT                   EVALHTHFNHPNEITAITKQAMDILFERGITVRNQSVLQRGVNDTVETMQLLVKRLSYL
FT                   NVQPYYVYMHDMVKGVEDLRTTIQTGLDIEKHVRGITAGFNTPTFVVDAPGGGGKRAIH
FT                   SYEYYDRDAGICVYTAPSVKAGYFLYFDPIYALTPEYQERWADDAESERMIAAAIERAG
FT                   RGVKRSARASTVPAP"
FT   gene            274624..275340
FT                   /locus_tag="Hoch_0182"
FT   CDS_pept        274624..275340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12823"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHG1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12823.1"
FT                   /translation="MRPQLSCVVSTLAVAALLGAAPLMTGCKGPGPKQIGEATLAQASG
FT                   VEAVPAEAEDAPVVELMPEREATIPEGSVVKLAIDRNTPWGQVIASLDVMAERQQTPVL
FT                   LVAERRRVRALPAIETLAVDDEDEVKSFLAAALEVIAYTDGKVCVRHPEVLEAKCVQTP
FT                   SKKYIDGAFTRQLVREATKGYGLRAAAIDLPAGLHWADAVRVIDGVRTCCGEDIAIRPV
FT                   YVPPEALPERVQVPAE"
FT   sig_peptide     274624..274686
FT                   /locus_tag="Hoch_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.745 at
FT                   residue 21"
FT   gene            276203..278506
FT                   /locus_tag="Hoch_0183"
FT   CDS_pept        276203..278506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0183"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12824"
FT                   /db_xref="GOA:D0LHG2"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHG2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12824.1"
FT                   /translation="MHVPRRIPRPCQPGAVAALLTSAALALGACLVPTEPWPDEFGIRF
FT                   EGVVVGSEPVRGATVEVWQVNDDGARIGGGPHRTAETDEQGRFAIHTGRRFKPPFVVIA
FT                   TGGTTSEYWSDDTLTLEERQQLRASITYAWLRRAKEPGIPLVLSPLTSAAAALGEARQT
FT                   EGLEADFESAADAAYGLLEEHFALDLRADVPTRETAGQVTEAVRHGLVLAALSGIAHQA
FT                   AQANGRSLQAVNILHVSEALAEDARGPGARLDGVGPDGAVALGTCGDACLLPADALRGG
FT                   IGRALAGDFLVSAANATGLGFADLSEYLLGLAAGSAAALFGDAPSEDLDKVPASLALRY
FT                   SPVFDETRDRVDSRAGQPPVHVHDPATPIDLAQGVADTCPVVFKHADLLRAPLASGADS
FT                   NPLRWRIAASDDLVGVRADDIDVTLLTPGGSSVPLALAEVSSEGSGVSFAVEADAAAMP
FT                   ALLSSEGEYRIEVNAKDLLGNAAAPLTACWEHRILAAPLFAGPLETLGPGSLDDLGAER
FT                   DNLAPLLRGDVAPKVASLIVENNTAAPVYLSLSIDEVVGRYSATWTNSRAFIREDDSVD
FT                   DCLAQNTCSLADPPAPTSQTLGPVDIPLSSLRLRVVESSSGRITPCSECDPSEFLLAAG
FT                   KRYEARLELADLSALIPAGVPREQLGEISVGPIGNAVKRTGIAAAYIQCGEEGQTAGEC
FT                   QFRTVFQLFQALTVAALEMDEVVFSAQVSALPSATPRTPLPADENSNATLSEPLSTGGW
FT                   QWITTENATLPEPG"
FT   sig_peptide     276203..276292
FT                   /locus_tag="Hoch_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.319 at
FT                   residue 30"
FT   gene            278766..279578
FT                   /locus_tag="Hoch_0184"
FT   CDS_pept        278766..279578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12825"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHG3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12825.1"
FT                   /translation="MPYGELFGGSCTLETGPNEHEAWMPHAGVHRNEIFDPDDGVTSTL
FT                   NWFGSYRANDRDEDHRMIVMATCLLPDETDDVCARNPWISHEVVRSAVGPGDGLDLRAA
FT                   CSTGTLFSGGCSADTIPDNDLSLMRSGFAPDNRDEWLCSFQSLHETVTYEVATMAFCLN
FT                   EDPLPAECGCCPPLAEQLTIRQTNEPLRNGPNRLEASCEDDEFLLIGNCMLDVPAVSEV
FT                   ESVTMFRYGYPPTDEHPDGDYSRWGCSWHNPTGYTPRALANAVCLPAQ"
FT   gene            complement(280197..282659)
FT                   /locus_tag="Hoch_0185"
FT   CDS_pept        complement(280197..282659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SNF2 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12826"
FT                   /db_xref="InterPro:IPR032871"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHG4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12826.1"
FT                   /translation="MESQASAPQRPTPPAVPRPASGSADTSQTDWATLDQQSKRDLLHR
FT                   AFCGTEPPDAATPSAATPVQTAPSPPLPQAAGPSHPPAAPVQRKPAQARETPLARARRT
FT                   RAIGDIKAVDDFGPLSDAERLAFIRALLAQLWVGIDDEAALVRIWTSFDGRMLAVAGAH
FT                   PGLWRQSLARGAKLDKLPAVTDVQARFRSDVHARARDILGRNEAYVRAEMDALGTSERG
FT                   TVTPAASVIPEDEQADYLASVRERAEDLVLARHAQARLAALEVGYERFSSKGGTIWHVA
FT                   RFKPDTPPTFAHDSEAVPAAQRAKDVRPWDEVKAHHERLQAVIAQLASASPVLYQAAAQ
FT                   GDDNALATMAAAPPGEARGTMAKRLSDQLSNIRTTQAELGSDLDELECTPLHEQLFAGA
FT                   ASASGTAWNAPGNQLIARQFIAGHARAKARTEAALATVAAAAFVIAEVASFGSATFFLA
FT                   AGAGVAAGGTLAAASWEHAEDLGTAANADAGAGGVVSRAQADRAQTTAIVNSALLFLDL
FT                   IPAARAARGAATASRGARAGAREGAEQAAERAGREGAEQAGERAGREGAEQAGERAGRE
FT                   GAEQAGGESAEQVAKASRRLQPNEAANWASVARDYVGKRLVQVGPPPGYSTYNVGERVI
FT                   LRRTNADDALFARLSLDEGGIIRAGAPPRIRVSNPLRKAESVGELLARAGHTARPPYHQ
FT                   AHHVIPDEVVRKSNLMRLARQRGVFDPDAIENIALLAKREVREEGKAPFTPAKVPGLSA
FT                   PLPRHQGPHPAYSEVILQAARRAEQELLEQGFTSLDEVPDELLKVATKDIQRDAWDTLE
FT                   MWQSAVLK"
FT   gene            283130..285001
FT                   /locus_tag="Hoch_0186"
FT   CDS_pept        283130..285001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0186"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   afw:Anae109_4431 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12827"
FT                   /db_xref="GOA:D0LHG5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHG5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY12827.1"
FT                   /translation="MLAPMSETNHEQAPADAASADADSGAGGDSGAYTESGAPKRGGIK
FT                   RLSELGRLVGLLRHYRGRFYLATIGLLISSGLGLVYPQAAKYAIDTGISGGSVEELNAV
FT                   LGWLLVAFTVQALMIWVRHYLMSWLGERAVADLRSMVFDRLLTLSLGWFHERRTGELVG
FT                   RLASDVTVVESVVGSDVSIALRNLVQLVGGVVLLFVVNAELTLYILMVVPPMTVGVVFF
FT                   GRIIRRMSKAVQDRLAEVSGQVQESIGAIQTVQAFVREKRESEVYRGGVEAAFEQALSL
FT                   ARWRATFFSTVSLTFYFAVAAIIWIAGRAVVRGEISPGDLTAFLLYTGIVASSLGSIAS
FT                   LWGSLQRAVGATERLFAIIDTVPDIADHEVATALPSGGGAVHFERVAFHYPARPDKPVL
FT                   SEIDLRIAPGETVALVGPSGAGKSTLTSLLFRFFDPVSGRVTFEGEDLRALRLSELRKA
FT                   MALVAQEPVLFSGSVRQNIAYGDDTATQEDIEAAARDAHAHTFILGMPEGYDTPIGERG
FT                   VKLSGGQRQRLAIARAILANPRVLVLDEATSNLDSESEALVQEALARLMDGRTTLVIAH
FT                   RLSTVRDADRIVVLDDGKIVETGPHEALMAQDGVYRRLVEHQLLAET"
FT   gene            complement(285025..285564)
FT                   /locus_tag="Hoch_0187"
FT   CDS_pept        complement(285025..285564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0187"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: sdn:Sden_2105
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12828"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHG6"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACY12828.1"
FT                   /translation="MRIAPVSWRALPVALLVALLTLGVTACAPKPVAATTSIFLVRHGE
FT                   KAMDAENPALTPAGRARAQSLAQVLRSVALDAVYSTDTARTRQTATPTAEAQGLPVRIY
FT                   DKDELVRLSLQLRQTPGRYLIVGHSNTTPELVAKLGGEPGAAIDEIGEFDRLYVIVLHP
FT                   DGSVETLLLRYGDAAP"
FT   sig_peptide     complement(285463..285564)
FT                   /locus_tag="Hoch_0187"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.509 at
FT                   residue 34"
FT   gene            complement(285564..285773)
FT                   /locus_tag="Hoch_0188"
FT   CDS_pept        complement(285564..285773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12829"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHG7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12829.1"
FT                   /translation="MTRHRYVDHLPDLIEPEEYAADPEGRRVKLRLKVTERGVEILGDA
FT                   VRPEELERILLALDPDILEQMLCG"
FT   gene            complement(285770..286804)
FT                   /locus_tag="Hoch_0189"
FT   CDS_pept        complement(285770..286804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0189"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: ppd:Ppro_0779 radical SAM
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12830"
FT                   /db_xref="GOA:D0LHG8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHG8"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACY12830.1"
FT                   /translation="MSEPAMRWQPAGFYRPGTRGPVCTLCPRQCELSEGALGYCQVRRR
FT                   RGAGLETATFATSVWHLQAIERKPLYHVRPGSRVLTVAAPGCTFRCSYCQNFRISQLGR
FT                   DVEARWDARPLAPEELAAAAAEADATIAFSYAEPILSTELTLAVAEQARARGGAVVWKS
FT                   NGFASTEAALRLARALDAACVDLKSADEAAHHMLTGARLRPVLDTLATWRAAGVWLEVA
FT                   TPVIPDFNSAPEDLRAIARLVYALGADTPWHLLRFHPDYRMGDTPPTSPALLQTARDIG
FT                   HDIGLRHVYVERALGQDARDTRCPSCQRVVVERAIWGLRALHLRAGRCEFCDTAIAGRW
FT                   EMPA"
FT   gene            complement(286801..288594)
FT                   /locus_tag="Hoch_0190"
FT   CDS_pept        complement(286801..288594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0190"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12831"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHG9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12831.1"
FT                   /translation="MSDTEHSDSQTASSDTETDSGAGAGTAAAPTTGALLADASAALGF
FT                   WGAAVSAGLDGTGRALRGPDGRCWVELAAPPERAAVLATAIGGLPFARRADAWYAVHAS
FT                   GQVIDALPLAAEPEPTPAPSATDANGARVLYTGAHRERLDPDAWTELDARALLAACALR
FT                   AVPLQPQPIIDVLIPAGLVRWTIEGALRRGLELELTPAAWQPAATARAASEGWMWLRMR
FT                   RPGGRVSVAWQRALIDLPGAAVARPARGGGARLLIDLRHRAAVDEPVLARLLSGDALAS
FT                   AGASDDRPTSEPELPVSWLLAGPELGAGRILARGAWLPAHALLPGQPPTHGQPPTQAQT
FT                   PTQPPAPAADASGVPEQASLAPVAVGLRRLSQHAGPATTDAVLVDEHEHGWLSRYLLAR
FT                   GLGETLYVVPGERRALLLSVGADLAALPFGTPLRRIGPGALFIDQTRALNPALPEVARA
FT                   RLFGMSDSVAVVLTDAAAWRFRLGKLAPAWTLWLGPGPSIRDAHDECVIDLRRMAAGTE
FT                   RLARPAVAKSEPARFRMSSEIQPAAGAPVSLEERARLRTEAATALLRGETVRAAEKLER
FT                   AGEALSAARLFERAAREREGA"
FT   gene            complement(288591..288872)
FT                   /locus_tag="Hoch_0191"
FT   CDS_pept        complement(288591..288872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0191"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GG18769 gene product from transcript GG18769-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12832"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHH0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12832.1"
FT                   /translation="MATRVRFRFNKTTGEVEEFLVDDQDRNLPESEHDRIAGEVARMVA
FT                   VRPHIEPVSDETAAAMPDTDNDNDRDRDSDGDRADERDADALPEPDRP"
FT   gene            complement(288886..289662)
FT                   /locus_tag="Hoch_0192"
FT   CDS_pept        complement(288886..289662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0192"
FT                   /product="response regulator receiver domain/DnaJ
FT                   domain-containing protein"
FT                   /note="KEGG: mxa:MXAN_1429 response regulator receiver
FT                   domain/DnaJ domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12833"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHH1"
FT                   /inference="similar to AA sequence:KEGG:MXAN_1429"
FT                   /protein_id="ACY12833.1"
FT                   /translation="MCNPRRIEITATRQVAEAWSREVERVAERSAQVTGEARVRQRLDD
FT                   SVAAPALAALERALREGVPGWRREGEGFRHEVEGGYAVYLPEQRVLEIAAVLGAEVRGQ
FT                   GRANMRLHGHVEDEIAGSGASEYYEDGYRGRTQEVAEGEAAQEAEHGIARAVAERVDEA
FT                   ARAAEAAAASELLARAEAQAGRDLEARTAAERARLEARAGERVELVGAHARQAFHRLLA
FT                   LAYRDALLALARARGADDIRCDDDGEVLEIEFSLPD"
FT   gene            complement(289655..290818)
FT                   /locus_tag="Hoch_0193"
FT   CDS_pept        complement(289655..290818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0193"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: mxa:MXAN_7011
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12834"
FT                   /db_xref="GOA:D0LHH2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHH2"
FT                   /inference="protein motif:PFAM:PF07728"
FT                   /protein_id="ACY12834.1"
FT                   /translation="MPWPEDIQTAIRQLQVLRRSLQQTFTGRDQVVEVLALGAVCQEHT
FT                   LLLGPPGTGKTELVTRFTQAVDAPLFSYLLTRFTEPSEIFGPLDVEAFQGGRYHIRTDG
FT                   MLPSASIAFLDEVFQGSSAILNTLLTLVHERVFHNGAERQRVPLLSLVGASNELPADST
FT                   LRAFSDRFVLRVAVAPVPDPQLDELLDKGWLLERARMEAPAARELPTLSEDALRSLHGR
FT                   LHEVAVDQIRSVYAQVLRELRAEGVEFSDRRMVKGLKLIAGAALMDNRTSAGIADLWPL
FT                   SYMWTTDDEAELVRPIVAQHLGDDDGARLAGSGTRSGEELRGELALLASREDALRGHSA
FT                   LGAHLMALGRLRREAILDHPDDDELRAAVEGAVSRVMALLEGPAPRV"
FT   gene            complement(290825..292900)
FT                   /locus_tag="Hoch_0194"
FT   CDS_pept        complement(290825..292900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0194"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   AAA ATPase; KEGG: mxa:MXAN_2898 ATP-dependent
FT                   metalloprotease FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12835"
FT                   /db_xref="GOA:D0LHH3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHH3"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ACY12835.1"
FT                   /translation="MRPRVDLCPLGGVRAVQNLRDQSLVLMGDGDDLRSLLERVPALSL
FT                   APLDSATLATALAELRLEVHDIDELDADTPLYRPPLAGATQAPGAGLARAESVAAIRPV
FT                   QVASATEDAAVASARPAAAPPVLRAAAPGAAARADGPHPDTVSEDDAVAVAYGDAIEEI
FT                   ASYLRAGLSVLVLCDKLVVRHLWPRIVRAAVREPLHLDPSSAQTTATAMSSASELGPEL
FT                   SPASNRPAQLDRLRDMLASMKRGQVMVLPHLDLLGAGGERGLSNEARTLARVLYEWPDR
FT                   LLLGFADHSLPLAPVIAERFAIRPELRGVPREVPAAEGARQVLGRAMLTAEEAAHFADY
FT                   DAGALFKNVAGLNPVRLRHAVAYAVHQARARGHDSERPAPSKLLIDAIRAFKIQTSSSF
FT                   EIPEVRMDDIGGYSEVKRTLGRAIDLIGGAWQLPDEALRSALIPRGFLLHGPPGTGKTL
FT                   FAKAVAHRLDAAIRVVSGPEVTDMFVGESERNLREIFAEARRNAPSVLVFDEFDAIAAS
FT                   RSGRADGGSRAGNAMVAQILTEMDGFRPDVPMLIIGTTNRLELIDEALLRPSRFQAISV
FT                   GLPDLDARRQIAAIHAARFHIQVAPEQLQHLAAISTGMNGDQLSAVFRDACLGLHCQRP
FT                   PIAFDNARMKALVDALRVDPRRRRDGVHSKLDILASKEVPTSPDAPSPPPPADAAE"
FT   gene            complement(292925..293911)
FT                   /locus_tag="Hoch_0195"
FT   CDS_pept        complement(292925..293911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0195"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acp:A2cp1_4033 para-aminobenzoate synthase,
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12836"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHH4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12836.1"
FT                   /translation="MSLQRALWALMRWAGEPDAPASAPPAIEVAALGEVTGDAIADLAE
FT                   PDEPLCALTSHLAAIQAARLGWTAPPLGDARDPGPAALWLAAAVAARTWPALCDRLLRV
FT                   IPAPECAWDLLLRHAIAGPVLAWSHAQQAGDTAASGAGAAAGASGDAPWLEAVCEASPL
FT                   TGVLAYPPRGQSDRCLALAADTIIAHPQGASSLAAHFATPVSPGPRALAVLTWRAHALD
FT                   RLRSGDQAQREFVLDVYEHALSVHRGALFAALESARAALGSASGAALAHALATARWWQP
FT                   LWHLHRSWPESLRERPYLDVPGLLAGLDLCRRAQILGASATAAVRAS"
FT   gene            294331..296853
FT                   /locus_tag="Hoch_0196"
FT   CDS_pept        294331..296853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0196"
FT                   /product="WD40 repeat, subgroup"
FT                   /note="PFAM: WD40 repeat, subgroup; SMART: WD-40 repeat
FT                   protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12837"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHH5"
FT                   /inference="protein motif:PFAM:PF00400"
FT                   /protein_id="ACY12837.1"
FT                   /translation="MRAYARWQAASVGRGAAPAPAWTPSLAQADGACLGLIEGFGGINA
FT                   TGIALAGDGVTLFTGHPHGRMRCWDLRTGARVWEAEERHARGIQALSLSADGTLLASAS
FT                   NDASVRLWDARSGALLAVLDGHGGTVWSVALAPDGSRALSGDQGGAVRLWRIARSGADC
FT                   SAELVSSNDAHGQAVWSVAFAPDGARYASAGADRCVRMWDSASGSEIGRMDGHEDTVWS
FT                   LAFSPEGSRLASGSADRSIRLWDVATLQPVGRLEGHEHGVAGVGFSPDGRLLASASSDH
FT                   SVRLWDARASRQVACFHAPEDYAWRVLWAPSGAFVVSSHHRDIVRIWDARSFSAGSADG
FT                   HVAADADGHVAASAAAHAGENIGENTGEHLGDNLGEASPGPLPPALALLPAALRAALEA
FT                   GFDVSLALLRDLLALTARPRAASGAESDAAAAISDHASDSVSAQAAVLAAHPGMRALVQ
FT                   LGWPPAARISLALVVLALARASGGERAARGDAGGDDAGAGAGPATGRAGAARQAPRGAT
FT                   ASEVVSAVARALAGPAQPATPPPVPAQTLGRGLDRVDERIITLLMALGPAACSREPGLP
FT                   LAFVGRLSEIVPLRAPERELLGRRLPTELAGQTEGTAFGYAREGISRRGELRALLPSSW
FT                   ALPGEVRAYRHLRGELLYRARAGRTPPRLGPLVIVLDVSPACVGAVSRALRTAAHLLAH
FT                   TVLRAGLPAYALTAGGAGTVRALGRSQDALELFLARSYEPVDANRTLVQALALRDSLRT
FT                   LRAPAAAAGGQPLVVLLSHAQLGAEEPTPLPTPHVRALFARYPGDEQPPPWRHACERWA
FT                   VIDTASASASTGGADAARIPAALAEILS"
FT   gene            296894..297679
FT                   /locus_tag="Hoch_0197"
FT   CDS_pept        296894..297679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0197"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SNF2 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12838"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHH6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12838.1"
FT                   /translation="MTPPPPPFPPPPPRDDSEPAAATALWEAAARCYLQADEREAASAC
FT                   LERAGRDSEAAVLYEGMARWRDAARCHRRLGAHAAAARCLEAAEDWDEAAASHERAGQW
FT                   VRAAWLRVHALGWHLGARATLAAAAAALAAGDGDGDDSDSGSDSDDGDALGAALVEARC
FT                   AAAAGSRRDAARLLDLALREFAAPSASAARCRLRDWAVAVADDIARPDLGARAHVRLGR
FT                   GSGADLRAWDAWSLRVLGEHAPYPGARTDGADSADGAGD"
FT   gene            297711..298766
FT                   /locus_tag="Hoch_0198"
FT   CDS_pept        297711..298766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0198"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce0035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12839"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHH7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12839.1"
FT                   /translation="MLAADIAFVDIDGAHWRNWYELLVPPALRGRARWALLFTDGPPPG
FT                   PTVAGLLWDGGGASGPDGAQARPLELAAAGALYIPDGGDAALAEVARELGVDAVVVVDS
FT                   GCAAPLYDEIATGMRTRDDIVAQGLWCLQACKRRDGRGVWSHPPMLGLAPPLGYEPLQR
FT                   SFDLLMPDRSSFVVYVYEDDASDVYASLIARKSGGHFDLITTHLGLEDTLDGRALARHW
FT                   QRDYGRLLALVRERYAPPSIAVFLQRQTFLRIATGPSDQFARELNAKHVIVDPMPAWML
FT                   GLLGGATMAAFAGRGAKVLARMLPSPARQAATGLAASAKTALRDSGTHPFARLGFDPVA
FT                   LWNDLRHLYRG"
FT   gene            298791..299420
FT                   /locus_tag="Hoch_0199"
FT   CDS_pept        298791..299420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0199"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azo:azo3184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12840"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHH8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12840.1"
FT                   /translation="MLAGVPALSAAALSFGRWYSRRTRRRFQRVPLTTTRSFDERAVGR
FT                   LVGDVRAIERALRAPLSGRPCVYYWVELSVYEGRFRRRLCGEERGRSFALDDGHGSALL
FT                   DPADAELVIGERSRYCDGLGADAAEVQAFLARHACECPPPLRASLVAVEMVLEPGARVA
FT                   VIGRGVRESDPDPRAARGYRDSGERVVLSSTPREPVRVSDDPACCE"
FT   gene            complement(299451..300470)
FT                   /locus_tag="Hoch_0200"
FT   CDS_pept        complement(299451..300470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0200"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   mxa:MXAN_4682 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12841"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHH9"
FT                   /inference="protein motif:PFAM:PF01904"
FT                   /protein_id="ACY12841.1"
FT                   /translation="MARRPPPQQLDLFGGPATPTAERGRTRQRVAPAQPSDSVTRLAAA
FT                   LPETLRLGTSSWSFPGWRGLVYGAGHTQSQLARSGLAAYAQHPLMRTVGVDRSYYAPLG
FT                   REVFARYAEAVPASFRFLVKAHDACTLACFPDHPRHGAQRGQANPLFLDPAYARDTVVA
FT                   PFAEGLGDKAGVLLFQFAPQPMSDFGNAERFIDRLYGFFDALPRGPLYAVELRNPALFT
FT                   SRYASALRELGAVHCINAVGRRMPNPRDQWRLADVGQSSALVIRWMLARHLGYEGARAR
FT                   YAPFDRVVEPDEPTCQSLAEVIRQGLERNLPVYVVVNNKAEGSAPLSVERLARAVTSR"
FT   gene            complement(300514..302703)
FT                   /locus_tag="Hoch_0201"
FT   CDS_pept        complement(300514..302703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0201"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: mxa:MXAN_6183
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12842"
FT                   /db_xref="GOA:D0LHI0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHI0"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY12842.1"
FT                   /translation="MLDTRIGGYRITKRIAKGGMGEVYLARHELMEREAAIKVLHPDLS
FT                   GNEQQVNRFLNEARATASIRHPGIVEIFDVGHEGARAYIVMEYLRGEMLASRLARTRIE
FT                   IDKALQFTRQIAGALGAAHACGIIHRDLKPENIFVVPDPDVIGGERTKILDFGIAKLLE
FT                   SRGGVHTVQGTMFGTPAYMAPEQCEDAAQVDRRADLYALGCILYEFLCGTPPFGRGGIE
FT                   LVAAHLRDVPTPVRDREPRVSEALDAVVMRLLAKDPEQRYGTCEALVRALDQVPNARTP
FT                   QPELAFAETSQGIAGDIQHAATATAQPGVGRVSVKNPGTEPGAIMNPGTAAGTSVAAAT
FT                   SPGQDGNASTHGGAGAAPTQSGASASPAAAEPVNLPSSGPQPSGRGRGPGLWLAALVIL
FT                   SVVGGLVWWQSSGSQTPSAPVEAGPSPEENLERARQAMSARDWQSAEFSANEALRALEK
FT                   RGAEGDDALIEEISALRRLAQDEQHNQYEFEKFQRAFEADELLDAVSILEDITAESVYR
FT                   PEAEALLAPAREAWLVEQRAAAAEAAERGRCRSVRQINQAAHQLFPGGDPEIEEQLANC
FT                   REQRRDDDDDKAEEPAKPSRPTRPRRPRQGGGSGSGSGGSGSGSGGSDGSGGDSGGDPG
FT                   GDSGGDAETPPPTDPLGGFRALVLVVQRRIVRCASNNDVSGDHVFIEVIIAADGTVTLV
FT                   PDSDNQAFATCVRKIAIPPVPGMPPVRQTVRVPLS"
FT   gene            complement(302790..304205)
FT                   /locus_tag="Hoch_0202"
FT   CDS_pept        complement(302790..304205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0202"
FT                   /product="Palmitoyl-CoA hydrolase"
FT                   /EC_number="3.1.2.2"
FT                   /note="PFAM: BAAT/Acyl-CoA thioester hydrolase; acyl-CoA
FT                   thioester hydrolase/bile acid-CoA amino acid N-
FT                   acetyltransferase; KEGG: rpi:Rpic_2088 bile acid-CoA:amino
FT                   acid N- acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12843"
FT                   /db_xref="GOA:D0LHI1"
FT                   /db_xref="InterPro:IPR006862"
FT                   /db_xref="InterPro:IPR014940"
FT                   /db_xref="InterPro:IPR016662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR042490"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHI1"
FT                   /inference="protein motif:PRIAM:3.1.2.2"
FT                   /protein_id="ACY12843.1"
FT                   /translation="MGPRRFSSRPALAGLILSALLGAFLGACASRSAPAPTAAEPTLTI
FT                   TPTRSLVDAPMDIRLAGLEPGERVTVRATMADSPELIWQASAVFAADAAGTVDLGRDAP
FT                   LEGSYESADAMGLIWSMTPSTEDWEQHARAAPQLQPMRIRYEAERTGADKVFAAVDVER
FT                   LRIAEDVRRSEVRAGGVVGNLYLPASASAQAPAPAVLVLGGSEGGLRESTAALLASHGF
FT                   ASFVVAYFAFDGLPPKLENIPLEYFDAALGAFAEQPGVDADHMAVLGVSRGGELALLLA
FT                   ASFPERLSAVVAYAASGVVWPGVGSLPPEPAWLRGDQPVPAVPFVADAAVQADVIQQMR
FT                   SGEPVSLRNTFLASMKNPEAMAAGVIPVERISGPVLLISGEDDAIWPASELSELVVTRL
FT                   RESGHTHAALHLRYPEAGHLILPPFRPSTARSARLATANMELAFGGTAAGTARASADSW
FT                   PQVLDFLERALRP"
FT   sig_peptide     complement(304107..304205)
FT                   /locus_tag="Hoch_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.499 at
FT                   residue 33"
FT   gene            complement(304307..305665)
FT                   /locus_tag="Hoch_0203"
FT   CDS_pept        complement(304307..305665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0203"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce0877 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12844"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHI2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12844.1"
FT                   /translation="MVALAPAAQANPFSVHAEASASVAWSDNVSNRSEVAGENETLPQA
FT                   GFFATIRPALLFTYETIRAVHVTSASVDLTAYETEEPSNTYGGTLSHNSAIALTPVSEL
FT                   GLGANLGFGRVDPLLVEQATQIQGETTFASLGLTEVLRTQLSADLRGNQSATFNRVETS
FT                   TAGAEALDSGLLPSTSSVTSSVAVSGGLDRVWQRTALGFTASFNYITIDQLSASNAQYI
FT                   ATLTGNLLRDLDPQWSLSLTAGMGATFDPVEAGDDLVGGANQDAFGPAPLGSVTVNYER
FT                   PVGSVIANFSGTASHAITPNLLLGNVTNTSSSSVSGNVPLPWFRYGDELAATVSGSLLF
FT                   SHSRPSLTNGEPSWNTYAANTALSYKLNDNVSANLRYQYVRTDVFNYQTGADVVILPPE
FT                   EFFRHTVLVELSGRFPSREAVQLPDRRFLRVDRSFDTSVNDSANDGQSGGGAE"
FT   gene            complement(305887..306834)
FT                   /locus_tag="Hoch_0204"
FT   CDS_pept        complement(305887..306834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0204"
FT                   /product="ATPase involved in chromosome partitioning-like
FT                   protein"
FT                   /note="KEGG: scl:sce0878 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12845"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHI3"
FT                   /inference="protein motif:COG:COG0489"
FT                   /protein_id="ACY12845.1"
FT                   /translation="MADSKHFGPETKTLSDISPADLIAKSRRNAPLSDTRRTVSMSALG
FT                   AVEAEFKPAARQPRAATTPAKQPETDAARTMMLDIGDMEPQQPIETVHEPPEINRTQHS
FT                   MPSGRNSDPRLLLWREPDSERAAAFRILRHHLMDHGRPQVIVVSSASPGEGKTTCAVNL
FT                   ALALAECNRARVLLVEATVRAPQLAKIFNFKPPWCFAEQLSAHREQPLMPWSTVQVTEA
FT                   HLHIAAMDPSLAQRQILDAPAFAIAMERLRLANFDHIVIDAPAVLGSAEVNLLQDAADG
FT                   VLLVARSKQATARTLRKAVEQLSPTKVIGTILLK"
FT   gene            complement(306827..308362)
FT                   /locus_tag="Hoch_0205"
FT   CDS_pept        complement(306827..308362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0205"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   scl:sce0879 protein kinase involved in polysaccharide
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12846"
FT                   /db_xref="GOA:D0LHI4"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHI4"
FT                   /inference="protein motif:PFAM:PF02706"
FT                   /protein_id="ACY12846.1"
FT                   /translation="MPIGTQTPRDKFDQLLAFVRRTMRYWWLVGVITFIGGALAVVFAL
FT                   TQKPKFLSETKIFYNERIQSSVLQGRDYGVNTKNLGYHYEEMLMSRTNIQSIIEKLELF
FT                   PKVRDKKGIDAALEEFDKSAKFRVRGTGMFNISFLGEDPEKSQAVTAMMVDILMREDER
FT                   LRREQASATLNFLLEEKAKINKDLDQRNRELAKFLTEHPEFALDNTVGGAQTPGATIRA
FT                   QAKAKSGQGPAVSGPTNVDPRILALERQRRRIRDRLAAPDQVGPPRKTPEQIEAERLVS
FT                   EAERDLRSAQRALQDRLSRLQPAHPDVIQAQSEVAAAQRRVRQLEAAVPSAAIPNKPID
FT                   RSALEGELREVERQIAGVRSSIREESGDDETAGEAEVPLSEEDWVIKLETEYARLKQAV
FT                   EEQQKRLESTDSSLSRAQITASQQMAEQGAVLSIIDPPSLPTLPQGKGRAILAAAGTAV
FT                   FIILGTLLALALALIDDRIYSAGDLERLAIAPVAVVVPKMRKPGLLRRLFRRG"
FT   gene            complement(308331..309506)
FT                   /locus_tag="Hoch_0206"
FT   CDS_pept        complement(308331..309506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0206"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_0660 exopolysaccharide transport
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12847"
FT                   /db_xref="GOA:D0LHI5"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHI5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12847.1"
FT                   /translation="MDDEPAVGQVLVSELQRFKGRMKVNPIPVLLLALVMTAGALFVFA
FT                   RKPTMYTARVILRISEGALTDYRGAVVPRGELKDYIYSFALSDALLMSEIIDKHGIYSH
FT                   ELGLFGATGALDELRDGLSVEIYHNFFHFSKRHESTPRSLRIAISYQDKNPEFAYKVAV
FT                   LLSDLVVDVERNKRLQEVRYAADNAHQVLDAVAADYDERDELIASAMSNLAEAELAGEG
FT                   VAAAMARVEIASLARTQLMKGRELEGLQRKIEQIDFNRQLEENHLGIVFELAGRIKPVP
FT                   KPPPGPLLLGLVGLVCFGIFVPVCAIGLGTFDSRLHESGDVHRLGMPALGHIPAFRGDD
FT                   IGSLRQRGALEPPTLLGRLGLRPRRVRRSDNQNRVASTRTTHAHRDPNTTR"
FT   gene            complement(309651..310847)
FT                   /locus_tag="Hoch_0207"
FT   CDS_pept        complement(309651..310847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0207"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   scl:sce1025 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12848"
FT                   /db_xref="GOA:D0LHI6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHI6"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACY12848.1"
FT                   /translation="MRVLALTTLFPNAARPLLSPYNRQQFAALSEYCEIEVLAAIPWFP
FT                   GAGLMSRWTVSGRQSDVPPVEQIDGLQVRHPRNLYLPRMSGLSPVLFGASLLPTVMRYR
FT                   GKVDLLLSAWAYPDGCASVALAQALGVPCVVKLHGSDVNVLSDQRVPRAYMQTLLPRAA
FT                   RIVAVSRALGRKVCELGVDPGRVAVVYNGVDPKLFYLREDRAEARAKLGLPAEGRIILY
FT                   VGNVLETKGALDLAAAFEKMHRAHPEAHLVIVGNGAAKEACEAVAARVGPRMKLVGGQP
FT                   LESICDWMAACDVLTLPSWNEGTPNVILEAYACGRRVVATDVGGIPDIVDDELLGEMVP
FT                   VRDVDALAAALGRAVERDYEPADIAARGARGDWPTSAGHLYEVLRAALADTTGRSAGV"
FT   gene            complement(310880..311191)
FT                   /locus_tag="Hoch_0208"
FT   CDS_pept        complement(310880..311191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0208"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: scl:sce0880 putative anti-sigma
FT                   factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12849"
FT                   /db_xref="GOA:D0LHI7"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHI7"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ACY12849.1"
FT                   /translation="MSNKNSIKREDNGDDTTISITGKLDVLTAPEMSTLIDGLVAEKRR
FT                   KVVVDLSGLDLIDSSGVAALVGMYKRVRAEGGDVTIRGIRDQPLAIFKLLRMDKVFNL"
FT   gene            complement(311309..311869)
FT                   /locus_tag="Hoch_0209"
FT   CDS_pept        complement(311309..311869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0209"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: scl:sce0881 anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12850"
FT                   /db_xref="GOA:D0LHI8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHI8"
FT                   /inference="similar to AA sequence:KEGG:sce0881"
FT                   /protein_id="ACY12850.1"
FT                   /translation="MSEARVIALTVPGSLAFRDLAIRVIIESCRLVGSRAVFSRVESTA
FT                   ANAASAHASVDEADRHLQANDGYDLGDSFTAEFVSAFSEIYNNIPIHAYQGRANGSIDL
FT                   RVEITPDRVIVELKDMGESFDIEAVPLPEALPTGGMGIHIARSMLDDLVYEPGPPNLWR
FT                   LTKYANASRKAAASAMSSPPSGE"
FT   gene            311925..312656
FT                   /locus_tag="Hoch_0210"
FT   CDS_pept        311925..312656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0210"
FT                   /product="sugar transferase"
FT                   /note="PFAM: sugar transferase; KEGG: scl:sce0882
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12851"
FT                   /db_xref="GOA:D0LHI9"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHI9"
FT                   /inference="protein motif:PFAM:PF02397"
FT                   /protein_id="ACY12851.1"
FT                   /translation="MRLSVRIAKRTIDICGALAGLAVTAPVMPVIAAAIYLDDRGPIFY
FT                   KQRRAGTLRSVSVENGIKRLQFNEFHMHKFRTMRTDAEKFTGAVLASKGDPRITRVGRF
FT                   LRKSRLDELPQLFEVLRGTMSLVGPRPERPELLQDLAFAIPFFEERMRDMKPGITGLAQ
FT                   VSLGYQGDIPEGSEIATFAGALQNPFDLEEAQGAVADDMRIKLLYDLAYAAAAEKLTSY
FT                   LPMEMKILFKTPVIMIRGAGR"
FT   sig_peptide     311925..312023
FT                   /locus_tag="Hoch_0210"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.948 at
FT                   residue 33"
FT   gene            complement(312810..313415)
FT                   /locus_tag="Hoch_0211"
FT   CDS_pept        complement(312810..313415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0211"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; Soluble ligand
FT                   binding domain; KEGG: scl:sce0873 outer membrane
FT                   polysaccharide exporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12852"
FT                   /db_xref="GOA:D0LHJ0"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHJ0"
FT                   /inference="protein motif:PFAM:PF02563"
FT                   /protein_id="ACY12852.1"
FT                   /translation="MKRTIYILAAMLVLACHACGGAPPPTYDYSQEPDPRRLPYVLGVG
FT                   DSLEINVWKNPDLTTSVTVRPDGIITMPLIGDLYAAGKTTEELKKEIEAQLANYIKLEV
FT                   TKIAIKVTNATSNRFTVSGEVAKPSTFQSPYYVTVAEAIALAGGFSRFADRTRMRLLRR
FT                   DHESGEVRTIPIDYTLIESGERPDMNLVLMPGDALYVP"
FT   sig_peptide     complement(313350..313415)
FT                   /locus_tag="Hoch_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.848 at
FT                   residue 22"
FT   gene            complement(313511..314161)
FT                   /locus_tag="Hoch_0212"
FT   CDS_pept        complement(313511..314161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0212"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfo:Pfl01_3195 general secretion pathway
FT                   protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12853"
FT                   /db_xref="GOA:D0LHJ1"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHJ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12853.1"
FT                   /translation="MQAFQQTERSQRERGMTLVELMLVLAIVGIVSSTAMVTLSPEPKM
FT                   EDQARRVAALVNEASRQAMTDGSLPPEIVATTLVEARRRMLVTTDTDGHQVLDLQQFVF
FT                   DEIASSSDWELRKRSYLGNGAFVYGWSLGAQVTPGSSIDVVGPRAGDPFSDATIECLPN
FT                   GTCAMEMFGAPANGVTLYLVDPKFKDDPLATNRRARVVIMPLNGMATKALSGW"
FT   gene            complement(314182..315447)
FT                   /locus_tag="Hoch_0213"
FT   CDS_pept        complement(314182..315447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_01757 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12854"
FT                   /db_xref="GOA:D0LHJ2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHJ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12854.1"
FT                   /translation="MSRHLSMHPTAAHRRTHDQRANERGLTMVELLITLAVGSMLLGFV
FT                   FNIHGRMSRAYRSQTSVGELQQSTRAAADLMAAHVRTAGFMMPKGAYVSAAIAALDAGR
FT                   APENRGIVDIDSDGAPFVPALEIANNPTGMVPGRMEPDRLHTFSANSFGQTTVIADPGL
FT                   DTITVANAGFFNGYTGLALITKGPVQKPHPQLGTMPDITTYNACIVRVTGAAATQLFFF
FT                   DEGQFNSGGLAHCRLGPDTAGEPRRALEPGSQVFRLDARAFRVDVDPGDDAKTQLAALQ
FT                   ISATGGLLDDWLTVGVGYVDLQLTQRISEPSNGDADDLDNDGDLRADWYAAPYTLATNE
FT                   AITQVGISVVVRSDSNASDTQTLIVPTPRNETGGFTAANNPEGDASDKSFSPTAPPPEY
FT                   AGEHIYRQSSLIVDVRNLGASY"
FT   gene            complement(315444..315956)
FT                   /locus_tag="Hoch_0214"
FT   CDS_pept        complement(315444..315956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0214"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfo:Pfl01_4846 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12855"
FT                   /db_xref="GOA:D0LHJ3"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHJ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12855.1"
FT                   /translation="MHATRPRSTRRSQGGFTLLELIIAMGICLVGLAGLMSLYLTTVQA
FT                   NGRATHTAIASTLGQQVMEELRNMPVQQPDPGYNGVTMETLAGGPIGTAQSTLISRTTT
FT                   ARDNLVYTVTVTANALGPVGDPRENLIFLRATVNWADQGATDDGSADQRLRHQIVFETM
FT                   RTRQDML"
FT   sig_peptide     complement(315819..315956)
FT                   /locus_tag="Hoch_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.677 at
FT                   residue 46"
FT   gene            complement(315978..318467)
FT                   /locus_tag="Hoch_0215"
FT   CDS_pept        complement(315978..318467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0215"
FT                   /product="Tfp pilus assembly protein tip-associated adhesin
FT                   PilY1-like protein"
FT                   /note="KEGG: gme:Gmet_0737 type IV pilus assembly protein
FT                   PilY1"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12856"
FT                   /db_xref="InterPro:IPR008707"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHJ4"
FT                   /inference="protein motif:COG:COG3419"
FT                   /protein_id="ACY12856.1"
FT                   /translation="MMYKHIKSNLPSLAAALGVSFAFAAHAQAQVITPTCETPTETVVY
FT                   SGASLDGAMSLKDNVTFTAGNLVFAAGGGSVRSEVVDLATTTPAIDTTEAVITGARIMF
FT                   TPTPPVDAAVYMSTSKAVPFFEANGQWVEAYRCDGTATDSEFCVRFPAGDGRDLRWRLE
FT                   MAGASISSVQLRFDHVADNENFRGGVTVSDGVSYFGGFSEPGDLGQMHALPADFAVTDI
FT                   YWEGRDKLQIDGNRDIYTASPDGTQRLDFVTGNYDPLMYDIFKFSDLGVPVAQYDAMID
FT                   MVVDWYRNALRFGNAFDADPPAADPGRRFGAVVNSTPAVVGRPKLPTWFARAPSAQRLL
FT                   FNTYQINKRTRPPLVIYGAKDGMVHAVYSNAVDIANSANGTEAWAFVPPSVASNFLVDA
FT                   LNSQDYPALSPMVTAYPDTSPIIEEVVLATGEFATIAILPDGSGGSGVSVLDITNSVID
FT                   TPFTSNGPTPLWQWYPGGTEAGLATNQPAVARVRITGDPDDHYFIITGTGSAYDDPTHQ
FT                   KGRDVVAYDLETGAVRWSFRMQCSLSTDITVFETDDGGEPVGTDGQPPIIDGYIDRAIF
FT                   GDRCGNIYKVDVTEVIDNSAAPTGIGTRPLIVDGLTVNAYFQTYTSPATEGPPVTGNFG
FT                   VRALDDGTSTRVVLFFGTGGIEDEPALSTSPRNKFYALFAAPASLGNDAELIDSFDAVC
FT                   ELGSCEKFYGGVIVSSDQVIYSRVLEPVPGNVDCETGRTVVEARNITGTLDSSLFDSGV
FT                   SFSETIDGVATGPLSGHGNAIYILDARGRATVVGDPRAGEAGGDTANGTGNGLGGDARS
FT                   AALINAPMRILGWRQVY"
FT   sig_peptide     complement(318384..318467)
FT                   /locus_tag="Hoch_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.890 at
FT                   residue 28"
FT   gene            complement(318510..319157)
FT                   /locus_tag="Hoch_0216"
FT   CDS_pept        complement(318510..319157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0216"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_01756 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12857"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHJ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12857.1"
FT                   /translation="MTICHRQIPRNRERGSVLVVALIALVALASLGSLTLVTVRSGISG
FT                   SSNGRAKAVALMAAEAGLAAGIDYARRNFDTTNLWTNIVNPSASLPNKPVGPGGVLGNT
FT                   AQPGTAENVFDPVTQAWYEVEIVNNIDDGVPELDATIFVHSGFRHGVDNDGRIIIRATG
FT                   YGPRDAKAQLELEIQTQALGRPCDDSGSSNDGSMPCGSVNGGSSSSRTDLAL"
FT   sig_peptide     complement(319068..319157)
FT                   /locus_tag="Hoch_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.608 at
FT                   residue 30"
FT   gene            319438..320367
FT                   /locus_tag="Hoch_0217"
FT   CDS_pept        319438..320367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0217"
FT                   /product="cysteine synthase A"
FT                   /note="TIGRFAM: cysteine synthase A; cysteine synthase;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: scl:sce7375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12858"
FT                   /db_xref="GOA:D0LHJ6"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHJ6"
FT                   /inference="protein motif:TFAM:TIGR01139"
FT                   /protein_id="ACY12858.1"
FT                   /translation="MPIYDSVVDTVGGTPLIRLQRLGKDLHATILGKMESRNPCGSIKD
FT                   RVGVALLRDAAQRGALTPGAVIVEATSGNTGIALAFAAAAMGYRLIITMPETMSRERVA
FT                   LLRTFGVEVVLTRGGMMRDAVSRAKEIARETPGAVTLEQFRNPANPDIHAQTTAREILD
FT                   DTEGKIDAFVAGVGTGGTVSGVGRVLKDVCPNAKIIAVEPADSAVLSGKPPAPHYIQGI
FT                   GAGFIPENLNLELIDEIVAVSERAALDYTRRLAREEGIFAGLSSGAAVAAAARVAARKD
FT                   MKGKQIVVILPDTGERYLSSTLGEELGA"
FT   gene            complement(320462..321295)
FT                   /locus_tag="Hoch_0218"
FT   CDS_pept        complement(320462..321295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0218"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: rpa:RPA4646
FT                   putative carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12859"
FT                   /db_xref="GOA:D0LHJ7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012354"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHJ7"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACY12859.1"
FT                   /translation="MDSLQREDRDPFRFPAVTQARDGAGEFGVLCIHGFTGTPFEMHHL
FT                   GWRLSQRGFTALGPRLPGHGTDLEDLDGCRWQDWYGAVEAAFDELRGSCERVAVAGQSL
FT                   GGLLALHLAAERGDDMVAVAALATPLWLPALSRAAIWATRPNQPLTARIGQRTKRFPKF
FT                   GGSDVRDLEMKQRNPCYRAVPVRALHQLVAFMDKVRGELSRVRVPTLVLHGRRDHTAPF
FT                   ACSTYLAREVGAALVRHRGLSESFHLIAVDVERDLVADEVGGFFERIAAARAGAA"
FT   gene            321387..322298
FT                   /locus_tag="Hoch_0219"
FT   CDS_pept        321387..322298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0219"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: mxa:MXAN_1525 FHA domain/GGDEF domain-
FT                   containing protein; TIGRFAM: diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; Forkhead- associated
FT                   protein; SMART: GGDEF domain containing protein; Forkhead-
FT                   associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12860"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHJ8"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACY12860.1"
FT                   /translation="MSEWKTRITKVQSIRPPSEVGQGCLVLIYPPGPDMGKRFPLEQEE
FT                   FVLGRGADCDIQVDYDSVSRRHARVYRDSQGRWLVEDLGSTNGSYVNDMPVQRSPLQDS
FT                   NFLKIGAAIFKFLLGAGIEASYYEEIYRMTIIDGLTGVHNKRYFVEFLEREIARCARHQ
FT                   RPLTLLMFDIDHFKQINDTHGHLTGDYVLKEMSRRLRERIRKEELLARYGGEEFAAVLP
FT                   ETDHVGGMTFGEQIRQLVGGEPFEYEGDRFQVTISVGVHTLYGQSLDVKGFIKHADDNL
FT                   YRAKRSGRNRVIGMDNASGVHS"
FT   gene            complement(322361..323503)
FT                   /locus_tag="Hoch_0220"
FT   CDS_pept        complement(322361..323503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0220"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   ank:AnaeK_4421 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12861"
FT                   /db_xref="GOA:D0LHJ9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHJ9"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACY12861.1"
FT                   /translation="MSSPTRILHVFGRMGRGGAETWLMNVWRHIDRERFLFDFLVHDST
FT                   PGEFDDELRSQGSRILVRPYARDPVRYSAAMAEAVRARGYTVIHSHVAYFSGWVLGLAR
FT                   GLGIAGRIAHSHNDFAQAQRAWPRAAYEGVMRKAIQMHSTRGLACSLPACSSLFGSEWQ
FT                   AQGKYEVLHYGYDFSRFTSEHIGGELRRVTRRALGIDEDAFVIGHIGHFSRQKNHEFIV
FT                   ELAAARRLRGHTRDRYVLVGGGGLRDSIERSVVERQLGEAFVFTGVRADVPELLAAFDV
FT                   MILPSRWEGLGIVVLEAQASAVPSLVSDRVPEEAVVIDDLVTQAPLETGAWLEALAEIE
FT                   NQPRPQRDRAVAAMRESRFGLERNVERLSAIYEQEAARAR"
FT   gene            323664..324929
FT                   /locus_tag="Hoch_0221"
FT   CDS_pept        323664..324929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0221"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   ank:AnaeK_4418 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12862"
FT                   /db_xref="GOA:D0LHK0"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHK0"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ACY12862.1"
FT                   /translation="MSVSPTPRRPAAGLRRNVSWAFAGNLVYAGTQWLILVVLAQLAAP
FT                   AAVGQFALGMAIAAPAILLANLQLRVVLATDARDEHAWADYLGLRLSGTAVALVVIAAI
FT                   ALIGYRGDSARVICLVAAAKAVEAVSDLCYGWFQKCERMDLMARSLILRGVLALLGFAL
FT                   ALWASGALVWAVAAMACAWVAALVLHDLPAVLGLLSHYGRDAGTRRPRFSRAHLSALVR
FT                   VSWPLGLTTLFISLDHNIPRYLLEAYHGPAELGIFATMVYVQMAGEMVVRALGQTAMPR
FT                   LARHWAAAEWQAFDALLGRILALGAVLGGAGVAAAALFGEPLLRLLFGAPYAARAEVFP
FT                   WIMAAGALLYLGSLLGHAAAATRAFARTAVPYALAAVVAVLAALWWIPSHGLYGAAWTL
FT                   CAVAAALCLAPLSVLVRLRRQA"
FT   gene            324926..326440
FT                   /locus_tag="Hoch_0222"
FT   CDS_pept        324926..326440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0222"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bam:Bamb_5110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12863"
FT                   /db_xref="GOA:D0LHK1"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHK1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12863.1"
FT                   /translation="MSAAADGRPPVRRVAALPSSLLASAGCALLVVALVAFDARFQHWF
FT                   VVPVAVCGALAACDALDWLRGRFDIFDPVGLIGLFGVYFFFAAPLLHVAWDRWISSAYW
FT                   LALVPPPADWRPWLGWMAWLNALGLLCYRAARAPFLGQRGPRRRWRVWRLAPRRFGPIL
FT                   LIAVALTTLAQVLVFLAFGGFGGFISAFEEQSRDGFAGLGWAFAIAESAPILLLMGVAA
FT                   ELGSRARKPSWTTVILVLLAFFCLRLIFGGLRGSRSNTVWALFWGVGILHLWVRPIPKR
FT                   LIVAGLAFLLTFMYFYGFYKAVGRDALRAFEGAEVRAELVEDTGRSFEALVLADLGRSD
FT                   IQAFILYRLSERDAGMRLARGRTYLGALALLVPRSAWPDRPPTKQKEGTELFYGPGSYV
FT                   PGRWSASKVYGLAGEAMLNFGPLAVPLAFIIFGLLVGFLHRHLRELGRRDARLLIAPFL
FT                   VNLCIIVLISDSDNILFSLIKNGAVPALILLVGCDRVRYRRATRGG"
FT   gene            326567..328510
FT                   /locus_tag="Hoch_0223"
FT   CDS_pept        326567..328510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0223"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase A domain
FT                   protein; KEGG: pfo:Pfl01_4555 response regulator receiver
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12864"
FT                   /db_xref="GOA:D0LHK2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHK2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACY12864.1"
FT                   /translation="MSDFEASPPVFASSGPRSVRASRRRPLMDADQSGAEEAFELAAEE
FT                   PQGPGPVRVLVADDSASIHEDFRKTLPPPRQSDPLDELEAVLFSSSSSAAATSHSAPLP
FT                   SFAIDSAFQGEEALAKVEAARARGEPYALGFIDIRMPPGWDGVETAQRILRADPHIQLV
FT                   LCSAYSDYAWEDLAEAVGHGDRVLILKKPFRTIEVRQIASSLAAKWQLVRERERQMQDL
FT                   EERVQARTAELARASQELQREMLERGKVEAALRTAQRLEALGRMAAGLGHEINNPLNFV
FT                   SGSLEMLDAELMRVRGRLREDEWARMGEMLHTAAAGVGRIAQIVSGIQFFDRPTEIQLE
FT                   VVDLWKVLTWSVKTVDDRLSPDLELVLDLDDVPAVLGKRIELEQVINHLLENAIQAVAA
FT                   APAPASGREHSVRVAARCEHAPGGSAGEVVIEIEDTGEGFPEGEIDKVFEPFYTTRSPD
FT                   QGTGLGLAICRTIVTALGGSIAAENPSEGGALVTVRLPAASPEAIQAAAAKPAATAPKP
FT                   VPNGRARVLVIDDEPLMLRIMSHALREHEVVTVQSADDALELLQREDFDIVFCDVMMPR
FT                   MNGPQFYEALAHLHPGLERRIVFITGGARDPEAQRFLDGLDNDCLQKPIPTDLLRARVG
FT                   EMLVRLARMSEK"
FT   gene            complement(328541..332428)
FT                   /locus_tag="Hoch_0224"
FT   CDS_pept        complement(328541..332428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0224"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: scl:sce9161 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12865"
FT                   /db_xref="GOA:D0LHK3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHK3"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY12865.1"
FT                   /translation="MARKGFPGSDRYLLRRELGAGGMGVVYEAFDKERGETVALKVLRH
FT                   VSAHGIYRFKREFRALQGLAHENLVRLGELTVADEDWFFTMELIHGQDLVTYLRGPSES
FT                   VALGTPTADTRTLMPLIARGSQPNADDDTDEAGEHTGTADAAADAGTDSDNDDDVVRAD
FT                   SAGDIDAFGQTAIDGFPRPPVTLDLAELRRVFVQLVAGLRVLHAAGKVHRDIKPENIMV
FT                   TDEGRVVLLDFGLILELDPEDWRATERTPAGTLAYMAPEQTNAGPVGPAADWYGVGVLL
FT                   YQALTGELPYTGSALVLVQAKQSPPERSARELWPECPDDLGELCEQLLQVDPAARPDAD
FT                   TIARCFASYAEGSETFAHATQVAEDAGAETWVPEGLELCLGRDLELAQLAAAHSEVNAE
FT                   DGAVSVVISGESGIGKSALLRHFTGRVQSEGAVLLGGRCYEYESVPYKALDGVIDALSG
FT                   YLKSLPDSDVEALLPEDAALLPRLFPVFGRVRIFARMSRNAQRPAGTDDGQWLRGRAFA
FT                   ALRALLQALAVRVRLVLVIDDIQWADEDSAELLTDLLRPPGSPPLLLLLSRRTGVESSV
FT                   ELSLPGRVRTIALQPLSHDDARELARRLVGDDDEALIAQHIADEAQGHPLYISELVRHV
FT                   GDHRSGPLRLDAAIWSRAQRLPDEARTVLGLLAIAGAPLTEATVQRAAGLGAGPLARAL
FT                   TFLRSEQMVRRDLVADEAWLEPYHDRVRESVASHLHLGKRRVMHDALADALAAEASPER
FT                   SPLRVQHLEAAGRWEEAAELAERAADEAVVALAFEHATDLYRDAVRLASRDRSLPQDAP
FT                   LYRKLADTLKLAGAEAAAGEVYRQLGAHTGEPRERDAFRGAAAECFLASGRVDEGVAAL
FT                   RQALADSDIVYPESDAQALRLMLWYQFRASHRLRRFRARPESSIAAEDLQRLELYQNAF
FT                   RGLVRIDSLRGGYFAARGLVFALERGAARYAGVFWTCQAIVSSMMGTSKHARAKTEIAA
FT                   AARALAHTSDELSKTHLLLAGTAYALFATDFRQVHARLDTLDRALERLGVHSFEYTTAL
FT                   VFRGLSWNRQLNAAALVAHMPQHLAAARRRGDLYSLFQLEVVGNLRWLVLDRPSTARRE
FT                   LEEAQKPPTEPGNALEWHALVARCQVALYDGRRAPLVAVQDEVSYLRQRSPLRFVQHVR
FT                   IEMTWFEARLALLDARARFLPTRVAARRKLRRHASALGGEGLDLGHMYEHTLLGGLAEI
FT                   EGERAVASSHLARAADAAERMGAPVWADLLRLRQDQLDGARATEAEERLRAQGVVDPHR
FT                   LANLALHPFGR"
FT   gene            332987..334132
FT                   /locus_tag="Hoch_0225"
FT   CDS_pept        332987..334132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0225"
FT                   /product="Tryptophan 2,3-dioxygenase"
FT                   /EC_number="1.13.11.11"
FT                   /note="PFAM: tryptophan 23-dioxygenase; KEGG: scl:sce8412
FT                   tryptophan 2,3-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12866"
FT                   /db_xref="GOA:D0LHK4"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHK4"
FT                   /inference="protein motif:PRIAM:1.13.11.11"
FT                   /protein_id="ACY12866.1"
FT                   /translation="MTRDVTTYWDYIKVEELLGLQTGLGDDEGTLSNDEVMFIVVHQID
FT                   ELWFKLTLRELASVRALFAQEHVREQSLSSAVRGIRRAALLFEQTAGHFALMETMTTRD
FT                   YLAFRDKLSPASGFQSAQMREIEILLGLPENERMALGHETYMQALRDPDGGETAASLRV
FT                   QARQRDTPTVRAAIEEWLYRTPIDGFTPDSEGDAEAVAAFIDSYLEAHRRELAGIQARA
FT                   VASALTEADRTRLGERYERELASARAWLEGRDVSAAHDDSEGTIERTRARRSRIRAALV
FT                   FIESYRELPLLAWPREVLDAIVALEQAFTIFRQRHARMVERVIGRRTGTGGSAGVDYLD
FT                   RTALTYRVFRDIWATRTVLLRESALPPLVHADYYGFAGSGA"
FT   gene            complement(334234..335643)
FT                   /locus_tag="Hoch_0226"
FT   CDS_pept        complement(334234..335643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0226"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SNF2 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12867"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHK5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12867.1"
FT                   /translation="MLRRIMIGALALPLAGTLAAGCGDDGGDGGDVDAAPLDGGQVDAA
FT                   PTDAGATDGGMVVDETVLSVAGGRFDGNEYEEYQDRDLFGAGQLVRLEEGTRAALYIEG
FT                   LDADTEYIAHVHALPCTENQAGGHYKLDPSIAEEQEDNEIWLRFTTNADGIGMATAEAL
FT                   GHTARGDAQAIVIHDSQADGAKMTCVDLRFNEEPTAAIEYSGSFSAFDGVDAADANIAG
FT                   TSAASVEAGTTAITMAPAQLDEAGTYEAHVHMLPCALEQGGGHYKRDTTIAMERENNEI
FT                   WPAVDDPDPQDFNHALRGDAQSIVIHRAVSPAEVPKVACADLVRQTEIPEFTSAGQGGA
FT                   LEGAPADYDELAATVELVRGQDGSTSVTLAVAGLPADTTGFGAHVHAGTCKASPPGGPH
FT                   YKLDPTIAEEQESNEIWLNFDSEADGTASSSASVDKHVARADAIALVIHDPASGDRVSC
FT                   VELAPSTAPLE"
FT   sig_peptide     complement(335578..335643)
FT                   /locus_tag="Hoch_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.496 at
FT                   residue 22"
FT   gene            complement(335833..336189)
FT                   /locus_tag="Hoch_0227"
FT   CDS_pept        complement(335833..336189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12868"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHK6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12868.1"
FT                   /translation="MIKSESITVDAPSAGFVHIHHVQIEHNGVDMGGPMWFETDSLPWI
FT                   IESLRACIEIYGEPARETECGGDSLKVFESGPEQAPIVNLRNRRAKDAEHGGVYALLMS
FT                   KAIAEQLVERLAAL"
FT   gene            complement(336186..338681)
FT                   /locus_tag="Hoch_0228"
FT   CDS_pept        complement(336186..338681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0228"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: ade:Adeh_0864 glycogen/starch/alpha-glucan
FT                   phosphorylase; TIGRFAM: glycogen/starch/alpha-glucan
FT                   phosphorylase; PFAM: glycosyl transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12869"
FT                   /db_xref="GOA:D0LHK7"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHK7"
FT                   /inference="protein motif:TFAM:TIGR02093"
FT                   /protein_id="ACY12869.1"
FT                   /translation="MKQDSSTPEPQVAVRVEDARTGMSHEALKRAVLDHLLYTRAKTPR
FT                   TASPLDIYFAVAHAVRDRLTKRWLRTQRHYVELDPKRSFYLSAEFLLGRLLSHNLMNLG
FT                   AYDYAVSELARYNVDLAEILEQEPDPGLGNGGLGRLAACFLDSMATQALPGMGYGIRYE
FT                   FGIFRQEIEGGRQVEQPDEWLRYGNPWEIARPDIAVKVRFGGYVQQSVQPDGSQRFHWV
FT                   AAQHVFGVPYDTPVAGYGVENVNTLRLWAARASEQFDLAVFNDGDYRRAVEEKALSESI
FT                   SKVLYPKDHSREGRALRLKQQYFFVCCSLQDIMRRYKRQHSGFDAFPDKVSIQMNDTHP
FT                   AITVAELMRVFVDDELLPWDKAWDLTRRTLAYTNHTLLPEALERWPIELFEELLPRHLQ
FT                   IIFEINHRFLREVHVFAPGDDDRKRRMSIIQEDGGRSVRMAHLAVAGSHKINGVAALHT
FT                   ELLKAKVLRDFAEMWPERFVNKTNGVTPRRWLWQCNPGLSKAISERIGDGWVTQLEQLE
FT                   QLDNYADDADFHAELSAIKRDNKEQLARIIERRNGVRVSPDSLFDVQVKRIHEYKRQLL
FT                   DCLHVVALYRRIKFGGARDTVPRTVIFGGKAAPGYEQAKRHIALIHDVGAIINNDPSIG
FT                   DRLKCVFIANYNVSLAERIIPAADLSEQISLAGKEASGTGNMKFQMNGALTIGTLDGAN
FT                   IEIREEVGADNFFLFGMDAAEVEERRRQGYHPGEYIAGSQELREAIELIESGYFTPGEP
FT                   ERHRAVTDNLRQVDPYLICADFDDYMACQDRVSETYLDQSRWLRMVVKNIAHSGKFSSD
FT                   RTIAEYAREIWNIEPVLLP"
FT   gene            339038..342976
FT                   /locus_tag="Hoch_0229"
FT   CDS_pept        339038..342976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0229"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; protease-associated PA domain protein; KEGG:
FT                   pat:Patl_1035 peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12870"
FT                   /db_xref="GOA:D0LHK8"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHK8"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ACY12870.1"
FT                   /translation="MKKVIRPWLFAAGLPLFFGPAVGCDGGLGDIDTSPAGEAPAQRLP
FT                   GDTEAAAPGGGNGDDGSAGNESGVGDPALADKPASFVRDLRDDFVEEPGLTGEHSYIVH
FT                   FRAAPLATYSGGVTGLAATNPRAAGTFGKLDANSPASRAYKSYLLSEQASALSTIEKQL
FT                   GRRLKSGTQYTTAINATLVRMSQDEAKRVSRMAGVRFVERDQAVWPETDRGPIFIGAPG
FT                   IWDGSATGMPSEGEGITVGIIDSGMNIQAEIDGVTGAHPSFAEMGDDGYVHTNPLGSGV
FT                   YLGGCVDNPEWCNDKLIGVFSFLNAQPNPGVDPNAPDDDPLWGFKDTSGHGSHVASTAA
FT                   GNVLFDVPVVDADGNPSSFSYERISGVAPHANLVSFKVCAPSCFFSDIAGAVEQAIEDG
FT                   VVDVLNQSIGNSGGSPWNSTSAQAFLSARAAGIFVAASAGNDGPDPGTAGRGNSAPWVA
FT                   GVAATSHDRRFPDKFLTDMAGGDTPPPPELSGLTISGGISGRLVYAGEFPVGNPGEPNF
FT                   DQPEQCLEPFPAGTFEPDMIVVCDRGAIARTAKGQNVRDGGAGGLVLANLAGGATSVVA
FT                   DPHVLPAIHIDAAQGDLLRAWLASGSGHTGTITATEQPVSDLSAADIMASFSSRGPYDA
FT                   FDILAPNVAAPGLSIFAAGAQVLFDHPGSPSVPGLFGTIQGTSMASPHVAGAAALMKSV
FT                   HPDWSDAEILSAFMTTGQTEVRKEDGVTPADPLDYGGGRVRVDLAAQVALVFDQSAEGF
FT                   AAANPALGGDPLALNVAALTEDVCISNCVWQRTVRAVRAGSFAATGTAGITIEPAAFTL
FT                   AEGEEMTLTFTANTDGLPEEIYGFGAVTITSDIADAPVQTMQVVIKPGRSNIPRAMSIE
FT                   ATRDRDSRLIDELRAVPIPDLSVTSFGLSRAQVSDAASGADSDTSSPFDDLEDGVHFEL
FT                   VPFPDFAQQFIAETMNSTSPDLDLFVGLDLNGDGLPSEDELYCSAATASAAERCTFELG
FT                   GDLSDFPDFWVLVQNFRASTPGAVDTYDIATTSVGVSEDGALSLSAPSAVPGGQPFSAR
FT                   VVWDAEMSEGELYYGRLSVFSDSAHSDASSLGNIDVRLLRGPDDVQIIMPPRLRADEVA
FT                   EVTVRVQPNHTDEPRAYDIVVPVEFGLFYMPGSAAADGGIFEDGAVRFSITRAPNTTEA
FT                   RDLHFRVHVRLPLAGVELPFTETDAVDLPFTEEATSVAFANVQYFTFMGFLPPLVDGST
FT                   VVVGEVATAAFRLRLVTDKSTVFNGVADATVYNADGEPVAEGLFLALGTDVLEFDFDTA
FT                   GLEPGEYTVVAELTDTFVYSMTVNLVAP"
FT   sig_peptide     339038..339109
FT                   /locus_tag="Hoch_0229"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            343146..344273
FT                   /locus_tag="Hoch_0230"
FT   CDS_pept        343146..344273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0230"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_5; ATPase associated with various cellular
FT                   activities AAA_3; SMART: AAA ATPase; KEGG: ade:Adeh_3266
FT                   ATPase AAA-5"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12871"
FT                   /db_xref="GOA:D0LHK9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHK9"
FT                   /inference="protein motif:PFAM:PF07728"
FT                   /protein_id="ACY12871.1"
FT                   /translation="MTARERLGQVRRELQALFIERDRLVDGALAALLSRQHLLMLGPPG
FT                   TAKSMLAKEVCRRIGGASYFEWLLTKFSTPEEIFGPVSLPALEEGRYERVTGGKLPEAE
FT                   IAFLDEIFKANSAILNALLTILNERRFHQGSEVREVPLRSILAASNELPEEDELGALYD
FT                   RFLLRFVVGYIEKEHRFARLLRLEEPESDACTVLSAEDLSALQAEADAVTIADELIEDI
FT                   IAIRRELGSAGVIASDRRYRQALGVLRAGALIEGRDEVNARDLDWLKHVLWSDPEQQAE
FT                   VVKAIAKVTGGQEEEARRLLAQAQEIHAYAHRPWPSLDARNRAIIEADTKLQHIQARLE
FT                   ALHENALRRERNSERVGEIFAQVVTLRERLIATRN"
FT   gene            344278..345807
FT                   /locus_tag="Hoch_0231"
FT   CDS_pept        344278..345807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0231"
FT                   /product="von Willebrand factor type A"
FT                   /note="SMART: von Willebrand factor type A; KEGG:
FT                   ade:Adeh_3265 VWA containing CoxE-like"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12872"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHL0"
FT                   /inference="protein motif:SMART:SM00327"
FT                   /protein_id="ACY12872.1"
FT                   /translation="MPPSELHVIVCDGYDREVFARLLREKRSMGECRERLGRLLPHPEP
FT                   LLCDLFSVLFKLNVVVRAAEELAAAVQIHHRLVTAVSQARDLAALRARTELRENECAAL
FT                   LPGLVERILTAMKRDFYIGPQELLEAAEVAHDEDTLAQREAEREHLRELPEDAFDDDER
FT                   ERLEGDLDGEIDALRERIDEARARQARVADKITSDLDDTIGRKVSVLPDQLEQGEDLRR
FT                   SMGLGSGREGQVGAAERLELGERLMRSRKLKLLAKLVGAFREVAFEARRRRVVRTPQVM
FT                   HEVGRGAHLDRLLPSELLGLPRHRGALHREFVRRLVEGELLEYELRGASSRGPMVVCVD
FT                   GSGSMQGTKEIWAKAVALTLTEIARRERRRCLAIVFSSGHALFEVELLGAKGRSNVRAP
FT                   MLDDNVLAFAEHFPGGGTDFEPPMRRALAAVSEGNYRRGDIVFITDGQAQVSENLIADI
FT                   TKARKKHRFRVRGILVDVADSDRGSLLRFCDEVREVTDLVADSLGDLFASV"
FT   gene            complement(345809..346810)
FT                   /locus_tag="Hoch_0232"
FT   CDS_pept        complement(345809..346810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0232"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="KEGG: scl:sce3817 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase III; TIGRFAM: 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein; 3-Oxoacyl-[acyl-carrier-
FT                   protein (ACP)] synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12873"
FT                   /db_xref="GOA:D0LHL1"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHL1"
FT                   /inference="protein motif:TFAM:TIGR00747"
FT                   /protein_id="ACY12873.1"
FT                   /translation="MIRTRFVGTGRSVPERAVSNEEIARRVETSDEWIRTRTGIRKRHV
FT                   LGEHEATSDMAAAAGRQACEAAGIALEDIECIVVATTTPDMPMPSCAMLTQAKLGIRGP
FT                   AFDVAAACAGFTYGTTVVDSLIRSGQYKRVLFIGAEALSKFLDWDDRGTCILFGDGAGA
FT                   VVAVAEEQDVPDGDPRARGILSTFLDGDGSLWRELNIPGGGTACPPSEDSLAQGQHYLR
FT                   MNGRVIFSHAVRNLSEASETALARAGLSIDDVDLVIPHQANLRILDAVAKRTRIPREKF
FT                   IVNLDEYGNTSAASIPIALDDGVRSGRIQEGMLLVHCGLGAGLTWGAVVVRW"
FT   gene            complement(346903..347409)
FT                   /locus_tag="Hoch_0233"
FT   CDS_pept        complement(346903..347409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sde:Sde_1041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12874"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHL2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12874.1"
FT                   /translation="MASEQLQKCTIVSLEESDIKIEALYNPNKIKISKKVNWSAHSPTP
FT                   DKKQQLEYAASAKMQTRTLSMELFFDGSEQGKNVHALYVSVLQQFTVPEKYSTKTSKNK
FT                   EEKVLRPPFVMVVWGTFPPFKGVLDSVDADYSLFTPGGMPLRATCSLSFTEVDPLQLTG
FT                   AQKSA"
FT   gene            complement(347656..349386)
FT                   /locus_tag="Hoch_0234"
FT   CDS_pept        complement(347656..349386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0234"
FT                   /product="Sigma 54 interacting domain protein"
FT                   /note="PFAM: regulator of RNA terminal phosphate cyclase;
FT                   sigma-54 factor interaction domain-containing protein;
FT                   SMART: AAA ATPase; KEGG: scl:sce7155 sigma-54 dependent
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12875"
FT                   /db_xref="GOA:D0LHL3"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009715"
FT                   /db_xref="InterPro:IPR017183"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHL3"
FT                   /inference="protein motif:PFAM:PF06956"
FT                   /protein_id="ACY12875.1"
FT                   /translation="MRSSGKRLVVIGLLGSTLDRGGRGARRWDKWRPSVALCRHEDLLV
FT                   DRLELLHMPAHQRLLHTVRGDIAQVSPETEVRPHALDLRDAWDFEEVFAALHEFARAYE
FT                   FRPDSEDYLVHITTGTHVAQICLFLLTESRHLPARLLQTSPPGPEHRGEPGRYAIIDLD
FT                   LSRYDRLASRFRQEQQDRVSFLKSGIDTRSPAFNALIERVERVALRSRAPILLSGPTGA
FT                   GKSQLARQIYELRRARRQLEGAFVEVNCATLRGDAAMSALFGHVRGAYTGASRDRAGLL
FT                   RQADRGMLFLDEIGELGGDEQAMLLRAIEDKRFVPVGGDREAASDFQLIAGSNRDLERA
FT                   VAQGRFREDLLARIDTWWFRLPALRERPEDIEPNLDYELAQWTQRQGTRVTFNREARAR
FT                   FLHFASGEATWPGNFRDFNAAITRMATLASGGRITIADVDDELSRLRARWQHAIPAASP
FT                   QPPPSPPTPDHPSENHTVSENASIDRSSPEHAQQTTNPSWPRARAALGDEALAALDRFE
FT                   RAQLEDVLGVCALSDSLSEAGRALFAVSRARKQRPNDADRLRKYLARHGLSWSQLSTER
FT                   "
FT   gene            349739..350959
FT                   /locus_tag="Hoch_0235"
FT   CDS_pept        349739..350959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0235"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   mxa:MXAN_4982 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12876"
FT                   /db_xref="GOA:D0LHL4"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHL4"
FT                   /inference="protein motif:PFAM:PF01139"
FT                   /protein_id="ACY12876.1"
FT                   /translation="MQAYEVFPTSNVPVKAWVRGVPVEDKARQQLENIAGLPFIHKWVA
FT                   AMPDVHLGKGATVGSVIPTVGAIVPAAVGVDIGCGMMAVRTSLTAAALPDALHPLRTAI
FT                   EAAVPHGRTNHGGRGDRGAWGRPPEAQQQAWGELSPTFERIVDKHPKLGRANHITHLGT
FT                   LGTGNHFIEVCLDEAERVWVMLHSGSRGIGNRIGSYFIELAKEDMRRHFINLPDKDLAY
FT                   LCEGTQYFDDYVEAVEWAQRYAMENRRLMMAAVLRALAESPSLPAFTSGEMAVNCHHNY
FT                   VAREHHYGKNVYLTRKGAVRAREGDLGIIPGSMGARSYIVRGKGEAQSFHSCSHGAGRV
FT                   MSRSEAKRRFTAEDHARATSGIECRKDSEVIDETPMAYKDIDAVMAAQSDLVDVVHTLR
FT                   QVVCVKG"
FT   gene            350962..351990
FT                   /locus_tag="Hoch_0236"
FT   CDS_pept        350962..351990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0236"
FT                   /product="RNA 3'-phosphate cyclase"
FT                   /EC_number="6.5.1.4"
FT                   /note="KEGG: pca:Pcar_2836 RNA 3'-terminal-phosphate
FT                   cyclase; TIGRFAM: RNA 3'-phosphate cyclase; PFAM: RNA
FT                   3'-terminal phosphate cyclase; RNA 3'- terminal phosphate
FT                   cyclase insert region"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12877"
FT                   /db_xref="GOA:D0LHL5"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013791"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR017770"
FT                   /db_xref="InterPro:IPR023797"
FT                   /db_xref="InterPro:IPR036553"
FT                   /db_xref="InterPro:IPR037136"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHL5"
FT                   /inference="protein motif:TFAM:TIGR03399"
FT                   /protein_id="ACY12877.1"
FT                   /translation="MGADIVIDGAAGEGGGQILRSALALAAVSGRAVVIDGIRARRRKP
FT                   GLMRQHLTAARAVAEVCGGALEGDELGARRLRFVPGAVRGGEYRFAVATAGSACLVFQT
FT                   VLWPLLAADAPSRVVFEGGTHNPMAPPFDFLARVFVPVLARMGVAMSLRLERPGFYPAG
FT                   GGRFAVELQPGPLRPLELFDAGPVRAVRARALVANLASGIGRRELAEVRAVLDWPEQAC
FT                   WVERADEAAGTGNVLLLELEREGVSELVCGFGERGKPAERVAREAAAEVQVYLACGAPV
FT                   GEHLADQLVIPMALAGGGGFCTGALSSHARTNIEVVRRFVPVDVRVDEIPDSGHTRVRF
FT                   GA"
FT   gene            complement(352310..355264)
FT                   /locus_tag="Hoch_0237"
FT   CDS_pept        complement(352310..355264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0237"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein;
FT                   Tetratricopeptide TPR_4; TPR repeat-containing protein;
FT                   SMART: Tetratricopeptide repeat; KEGG: ade:Adeh_3810 TPR
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12878"
FT                   /db_xref="GOA:D0LHL6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHL6"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ACY12878.1"
FT                   /translation="MSDFARRPTIDEIEQLRAQVRREPGSPAFVRLGEAYLALGRPQDA
FT                   IEVGVPGLRDNPDSTAGRMMIGRAYVMQHQWKEAQDELLRLVKADRNHAAGFALLGEVL
FT                   LRRQDLKRALPVLQHAQNLNPTNPYVEDLLKRARTGRAPDPPPPPPVPQDPQPAAAPYA
FT                   SASAHNDPLQFGVDEPTRVAGDMSSGLTPPPAAAPHGHAPQYPGHQSAPAPAPAPRPRQ
FT                   QQQAITDPGAKTIMAGAAPAAESKPPSPRPIPRALAQPAPQAAPAPAPAPKAEPETKKK
FT                   PKVAAADMPPPGPPTGVRPRILSMDKPTDAAREAMHQAADVGDYLNALLTQGLLNVPAV
FT                   QAQHTPHAYRSGKRWGHSVTRTFVFLFVLLAVGLGGGAFWIYQTEQQREEEVARHIARA
FT                   DTLLTTGTYNDVQEAREATASALRRDPASVSAMAKFARVETAAALLYGTPAAKGTSAML
FT                   RARKELTEEDAAWADIVFAEIASTLATLSDEAAGAPQERLGDARKTADAWLEKHPDDAW
FT                   VRWLSGVAMLYANDLSGAAEAFEAAEADGEGPVVASIYRADMQTDAGELDGASVRYEAA
FT                   LERAPKHPLAIIGNALVQLARAEEAAVVLGKINTTMTEDEGPRANAYRALVFALAYLWV
FT                   AWDYDQFTENLAKAEGVAEPRFLGRVALAQLANGQFAAAGDTRNRIVWYVAEPEQTHPV
FT                   VAAVDAELQWSSGLSAPAIEQVGDSENIRARHLVGRALFDLGRLDESEKAFAEILEFAP
FT                   EDWEAQTWHAAAQLAQAKGRARNEFDETLQQIARTQSNQVVRYVRGLAWQRSGDMREAR
FT                   RHFEESLEGVADEITELAEERANSMAYRAHAALAELDLDAGSTDKAVAHLERAVALNPA
FT                   YLPAMALLGRVQVQRGQHAEAAATLKPLLEEPEIANAAVELAYAEALVGGGSPSDEARG
FT                   QAREAVLRAKDKGASAEELGRVAALVDETLATEIGAGGAEEKPSRRRGRRRGRR"
FT   gene            complement(355404..356873)
FT                   /locus_tag="Hoch_0238"
FT   CDS_pept        complement(355404..356873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0238"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: bxe:Bxe_B1295 SSS
FT                   family Na(+)/monocarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12879"
FT                   /db_xref="GOA:D0LHL7"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHL7"
FT                   /inference="protein motif:PFAM:PF00474"
FT                   /protein_id="ACY12879.1"
FT                   /translation="MERWTIVTLICGAYLVASLVMGVLPGRKVTSGVSGFVAGDRAMNV
FT                   VVLYFVMGASVFSSFAFLGGPGWAYGRGAAAFYILAYGVVGMVPLYFMGPRARRLGSRF
FT                   GFVTQAELLAHRYQSRAISVLLAVLSIAAFVPYLTLQMKGAGYIVSVISEGRIEPWVGA
FT                   AVAYAVVLVYVLASGVMGVGWTNTFQGIFMMAVAWFLGLYLPERLHGGIGEMFAAIEAS
FT                   ERAAMLTAPGLDAAGQPWSWATYSSAVAISALGFCMWPHLFMKSYAAKSERALRLSAVL
FT                   YTTFQAFLIPILFIGFAGVLAFPGVSPSDTILPHILTQVDLSPVLVGLVCAGTLAASMS
FT                   SGDAILHAAASIGVRDGLRPFIGARLSDRGEANAIRALILVIAGVAYVFAVVVDVSIVA
FT                   LLLGAYGGVAQIFPPMFAAFYWPRATRAGAVAGLLGGLITSTLFLVMPEWRPWPIHEGA
FT                   YGLLVNLLLLVSVSLATPPLPIAHLRAYMSR"
FT   sig_peptide     complement(356805..356873)
FT                   /locus_tag="Hoch_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.673) with cleavage site probability 0.656 at
FT                   residue 23"
FT   gene            complement(356876..357169)
FT                   /locus_tag="Hoch_0239"
FT   CDS_pept        complement(356876..357169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12880"
FT                   /db_xref="GOA:D0LHL8"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHL8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12880.1"
FT                   /translation="MHDPDEVPRGLVLFAPDTPPAYRRRRLIFAALLALAAAAQVWPLY
FT                   ALFAAPRPFVLGMPQPLVWIISWMLLMFGALIWLYRSEPPDPADPPPPPAEP"
FT   gene            complement(357266..358759)
FT                   /locus_tag="Hoch_0240"
FT   CDS_pept        complement(357266..358759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0240"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   dimerization region"
FT                   /note="PFAM: pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region; FAD-dependent pyridine nucleotide-
FT                   disulphide oxidoreductase; KEGG: aav:Aave_2433
FT                   dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12881"
FT                   /db_xref="GOA:D0LHL9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHL9"
FT                   /inference="protein motif:PFAM:PF02852"
FT                   /protein_id="ACY12881.1"
FT                   /translation="MLARMSRETRVDVAILGAGTAGSHALEQVRRTGKSFVVINGGPLG
FT                   TTCARVGCMPSKLLVQAAELYHDRHRAARVGIRGTEALRVDMPAVLERVRALRDDFVAS
FT                   TIDSFYDKLSQNPDGTQPSKDERARRIDERLIEGYARFTAPGAVEVDGRIIRAERFIIA
FT                   TGSSPIVPDEWAALDERALTTDTLFEQRDLPARMAVLGLGVIGAEMGQALARLGIEVSA
FT                   FDTSDEIAGLSDPAIAACARELLGRDMNLHLGCEAKPVHADEELRIDFGAGADAVAVTV
FT                   DKVLVCIGRRPNTGDLGLDDIGAPLDDDGHPQFDAETMQLGDLPIYLAGDASGPPLILH
FT                   EAADEGRISGFVSSREQTRGFRRREPFGIVFTDPNIATVGEAWNQLDHDDVVVGEVDFS
FT                   SQGRARVMVRDSGRLRIYGARDSGRVLGAAMCAPLGEHLAHLLAWSIEQKLTVFDLQQM
FT                   PFYHPTLEEGLSTAIADLAAKVARDAPSPVPELRPAERE"
FT   gene            complement(358788..359420)
FT                   /locus_tag="Hoch_0241"
FT   CDS_pept        complement(358788..359420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0241"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   csa:Csal_2901 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12882"
FT                   /db_xref="GOA:D0LHM0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHM0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACY12882.1"
FT                   /translation="MTQDASTRDPAPTRSPAAAPTAPTAPAGPTAPRWRLDGDTELRTL
FT                   VEDDADELFALVEANRERLRAWLSWLDEHRSVDDILTLIGHYQREYTRGRSLRLAIVHR
FT                   GALAGMAGLHRVSASDRTAALGYWLGAAFEGRGLVTRALVPLIRHGIEALGLGRIELAA
FT                   ATGNRRSIAVAERLGMHFEGTLRRREWLYDHHVDHAVYSLVPGDRLP"
FT   gene            359939..362419
FT                   /locus_tag="Hoch_0242"
FT   CDS_pept        359939..362419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0242"
FT                   /product="Heat shock protein 70"
FT                   /note="PFAM: Heat shock protein 70; KEGG: scl:sce7648 Hsp70
FT                   heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12883"
FT                   /db_xref="GOA:D0LHM1"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHM1"
FT                   /inference="protein motif:PFAM:PF00012"
FT                   /protein_id="ACY12883.1"
FT                   /translation="MSTDNASSERPFYAGFDLGTTNSAAAVFDGEQITLVRNAQGSALT
FT                   PSVVRIDGKGRTTVGVRARRYLDSDPDNTRSEFKRLMGTDKPLDFPAAALTRTPQELAA
FT                   QILGALRADVRDQLGILPTRAVIAVPALFELPQSNATAEAARLAGFERVELLQEPVASA
FT                   LAAGWRAEDMNGAWLVYDIGGGTFDVSLLETRDGLLRVVGHDGDNFLGGRDFDAAVVDW
FT                   MIERLAEDDDLRLDRGNPEHAAALQVLRRVAEEAKIELSRVDEAVLAPPQPLQVGDTAL
FT                   EFELTLDRDTLERLCAPVVDRSLDVCRRLLEAQGLTPGQVERAVLVGGPTVAPFVRARI
FT                   ERELGVQVSEGHDPMTLVAQGAAIYAATANLDARPEKRAPAAGGHHVWLQYPAVSSDLT
FT                   PHVVGRVTTRAQPGAPTKLRLVRKDGAWTGAETAIDGEGGFVTIVDLAPRKANVFTIEA
FT                   TDATGATVAVHPDEFTIVQGITISDPPLSRSVGVALASDHVHVYFERGAALPVRRTFTH
FT                   FTVETVAKGAEQSVLKIPIVQGEFSRAHLCRLVGSLEIGGARVSDTVPSGSPVEVTIEL
FT                   DRGGRLSASALVPATGQVFEEVAHLLVPTADPEVLSASLADLRKRVVELRTEAFRKGWS
FT                   EGLELLEGTEEQLEAIEHDVIATRGGDEDAGQKARRSLLELDAAIGEVELRRRWPELEE
FT                   KAMGELAWASDWVSRYGTAAEKQLLEEVGNAVSTARSSHNPGELERQLRVLRRLGNAAF
FT                   HRHPEAWQWLFEGAASKLSSATDLPKAQALVDQGKAAITRGDEVALRGVVEQLWRLLPI
FT                   DVQTRRLGFDSGIR"
FT   gene            362427..362807
FT                   /locus_tag="Hoch_0243"
FT   CDS_pept        362427..362807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0243"
FT                   /product="putative heat shock protein DnaJ, N-terminal"
FT                   /note="KEGG: scl:sce7649 putative heat shock protein DnaJ,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12884"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHM2"
FT                   /inference="similar to AA sequence:KEGG:sce7649"
FT                   /protein_id="ACY12884.1"
FT                   /translation="MDSGQRIRGNPFYVLGVSVEASRAEIEREGQKLLGMLALELSAAT
FT                   TYATPLGAHTRTVEAVREAMAELRDPDKRLAHELWARLPVPTADADANADTDAAAGADA
FT                   AGDAPWPGARARLGWAARGSDA"
FT   gene            362804..364288
FT                   /locus_tag="Hoch_0244"
FT   CDS_pept        362804..364288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce7650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12885"
FT                   /db_xref="GOA:D0LHM3"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHM3"
FT                   /inference="similar to AA sequence:KEGG:sce7650"
FT                   /protein_id="ACY12885.1"
FT                   /translation="MSIWVSLLAYLLWKLVRVVMGEDAQVPSEGFVLAWAYVALGTALL
FT                   ALGAVAGIWWCWPALGLGAVLLAPWTVTRALLIPLGLPRLAYALSWCAGWRWNRDRTGG
FT                   ALVAGAWALLRQRRPAGATVAWLERRRDAAPALQAAQVLATGLLAAARGDLAGARRLLD
FT                   SVDGLGPRRTPRYVHALAREWLALDAAERGDWAEVVACGEGPQARTRLTLLLAAVGACL
FT                   MDETGPRPTRERLWVAWLLAPQRRHTWPLLQRALAASAATAGDADADRPRALLGTGLVS
FT                   DPYLDALATHAAVIAGRSKLTPAQALRSAGDAWQRALDDPDTQAWIAQRAAHLGARSQT
FT                   QAQARLRETITRELAEFARTHDLPVARWARDCGVLREVERVLREEQLSSLELAFDALAN
FT                   RVARQEALPPMDEWRAWLSLRAQHRQAAALGGLDLRRLAFPQIHQVACKWAVWMWNERK
FT                   QYLLANSVFAWLLAEAVLVGDAEAIELQRRNWDDSL"
FT   gene            complement(364333..365385)
FT                   /locus_tag="Hoch_0245"
FT   CDS_pept        complement(364333..365385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0245"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   tdn:Suden_1233 CDP-diacylglycerol--glycerol-3- phosphate
FT                   3-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12886"
FT                   /db_xref="GOA:D0LHM4"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHM4"
FT                   /inference="protein motif:PFAM:PF01066"
FT                   /protein_id="ACY12886.1"
FT                   /translation="MVTVMRLIPMPLLCWLVYAEQIWLALVLGTFIGSTDFIDGYLARK
FT                   HGPTVLGGLLDPIADKVFIALAYLPFADLGVVPAWAVALMFVREFLVTALRSAYEQRGM
FT                   SMKTSYLGKVKTWVQMQGLGLLLLFVLLAEQSGVLFGLLLAASVLPLVAVLAMWLARRR
FT                   LWPGALLMTVFTLPLLLLHANGDIQLTLLVGMLIVVGVTWVSGLDYLAMGVRELRGRGD
FT                   FGRADVVRLVGAISLPVAVFTALVSTPMPVWAPALVLTAELSVGGLDNLLSHHKAAAGA
FT                   LSWSVRVLGTSALLLMPVVLGLGAGAATIAGIAAALLSLLGVCREFWRGRDFYLDSRLR
FT                   DKAMRAPMVV"
FT   gene            complement(365562..367031)
FT                   /locus_tag="Hoch_0246"
FT   CDS_pept        complement(365562..367031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0246"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_1527 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12887"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHM5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12887.1"
FT                   /translation="MRPIVTAIAAGTLAVTALAGCPSREVSEVGIVQQKQQKKQIDVEL
FT                   KRDLDILFVIDNSDSMGEEQASLAANFPAFIDKLQNIEGGLPNVHIGVVTTDVGAGNVN
FT                   DLCSTATSDKGELQADLHLEDGEACAGLALGLDDNPYIVDEVRDPEGDPNDRVTNYSGG
FT                   DLAQVFSCMAQLGINGCGFEQPLESMRLALDPNTAANSGFIRPDAFLAIIIISDEDDCS
FT                   TYDPEMFDKTVTGIDSKLGPLDSFRCFEFGVQCDPDDIRSEGEKFDCVPREDSPYMSGV
FT                   QEYVDFVKGLKVNPDKIIVAGIIGVDPDENGEEANPQVTLETRDINGNQAQFYRLEPAC
FT                   ETGAGKAAPAVRLNAFLNQFTNNSSTTICDENLSDALNRTADLLTAVIGNPNCLTTDVF
FT                   IRDASDTQLPYDCQASYLLGEEESALPHCDVNSEDAKNQPCWYIAQDRQEECADAGEPF
FT                   QELFVIDNQDRDPNTQVVLQCAIESDFELEE"
FT   sig_peptide     complement(366972..367031)
FT                   /locus_tag="Hoch_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.896 at
FT                   residue 20"
FT   gene            367445..368926
FT                   /locus_tag="Hoch_0247"
FT   CDS_pept        367445..368926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0247"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   afw:Anae109_0684 two component, sigma54 specific, fis
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12888"
FT                   /db_xref="GOA:D0LHM6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHM6"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACY12888.1"
FT                   /translation="MVVDRDAASRDELQHALSAQGCRVTAVDDGRAAKVELAAQSFDAV
FT                   FCSVSETEALAGDAAAIPRVATLPRGALREGMEAVASGLACDCLVVPASADEVAMALLR
FT                   AARLAPLLGAAAAAPAQAQRDDASDDAQQGTGETGAARDAQPARRRPRAKLVVVGGMVG
FT                   ASAAIKDVFATIDKVARHKAAVLITGESGTGKELVARAIHDASQRKGKNFVAINCGAIP
FT                   ANLLESELFGYRRGAFTDAVRDKTGLFEVADGGTLFLDEIGELPLNLQVKLLRVLQEEE
FT                   IRRIGDNRTTKIDVRIVAATLRNLGEDAENGRFREDLFYRLNVLNIVLPALRERRADIA
FT                   PLAEHFVAAYRKRHKSSQPRAEGISEAAMGLLEAYAWPGNIRELENTIERAMVLADGPL
FT                   IEPHLLDAKIAQFAPAGAAQTAPAASASASDEDLRSVAIALDGDDLSIKKHTRLFEERL
FT                   VRIALGKTDGNRHNASKLLGISYRALLYKIKEYGI"
FT   gene            369043..370089
FT                   /locus_tag="Hoch_0248"
FT   CDS_pept        369043..370089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0248"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /note="TIGRFAM: type IV pilus assembly protein PilM; KEGG:
FT                   afw:Anae109_0686 type IV pilus assembly protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12889"
FT                   /db_xref="GOA:D0LHM7"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHM7"
FT                   /inference="protein motif:TFAM:TIGR01175"
FT                   /protein_id="ACY12889.1"
FT                   /translation="MAKNCIGLDIGSSSIKAIQLKKRKRGLEVCAFGMEPLAPQTIVDG
FT                   TIMDQTAVVEAIRALWKRLKLRQRDVAIAIAGHSVIIKKISVPRMSSNELAEQIPQEAE
FT                   HHIPFSRDDVEIDYEVVLEENLSGQMDLLLVAAKKDVVADYTQVVKDASLVPQVVDVAA
FT                   FTAQNGFEANYQLRDDETVILINIGAAISNINIIRGTQSLFTRDVTIGGNLFTEELQKQ
FT                   LSLSYEEAEAYKVGGGPNEQGVVPEPVEQVIESVADVMAGEFQRSLDFFLATSAETNVT
FT                   RVCLAGGTSKAPALHRAIAQHSRLPVEVIDAWRNVSINASLDSDFLAAHAPEALIGVGL
FT                   ALRAGNDK"
FT   gene            370109..370741
FT                   /locus_tag="Hoch_0249"
FT   CDS_pept        370109..370741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0249"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   scl:sce6187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12890"
FT                   /db_xref="GOA:D0LHM8"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHM8"
FT                   /inference="protein motif:PFAM:PF05137"
FT                   /protein_id="ACY12890.1"
FT                   /translation="MIKINLSPLRRPKTSGEGARLVLLAALLWIGTLLVIVFVVHLPMT
FT                   DEMDTLNSAVASLSADNADKRNELKGYEELKSTLADAEARAAVVERLNEARAVPAHMLY
FT                   ELSRILTPGRLPTTTEEVAKQIEEGRFREMVREWDPAQVWIERFSEDEEGSFKLEGKAQ
FT                   SDSDMTQLALRLQASVYFYEVVPVGGNEVEEDGAVFYKFTITGKVAY"
FT   gene            370743..371408
FT                   /locus_tag="Hoch_0250"
FT   CDS_pept        370743..371408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0250"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0643 type IV pilus biogenesis protein
FT                   PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12891"
FT                   /db_xref="GOA:D0LHM9"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHM9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12891.1"
FT                   /translation="MADRSFLDEVTKWTPRQKAAFVLLPPFLIGLLYAFGPLPFSYQET
FT                   QDELVQKGSERNRLLGEQAQLDRDLETKKQLLQRMEELEQSIRANERALPTDAELPAFF
FT                   DFLQRRASEAGVSIRKWDQMSSEKLGIYVRVPVKIEVSGTFLNLVRYFYLLGPVSDVDR
FT                   SRNEALSLGERIVSVEELTLDDAELVDREVVLTAYFIAATFYLDEQAQQAGQQAGAQK"
FT   gene            371438..372097
FT                   /locus_tag="Hoch_0251"
FT   CDS_pept        371438..372097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0251"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_0689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12892"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHN0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12892.1"
FT                   /translation="MATSTTLRSGAARPWSLPVLLAVAWLVAGCGDDPVVATANPNANR
FT                   AAQQAQQLPEQSGLRFHVKIDDRLGEEQAQALREPFDLSDFRPDASGKTKRDPFRSLAA
FT                   AQLAAQLEQSKPTEATQICKDTVAPQSSLRELRLVGIVLRGTRSYALFVDGRSAGHIVT
FT                   KGDCLAQEKARVDSVRAGFVTLQIYPENTTGAPDALFQERTIALYPDEIPVDGDLP"
FT   gene            372094..375903
FT                   /locus_tag="Hoch_0252"
FT   CDS_pept        372094..375903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0252"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; Secretin/TonB short
FT                   domain; NolW domain protein; KEGG: scl:sce6184 type 4
FT                   fimbrial biogenesis protein PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12893"
FT                   /db_xref="GOA:D0LHN1"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHN1"
FT                   /inference="protein motif:TFAM:TIGR02515"
FT                   /protein_id="ACY12893.1"
FT                   /translation="MKRFNNTPQHFAPPMARAGAPRARGRWSQRAAAVTLAALVATLGS
FT                   LSSASARPDKSRIRAVDHREAGAVAGTMQIRIRGTQEPTFTVYKLDYPARVVVDITGAE
FT                   LDRKLTGESDHKASWPVNGWAVNQLSVYELHDVAGDGASQGGHSLVRVVVGMARPGTYH
FT                   AEARGRDVMVTVTPQEAQPAGVAPGQIEAATKAVEQAEARRSAVLAEAEAAERRKRAAE
FT                   GERERLAKALAQAEQARSDARSQAQEAERRAAQARELREREEAAYREIADARREAEQRA
FT                   EQARELREREEAAYRQATVARREAERRSAEIGAADDKLNALQSAAAEARAEVESLRRAA
FT                   AEAERRAAGMRERKDSTEREIARAKAEAERQAGALRDAERTLSAHKREISSQEREVARL
FT                   SKVRGEAERALRDLDSAAKKARAAREAEEAQLATLSQRRDHLEGELATARSAIREAQAS
FT                   WKAQRSEAEAQLNQLGRAVDNARAERLAEEKRLSELAARRKQLEGEIDRIRQEHERDGK
FT                   SSSRRAAAEMRALDSARVAEEKRIAELATRRKQLERELQQARAKVRVAAQAEHKAQRSE
FT                   ADAEREALAKAVAAAKQQRAEEADKIAELGKRRSALEASLASIHAQVEAAENSRAQAER
FT                   ARRAEEAKLAELSERRKTVESDLAERQRAADAKASKRKLAKAKAASKVRVEEVDFVDAD
FT                   EVARVVIALSDRADPKVVRAEGKRVVLEIDDVTLPSKLERTLDTSAYRGPIRAVSSYRS
FT                   PDDADKMRLVVDLAYPAKHALKRSGNSLLWDFAKSAKRERQAARTQSARKRRPSGSARA
FT                   QSIPAPVVGGYGAASTPITQKTVAQLANQRRRVYRGTKIDLDLQNVDIHNVMRLLADVG
FT                   GINIVVPDEVSAEVTVRLRQVPWDQALEVILASKGLWYRREGNLYRIATRKQLDAEAEA
FT                   EAERIAALIKAEAPEPQIFTLNYAVASQLKPQLEALLSPKGRIEIDERTNSLIINDVRA
FT                   HRTRIIDLLTRLDTQTPQIQIEARIVEARSTFAREFGVQWGGSLLDANTGLVFPGNYGV
FT                   VGGNTDSQTVGTGVAAASPDFAVNLPAATGTGAGGALGFAFGSVGGGLNLTLRLSALED
FT                   TGTVRIISAPKITVLNNVEAEISQGVSIPISVISANGVQTQFVQADLSLEVTPHVSQRD
FT                   CSIAMDLQIQKNEADFVNTGARGDPTILRKEASTTVLVADNETTVIGGIYTRNSGLSYS
FT                   KVPFLGDLPLLGWLFKNRRENDERTEVLVFITPRITNKAFLRCE"
FT   sig_peptide     372094..372249
FT                   /locus_tag="Hoch_0252"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.584 at
FT                   residue 52"
FT   gene            375938..377593
FT                   /locus_tag="Hoch_0253"
FT   CDS_pept        375938..377593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0253"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="2.7.1.71"
FT                   /EC_number="4.2.3.4"
FT                   /note="KEGG: scl:sce4842 3-dehydroquinate synthase;
FT                   TIGRFAM: 3-dehydroquinate synthase; PFAM: 3-dehydroquinate
FT                   synthase; shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12894"
FT                   /db_xref="GOA:D0LHN2"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHN2"
FT                   /inference="protein motif:TFAM:TIGR01357"
FT                   /protein_id="ACY12894.1"
FT                   /translation="MPRHVFLTGFMATGKSTVGRQLAARLRRPFLDLDDAVEAEAGHTV
FT                   ADIFASEGEIGFRRRERAALQRIADGPAAVIATGGGAACHGDNLAQMRRSGLTIALTAP
FT                   LATARARADAGERERPLLRATEAELEALYRSREPMYRQAHACVRTEDSEPALLAREIAA
FT                   LVARAETLPDDAQEQASWVALREGAYPVVVAEGGSDRVGTWLRSVLGERRPSRVAVVSD
FT                   DNVAPLHGERVRRAIDGADLCERPCSLHTVAAGERSKRFEVLGRLVDELVAEGLDRSSL
FT                   VVALGGGVVGDLAGFTAACLYRGVPVVQVPSTLLAMTDAAIGGKTGIDIAAGKNLVGAF
FT                   WQPRMVVVDPALLATLPARELRAAFGELIKYGLLDGEELYARIEALADALAAAGDEPGA
FT                   ALSPAFTEIIRRCAAIKCWIVTRDQREQTGERALLNLGHTVGHAIEAACAYEGMLHGEA
FT                   VALGLVAACRVSARLGQCADGLEERVRATVERAGLDADLDRWLRGDDAERVLGFLATDK
FT                   KRAGKRIGFVTIGAMGDCGITPIELAELVRILRP"
FT   gene            377731..378090
FT                   /locus_tag="Hoch_0254"
FT   CDS_pept        377731..378090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_1822 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12895"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHN3"
FT                   /inference="similar to AA sequence:KEGG:Gura_1822"
FT                   /protein_id="ACY12895.1"
FT                   /translation="MFKEQIQKVVDALGNGYGGIIMGLDGIAVDSYVRDSGGFDINIVT
FT                   MEFSFILTQVTKAAETLKIGGLEELVVKAEQLVLVMRMINEQYFLAVALPPDGNLGKCR
FT                   FLMRLTAPKLLSELI"
FT   gene            378101..378655
FT                   /locus_tag="Hoch_0255"
FT   CDS_pept        378101..378655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0255"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: geo:Geob_3059 3-dehydroquinate dehydratase,
FT                   type II; TIGRFAM: 3-dehydroquinate dehydratase, type II;
FT                   PFAM: dehydroquinase class II"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12896"
FT                   /db_xref="GOA:D0LHN4"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHN4"
FT                   /inference="protein motif:TFAM:TIGR01088"
FT                   /protein_id="ACY12896.1"
FT                   /translation="MSAPSDRAADAAAPLRILVLHGPNLNLLGTRAPEIYGSTTLAEID
FT                   ASLRQRAAAAGAQLDSAQSNHEGQLVDHIQAAASRYDAIVINPAAYTHTSIAIRDAIEA
FT                   VGLPVVEVHLSNIHARESFRHHSMTAARCVGQICGFGAQSYELGLDAALAHVKGLRERR
FT                   GRERERRDSERERRARDSESE"
FT   gene            378660..379295
FT                   /locus_tag="Hoch_0256"
FT   CDS_pept        378660..379295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0256"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: mxa:MXAN_5768 acetyl-CoA
FT                   carboxylase, biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12897"
FT                   /db_xref="GOA:D0LHN5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHN5"
FT                   /inference="protein motif:TFAM:TIGR00531"
FT                   /protein_id="ACY12897.1"
FT                   /translation="MAQSRKTSKSTSKKAATKSGSKTGGKSSPPRSASATSSAAAAAGD
FT                   DPTVAMVRGLAEIVESRGLSELIVELPEAKLTLRRASAEVVLGQPSAMPVPAVMAAPQP
FT                   VLAPAPAPAAAPAPAAAPAPAPAEPEDDSHVVTSPFVGTFYRRPNPDADPYADVGARVE
FT                   KGQALCIVEAMKLMNEIEADISGTVVAVLASDAEPVEYGQALFKIAPG"
FT   sig_peptide     378660..378791
FT                   /locus_tag="Hoch_0256"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.466 at
FT                   residue 44"
FT   gene            379315..380649
FT                   /locus_tag="Hoch_0257"
FT   CDS_pept        379315..380649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0257"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: Carbamoyl-phosphate synthase L chain ATP- binding;
FT                   biotin carboxylase domain protein; ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP-grasp; RimK
FT                   domain protein ATP-grasp; Carbamoyl-phosphate synthetase
FT                   large chain domain protein; KEGG: mxa:MXAN_5767 acetyl-CoA
FT                   carboxylase, biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12898"
FT                   /db_xref="GOA:D0LHN6"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHN6"
FT                   /inference="protein motif:TFAM:TIGR00514"
FT                   /protein_id="ACY12898.1"
FT                   /translation="MFRKVLVANRGEIALRIIRALRELGIRSVAVHSEADASALHVKFA
FT                   DEKVCIGPAPSARSYLAVPSIISAAEITRADAIHPGYGFLAEDPEFAEVCEKCDIQWIG
FT                   PRPDSMRLMGDKIRAREAMAKAGVPVLPGSGAINTEAELHQAVEQIGFPLILKAAAGGG
FT                   GRGMKIVREPGRLVADWSLARTEAQAAFGNPDMYAERYCERPRHIEIQVVADHHGTAAH
FT                   LGERECSVQRRHQKVVEEAPAASLDSDIRDQMTDAALKAVRAIGYRNLGTLEFLLDEDG
FT                   QFYFMEMNTRLQVEHPVTELITGVDLVREQIRIAAGERLSFGTRRPRGHAIELRINAED
FT                   PETFAPWPGKITGLNLPGGLGVRVDTHIYDGYVVPPHYDSLLAKLVVHDDTREAALRRA
FT                   RRCLEEFVVEGIRTNLAFHRRIIDHPEFQAGRYDTGFVARLLAGK"
FT   gene            381013..383937
FT                   /locus_tag="Hoch_0258"
FT   CDS_pept        381013..383937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0258"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide repeat; KEGG: mxa:MXAN_5766 TPR
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12899"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHN7"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACY12899.1"
FT                   /translation="MAFNKNKVMEVARRYVEKGQLDKAIREYTRVVEEDPHDVRVWLKI
FT                   GDLHVKNGAKREATETYLRVAPFYSEQGFFLKAVAVYKQILKLNPRLVEVNLKLAELYR
FT                   QLGLMSDAMQHFEMVAGHFHREGKTSEALETVRQLVELAPDNVATRIKLAELYSKEGMT
FT                   EEAVAEFTLACDHLRAQGREEDFVKVGERLLWHRSENVALSRELAGIYLRRNDARRALQ
FT                   KLQACFKANPRDVDTLELLAQAFQHLEQSAKTVSVLKEMARVLEEDGRRGDAMAVYERI
FT                   LQLAPGDRDALAQTGRSAEAAVAPPPSQGSHSTSMPPPGASASAPPPPPPAASAPPPPP
FT                   PRGRALTVSVPVAGPRKPRPTGSVPLVGNQASFAQEAARSVGSGRPLVSDFADESSVAG
FT                   EEHSESIAKIFTETDVYVKYGLHDKAIEHLRQVFALDPVNLEGHERLKEILLSQGRHAE
FT                   AVVELVTLGDLCATYNRHRAAAYVREALVLAPEHAPAIELAQRIGLSAHGLSANPPASS
FT                   PRPTSELVLDESADLSDFDIEVEEPQRRDGDTHIIVSPRNSVLRRGADPVDDPGDDPLI
FT                   DESADSVDTAILSLDGLGIDDVDMLLGGGAEDPLAPQSFDNRADTAMGLATEVIELEQA
FT                   DSSDIFSSESMSDLLEEPFSTTLDGDGPATSVMNAFDLDDDLSLDLDEFEASSMVESAL
FT                   ADPGEFVEQSTRPTTKAPDAGAGGIDDDLDEADFFVAQGLFDSAREILRNVLNTHPHHP
FT                   LILAKLEELDELERGNATADSAPAAVAPETAVTDEPALLGPEESTIDRSLRAQRKPAVM
FT                   LEKPVEDEDADTHYNLGLAYKEMGLYDEAIAEFEKTLTVPEREVQGRFMMGLCHRAQDD
FT                   WLSAINQFKAGLHAPRINESEQLSLYYEIAMAYETGVNDLNEALYFYELIQKRDRDYRD
FT                   LQDRISSCRGQPREEGSSSRESGDEVDAAVDSLLAETDHRSPRG"
FT   gene            complement(384179..384661)
FT                   /locus_tag="Hoch_0259"
FT   CDS_pept        complement(384179..384661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0259"
FT                   /product="ATP-dependent transcriptional regulator,
FT                   MalT-like, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: ara:Arad_7333 chemotaxis
FT                   methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12900"
FT                   /db_xref="GOA:D0LHN8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHN8"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACY12900.1"
FT                   /translation="MVVVDGPERAVYMNSSARTLLQSPSGEMPDWVSPHVEPMLEGLTR
FT                   AEQTVERWVREEMVLRVRARPLDRYSGFAVLEITVAQVAGGRHVADQLARSLQIPISDA
FT                   KLLALLWRGMSNDEIAQTLSVRVGTIKSRLFRLYQRLGVKRRPAAVLRAAEVLSAA"
FT   gene            complement(385377..386756)
FT                   /locus_tag="Hoch_0260"
FT   CDS_pept        complement(385377..386756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0260"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="KEGG: smt:Smal_0784 phospho-2-dehydro-3-
FT                   deoxyheptonate aldolase; TIGRFAM:
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; PFAM: DAHP
FT                   synthetase class II"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12901"
FT                   /db_xref="GOA:D0LHN9"
FT                   /db_xref="InterPro:IPR002480"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHN9"
FT                   /inference="protein motif:TFAM:TIGR01358"
FT                   /protein_id="ACY12901.1"
FT                   /translation="MKPNSTPSAAAWSPTSWQEKTATQQATYPDQEALDRVVAQIARLP
FT                   PLVTSWEIEALKEKLGRAARGEAFLLQGGDCAESFDNCDSQTIAGKLKVLLQMSLVLTH
FT                   GIRRPIIRVGRIAGQYAKPRSADTESRGEVTLPSYRGDLVNRLAFTDEDRTPNPDLMLR
FT                   GYERAALTLNFIRALADGGFADLHHPEYWDLSFAQHHDTEGHYERIVASIRDAIAFMES
FT                   VGEMRLTGLGRVDFYTSHEGLMLHYEQAQTRRVPRRDGWYNLSTHMPWIGMRTATMDSA
FT                   HIEYFRGIRNPVAVKLGPAVTPEWITQLLDVLHPDDEPGRLTFIHRLGAEKVSDLLPRM
FT                   IDTVQRSGKTVLWTVDPMHGNTESTERGVKTRHFDKILAEVEASFEIHESMGSTLGGVH
FT                   LELTGDNVTECVGGARGLSEADLERAYRSTVDPRLNAEQALELALRVTQHLHTSNQSSR
FT                   R"
FT   gene            complement(386971..388431)
FT                   /locus_tag="Hoch_0261"
FT   CDS_pept        complement(386971..388431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0261"
FT                   /product="Integrin alpha beta-propellor repeat protein"
FT                   /note="SMART: Integrin alpha beta-propellor repeat protein;
FT                   KEGG: pin:Ping_0512 PKD domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12902"
FT                   /db_xref="GOA:D0LHP0"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHP0"
FT                   /inference="protein motif:SMART:SM00191"
FT                   /protein_id="ACY12902.1"
FT                   /translation="MVTLFDCADAGRAPGASQSRNHSTPSQRRAGPPRALAQLGGALAC
FT                   FALLGCGGSNGTPDLDGGDGPDPQVDAGVDAEPMPQPDAGPPAGFDFPDFLGAASGASR
FT                   NWFGFSVDADDGVIVVGAPFYDHFEDGEVVGPSVGAAYVFEQVGDMWLQTGHILPPDPS
FT                   EDEYTSSMFGWSVAVEGDLIAVGAWNEDTGAQNGAVYLYQRGGGTWVFHDRLVPDAGDD
FT                   QSQFGYALDIHSGRVAVGAPIVTDVDDNDPATFAYIFERQGQSWQATKLLPDEIPFDAW
FT                   YGYSVSLTEDMLVVGAPGDKIRGDGAGTVYVFGLVNNTWQQIAQLDSLFNEARDHFGRS
FT                   VAAEGDVIVIGADGGGDPTTLNTGAISIFVREQGTFGEETLIIPDDFSVGQGFGASVAM
FT                   RDGVIIVGAHRDDERGVDAGAAYIYMQESDGTWIQYSKLYNPAGRSGDQFGAAVAISDT
FT                   RAIVGARYDDDDGADSGSAYIFEKAPSP"
FT   gene            complement(388929..391349)
FT                   /locus_tag="Hoch_0262"
FT   CDS_pept        complement(388929..391349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0262"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: mxa:MXAN_5696
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12903"
FT                   /db_xref="GOA:D0LHP1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHP1"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY12903.1"
FT                   /translation="MSSPENFGPYEVYERLGIGGMATVHRAKERGIEDFERIVALKRLL
FT                   PHLAEDASFVRSFVREAKLASMLQHAHIVQLYELGRVGQVLFISMEYIEGCDIRRILRR
FT                   ARKIAGPPVVPVFLSLMTQLCDALDYAHSRADSDGNPLGLVHRDVSPSNVLVTKEGHVK
FT                   VIDFGIAKAQSSHLKTQTGRIKGKLAYMAPEAVRGNDLDARSDIFSAGVIAHELLTARP
FT                   LFSSKNEYQTLQRVQRAEVEPPSKYNPDCPPELDSIVLRALSRDEDKRWQTAGEMRDAL
FT                   EHMRMQLGYSATTRDVASWLEWAFALDEPPSAEMRRSRRHTSSSFAADSETIPSGMFSP
FT                   VSFAGRATPRPSPADVVSLPGIPEAEPEVQVVPLGGDDPEDHADVAWGSLEAEDGRVVL
FT                   EAIPDVSAKYVAPPAAVASSGTIGGAQPRAATAASAATASAAAAAPTQARSRTGMLLVA
FT                   VLAIAALGVGAFVALRGEGETQAPAPVTTAVLKFAVEPTDARIEVQGYGTHEGVPLRLE
FT                   VDAPATYRVQIQREGYTSYVSEIELEGGEIRSVQVVLETGHSDQAAVAVRSTPSEQRVM
FT                   LDGELLEQRTPVTLEMSPGAHTLVIVDDAGGELWRHEFDASASTQYEFHPTLSEREDTE
FT                   ERSHRRHRDDDDDDDRERRRRRQSQDDERGDSPEVAAAAPQPSAQSPGQPLAIQTPTAS
FT                   VLDSLAKVEPPKMIERKQPAKPVMVSSNKVERRSGSLPRLEAMRRDLPERVRALLCIDT
FT                   SGRVSSVKLYDIAKASVRKDLEGALSKWRYAPYREAGKAVPACFGITFRTVLN"
FT   gene            complement(391565..391807)
FT                   /locus_tag="Hoch_0263"
FT   CDS_pept        complement(391565..391807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0263"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: oan:Oant_2390 BolA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12904"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHP2"
FT                   /inference="protein motif:PFAM:PF01722"
FT                   /protein_id="ACY12904.1"
FT                   /translation="MKPEAITAKIRESLPDAKVELRDLTGTEDHWEAVIVSESFRGKTP
FT                   IQRHRLVFDALAEEMKGPIHAFTMKAWTPDQVPGN"
FT   gene            complement(391811..393442)
FT                   /locus_tag="Hoch_0264"
FT   CDS_pept        complement(391811..393442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0264"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /note="TIGRFAM: delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase; PFAM: Aldehyde Dehydrogenase; KEGG:
FT                   dat:HRM2_16880 PutA2"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12905"
FT                   /db_xref="GOA:D0LHP3"
FT                   /db_xref="InterPro:IPR005931"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHP3"
FT                   /inference="protein motif:TFAM:TIGR01236"
FT                   /protein_id="ACY12905.1"
FT                   /translation="MHDAIAQVPTPHNEPVLGYAPGSPEKQRLKQALARIAGEEIEIPC
FT                   IIGGERVETGTLESVVMPHDHGHTLARFHVAGGDEVERAIRAAQDAKREWASMRWESRV
FT                   AVFLRAAELLAGPHRMTINAATMLGQSKTCHQAEIDAACEFIDFLRFNCAYAQELYAQQ
FT                   PSSSPGMWNALELRPLEGFVFALSPFNFTAIAGNLPCAPAIMGNTVVWKPSESQTLAAY
FT                   YTYLLLEEAGLPPGVINFLPGHGQDVAPRAMAHPDFGGLHFTGATSVFKSLWALASANL
FT                   DTYRSYPRIVGETGGKDFIIAHPSADEDALVTAIVRGGYEFQGQKCSAASRVYVPRSLW
FT                   QRIEKPLVDTIQSLRMGDVRDFRNFLGAVIKKDAFDRHSQVLGAAKSDARVRIAAGGET
FT                   DGSKGWFVRPSLLVVDDPGHTNMKTEFFGPIVSLYVYPDGGFDDALELVDQTSPYGLTG
FT                   AIFARDRRAVDQAARALRYSAGNFYVNDKPTGAVVGQQPFGGARGSGTDDKAGAPMNLL
FT                   RWTAARTIKETFVPPTHYAYPFMDEE"
FT   gene            393758..395047
FT                   /locus_tag="Hoch_0265"
FT   CDS_pept        393758..395047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0265"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: scl:sce3000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12906"
FT                   /db_xref="GOA:D0LHP4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHP4"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ACY12906.1"
FT                   /translation="MKDRVFRDPVHGIIELRGDDRALAPILETRAFQRLRRIKQMGFAW
FT                   LVYPGAEHSRFGHALGAFHLANRVTRALAVEPSLARLVKIAALLHDIGHGPFSHAWEQV
FT                   FAGADHERWSMRIASESGELCEVLSALDPGLPQQLVGFWDKSHRPAFARKLVSSQLDVD
FT                   RLDYLLRDGHYSGVGYATFDLDWILHALRIEPIRGGSDPADLVVDYRRGKFAVEQYLFA
FT                   RSYMYAQVYHHKTVRSAEWMFVKLMQRFSELARAGDEPASLPAAARLARESELPVAAYL
FT                   SLDDIAVTHAIDVWSGEGAAGEDGAAVDPVLRDLALRLTRRRLFKTIDLGDEPGVIERL
FT                   RARVHEAAEARFGEAAGYYYHLDNARQIGYRKVLGEELYVVDHPRYGTVKLGRLLDDMP
FT                   LGQPTSTVRLVCAPELLDILEPIAESALST"
FT   gene            complement(395091..395381)
FT                   /locus_tag="Hoch_0266"
FT   CDS_pept        complement(395091..395381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12907"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHP5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12907.1"
FT                   /translation="MKHFFDTHDEDSPMKNALLQSLKLGLSTLALGALLTACGGNQTQP
FT                   GDPAEPPDTVPSGCCQLDSSCVQVDEASGCEARGGEFFSDTACTSNECVVQ"
FT   gene            complement(395474..397090)
FT                   /locus_tag="Hoch_0267"
FT   CDS_pept        complement(395474..397090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0267"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   scl:sce4877 two-component histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12908"
FT                   /db_xref="GOA:D0LHP6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHP6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACY12908.1"
FT                   /translation="MDSATKPPDSVSLSESAPRPGAGAGADPNAAAATGPRWRRVLARV
FT                   ATHLARIRYRLLLVNVMVVAVPLLGVGFARTFEREMLRGLEDDMIHQAELVRAQIHLAD
FT                   EPDLAALGPTLREAARYTRTRIRVLDVDARVLADSHRLGPPEGAEAPAPSLLGYSSDTY
FT                   HAPEAPKPLDVSARSEIQAALAGRYGAATRLWENRSRLYLFSALPIFDRLSDELSDAEV
FT                   APRRVIGAVYVTRSTGPVKRAMYRLRTWLLWVLAAALAATAILSLFLAATIARPLTRLT
FT                   RIAKRIASGARGERLALDRRDEIGQLARAFDTMTQRLDERVRYTRSLAADISHEFKSPL
FT                   TSIRGAAELLQDGAADDLPARERFLGNIIEDSERLDRTVSRLLELSRIESEATQIEIFD
FT                   YEALVREQVERYREQAELTLSYRSQHTQLPGRRNHLASVLGNLLENAALHAEAGTAIDV
FT                   HVSDLGGGRILTEIRNRGPIISEAVMLRLWDRFFTTRAKQGGTGLGLAIVASIVNAHGG
FT                   RVSVRSSAEEGTTFAFELPLR"
FT   gene            complement(397065..397748)
FT                   /locus_tag="Hoch_0268"
FT   CDS_pept        complement(397065..397748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0268"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; Helix-turn-helix
FT                   type 11 domain protein; transcriptional regulator domain
FT                   protein; SMART: response regulator receiver; KEGG:
FT                   scl:sce4878 two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12909"
FT                   /db_xref="GOA:D0LHP7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHP7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACY12909.1"
FT                   /translation="MNPARILVADDESNIRDVVQYALERDGYRVETAADGQSALARIEA
FT                   GGIDLVILDVLMPELDGLNLCRKLRERGDVPIIFLSSRSEEADRILGLELGGDDYVTKP
FT                   FSPRELATRVKAVLRRVAARRGADDAPPALVYERLTLDPAAHELRVDDDKIALTVTEFR
FT                   VLHAILERPGRVLTRSQLIDRAYEDGLHVSERTIDTHIRRIRAKLRPYGIEAIETVHGL
FT                   GYKTP"
FT   gene            complement(397745..398545)
FT                   /locus_tag="Hoch_0269"
FT   CDS_pept        complement(397745..398545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce4879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12910"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHP8"
FT                   /inference="similar to AA sequence:KEGG:sce4879"
FT                   /protein_id="ACY12910.1"
FT                   /translation="MSLDALLCLYAVVGAGCVLAAHHAQRSQRLRGAHATRAATRAIDA
FT                   ALLGLLWPLYGPLLLLRERDGEGGAHVEDSAVPDTSEVTFLSALRRARHTPLGAVLPDE
FT                   ATAQALARRLRVAAAKVREIDALLAQPAFDEEAAARRLRTLREREDQRRGASAAAGGTA
FT                   DPAPSAPLSLSTAALRLQNIRRLRALRHRFASELDDVGELLIQLTTQAEVLRLAGPASP
FT                   SAGAAGAPWGDEDAGELVRELVSRVEGLDEMLDDDPHLLDARAS"
FT   sig_peptide     complement(398483..398545)
FT                   /locus_tag="Hoch_0269"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.849) with cleavage site probability 0.822 at
FT                   residue 21"
FT   gene            complement(398542..399663)
FT                   /locus_tag="Hoch_0270"
FT   CDS_pept        complement(398542..399663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0270"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce4880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12911"
FT                   /db_xref="GOA:D0LHP9"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHP9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12911.1"
FT                   /translation="MNMTSTIDSLPAADAANPIAERAERAPAPSTDALALRLAGGAQPD
FT                   DADAGAGAGTANVERRAALSATGALATIDALLRDRDAVLARIRRGLGLAELGRCALLTV
FT                   ALACAIFGAAVGMHRGGVQILFAAIKFPLVMLFTAAIAAPCLTAFNAALDRPYAVRKDV
FT                   ALMLSALAFGALLLLAQAPLLLLAALLGLGYHAFILLTFCCAALAGIGCAAVLARGIAS
FT                   QSHRHAKIAVVALLAVLSAVGGQMAWTLRPYVVRPRTPEVPFLRQIEGNLLESVLTSSR
FT                   SARGIYSEDYEAREYEIREFRGEEGGDYGDQFAPEFRAGDFMRDIDQMAEETVHPFEAI
FT                   ERSGDTAEPASDSAGYSRDEVGGRWSEIEDAQR"
FT   gene            complement(399678..400235)
FT                   /locus_tag="Hoch_0271"
FT   CDS_pept        complement(399678..400235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce4881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12912"
FT                   /db_xref="GOA:D0LHQ0"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHQ0"
FT                   /inference="similar to AA sequence:KEGG:sce4881"
FT                   /protein_id="ACY12912.1"
FT                   /translation="MTTTTSAVPSGATQAPGRAPSAPLPAASWRDMLLATLAGPVALGA
FT                   VLGLEVGPLTALLKSLALPAVLLGVAAVMVPALYVGATLTGAAPPAHLLVRSLGRGFRA
FT                   CGLVMLGLVAPALFLLATTQALGVAALVGTAATAAGVLIGLRVLFTDLFRGRSTVAIAA
FT                   FALWSLVALGIGLRLFVEFVAA"
FT   gene            400545..401477
FT                   /locus_tag="Hoch_0272"
FT   CDS_pept        400545..401477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce2345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12913"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHQ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12913.1"
FT                   /translation="MPQSLGRAASVPGASAGVSARVSGQPAAVEAERARVHGLAAFVLH
FT                   AHLTEGHRLRFDPSLQEGPAGYTQLEIERLAGNHSHGGVELVFFIAVLMDSSPDTAEAM
FT                   TAACEARARELIDDGVRRVFVLLERWERVHHHERLREWVPGHDSWRPYASDGAVIDACL
FT                   HAPLPVRAFWDEDDAERAVAGVLIDKSVDIIEDYGLKRHAVGREAGYRSGRREGFDSGK
FT                   DEGYRAGKDEGYRVGKSDGFRAGRSEGYAAGALDGVREAIFLLLRSRGVVLEEAAYARL
FT                   MRSDDAEALQRWLTRAAHAVSSTELFDDA"
FT   sig_peptide     400545..400619
FT                   /locus_tag="Hoch_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.751) with cleavage site probability 0.509 at
FT                   residue 25"
FT   gene            401804..402277
FT                   /locus_tag="Hoch_0273"
FT   CDS_pept        401804..402277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0273"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: [2Fe-2S]-binding domain protein; ferredoxin;
FT                   KEGG: mxa:MXAN_4830 isoquinoline 1-oxidoreductase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12914"
FT                   /db_xref="GOA:D0LHQ2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHQ2"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ACY12914.1"
FT                   /translation="MLELTINGTTQQVEADGDMPLLWVLRDIVGLTGTKYGCGKSLCGA
FT                   CTVHVDGTPVRACVTPISAAQGRSVTTIEGLSEDGSHPLQKAWLEENVPQCGFCQAGQI
FT                   MSAAALLASKAQPSDDDIDAAMAGNLCRCGTYLRIRKAIKRAAGMPQDQGDGQ"
FT   gene            402274..404604
FT                   /locus_tag="Hoch_0274"
FT   CDS_pept        402274..404604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0274"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead; KEGG: ade:Adeh_3102
FT                   molybdopterin-binding xanthine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12915"
FT                   /db_xref="GOA:D0LHQ3"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHQ3"
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /protein_id="ACY12915.1"
FT                   /translation="MSHRYADEVFAQLYPHMAHGAGPSESFESAPAPAGGGLSRRSFLR
FT                   IGGAAGGGLLIAVSLGACKDKPATTGEQPSEQPSEDPSGPFEANAFVTIEPEGTAKITV
FT                   AKSEMGQGVRTTLAMIVAEELDLDWARVRVEQAPGDGETYGKQGTGGSGSVRDGWIPLR
FT                   EAGAKARAMLVAAAAKKFGVDAGELSTSASTVRHEASGRSLGYGELAGLAAQESVPDSV
FT                   TFKSASEYTLLGKEHPGIDVLDIVQGKAVYGMDLRKPDMLYASIERSPIFGGTVKSVDS
FT                   EAAMAVPGVVKVVEIPAQGGDIKVASGVAVIAKNTWAAMKGREQLAVEWNPGEHAEESS
FT                   DGYLGQMRKSIAKQGEFEVNKLGDPEAQISAGAVALRARYEVPFIAHATMEPMNCTALV
FT                   DGERCQLWGPMQFPNWARGAAAKVLGIPVEKVSAEITLLGGGFGRRINPDVAVEAALVA
FT                   KEVEGPVPVQVLWSREDDMQHDFYRPIAVHEIEASLDAEGAPLAWRHRMSTPAIRATIA
FT                   AEAEIEDLAVGESNGASDMLYRIPNRSLEYTHQPSGVHRGWWRAVHTTHTTFAVESFLD
FT                   ELAEKAGKDPYEYRMGLIDELTVSRPQPNKDFPWDPARLRGVLELAAKKAEWGKELPPG
FT                   HGVGLAVGIDHLSYGAEVVEVSVIDGKLRIHKVVCAADCGPVLNPNGARAQLEGGIVQG
FT                   LSAALKEKITITGGRVDQGNFDSYPILRIDEAPLVIESYFVETDTHPTGLGEPSVPPIA
FT                   AALANAIYRATGKRLRTLPLQLA"
FT   gene            404601..405653
FT                   /locus_tag="Hoch_0275"
FT   CDS_pept        404601..405653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12916"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHQ4"
FT                   /inference="similar to AA sequence:KEGG:Pcar_1528"
FT                   /protein_id="ACY12916.1"
FT                   /translation="MSEREFIAPGDVRWRQFLARTPHDSYHRPAYLRAAAAQLGGAPCA
FT                   FWARRAGAELLVPLIRRSLPSALGAPDTWSDAIGPYGYGSPLFTPGASDELARALLGDF
FT                   AEVGRADGLVTVFSRLHPLLPSPLAALRAHGEVVDHGETVYLDLSVAPETLWRQLRSNH
FT                   RRDIDRLLRAGFRLHIDAWRHLAVFAELYAAAMDRLGAARSLRFGRSYFESLVADLPGS
FT                   TRLVLVRAPDGSPAAGAFFMNCDGLVQYHLGAVAAEHAALSPLKLCLHGMAMTAQSLGA
FT                   RLLHLGGGLGARRDSLFHFKTGFSPQRAAFRSFRMVLHRARCDALVARLPEPQRAAADA
FT                   GFFPPYRAGS"
FT   gene            405763..407355
FT                   /locus_tag="Hoch_0276"
FT   CDS_pept        405763..407355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0276"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_2215 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12917"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHQ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12917.1"
FT                   /translation="MKDSVRALLRTRIMHHDASIFRNRFTLRNLGWRGTCAAVAVAALG
FT                   ASGCGGGDEQQAATPAETRQYISDNVPNIVDSMTLSLEEWNSDPKFTQMDEHFAQLSSS
FT                   FERLFPMVAAEGDEFVALAQAVAAEDGLEDEPSLADAIEDTAGIVFSDDNYEGEGIYRL
FT                   SGALVCGELIMSQTEAGETDSEIDPDCVSEIDEIELRLRATKVGGALELGVRIGPNQDE
FT                   PLVLTLGERFVRMSIDLAEAKEAIAFLSADDAAELPAVMEGVFSLSLETPAADEVALRM
FT                   SIDEAVRFESAPGEGQERVRVETAATEALYLLEASPRGLFLSYGLGRTQFTGPWSAFSD
FT                   EGTGLGELKIDWQGLSYRLELTGESDELTVRDIGLGNGSSTVTLDGKTLVAVDLNADSG
FT                   RHFDLGFGFDDSGAGYIDIEPGLDLEVQYDFALLSEAGVFIDSPLEQAGYRLQVRGDAP
FT                   RLRALEADPLLGTGGGVEVLAGELVITADGYDGELLVPAGQCLVELAEAEADAHPLIGA
FT                   LAVSDCAPSAALR"
FT   sig_peptide     405763..405918
FT                   /locus_tag="Hoch_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.914) with cleavage site probability 0.373 at
FT                   residue 52"
FT   gene            complement(407397..407969)
FT                   /locus_tag="Hoch_0277"
FT   CDS_pept        complement(407397..407969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0277"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bur:Bcep18194_B2186 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12918"
FT                   /db_xref="GOA:D0LHQ6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHQ6"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACY12918.1"
FT                   /translation="MHQRHYQLAPEANAPDFALPSGFHALLWTPPTPRAHQLAQPRALG
FT                   RLLGGDLDPLAPRLLPAWVCMHHLRVFRNRDLAVYLASRDGRVVHRSCALPAWYRLPFM
FT                   APDDLQIAATFTAPEARGQGLARAAVSALVARFRSPGRSFWYFADADNRASQRVIEQCG
FT                   FRFAGEGVRTRRLGLAVLGQYVIDRPV"
FT   gene            complement(407978..409849)
FT                   /locus_tag="Hoch_0278"
FT   CDS_pept        complement(407978..409849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0278"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12919"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHQ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12919.1"
FT                   /translation="MRRRAHATCPLSAQRPTVLPALLLALAGCSAGSADGGSDPGDAGP
FT                   APGDAAPYCQMNIAITPEMPRAPQDVVATAEIASGSLIGFRDYEWSVRRSGQPVDFEVT
FT                   GVDAQQITFTADAPGQYEITLFGSVDGTECGSEYQLLSVVAPDAASTGYRLRFLPRPEQ
FT                   NAVPYERVDTIADGIDYYLGRLFLPSGLLVDGTLRDEQGNPLAAYLRAVRVGELARETF
FT                   ADTDGSFRLRVSDLGYDLLIVPEDASIAPARVAAPTSYTWTITLPASEQATGVVLDPDG
FT                   QAVADARVSMSIDGAPAAVVRTDEFGAFSVPVRAGELAELAIVPPDESGLPRLTLAADS
FT                   ALAAAALDAPLEVAYAPGLAIHSVAPTARSTSGSALAGVRATWNARSLAVPAGAPLDAA
FT                   GALAFGTDASAALAASAHASALSGSDGTWPALDLPRGLYDVILEPPADAPADEAVTRLL
FT                   IDVDGSSVNQLELVRAATVRGRVLDDSGAGLAEVQIAATPRGLLAPSAAANAVTRSDDD
FT                   GAFTLALAPDTEYGLTLDGDSRSYARTRLDIVTPAAGTLSDELRIDLVPAAKLTGQVFL
FT                   LDGAAGAPGVVVQLLCLACDDTEPLAEAVSDKTGTFVLAVPAPTPAE"
FT   sig_peptide     complement(409739..409849)
FT                   /locus_tag="Hoch_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.504 at
FT                   residue 37"
FT   gene            complement(410008..412020)
FT                   /locus_tag="Hoch_0279"
FT   CDS_pept        complement(410008..412020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0279"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; aminoglycoside phosphotransferase;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; KEGG: afw:Anae109_2094 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12920"
FT                   /db_xref="GOA:D0LHQ8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHQ8"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY12920.1"
FT                   /translation="MGATLGRYQLERELGSGGMATVYRARDRELRREVALKVLFPHLSK
FT                   RPEVVARFLREARAAAALDHANIVRVYDTGGGAGSADDDDALSDPPYLVMELVEGRSLD
FT                   GALREHGPFLGEIVAAIGMLLCDALAEAHRAGIVHRDVKPANVMVTRRGRVALTDFGVA
FT                   RLDDDDSAILTRTGMLLGTPAFMSPEQALGDPLDARSDIYSLGATLYQLATGKMPYSGS
FT                   TQRILTAIIEHKTVPPLQRNPAMGGELAGIIEHMMAAAPADRYQNADEASDALLDVVMA
FT                   GGIAPGPDAVAEQLARFFAAPADYTEAMVPKLVAISLERARAAAAENALPQAMAFADRA
FT                   LALDDDCDEAVALVERLGTHHERRVRNSLLVAAALVAVIIASATDFTLWPRDSDDAANS
FT                   DDSSTWVGGGVLIPDASPQPGARGRDDGARSIGDGDQRAALTAPATTATATPDPGAAPP
FT                   ASPGTAAATADTDTERDSRKPRTRATTAGASARPRAQRPAVEPAAEATIDAGAPERAVV
FT                   AIDAATAVVVAPAPATVTVDIKQWCDLSIDGSDYGRAQRTRAIELPAGRHRFVCSQGPG
FT                   RSAWRQTVTLRPGERRQLSGSVLAPVSVRVEVSGGDAVRIDGTRHDNGARLQLDPGRYR
FT                   IAVLSRDQERSYDYVSIPAVASCTVRDRPTLDCYR"
FT   gene            complement(412151..413038)
FT                   /locus_tag="Hoch_0280"
FT   CDS_pept        complement(412151..413038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0280"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; GGDEF domain containing protein; KEGG:
FT                   pin:Ping_0978 response regulator receiver modulated
FT                   diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12921"
FT                   /db_xref="GOA:D0LHQ9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHQ9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACY12921.1"
FT                   /translation="MLLKKIVVAEDDDAIAHMVNMSLGDAGFLCLRASDGEEALNLVRL
FT                   HTPDLLVLDVMMPRMDGIEVARRIKGDVVLSKIPILMLTALSAVDNKLEGYEAGADAYL
FT                   SKPFDLREFSAQAKALIRSSTRERGRNPTTNLPGSGAVDDHLENVLGKPAGISVVCFDV
FT                   REFGAYTDEVGFSRAESLVASLGDLILERVRALVPDSAFLGHLGGCDFIAVVPSELADS
FT                   LSQQVLERFDEAHREWLLEETPVQSLTMSGAVVPLDGLQKGASATISERIASAMKTAKE
FT                   KKGSGYVVWQADKA"
FT   gene            413232..414554
FT                   /locus_tag="Hoch_0281"
FT   CDS_pept        413232..414554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0281"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   ade:Adeh_0576 peptidase M16-like"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12922"
FT                   /db_xref="GOA:D0LHR0"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHR0"
FT                   /inference="protein motif:PFAM:PF00675"
FT                   /protein_id="ACY12922.1"
FT                   /translation="MAPGLRHTCPEAPVFPTIISTALDNGLRVLTAPLPHLHTATLAAF
FT                   VKVGSRFERAEDNGLSHFVEHMLFRGTDAYPNSRHLNLAIEGLGSALHAETGRDLSLYC
FT                   MSVEPGLVGDGLGLFGEIFGSPRFGEIDLERRIILEEINEDYAEDGSEINGDDIARGLV
FT                   FDGHPLAQRIIGSRDNIRRFDGDDVRRHFARHYTGANMLVCVAGPVAHEEVVEGARAHL
FT                   GGLPTGTPVAVAPLAFEQDRARYKYVRDSGAQTSLNIVFRAVPDMDAGYMATAALSRAI
FT                   DDGMATPLHYELCDQKGLAYSIQASLEPLADVALFEVSGATSPNKIPELVGDVLALLGR
FT                   FREQPLSDEELSRIKRRYRLDLLGGLDDGYAVANWYGGPALYYPPPDFAERAAQMEALT
FT                   ADDVLAAARQIFRPERLSVSIVGALSRARRDRVRELVVKWK"
FT   gene            414624..415193
FT                   /locus_tag="Hoch_0282"
FT   CDS_pept        414624..415193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: acp:A2cp1_2273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12923"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHR1"
FT                   /inference="similar to AA sequence:KEGG:A2cp1_2273"
FT                   /protein_id="ACY12923.1"
FT                   /translation="MAEEKSDMSDLPDGEDFEAGEGELRFGDLPKSVRQRVETVIPEMV
FT                   KKTFAAGMGALFTTEEGIRRLAKEMSLPKDVAGYLAHTAGDAKDELLRIIAREVREFLE
FT                   TVNLSEEIAKMLTTLSFEVKTEIRFIPNDEKYGGVKPDVKAKVGIRRNEERPRRRRRRR
FT                   RRFRDGDGDGDSDNERDGDGDGDGES"
FT   gene            complement(415236..416330)
FT                   /locus_tag="Hoch_0283"
FT   CDS_pept        complement(415236..416330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0283"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12924"
FT                   /db_xref="GOA:D0LHR2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024521"
FT                   /db_xref="InterPro:IPR026351"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHR2"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACY12924.1"
FT                   /translation="MPTRAIRVLPAPARFDDALRKHGAPPLAAAAIDTLQINLGKRCNQ
FT                   ACLHCHVEAGPNRSESMSAATAERLVALLERSPAVRTVDITGGAPELNPHFRDLVRAAR
FT                   ARERAVIDRCNLTILFEPGQDDLDRFLAEHRVHVIASLPCYGPENVEQQRGGGVFAKSI
FT                   AALRRLNQLGYGAEGSELRLDLVYNPLGPSLPGDQAALERSYKERLAADHGLRFHSLYT
FT                   ITNMPIRRFAHALERDGQLEAYMRLLVENFNPGAVAGLMCRSQINIGYDGALYDCDFNQ
FT                   MLELASSAPSRARASHRVVDRAAEHGRENDGRDEIVRLDTFRPPTIWDIDSFAELHERR
FT                   IATGEHCFGCTAGAGSSCGGALLA"
FT   gene            complement(416391..416972)
FT                   /locus_tag="Hoch_0284"
FT   CDS_pept        complement(416391..416972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0284"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; sigma-70 region 4 domain protein; KEGG:
FT                   afw:Anae109_0839 ECF subfamily RNA polymerase sigma-24
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12925"
FT                   /db_xref="GOA:D0LHR3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHR3"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACY12925.1"
FT                   /translation="MRHKKDQSDQPPPKPSLVQDDVLTPALGDSERNYVYSVAMKYVKD
FT                   EEAAADVAQDALLLAHRHRGSFRGDSRYSTWLYRIAATTALMYLRKKRRRSREILSPLR
FT                   VEEDSVLAQHPRSPESGPDDAVASQEAMEIIRQRLGELGDKYERIFWLRYLEGYTETEI
FT                   AALLDLTLATVKTRAHRARVAVRETLRAAA"
FT   gene            417162..418397
FT                   /locus_tag="Hoch_0285"
FT   CDS_pept        417162..418397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0285"
FT                   /product="response regulator receiver sensor signal
FT                   transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: dde:Dde_0110
FT                   multi-sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12926"
FT                   /db_xref="GOA:D0LHR4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHR4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACY12926.1"
FT                   /translation="MADVLLFLVADNPLSARDLGTALAHASGYDVQVYTTVDEAREQAA
FT                   RPDALIVVHRSVGMNGVGLVRELRRNDKALVALVVTRRTDEAATATAIAEVGHLFHVYE
FT                   PCWARDVLCRVDSGLEQQRLRRELSRARAESETWVHALDSCAGEVQRAEAELRTTHSSL
FT                   RTATERLVEAEQIAAVGRVAAAIAHELSRQLALVGYAEAIKSRVAEDPELVELADIIVA
FT                   AQKRLASMIDEIRDFATGDAREVRDLRREPADMAAVVDEALAIMRYDRDVCRRVIERRY
FT                   RARPLAALHRQKFSQVIINLISNAVVATRPGDVIEVELDVDESSADAGPGTATLTVRDS
FT                   GVGMSPEVLARLGEPFFTTRAERGSGLGVGICMRIIEEHGGVIGYESELGRGTTARIAI
FT                   PLLSDGAIGGAL"
FT   gene            418400..419866
FT                   /locus_tag="Hoch_0286"
FT   CDS_pept        418400..419866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0286"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; response regulator
FT                   receiver; ATPase associated with various cellular
FT                   activities AAA_5; SMART: response regulator receiver; AAA
FT                   ATPase; KEGG: afw:Anae109_4152 two component, sigma54
FT                   specific, fis family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12927"
FT                   /db_xref="GOA:D0LHR5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHR5"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACY12927.1"
FT                   /translation="MHPAQRVLVVDAEPQIHRLIALLLGDGYQVDGAASAAEAIARVHH
FT                   TPYDAVLIDTDLPTMSGFDLLRKLRKLAPELAVILTTAQATVQAAVKAIRIGALDYLRK
FT                   TVSADELRAAVQRAADHATLAREVRRLRSEVDRARGLDHLIGDSPAMRQLVGLVERVAH
FT                   SDATVLILGESGTGKELLSRTLHRIGPRADRPFVAFDCSALTPSLLEAELFGHEKGAFT
FT                   GAGKARRGLFREAHQGTIFLDEIGDIAPSVQNKLLRVLQEREIKPVGGDQFVQVDVRVI
FT                   AATNKDLKAQVARGAFREDLYWRLAVVPIQVPPLRERREDIALLAAHILERKRGAAKSF
FT                   AGGETPYPTKISPGAMTRLLAYHWPGNIRELENVLSRAAILCDGEEIRADDLDMVGVPG
FT                   DQATPPDSAGATEDDAPGPAKLGGLDVDASAGRPLKRLIDETVKAVERQAIAEALERCE
FT                   GSPSKAARRLGISRASVYNKIKEYGLQTGS"
FT   gene            420102..421148
FT                   /locus_tag="Hoch_0287"
FT   CDS_pept        420102..421148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0287"
FT                   /product="Isocitrate dehydrogenase (NAD(+))"
FT                   /EC_number="1.1.1.41"
FT                   /note="PFAM: isocitrate/isopropylmalate dehydrogenase;
FT                   KEGG: mca:MCA3071 isocitrate dehydrogenase, NAD- dependent,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12928"
FT                   /db_xref="GOA:D0LHR6"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHR6"
FT                   /inference="protein motif:PRIAM:1.1.1.41"
FT                   /protein_id="ACY12928.1"
FT                   /translation="MSEQEPVEFSKCPKVSLIKGDGIGPEIAEACVQIIEAAGGTIEWE
FT                   PVAAGLTAIEADHDPLPQATIDSIAANRVALKGPLATPVGGGFRSVNVALRQHFDLFAN
FT                   VRPAISLAGVPTRFENVDIVLVRENTEDLYAGVEHYIDPRRSAAESIAIITQFGSERVI
FT                   RYAFEYARRHGRKQVTAVHKANILKMSNGLFLDVGREVAKEYEDISFDDMIVDATAMRL
FT                   VVNPENFDVIVTMNLFGDILSDLTAGLVGGLGVAPAANIGSGGCAIFEAVHGTAPDIAG
FT                   QGIANPTGLLRSAVLMLEHIGQGDVAERVNRGVMQALADASSRTRDLGGEADTAAFTKA
FT                   VIANLEGS"
FT   gene            421254..422165
FT                   /locus_tag="Hoch_0288"
FT   CDS_pept        421254..422165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0288"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: bav:BAV3184
FT                   universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12929"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHR7"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACY12929.1"
FT                   /translation="MSTILFATDFSEASEVAGHVTRAVARHLQARVICAHAVVATEAQP
FT                   DAYELASGHVEDFRKSFQEDLAARHARIEQFAEELGRYGLSASSRMLDGSVIESICEAA
FT                   DEAQAALVILGSHGRTGLKRFVLGSVAERVVRLCSTSVLVARAPVIDQQGFRRVLVPTD
FT                   FSEAAEVALDQAASLAAADASIDILHCWQPEEFPDGLIHRTEDAKVHDNLGKQVQDRAN
FT                   SLGNALVRRVAIGKRKVRFHWQHSRPGAGIHEFIEQQAEPYDLIGVGTHGRTGINRLLV
FT                   GSVAESTVRYAPCSVLVARPRV"
FT   gene            422332..423357
FT                   /locus_tag="Hoch_0289"
FT   CDS_pept        422332..423357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: NCL; nucleolin ; K11294 nucleolin"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12930"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHR8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12930.1"
FT                   /translation="MLARSFRLDPNRQVCRWGLVFLLAPFLAVGSVIAPAIVSLETVAY
FT                   AQDDDDWDDEEDDDDDWGEEEEEFEDEEENEDGYVQPPVTAGGLYTKKTYPVAALSRPL
FT                   TVIEGMVEVRGGIDIDVSDETAFEVFRFKADARYGIADHVELQAVFDLLLSGEPVYTSY
FT                   PTPEFEAGLGIEGGLYYDMVHFRAVGAVVSRKPFTIVEGDPDDPDSEDMLVVDPNAESE
FT                   TGFDLILGFPFRYRFKPEIAIIALDELMTIHFGGGKPDLNVGVGGVYQLIPQAAVIARA
FT                   ELYVPQFDTRLLTVPLTAAAQFSPNNQFDLGLEFTLPVDVRDEDNRFSQRSVLIYAQAR
FT                   L"
FT   gene            423395..424756
FT                   /locus_tag="Hoch_0290"
FT   CDS_pept        423395..424756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0290"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: scl:sce2470 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12931"
FT                   /db_xref="GOA:D0LHR9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHR9"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY12931.1"
FT                   /translation="MPVCPRCRERFANPERFCPTDGSVLVEDLDLARIGTEVGNYHLHE
FT                   ILGRGGMGTVYRAEHIYIKKRVAIKVLHAQFAKYEEAVVRFLREAQAASSIQHPNIVDV
FT                   TDFGHTPDGGVFFVMEYLEGTSLEDKIEKNGFIELHRALNIANQMSLALAAAHEKHIVH
FT                   RDLKPDNVMLIRKPGRRNIFRAYTDDEGDTRIVTERENQFDFVKILDFGIAKVLTVDEG
FT                   DTLQGAIFGTPEYMSPEAARGAEVDLRSDIYSVGVILFDMLCGRPPFEADEVQDVLAMH
FT                   ISQRPPSPRVIAPEREITEACEHLVLRALAKDPFERHQSMDEFREELQHCYGSVAYRRN
FT                   ARSIPGAATLGPEGRGRRLTDELDEWIHTEPRLSAERVHRLTYGGDDDESTTVESSMPM
FT                   MSPRDTLQDIQPPAVAMEPQTEPNLARSALLTPEEEDRLAAAVDAALDDELEDF"
FT   gene            424878..426368
FT                   /locus_tag="Hoch_0291"
FT   CDS_pept        424878..426368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0291"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: Carbohydrate kinase,
FT                   FGGY-like; KEGG: dal:Dalk_2599 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12932"
FT                   /db_xref="GOA:D0LHS0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHS0"
FT                   /inference="protein motif:TFAM:TIGR01311"
FT                   /protein_id="ACY12932.1"
FT                   /translation="MRYVVAIDQGTTGTTVLVLDRELHVVGRATREFPQVYPQPGWVEH
FT                   DPEAIWNSVTESLGAALSDAGIRGEEVAALGITNQRETTVLWERASLRPVRNAIVWQDR
FT                   RTAEMCARLKREGAEEQVRAKTGLFFDPYFSGTKLRWMLDEDPTRRRGAEDGSLCFGTV
FT                   DSYLVARLSDGGAHITDVTNASRTLFMDLRTLDWDDELLAVLEVPRALLPEVRSSSEVY
FT                   AETRGVPGLPDGIPIAGIAGDQQAALFGQACYEAGAAKCTYGTGAFLLMNTGDEIVASK
FT                   SGLVTTVAWKLGTGAEAGEVRYALEGSAFVAGAVVQWLRDQLGFFSSAAEIEALAASVE
FT                   DAGEVIVVPAHAGLGAPHWRPDARGLITGLTRGSTRAHIARAALDGVALQNYDILKAME
FT                   RDSGRELASLKVDGGASANDLLMQFQSDVLGVSIARPEILETTALGSAFLAGLATSVWA
FT                   DKAEIAAAWREAKRFEPKADRTVIDAHLERWNEAVAKA"
FT   gene            426563..427252
FT                   /locus_tag="Hoch_0292"
FT   CDS_pept        426563..427252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0292"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; KEGG: scl:sce3641
FT                   ECF family RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12933"
FT                   /db_xref="GOA:D0LHS1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D0LHS1"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACY12933.1"
FT                   /translation="MAISAQAVRISSPAQSSLAVSDTAPPQWTDAELLARTLRREEIAW
FT                   TELLRRYRTLVYRCITKVTRKYAPSLPNAEIDEVYAEVLLSLLRDDLRKLRKYDPERGA
FT                   KLSSWIGMITINITHDYLRRMGRRPALDRIDGAPESREESERTPLDELLEKERWAQFNG
FT                   LLSDFSEKDRTFLNLYYGQGMEAERVADEMAISVKTVYSKKHKIRRSLRQRIESAGDCS
FT                   AIADLAA"
FT   gene            427383..429887
FT                   /locus_tag="Hoch_0293"
FT   CDS_pept        427383..429887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0293"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: glycosyl transferase family 51; penicillin-
FT                   binding protein transpeptidase; KEGG: afw:Anae109_0060 1A
FT                   family penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12934"
FT                   /db_xref="GOA:D0LIQ5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIQ5"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ACY12934.1"
FT                   /translation="MTETTRQRADIANPADGGVIYWTFKLYLFLIFVIGVAVLLTGLLV
FT                   YRYFAQQAPPAMDLEDYASQVPTVSRMYAADGTLMGEFAEEWRELVPYEDMPKPLIQAF
FT                   LAIEDHEFFNHGGLSFRGIARAAWTNLVAGDFAQGGSTITQQVAKQFLSSDKSLTRKAK
FT                   EAILARRLEARYPKEAILSVYLNHIYLGSGAYGVRAAARRYFSKRLDELDVAEMALLAG
FT                   LAQAPSRYSPMRRPERAKQRRNEVLAAMEQNGFLSAEDTARWQEQPIRLAPHDSIFPDR
FT                   MPYYAEHVRRYIVDTYGIDALMGGGLRIETAVEPSVDAAAAENIDFGVRKQDKRQGWRG
FT                   PEAYLEGTARELFAERARELYGDQPPAFDRRYLGLVESVEARSARVLVGGNSYPLPLAN
FT                   MDWAAPWSRNDAVNDQLIDNARRALRPGDVVWVSRESATLAPFRDWFLKDGANPRWTPS
FT                   TRDRQEMSEVRLKLEQVPHPQGAVFTADHETGYVVAMIGGYDFDRSEYNRAVQACRQPG
FT                   STYKPIYYSTALDIGYGFDSILNDKPRAEIDPITGEVWYPTNLGGTVDNQVTLEYSLVF
FT                   SKNIPSVAIFKLVGANEVEAWARRLGFTSEIIADQALALGASCTYLDELTRAFAIFARS
FT                   GRWIDWVYVRRVTDRNGHVLEDNTVPGDPDLRAGQRLDRLYATAGIAAKQAIPARTAFL
FT                   TSTLLREAIRSGFATVVRQAGINAAGKTGTSSATMDTSFVGYTSRWITSVWLGDDMRER
FT                   PLGRDDAAYMTVVPLWTRFMYETAKDHPNEEIPWQVPPGVNPRDRGDHSRGENHGPMPL
FT                   VYRKAAKPELLEQMINGESPDL"
FT   gene            complement(429862..430596)
FT                   /locus_tag="Hoch_0294"
FT   CDS_pept        complement(429862..430596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0294"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dvl:Dvul_2159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12935"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIQ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12935.1"
FT                   /translation="MQPGLKVCALIGLPLLVSFGASLGACGVVRLPAPPDATPADAAVL
FT                   DAPADAAIADAAPPDAIPDAALPDAAPCVFEIDLADLAEPLEGDTVDYQGITLYGSRVS
FT                   LYPGFGLGIIGSGPSDRFIDGLEEVAIVFQVPPGARDVSYRVAAATDADNDTVRGLHHL
FT                   TARGFPSGAESTLVDSEGVVEIARVFPSLGPISRLTIAGRFDGVRIDRLTYSLCESSGA
FT                   DGPLRAGVRAGGEPLRGPGSRR"
FT   sig_peptide     complement(430519..430596)
FT                   /locus_tag="Hoch_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.691 at
FT                   residue 26"
FT   gene            430726..431331
FT                   /locus_tag="Hoch_0295"
FT   CDS_pept        430726..431331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0295"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12936"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIQ7"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACY12936.1"
FT                   /translation="MGAELPRITLTYCQSDKSVQGTGLCELGCREIYTEISGFGSRVIF
FT                   LGADPSSHVRVDDPYVSGRQLAILREGEGWLVSAWPNTHNPTYLDGRELTEISSLMAGS
FT                   VLRAGRTAWVVTSTPPEAGEVHVRARNLIEFCVAAYRIYGTTRKAASAIGMSDRTFRRR
FT                   LLESEEGTALLADRRPQPRKRHACHPMGVPVVTTDYLG"
FT   gene            431508..432473
FT                   /locus_tag="Hoch_0296"
FT   CDS_pept        431508..432473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0296"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; short-chain dehydrogenase/reductase SDR;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: pcr:Pcryo_0617
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12937"
FT                   /db_xref="GOA:D0LIQ8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIQ8"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACY12937.1"
FT                   /translation="MPTGRRILITGGAGFIGSHLCERLLTDNDVVVLDTFRRDALSSTG
FT                   LSEHPRIRVVRGDVLDAATVADAMAGCDAVIHMASIAGVDTVMRNPVLTMRIAMLGTMN
FT                   LLEAARESGEVKRFIDFSTSEVFGRYAYQVTEFDSTVLGAVGEARWTYAVAKLATEHLA
FT                   MNYQKEFGLPACSIRPFNIYGPRQVGEGAIHHFIRRALTGETLQVHNDGAQIRAWCYID
FT                   DIVDAILLALEREQSVGHAFNIGNPRSTVTIYQLARDIVRLSGSSSAIEFHPWPHPDVE
FT                   IRVPAVAKARELLGFEAQVDLEQGLKRTIAWYRDHGNRVG"
FT   gene            432454..433584
FT                   /locus_tag="Hoch_0297"
FT   CDS_pept        432454..433584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0297"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; KEGG:
FT                   bbr:BB0122 DegT/DnrJ/EryC1/StrS aminotransferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12938"
FT                   /db_xref="GOA:D0LIQ9"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIQ9"
FT                   /inference="protein motif:PFAM:PF01041"
FT                   /protein_id="ACY12938.1"
FT                   /translation="MATALDERIPLARPSVGASELAAIERVLASGRLVMGPENQRFERA
FT                   LAERAGRAHAVCVSSGSVALELALWSLQLVPGDEVLVPCGGYPAAAHAILRQGAVPVLV
FT                   DIAEGDWNMDPAAAADALTPRTRAAVSVDTLGAVADGAALEDAVRGRGATIVSDAACSL
FT                   GGCDAGGRVGGNTGALGTFSFHPRKVLTTGEGGAVVCDDEALAERVRVLRNQGQSGPGQ
FT                   FAFPGTNARLSEMAAAMGNAQLARFDAMLRERKMLVDGYRERLARLRERELLRWQEVPE
FT                   SASPAHQTFAVLLSEHPLVANRDQARAYLAEADIESQVAVYALNQVASLRELPSARASF
FT                   PVAESVAARGLALPLYIGMRAAQLDRVCDTLAEVLS"
FT   gene            433581..434684
FT                   /locus_tag="Hoch_0298"
FT   CDS_pept        433581..434684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0298"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: scl:sce5790 putative ABC transporter, ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12939"
FT                   /db_xref="GOA:D0LIR0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIR0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY12939.1"
FT                   /translation="MSAVIEVNDLRKRFRTPLRRNEVEILRGLSFSVEQGEVYGFLGPN
FT                   GAGKTTTIRILMGLVAASGGSAKLLGEPVPSREARAKLGFLPESPYFYDYLTVAELLDL
FT                   TGRLFGIEHRARKRRAEALIERVGLTRARKTPLKKYSKGMLQRAGLAQALINDPALVVL
FT                   DEPTSGLDPVGRKDVRDIILSLREQGKTVFFSSHILADVETVSDRIGIVVGGLMRDTGS
FT                   VRALCGDALLRTEVVVRVPAALSDADQAALVGDAGSVERRPVLGADGPSEALHELHLSL
FT                   APDADVDAFLAHARQHGARVESVSPRRRTLEDLFLHHAGVKAGAGAGPGAGPAGEPVAE
FT                   SQPSDDGTKNTAEDEGKGKDKDKEAEA"
FT   gene            434681..435472
FT                   /locus_tag="Hoch_0299"
FT   CDS_pept        434681..435472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce8041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12940"
FT                   /db_xref="GOA:D0LIR1"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIR1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12940.1"
FT                   /translation="MIARIYAIALNTFREARRRRVIYAIVLAVVGFNLFGIALGELSLY
FT                   EQARVARDVGLAGVSLFGCVTAVVLGVSLLYTEVQRRTIHTIMSKPLRRAEFVVGKYLG
FT                   MAGTLSVLVVLFTVTMLALLQVREVPLDSALLKAVLLSYTEVLVVAAVAIFFSVLSSPY
FT                   LSGMFSFLVFFLGRITPEIRVFLDSEESPIIRGGLEAALYLVPDLYIFSISGSTVDGEY
FT                   VSVHESFVGWDYVAASMGYGGLWMVMLLALAALIFSRRDLL"
FT   gene            435484..436272
FT                   /locus_tag="Hoch_0300"
FT   CDS_pept        435484..436272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce8040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12941"
FT                   /db_xref="GOA:D0LIR2"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIR2"
FT                   /inference="similar to AA sequence:KEGG:sce8040"
FT                   /protein_id="ACY12941.1"
FT                   /translation="MTSKDPTAEPTATAPEAATAPGEDDGASADPTVAQAARRALRRKI
FT                   AAVVLVLAVGLGVVVTRAVWAGASALAAGDAASARDEQALAIVMWRRAARWYVPGSAHV
FT                   ALAYERLQDSARAAEEAGDLATALAAWRGVRSSVLATRSFYLPFEDRLATANQRIAVLM
FT                   AEQERTEAEAPGAEPETARGDPDPEAVAWHLERLEPIPGPSVGWAAVAIFGFCMWLGGG
FT                   LLFVSRGVTPGDQLVPRTAAYAGVLIVVGLLTWFFGLYFA"
FT   gene            complement(436339..437112)
FT                   /locus_tag="Hoch_0301"
FT   CDS_pept        complement(436339..437112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0301"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_0230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12942"
FT                   /db_xref="GOA:D0LIR3"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIR3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12942.1"
FT                   /translation="MNPMTRYRRIEARRLGLRPGVIAAGLAALLVALTHLVLPRLPAGV
FT                   LDFIALAFQLDDFAGVVLLNEILIPLFAVYVLGMLGMLGALVAPRENGELELLLAKPIG
FT                   GAGLLAARVWPIVLSSAAVGVATSLAVALSIALIPSAELSALDALGASLALTAVAVFEL
FT                   GLLAAVLVGVRDSFYAIALGFGIWFVPVMPTAAYLYRPDVFEGAPQLTTAIVLSSAVWH
FT                   AEVLALAGPLALAAALLACVGLVRLAGWRLARAEA"
FT   gene            complement(437109..437885)
FT                   /locus_tag="Hoch_0302"
FT   CDS_pept        complement(437109..437885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0302"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_3970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12943"
FT                   /db_xref="GOA:D0LIR4"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIR4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12943.1"
FT                   /translation="MIRLLLIDYRRGLGERKVKLLAIMYLYAVIAMPLVLAQPPAHVRQ
FT                   AIGLWLDTADPFATFLFAWIDLAMNKIVAFAPVVLAGGILLHERDTGQLAIFAAKPLSL
FT                   ERYFLVRALSACAIMLTLHLGANALGAVLFGFTVEGFAVLPFAAAMLPHLCVALCTTAL
FT                   AAAIAMLTRRRSLSLALGMLTLFSLVGVALFGLINPAWRTAALFNPLSLGVEGLRFLDH
FT                   ADMFPVLAACAALLGWTALLLALGTRLARRLEVVPS"
FT   sig_peptide     complement(437772..437885)
FT                   /locus_tag="Hoch_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.924 at
FT                   residue 38"
FT   gene            complement(437882..438616)
FT                   /locus_tag="Hoch_0303"
FT   CDS_pept        complement(437882..438616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0303"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mes:Meso_3123 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12944"
FT                   /db_xref="GOA:D0LIR5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIR5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY12944.1"
FT                   /translation="MTAIETHALSKRFGALAAVDQVEFEVRAGEIFGLMGHNGSGKTTL
FT                   LRMLLGLLAPSGGRASVFGLDPQRDALAVRRRCGYLPAEYTLPPDMTPRSLLDYIAAMF
FT                   GLPAEEARARAEQLIDSFDLGAAADRKLRGFSTGMLQKVGLAQALINEPELLLLDEPTS
FT                   GLDPLGRHDLLERLRHASAERGTTVVFSSHILSDVEALCSRVAVLHHGRLIAYGALDEL
FT                   KREHKVADIDALYLALARREAA"
FT   gene            complement(438603..439235)
FT                   /locus_tag="Hoch_0304"
FT   CDS_pept        complement(438603..439235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0304"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rso:RSc1007
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12945"
FT                   /db_xref="GOA:D0LIR6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIR6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACY12945.1"
FT                   /translation="MAPARDPSRRRRILDVAREHFRQYGFVRARLDDIAAGAGCSKGAL
FT                   YLEFANKETLMRCVADELFGAIRTRYEDEVLTIASPLARIGATLRLMFDLMLSEPLFQR
FT                   LLSDDPELRMLRDQPEVEAAAANAEFARIQAWIDEGIELGEIRPDVDRDAMPHVLALLK
FT                   FAPHHLRLATLGRFDERRTLDALADNFVAGLAARPPARTRRKGSDRD"
FT   gene            439507..440745
FT                   /locus_tag="Hoch_0305"
FT   CDS_pept        439507..440745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12946"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIR7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12946.1"
FT                   /translation="MSSLPNPHHDFRTSCESPVSFVATPKRGTRSFVLPEEIGKRVIVD
FT                   VIHDGDVIPGEFLVDSEGESIAREAFHDDYVLERDWGASLLAEELTTLLGLSGFWKVEI
FT                   ARVVMDFGRFPGITPKDADHLSRHAINYPFSALLGFAQKRRILEHYYDAISKKYNEFVP
FT                   PAQVKIALHTYDVYNRSGTRRPPASILTRCVGYQVSSEMPFGVFDPLYPDILGEFTSDR
FT                   ILRDRLSLTMESSGIHTEHNYPYLLPDGSVEVRSQVWSFFHTAKKAFQAAYPETKSDGA
FT                   FAMVWRMLLDTNLRSSQSEMLRSYLHAFRRVPVGREEEFAVARRAYERIKAFVYRDGKQ
FT                   FVESYRHMPGRPSALGIEVRKDLLFELDGKGHPVAPKTREVRKIARILARALHIYFTED
FT                   CPKARTSEFFGIS"
FT   gene            complement(440774..442012)
FT                   /locus_tag="Hoch_0306"
FT   CDS_pept        complement(440774..442012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0306"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   ank:AnaeK_4417 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12947"
FT                   /db_xref="GOA:D0LIR8"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIR8"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACY12947.1"
FT                   /translation="MVAIPASESANATGLRLAIATDVRFLRDSEGRIHCRSGGTAYRFW
FT                   QRYAIAFDEVRVLARVFPRGADDPQQPAPVEGPGVSVHALPGFDGPRGLARVAPRVLAS
FT                   IWRGLRDTDALVVRAPATVGLIASRIAQGRGLPLGVEVVGDPCDTFGPGGVGRGAAPFF
FT                   GQVFIRDLRWQCRRADALAYVTASALQRRYPARADAFATHYSSVELDTDAIAPAPRTHT
FT                   AAVQAPHLVTVGQLEQPYKGTDLLIEAVRALRERGLDARLTVVGDGRFRRALEAHARTL
FT                   GVAEHVHFAGLVPAGAAVRAILDTGDLFVLPSRAEGLPRALIEAMARALPAIGSRVGGI
FT                   PELLPERDLVPSENPRALADAIAYALADPARLDAMSRDNWERARRDYHTAILETRRRAF
FT                   YTHLSRAAVRARP"
FT   gene            complement(441990..443045)
FT                   /locus_tag="Hoch_0307"
FT   CDS_pept        complement(441990..443045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0307"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Semialdehyde
FT                   dehydrogenase NAD - binding; homoserine dehydrogenase NAD-
FT                   binding; Oxidoreductase domain; KEGG: lch:Lcho_1397
FT                   oxidoreductase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12948"
FT                   /db_xref="GOA:D0LIR9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIR9"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACY12948.1"
FT                   /translation="MASTSRIRIAIAGIGYWGINWVRTLAREPGAKVTWLCDPEPAGRQ
FT                   RGSLLAPDARQTATFEDLLDADDVDAIVLATPAVAHAKQCLAALAADKHVLVEKPLALT
FT                   EEDGREVQRAAQASERVLMVGHLMLYHPAVEHLATLIERGELGDIRYLYANRVNLGRAR
FT                   RDENALWSFGPHDVSMIDYLLGASPNLVWAKGESYLRPGVEDVVFLHLGFPERRMAHIH
FT                   LSWLDPRKERRLTVVGSRKMVVFDDVSAEKLRIYDKGYEEPPPFTQFGEYLAIRTGGVY
FT                   IPHLPMTEPLAVECAHFLECIRHGLPPRTGVDSALRVVRVLATAQRSLEQGSKPLLLNN
FT                   DTASYGRDPRL"
FT   gene            complement(443179..444489)
FT                   /locus_tag="Hoch_0308"
FT   CDS_pept        complement(443179..444489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce5938 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12949"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIS0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12949.1"
FT                   /translation="MRRSLCIALLLLAASAGTAAAQSPVVEGPGIRVGEGTVIHPSVGV
FT                   LTGVLSNPFYESSDPNPVPVVHLRGAFTIASQHSRPAGELALLHSDEERSDAAPALEFR
FT                   FGAHVDAEWYLSGDEQTAQRLVSGGLSGHVLTAPRGPVSVFADDTLVRVSQPVNFDYAP
FT                   WRNLNRIINRFAGGVQVRPGGGAFRFALQYENTIDAFESSDSSFANRIHHLARARGEWQ
FT                   FLPRTRFFLDGSWGYFGPLSGASCELLKRESRPLRVLGGASTALTELTSLRAHIGYGNG
FT                   YYQSRGAAGCMDVGNEDFNNVLLGAELGFRYSPLGRLSVTYEYDFQDSLQANYFTDHAL
FT                   IARVIHQIDRVQLFSGLDLRLRHYAGIMPALSGPAGEMSRDDIIVRLFGRAHYVFRDWL
FT                   AFTAELDLVSDSTDFTYNGDPLGYNRTELRIGTVAAF"
FT   sig_peptide     complement(444424..444489)
FT                   /locus_tag="Hoch_0308"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.916 at
FT                   residue 22"
FT   gene            complement(444526..445263)
FT                   /locus_tag="Hoch_0309"
FT   CDS_pept        complement(444526..445263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0309"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce5939 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12950"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIS1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12950.1"
FT                   /translation="MPMSSKHILAALAAACIAGSSLLWAQPGGTPATAPQDPSADADAD
FT                   AASAAQAAGQGEDGEGQAPGDEAAMPGADERAARQMTPQEMIAGAATVTSAIQTLRIEV
FT                   EGVQAEAREAEDMIRLNCIDDKLAQIDRVLELVEASRADLAAVVASGDFEDRVHHYGVI
FT                   VAAHDKARDVRSEADACIGEEMTFPGNAEIDVDDPGIDDPTKYAPFQLADSPMLDERAQ
FT                   LPDVPPWEQDVVIERPHYATPFI"
FT   sig_peptide     complement(445186..445263)
FT                   /locus_tag="Hoch_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 26"
FT   gene            complement(445473..446417)
FT                   /locus_tag="Hoch_0310"
FT   CDS_pept        complement(445473..446417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0310"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_4446 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12951"
FT                   /db_xref="InterPro:IPR039498"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIS2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12951.1"
FT                   /translation="MPGASQRRALLALTAWAAREDPDEPLPEAQLAALPEALVRRHFLA
FT                   PLAYRAGAGRFRRDYIASALMAELRARTLDEVTGAFADAGIELVRIKGIAYLGALYRDP
FT                   AERPMSDIDLLVPPARHADAARALRRLGYWRVGSPRQHSRLHHAVGYKRRNASVDLHRS
FT                   MVQPWRSRVDIDALWRRASREPAGPQRLEAVDEAVLHFAHLARHELLAPLVNYIDGARL
FT                   LRRVARADIAARARDFRLARAVDAALRMTEALTSNARLRPGLGTSPDEVLAYRPIWRPL
FT                   QIARKALLVDGPAELVGLFAVGCYDGLAHRLRP"
FT   gene            446542..446826
FT                   /locus_tag="Hoch_0311"
FT   CDS_pept        446542..446826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12952"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIS3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12952.1"
FT                   /translation="MSEPSEHATRYRRHPQTAGRIIDGQAFVVTADDNRLHTLNRSATR
FT                   IWELASAGCTADDAAQMLTEHYAVEFEIARSDAEQCLADLATRRILVRD"
FT   gene            446819..447517
FT                   /locus_tag="Hoch_0312"
FT   CDS_pept        446819..447517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0312"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methionine
FT                   biosynthesis MetW protein; UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 12; KEGG: azo:azo1891 biotin
FT                   synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12953"
FT                   /db_xref="GOA:D0LIS4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIS4"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACY12953.1"
FT                   /translation="MTERGRRGRRAAEIAADYDRAAADYDRRHGDRRSAARAHIIDRPQ
FT                   REIARGAKRVLELGCGTGRLLATLEAEQRVGVDLSREMLRRARARGLAVVCADAHALPF
FT                   PDGCFDAIAAPKGVFRYLEPTAAFAECARVLAPGGQLCVHQYALRTWSLAAAAADLRAL
FT                   RRGEDESRAASPHLDAPEELFAPARRAGLRVVRVHLWRSLRVPPYALAIPAWLPGRWWS
FT                   HCAVVFARPA"
FT   gene            complement(447557..449050)
FT                   /locus_tag="Hoch_0313"
FT   CDS_pept        complement(447557..449050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0313"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   mxa:MXAN_1262 receptor family ligand-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12954"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIS5"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACY12954.1"
FT                   /translation="MSPMPSQHTAFGAAATLGALLFSGCVLTTTDRNQCRDNLECRDAF
FT                   GLGATCNADGFCVSEAIDPRCTKTFPDDLLASDERRRFYKDYVVVGSIMQREVALFEKF
FT                   ELSAELAFSRANQSGGVDGRRFGVVYCSADAGYDDGLEAGGEAAAAMAGYLADTMSVPA
FT                   IFGPATSAETESAFLALEGKNVLLVSPSATSPDLTPIDNPEPSDENPGLLWRTAPPDSF
FT                   QGEAIAVDMRAPGAGREVAVDTVVVIHIDDTYGNALYQAFASSFESRGGTAISRPFVPN
FT                   NASQPGARLDEVVPQVGLAGGFDEVLFISSSIDDIVGFLNTSAEFAGYDGKGIFLAEAA
FT                   ASDDVLNVADATRFPQVRGSRPRARDRDSDLVYANFLSAYSFAYKEDADGQVFTANSYD
FT                   AGWLIAFGVSWALINEGSLDGTSIARGLRRLSSGPTVNLDGEGWATMLESFGNGESINI
FT                   NGASGSLDYDNSTEETATEVEIWTISAENEIDVVDLFEP"
FT   sig_peptide     complement(448964..449050)
FT                   /locus_tag="Hoch_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.959 at
FT                   residue 29"
FT   gene            449375..449674
FT                   /locus_tag="Hoch_0314"
FT   CDS_pept        449375..449674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12955"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIS6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12955.1"
FT                   /translation="MDKKAATAPPKSDSEQPVRAPQGPAGDAELTGADVTSNRKGSGDG
FT                   WRWEGERNACIYLVDRQCFDDRAAACSAAGCAGSDCRANTEKAVPAKVSCKGAD"
FT   gene            complement(449696..450754)
FT                   /locus_tag="Hoch_0315"
FT   CDS_pept        complement(449696..450754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0315"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12956"
FT                   /db_xref="GOA:D0LIS7"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIS7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12956.1"
FT                   /translation="MQIGVITNPKSRKNRGRPERADRLQSILGSFGEVHETDSVDSIKP
FT                   ILRDFLRKRARYWVADGGDGALHWMLRMGMEVLDEEEFIGTEMPLPLLPTRGGTIDFVA
FT                   NNVGIQGNAESILSSLRSAVERGAEIEEAVVDSMLIDAVEVTDEGEVPFRTYGFACAAG
FT                   GVGQRFFANYYKEDDPNPRTIVKIVSKMVASVPLAMTPLRRLRGLPWHLDEFAREVFAP
FT                   AQARVSIDGMILPEEQLDGIHIASMAINLGNVFRLFNKAETPGLMHAIVGSASPINLMF
FT                   NLPRMYSGKELRGRQILDRPCRELTVEATGDELLAPVVDGEYYPNLRKITFKLGPRVRI
FT                   PRVVASRTSRRH"
FT   gene            complement(451218..451293)
FT                   /locus_tag="Hoch_R0010"
FT                   /note="tRNA-Ala3"
FT   tRNA            complement(451218..451293)
FT                   /locus_tag="Hoch_R0010"
FT                   /product="tRNA-Ala"
FT   gene            complement(451414..452112)
FT                   /locus_tag="Hoch_0316"
FT   CDS_pept        complement(451414..452112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0316"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rlg:Rleg_1393 ribonuclease, Rne/Rng family"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12957"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIS8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12957.1"
FT                   /translation="MSSKRWQRGRRPPGFAAASDVQQTLGSLLRSTLQQVSAVKDVALR
FT                   QARSSFEQLDGAVLQRKRQAAMAELGELVWELANTGRLGEIMEHPDLEALLRDVQEIEE
FT                   RMEQEATSDSEAVSSASWTPPPPSPSRASSGAAGNRRGKERMRVWRPNLADLEQQDAAH
FT                   GDDDRGHGHAQSEPASAAPEAAPQAASRRGRRSRGRSGGGGGIAFVDSGPEDDEDLSEY
FT                   MNDDDVPRQG"
FT   gene            452185..454209
FT                   /locus_tag="Hoch_0317"
FT   CDS_pept        452185..454209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0317"
FT                   /product="two component regulator propeller domain protein"
FT                   /note="KEGG: dma:DMR_23110 two-component hybrid sensor and
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12958"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIS9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12958.1"
FT                   /translation="MNETQRIEVGGGKGRRSGFVRLAALMALSALALGCPHAPKVEEVA
FT                   APQISVSSFSEGSPVRALSALPPYVFSVSRDGLDRWEPEVGQSLQLSAEHGLPGDRVES
FT                   MTYDPVRRTLWIATDNGVTRLEVQTGSFSEIPPPPQVLGLMPLSSVVIEPAGDGGLWIG
FT                   HPRGLYYTNPAGQWTETPIRVPITALHRAADGWLWIGTSQGLLALLPSGESFSYGPEQG
FT                   CNIEDVQLLATAPGEVPMAVGTNQDGEQRVVLFYDKRCATYRVAPESETWVSVTRSGNE
FT                   LLVLTPDHLYRLFAEREKPPSLDRHGMRLWITESAEGIDAPSKPFDIRLVSNIEVPDGA
FT                   RVVAAGPEQILLGTSSLGTARYTSDAKVSWLRRSELVADAISLSVACRSARDCYVGTGT
FT                   HGWHYVGTHFEPVSDTGGPALAFARDNEGEIFALVRGEDERHLHVEQLEGDAWTRLEDI
FT                   VITTPGLRAEPVFARMSPEGSLWVGLRYREALSAVKPYGLAEVELDSARVRYHRRQRRR
FT                   PRSMMPVPLELSDIAFPDSGEVWLASPQGAVQIRKRRVKVHKETSDGQGLKTEVVRGIA
FT                   ASPEGAVYIASREGVAAFEGTAWRYPSELAGSVNDVAVGAGGRLWMATQRGLAYFEGGE
FT                   LRRIDIHRGLLQNQLDDVDVDHLGRAWVYGAKGISIVAP"
FT   gene            454416..454709
FT                   /locus_tag="Hoch_0318"
FT   CDS_pept        454416..454709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0318"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG:
FT                   mxa:MXAN_3704 cell division protein FtsB"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12959"
FT                   /db_xref="GOA:D0LIT0"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR023081"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIT0"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ACY12959.1"
FT                   /translation="MGLATALATALAYFPYRLLDGSSERKAAALRAQYEQTVTDTQRLA
FT                   NENQRLRRQIEALKGDVGAIEDIAREELGMVRPNEVIFRIEEVRGEVHEGGE"
FT   gene            454706..456904
FT                   /locus_tag="Hoch_0319"
FT   CDS_pept        454706..456904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0319"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: scl:sce8397 GAF/GGDEF domain-containing
FT                   protein; TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; GAF domain protein; SMART: GGDEF domain
FT                   containing protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12960"
FT                   /db_xref="GOA:D0LIT1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIT1"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACY12960.1"
FT                   /translation="MSNLRNLRRALHIGGGTLVGALACAMIAAGALDASALETPRIASM
FT                   LLLACVAVLTVTAISRRMQFTPPSARSQRASFWLGAAPILADVEIAFALVSACYAIIAV
FT                   TGSMDSPMYPLLYGVVAFAVSFLSRPGAWATVGAAVILELAFFLRMPFGMDAVAPLLLH
FT                   GFFLAGASAAHALFWRGLIAAHQRRRARRLERELQAQRDSARDYRLIAAALGAESRAPR
FT                   NRLQEEHMLALGGVQTISDSVFHTMRLMKWALGAQTCALLWLTERGDAFKVKELASDSD
FT                   DVTESSRVAAAGPLGAILRDRAPLILARTKPRQIPYYDRGDFTGAFVGVPVMEGAHLRG
FT                   ILCADRDQPFDDDELTILAGATEQILRYVQSEQVFRAVERAKYEHERFYHASAMLCRAL
FT                   TLEEVMETAFDAASQIVGFDLAAITIYEPERKRHRVYSVRVSDEDAPLIDPESLADLEF
FT                   RDNTGLAAMVVKNKHYLPAGGELRDLTAPVYTKQVRLKEAESLLVLPLLSGDEAIGTFM
FT                   LASRERQQFGKDVREMLGIIANQVAVSLQNGMMYKTMETMATTDGLTGLTNHRTFQDRL
FT                   VQLLDRAERTRQPAAILLCDVDHFKNVNDTYGHPIGDEVLRQVAGVLLRSVRKIDIPAR
FT                   YGGEEFAVVLEATDLEGAMNLAERIRKDVAALVVDSDKGPFQVTMSIGIASFPDDATDR
FT                   AVLIERADSALYLAKESGRNRCMSYQTLAASRRLRKAS"
FT   sig_peptide     454706..454816
FT                   /locus_tag="Hoch_0319"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.584 at
FT                   residue 37"
FT   gene            456916..457638
FT                   /locus_tag="Hoch_0320"
FT   CDS_pept        456916..457638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0320"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mmw:Mmwyl1_4073 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12961"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIT2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY12961.1"
FT                   /translation="MPTALIIGSSDGIGLALVRALLARGYQVAGLSRSPLPAERVGDGA
FT                   ERYQHLALDVRDPAYRAHVAELCQRLGALDLCIYAAGIGDSLALDQLDENAHLAGERPV
FT                   FAVNLMGLVDCIEVVLPRMLARGRGHIIGLSSQADGFPDGGAPSYGASKAGMSAYLERL
FT                   ALAVRARGVAVTNVRLGFVDTKMAKADVRPFLITPEAAAERILRCLRRKPIRVTHPWRM
FT                   AALLWLVAWPGRLRIWLS"
FT   gene            complement(457668..458105)
FT                   /locus_tag="Hoch_0321"
FT   CDS_pept        complement(457668..458105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0321"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   xca:xccb100_3712 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12962"
FT                   /db_xref="GOA:D0LIT3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIT3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACY12962.1"
FT                   /translation="MALQWISESPAYWDQDKARIVGGAPAGIFDVRYQRCQPGDLLPAS
FT                   WWRVSSDGETVGYGWLDIVWGDAEILLATAPGAQGKGVGSFILDKLEEEALARGVNYLY
FT                   NVVRPTHPQRDAIAAWLSARGFEESDDGSLFRAISRKPEKS"
FT   gene            458241..458726
FT                   /locus_tag="Hoch_0322"
FT   CDS_pept        458241..458726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce1927 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12963"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIT4"
FT                   /inference="similar to AA sequence:KEGG:sce1927"
FT                   /protein_id="ACY12963.1"
FT                   /translation="MASRVWAYLASALLIGAMCVPFSWPLHRDSFPLSNYPMFSRPLPD
FT                   PSVTITYALGIEPGGARHHLPPKLVANEEVLQARAVLARAAAAGAGPVSALCRRIAERV
FT                   AARVAAAGADSEYAGVREVRIVTGSHDAVAFLTGEDLLGDEREHGACPVIVAAKEGP"
FT   gene            458723..459772
FT                   /locus_tag="Hoch_0323"
FT   CDS_pept        458723..459772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0323"
FT                   /product="HTTM domain protein"
FT                   /note="SMART: HTTM domain protein; KEGG: scl:sce1926
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12964"
FT                   /db_xref="GOA:D0LIT5"
FT                   /db_xref="InterPro:IPR007782"
FT                   /db_xref="InterPro:IPR011020"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIT5"
FT                   /inference="protein motif:SMART:SM00752"
FT                   /protein_id="ACY12964.1"
FT                   /translation="MSRTDAPAPGVLARIGRAIDGYWLAAAPPERLAAVRVAVGLFAFV
FT                   YMVGRLPYWLSYAHFDPYQYAPVGVLAWFQPKPFVPALVQALVVATALAGAPFVLGWRF
FT                   RVTGPLFAALLTWTLSYRNSWGMVFHTENLMLVHVWVLAFTRSSDAWSMDAARGRCAPL
FT                   GASATAAAADADADADADADANTGADAGETHAHGCYGWPLKLMSVVVVIAYVFAGVAKL
FT                   RNAGMDWLWGDELRNHIALDNARKALLGDIYSPLATPLLQFGGLFRVLAFVTVVAELGA
FT                   PLALLSMRAAAVWIALVMGFHWGVLVLMMIMFPYPMLGVAFLCFFPAERPGRRIAERIQ
FT                   RWRQARARS"
FT   gene            459959..460666
FT                   /locus_tag="Hoch_0324"
FT   CDS_pept        459959..460666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0324"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: maq:Maqu_1013 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12965"
FT                   /db_xref="GOA:D0LIT6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIT6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY12965.1"
FT                   /translation="MPDAILEARAITKTYRMGEVDVHALRGVDTALYAGELLVLLGASG
FT                   SGKSTLLNILGALDVPTTGAVDFGELALTGADEDELTQFRRDHVGFVFQFYNLIPSLTA
FT                   RENVALVTDIARDPLTPEEALHMVGLGERVDHFPGQLSGGEQQRVAIARAVAKQPTLLL
FT                   CDEPTGALDSRTGVLILEVLERINRELGTTTAVITHNAPIAAMADRVLTLADGLVVSEE
FT                   RNADKARPRDLQW"
FT   gene            460660..463032
FT                   /locus_tag="Hoch_0325"
FT   CDS_pept        460660..463032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0325"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   rfr:Rfer_1941 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12966"
FT                   /db_xref="GOA:D0LIT7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIT7"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACY12966.1"
FT                   /translation="MVSALDRKLLRDLRTLKGQVLTIALVVACGIASFVALQSTWHSLA
FT                   VSRDTYYERYRFGEVFAHLERAPDSLGARIEAIPGVARSYTRVVEQALVPMPGRTTPAV
FT                   ATLVSLPGDRPPPLGAVYLRAGRMIEPGRDDEALVIDSFAQAHGLQPGDSVAAVINGKL
FT                   RRLELVGIALSPEYIFTMAPGALTMDTGGTAVLWMDEAVLAPAFQMESAFNDVVLDLQP
FT                   GASEPEVLRQLDALLAPYGGRGALPRAKQPSNFMLADELSQLEGFATTVPTIFLSVAAF
FT                   LLYIVLSRVVHLQRTQIATLKAVGYRGREIGAHYLKLVSVIVALGAALGMALGAQIGSG
FT                   ITGFYGQFYRFPVLVYELQPQVIAGGVLISMGAAVAGALAAVRRIARMPPAEAMRPPSP
FT                   PVYRRGVLDHPALTRLLGTSTVMVMRELRRQPLRLLLSSLGIAAAVGIMVTGSFGFDSV
FT                   EFVMRDSFHRENGGDLMVNLLAPVPASELGTLAHLPGVLDVEGTRAVPVRFRSGPVWRD
FT                   SSIMGLADEPRLRRIVDREARVVTLPREGLALSKKLGEILGVGIGDRVEIEVKEGQRRI
FT                   YEVPVAALIDDTFGLQGYMHLSPLHALLGEDSSVNALQLRIDPLRAEELDLQTRLVEIP
FT                   NIARVTEKRAVVASFYEQTGASMGVMSFVLGLFAAIIAVGVVYNNARVALSMRSRDLAS
FT                   LRVLGFTRAEISAVLLGELSVQLLVALPMGLLLGTWWAQGVMGSIDAETYRLPIVISKA
FT                   TYAQAVLVTLGAGLASALLVRRKLDSLDLIGVLKSRE"
FT   sig_peptide     460660..460776
FT                   /locus_tag="Hoch_0325"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.810) with cleavage site probability 0.582 at
FT                   residue 39"
FT   gene            463069..464385
FT                   /locus_tag="Hoch_0326"
FT   CDS_pept        463069..464385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0326"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: rfr:Rfer_1702 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12967"
FT                   /db_xref="GOA:D0LIT8"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIT8"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACY12967.1"
FT                   /translation="MSEPASNAPQPSRSPSGSLDPKERPVAAAAAVRRQRQRRMRTLGR
FT                   WLKRGVLALVVVGIGASLVTAFLPEPVSVDLVAATRAPMRVVVREDGITRVVERYVISA
FT                   PLAGELLRIEHEPGDAVAAGDVLARIVPARSPLLDARSRAGADARLGAARAARRQAEAR
FT                   AERALAASESAEREAQRYRDLGARGAVSDEARERTEADARMAAQDLAAARMAVEVATHE
FT                   LEAARAALGQDEGAGTGEVLVRAPVAGRVLLVHQESAARVEPGRALLEIGDPGSLEIVA
FT                   DVLTRDAVAIAPGAEVAVERWGGESALRGRVERVEPSAFTRVSALGVEEQRVYVLIALE
FT                   PGQDAALALGDGYRVEVAITVWQADDVLSVPLGSVFRDGERWAVYVERDGVAALVPVEL
FT                   GRRNRERAEILSGLDAGARVIAHPGDRVSENVAIVAAAH"
FT   gene            complement(464428..465345)
FT                   /locus_tag="Hoch_0327"
FT   CDS_pept        complement(464428..465345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0327"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: bav:BAV3184
FT                   universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12968"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIT9"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACY12968.1"
FT                   /translation="MKLASIAVGVDFSEESNVALEQALHLAKTHDTQLTLVHVGALPPH
FT                   TVEVPESLRPTLTEYERILNQHLDEDRNRLAELRVSCEARGFKNVTTQVVDDHPDQGLC
FT                   QAADQLSADLLVVGTHGRTGVKRLIMGSVAERVVRLSERPVLVARSPVEADAPGYQRIL
FT                   VGMDFSSTAQEALRYAVALAAPGAVVDLLHCWRLPLASVPYFPAGDVGASIEGPLRTYT
FT                   EELGQKLASEHSTPTCAVNYHSVEAAPTQGISEWLEARPYDLTVVGSHGNRGMRRFLLG
FT                   SVAEATVRHANTSVLVVHAPETDE"
FT   gene            complement(465474..466967)
FT                   /locus_tag="Hoch_0328"
FT   CDS_pept        complement(465474..466967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0328"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein; KEGG: mxa:MXAN_4081 putative
FT                   ATP-dependent RNA helicase RhlE"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12969"
FT                   /db_xref="GOA:D0LIU0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIU0"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACY12969.1"
FT                   /translation="MPFQQLGLSEPLVRAVHDAGYTNATPIQTQAIPPALDGRDLLGCA
FT                   QTGTGKTAAFSLPILQRLAETGDGNARPRRGARPIRALIVTPTRELAAQIGDSMTTYGR
FT                   HLPLRNTVIFGGVNQNRQVDALRRGIDILVATPGRLLDLMDQGYIHLDRLEVFVLDEAD
FT                   RMLDMGFIHDIRKIVAAVPSERQTLLFSATMPGEIQSLAAGLLQEPVKVSVTPESTAAE
FT                   TVEQCVYLVSREDKQSLLTELLRDDPEMAKVLVFSRTKHGADRVAKRLSKSNIPAQAIH
FT                   GNKSQNARLRALESFKRGDTRVLVASDIAARGLDIDALSHVVNFDLPNEPETYVHRIGR
FT                   TGRAGCEGVAMSFCADEERGYLRSIERLIDQLIPVIEDHPFPAGFDKLPVEQPRPQRAN
FT                   HGGPPGRSRRSGGGRRGPGGGPGAGTGNGRRGPGGGSRPRRGGGGGGGGGGGGGGGGGG
FT                   GGGESPSRSRRGSGSGRRSGDARPADTGGRSRSRTRSRS"
FT   gene            467192..467371
FT                   /locus_tag="Hoch_0329"
FT   CDS_pept        467192..467371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_0364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12970"
FT                   /db_xref="GOA:D0LIU1"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIU1"
FT                   /inference="similar to AA sequence:KEGG:Gmet_0364"
FT                   /protein_id="ACY12970.1"
FT                   /translation="MRFLGVLLFVLGGGGTAFATWASYQRGRPQDVLFGLLAPVAMLVT
FT                   LTGLLLAFVPDFFG"
FT   sig_peptide     467192..467251
FT                   /locus_tag="Hoch_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.943 at
FT                   residue 20"
FT   gene            complement(467399..468319)
FT                   /locus_tag="Hoch_0330"
FT   CDS_pept        complement(467399..468319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0330"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: scl:sce6540 putative ribose-phosphate
FT                   diphosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12971"
FT                   /db_xref="GOA:D0LIU2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIU2"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ACY12971.1"
FT                   /translation="MAQPLLYTTAAYAYLGDELRASGGFAAGEIEQQQFPDGERYRRLL
FT                   TPCDDRDVILLGGTISDSDTLELYDLACALVYYGARRLSLVIPYFGYSTMERAVRPGEV
FT                   VTAKTRARLLSSIPGATMGNRVFLFDLHVAGVTHYFEGQTHPVHVYGKPVISDLVRRLG
FT                   GDDFVLACTDAGRAKWVSSLANDLGVSAAFAYKRRISGSRTEVAGVSAHVAGKCVVIYD
FT                   DMIRTGGSLLGAARAYRDAGASDVAAICTHGLFPEDALARLRDSGVVSRVACTNSHPRA
FT                   NELACDYLSVESIAPLLAQRLRTRV"
FT   gene            complement(468573..469169)
FT                   /locus_tag="Hoch_0331"
FT   CDS_pept        complement(468573..469169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0331"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   ank:AnaeK_4073 protein of unknown function DUF179"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12972"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIU3"
FT                   /inference="protein motif:PFAM:PF02622"
FT                   /protein_id="ACY12972.1"
FT                   /translation="MIETELAPGLLLAMPHLLDPNFRRSVVLMVEHDDEGSFGLVVNQP
FT                   TELSMDELYESLDLAWKGSSEAMVWRGGPVMPTHLWLVHAPLAGSSDSGTESALLGLGD
FT                   GGTVAVGPELRVSGAMPELIEMFGNEPPAQLRVLLGYAGWGGGQLAQEMSQGAWLHVDA
FT                   TPELIFETPAEEMWERAVRTLGINPETIIHGAGIH"
FT   gene            complement(469311..469976)
FT                   /locus_tag="Hoch_0332"
FT   CDS_pept        complement(469311..469976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0332"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: xcb:XC_0569
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12973"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIU4"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ACY12973.1"
FT                   /translation="MKRIARILVTVGATAMLFAGCSKEEPVAEEPVAEEPAAEEPAAEE
FT                   PAAEEPAAAAAEEGADFVKLYASHEPATEADPVIIEIQTFQVTEASFDPANLEGATAAF
FT                   ELDLTSIKSDKEKRDAHLQTPDYLDTGKYGMATVKVHDVKKVDDDTFSAQADVNFREMD
FT                   KTFPIEFDVVGSTEDTVTIKGMHEFDRMDFGVGKEPDGENEKVAKNVKIEMQLTLKKS"
FT   sig_peptide     complement(469902..469976)
FT                   /locus_tag="Hoch_0332"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.475 at
FT                   residue 25"
FT   gene            complement(470119..471114)
FT                   /locus_tag="Hoch_0333"
FT   CDS_pept        complement(470119..471114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0333"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: pla:Plav_1988 YceI
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12974"
FT                   /db_xref="GOA:D0LIU5"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIU5"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ACY12974.1"
FT                   /translation="MERSPRSPYWAIAPALLAVLASLARWLQQGSGNLYTALDKRFYIP
FT                   DPVVGWRITEDSPLWLGVDVVGMLTAYTVTLVVVARFVGQRERQNGATWSPGRNALWGI
FT                   AAIPLIVPVWAFASGGVPEGAREALPPGVIGPPPGGFEGTLAGLPAGRYEIVSGAESAV
FT                   TAHLKAGGEEFDARFAGGLSGTLQFDPSNLEAPLNIEVRVDASSVDTGVSMRSKHAASE
FT                   DFLDAAKHPELRFSTAALSSSRQGDSPSQLVFWTDGTVTIMGKELSVPVQGTVSVLDEQ
FT                   ARERVGADAPGLVVTADFPLDLAETPLPAEEFDETRATLRAVLILTHRPE"
FT   sig_peptide     complement(471040..471114)
FT                   /locus_tag="Hoch_0333"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.909) with cleavage site probability 0.694 at
FT                   residue 25"
FT   gene            complement(471202..471420)
FT                   /locus_tag="Hoch_0334"
FT   CDS_pept        complement(471202..471420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12975"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIU6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12975.1"
FT                   /translation="MKFFARAVISGFGFSVGKALFDKVKDHVGLGDSSSSTRPQGGVTQ
FT                   VDDIEDAEEDRTLGVATELETLDHAVH"
FT   gene            complement(471595..472959)
FT                   /locus_tag="Hoch_0335"
FT   CDS_pept        complement(471595..472959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0335"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dal:Dalk_1952 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12976"
FT                   /db_xref="GOA:D0LIU7"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIU7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACY12976.1"
FT                   /translation="MDAPPTEPRAGHPPERRSLLRALGLHRRELRAWAMYDWANSAFAT
FT                   TIMAAVLPIYYSSVAASHLEHHVATARWAYTQVVALIIGVAIALTMGALADYLGAKKRF
FT                   LAAFMLFGVFGCLGLWFAEEGDWLLTSICYVLGHVGFASSNVFYESLLPHLADEKEIDR
FT                   VSTAGYAIGYIGGGTLLAFNLAWILMPDTFGFADSGQATRAAFVSTGIWWALFSIPILR
FT                   HVPEPPRELDRGERANANPVVASVKRLGQTFREIRKHRDVFTFLLAFWLYNDGIITIIK
FT                   MATIYGTEIGLEQGDLIGALLLVQFLGIPFTFAYGALADRIGTKPAIYLALVVYIGICT
FT                   LGYFMDQAWQFWALACGVGAVQGGAQGLSRSLYGSMVPPGKSSEFFSFFSISSKIGSIF
FT                   GVLVFGVISEGAGTSRLSILSLIAFFIVGMILLSRVDVQRGRAAARAEEAEMHVA"
FT   gene            complement(474256..475119)
FT                   /locus_tag="Hoch_0336"
FT   CDS_pept        complement(474256..475119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0336"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   pap:PSPA7_0898 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12977"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIU8"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACY12977.1"
FT                   /translation="MRTLTSILGNSQRLDGGAMFGNAPRALWTRWLTPDEHNRVPLACR
FT                   CLLVREDERTVLFETGIGAFFEPAMRERFGVVEERHVLLEQLTERGLAPEDIDVVVLSH
FT                   LHFDHAGGLLNAWREDAQPSLVFPRATFVVGETAWERAKKPHPRDRASFIPALTSLLED
FT                   TGRLELVAGERSQTLGDGYRFHRSDGHTPGLLVTEIAMPEGPVVFCADLIPGRPWVHVP
FT                   ITMGYDRYPELLIDEKQRLLEDLHERGARLFYTHDSEVALSGIARDERGRFRPADEHAS
FT                   IDALAN"
FT   gene            complement(475429..476103)
FT                   /locus_tag="Hoch_0337"
FT   CDS_pept        complement(475429..476103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12978"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIU9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12978.1"
FT                   /translation="MPRIRPARSHAASIEAPVRGNKMTDQAHLGIVGLWVSRHSAIRQV
FT                   SLEGKPAGDSGCLSVQCWEVNTLSARCLCKEKHAGRRGSPHAFVEGRRRGLAVVKKALR
FT                   DTRLRYAGAMPPAPASVGVCREIVPSRHREAMLAGITSPPIRECGARSRGPFSGAGSCL
FT                   RAHGCGCSRARGRRGRSWTVQTRYETPKLVPGKSSGHSDSGSAKTDLALTKLGYRCRIS
FT                   DR"
FT   gene            476114..477211
FT                   /locus_tag="Hoch_0338"
FT   CDS_pept        476114..477211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce4191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12979"
FT                   /db_xref="GOA:D0LIV0"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIV0"
FT                   /inference="similar to AA sequence:KEGG:sce4191"
FT                   /protein_id="ACY12979.1"
FT                   /translation="MTRRVNSRHLAYGIGLLVAVTCLWLSFRNARFSEVWRIVGEIGPI
FT                   APIILVPYFVAVTVDTTGWRRIFLEMGHRLRLRRLLGVRFATEAVLMSAPGGSVLSDTI
FT                   KPFVLKATDRVPISATLTSVALRKWSIMAAEVVYLSIGCVIGFSLYRAASEPVLGQATG
FT                   FEWIVVAATALLALGVVASFAMLSGGTLTERVYTKLMRVLPAFLSDRLRSTHDGARALD
FT                   AYMRRVFTERRRGLAVSVALYVGHWFIEATETWLIANLLGVPLDFTHAVAIESACSFLR
FT                   AIAFFVPAGLGVQDLGYATLFAVAGVPAPVEFSLAFTLVKRSKELVWVVIGYLVLLSLP
FT                   IKRRPVMEAAAAPGESALAADARGA"
FT   gene            477222..478292
FT                   /locus_tag="Hoch_0339"
FT   CDS_pept        477222..478292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12980"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIV1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12980.1"
FT                   /translation="MNHSQQARASRKKQILFVGGDVAQTRQIHDVAKHLGDYEQYFSPH
FT                   WGDRFISLVRELGLIEYTIAGNKRGQNTLDYLHEQGLRVDKYGRRGCYDLVVSCSDILV
FT                   PRNIRYTKLVVVQEGIFDPEHRSYRLIRLLPFLPRWMAGTAMTGMSGLYDAICVASPGF
FT                   RAHMIARGADPNRVHITGLIHYDNCRLYEDNEFPHRGYVLACTSDGRETWKADDREAFI
FT                   ARALELAQGRQVIFKLHPNEDYERSEAEIRAQSADALIYYREPGIKAEEMVANCEVLLT
FT                   EWSTLVFVGLALGKECYSYHDMELLKQLMPIQNGGSSAEKVAEICRRIIESPEPPTPVV
FT                   MDPKRSLATRIAEAFH"
FT   gene            478302..479168
FT                   /locus_tag="Hoch_0340"
FT   CDS_pept        478302..479168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0340"
FT                   /product="acylneuraminate cytidylyltransferase"
FT                   /note="PFAM: acylneuraminate cytidylyltransferase; KEGG:
FT                   rpf:Rpic12D_0583 acylneuraminate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12981"
FT                   /db_xref="GOA:D0LIV2"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIV2"
FT                   /inference="protein motif:PFAM:PF02348"
FT                   /protein_id="ACY12981.1"
FT                   /translation="MSTDTEQRQDRRKVAIVIQSRTGSSRLPGKILMPLAGAPLLARML
FT                   ERVRAAELPGHEHRADVAIIVATTTDEGDAPVAALCEEVGVACFRGHPTDLLDRHYRAA
FT                   EQMGADVVVKIPSDCPLIDPAIIERVIGFYLDHADEYDFVSNLHPASYPDGNDVELMPM
FT                   AMLALAHREAELPMQREHTTPFFWDQPERFRVGNVAWERGLDYSMSHRWTIDYQADYDF
FT                   IAAVYEQLYRPEAPIFSLDDILALLERRPDIHQINAHLAGVNWYRNHRDELRTIESWQS
FT                   RDLEVSK"
FT   gene            479165..480031
FT                   /locus_tag="Hoch_0341"
FT   CDS_pept        479165..480031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0341"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase domain protein; KEGG:
FT                   bra:BRADO5169 putative transketolase N- terminal section
FT                   (TK)"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12982"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIV3"
FT                   /inference="protein motif:PFAM:PF00456"
FT                   /protein_id="ACY12982.1"
FT                   /translation="MTTTNNAPSADAGLERMALRVREHIIRMSGRGGCFIGASLSCADL
FT                   LVYLYSEVLDIAPDRVDDPKRDYLLLSKGHDVPALYGTLVELGYFDGARLDKHTSTEDH
FT                   VYWHPNRAIPGVEFHSGSLGHLLSVGMGIAMDIKLRGDNNRVFVVLGDGELNEGSVWEA
FT                   LLVAKAKKLDNLIPVVDRNWFQANIRTEELIPLEPLAERFRGFGYEVHRFDGHSFPAMK
FT                   DAFGKLGNGTNQVFIADTVRGKGLPSIQERADRWFVRFEQNEVEELLTELHGQGSATLT
FT                   SDPLHVR"
FT   gene            480041..481006
FT                   /locus_tag="Hoch_0342"
FT   CDS_pept        480041..481006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0342"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase domain protein; Transketolase
FT                   central region; KEGG: bja:blr5427 transketolase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12983"
FT                   /db_xref="GOA:D0LIV4"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIV4"
FT                   /inference="protein motif:PFAM:PF02780"
FT                   /protein_id="ACY12983.1"
FT                   /translation="MRAQSYEDLLAELCGEIPELVVMTAENRGAIRNLPPKIGDRFIDV
FT                   GICEQTMLGAASGLALRGRIPVVHALSTFLTMRAFEFARTDAGIPHLPVKMVGAVPGFL
FT                   SDANGPTHQAIEDIALMRGIPGMQVVCPADAEELLDAMPVVVNSGSPCYVRFYAGPRRR
FT                   PSTEPFAMGKAQTLRDGKHVTILSYGFLVAQALEAAEILGRSGITARVVNMRTLSPVDT
FT                   DAIVSAVRDTELVVTLEDHFRTGGLYSITAETLLDRQIKGNVLSIALDGKWFRPGLLDQ
FT                   VLAYEGFTGAQIAERTERALRSGIQIEANPSPSEELHRHV"
FT   gene            480999..482333
FT                   /locus_tag="Hoch_0343"
FT   CDS_pept        480999..482333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0343"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   dal:Dalk_0629 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12984"
FT                   /db_xref="GOA:D0LIV5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIV5"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ACY12984.1"
FT                   /translation="MSESIRLDRGFPKIAASEELFGRCEGLVPSYTQTLAKGPQQHVRG
FT                   VAPKYLRRGSGSHVWDADDNEYIDMTMGVGPLILGYGYEAVDEAVRAQLAEGMTFSLMH
FT                   PLEVEVAELIRELVPCAEMVRYSKSGADVCSAAVRVARAYTKRSKVLCCGYHGWHDWYI
FT                   SVTDRSSGIPGSTGELTHTFDYNDIDSLAAAIDDQTACVIMEPTVFQAPKDGYLQAVKD
FT                   LCDKHGALLVFDEMWTGFRMAVGGAQEYFGVTPHLATFSKAVANGMPLALLCGQAKYMQ
FT                   VLHDDVFFYTTFGGEALSLAAAVATVNELRSKDVPKAIAKTGARLREGYNALVAELDMP
FT                   YTNCIGFDCRTMVTFQPTGEQSPLHMKTLLQQEMLRHSVLWGGFHNMAFTHSDADVEHV
FT                   LAAYKKALPVLKQAVADGKVEASLAGGSIEPVFRRTSNFNTKPRR"
FT   gene            482351..483172
FT                   /locus_tag="Hoch_0344"
FT   CDS_pept        482351..483172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0344"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bja:blr5976 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12985"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIV6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY12985.1"
FT                   /translation="MSSTMFRLADKVAIVTGATGLLGREHCHALASAGARVVVADLDQA
FT                   ACASFAGELQAAHGTESIGQSVDITDPDSVAALLKATLGAFDRVDVLVNNAAIDDKAAA
FT                   ERTDAEATAFENYPLSAWKRMIDVNVTGTFLCCQVIGAHMAERGTGSIINVASTYGLVA
FT                   PDQSMYRRPDGSQAFFKSAAYPTSKGAVLQLTRFLGAYWGGKVRVNALCPGGVMTENTD
FT                   PAFAERYAARTPAGRMADRGDYRGAVVFLASDDAAYMTGNQLVVDGGWTCL"
FT   gene            483163..483678
FT                   /locus_tag="Hoch_0345"
FT   CDS_pept        483163..483678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0345"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /note="TIGRFAM: 3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family; KEGG: bph:Bphy_0330
FT                   3-deoxy-D-manno-octulosonate 8- phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12986"
FT                   /db_xref="GOA:D0LIV7"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIV7"
FT                   /inference="protein motif:TFAM:TIGR01670"
FT                   /protein_id="ACY12986.1"
FT                   /translation="MPVSDLEKRASALRLVMSDNDGSLTDGTVLLSSDGQTSKRYSLRD
FT                   GHGVELLRNDGVATAIVSREQCPVAQRRAEKLRLPHVFLGVQDKRAKLPELLATAGVEP
FT                   SQVAYFGDDLNDLDIMRAIAEQGLCGAPADAHPRVAAAAHYVCEKPGGYGAFREFAEWL
FT                   LALRGIQH"
FT   gene            483732..484673
FT                   /locus_tag="Hoch_0346"
FT   CDS_pept        483732..484673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0346"
FT                   /product="N-acylneuraminate-9-phosphate synthase"
FT                   /EC_number="2.5.1.57"
FT                   /note="PFAM: N-acetylneuraminic acid synthase domain; KEGG:
FT                   zgc:77126 ; K05304 sialic acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12987"
FT                   /db_xref="GOA:D0LIV8"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIV8"
FT                   /inference="protein motif:PRIAM:2.5.1.57"
FT                   /protein_id="ACY12987.1"
FT                   /translation="MHEQTRLMIADRSVGSGFPVFVIGEIGINHNGSVETAKALIDGAA
FT                   RAGVDAVKFQKRTPEVCVPRDQWDRMRDTPWGRMSYIDYRHRMEFTREQFEEIDAHCRA
FT                   NNILWFASCWDEESVDFLEYFEPPCYKAASASLTDISLLRKMKSTGRPLMISTGMSTMD
FT                   EIREAVAEVGTDNLLIAHSTSAYPCSTKELNLRVIPNLAHMFPECPIGYSGHEEGITPT
FT                   LSAVTLGATFVERHITLDCSMWGSDQAASVEPGMLSELVRNIREVELALGDGRKRVYPS
FT                   EIPQMQKLRRVKRQNGASMTPEGESSVVQLVR"
FT   gene            484673..485554
FT                   /locus_tag="Hoch_0347"
FT   CDS_pept        484673..485554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0347"
FT                   /product="fatty acid hydroxylase"
FT                   /note="PFAM: fatty acid hydroxylase; KEGG: vap:Vapar_3537
FT                   fatty acid hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12988"
FT                   /db_xref="GOA:D0LIV9"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIV9"
FT                   /inference="protein motif:PFAM:PF04116"
FT                   /protein_id="ACY12988.1"
FT                   /translation="MSPEVLSAIVIVCSAVLIIALEYRFPYERRQRLLREWLWSDLLLY
FT                   GLFQSLGLGIVIGALIAFIDRHTGWSSYGLLSGWPIWAQVMFFVLTHDFYIYCFHRMQH
FT                   RSRYLWRLHEAHHSARDIDWIAGSRSHPLEIFINQTIEFAPMILLGAHPVVPVIKGAIS
FT                   AIWGMWIHCNIDVKSGPLQYVINGPEMHRWHHAKDIPGPEEGLPAEGANFATKFAFWDY
FT                   LFGSAFRPRDRKPAAYGLFDDNGPFPEDYFRQVAAAFRPFQPVPTDPAGAHEPSMLSSE
FT                   SGGEPPQVARPQ"
FT   gene            complement(485608..486774)
FT                   /locus_tag="Hoch_0348"
FT   CDS_pept        complement(485608..486774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0348"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slo:Shew_2245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12989"
FT                   /db_xref="GOA:D0LIW0"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIW0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12989.1"
FT                   /translation="MRTFKTLIKWLSLVTSLAAALMLVLWAYWYHRPNTAVVAPELELE
FT                   SWPAVAEGMHDSNTDLLHWRGRFYLVHARSPYHLGSGNAKLVVWRSDDAKSWEKSAEIV
FT                   TPDEDLRDPKLVAIGDKLHLYALINHNIEPEPHATALSTSEDGVSWSPLQTLQPEGWLF
FT                   WRPKSRDGVTWYVTAYWHEHGASRLLSSRDGVNWDTVSTIHEGDRNDETALAFLPDGRI
FT                   LVTARLEGERAWHQGAADAATLLAVAAPPYTSWSTSVSKTTRLDGPVLFEHEGRVFAVG
FT                   RFDPEGYDSWYRHSSLFGRKRTALYEVRPDKLVYLSDLPSAGDTAYAGVAVVGDELYIS
FT                   YYTSDIERDYSWYLGLVTESNILMAKLPLRGLEALANAKAASQPVAAH"
FT   sig_peptide     complement(486691..486774)
FT                   /locus_tag="Hoch_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 28"
FT   gene            486954..487637
FT                   /locus_tag="Hoch_0349"
FT   CDS_pept        486954..487637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0349"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: dvm:DvMF_1696
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12990"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIW1"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACY12990.1"
FT                   /translation="MELIFVRHAEPAWVSGGQSNLDPPLTALGQVQARLTASAFRQRET
FT                   PSEILVSPRVRARETAAPIAEALALAPCEVPFFEEIRLPDWSNTPADEVSRTLREARAR
FT                   PMDTWWDGLPGGESFRDFHERITGGLRALLAGRGARRVSDERHAVWEFEDREQRLLFVG
FT                   HGGSNAVALTFLLDLQPVPWEWERFVSQHASITVVRSRRIATGHIFALRSFSAVDHLPL
FT                   DMRST"
FT   gene            487684..488553
FT                   /locus_tag="Hoch_0350"
FT   CDS_pept        487684..488553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0350"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cps:CPS_1694 putative pullulanase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12991"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIW2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12991.1"
FT                   /translation="MHRVTPTHTLRAAWRGRLFAVCALLVGCALLVGCASAAGPEARPD
FT                   AGAPNMVDADLGSAPFAVPLYLRGSFNDFAADLEMRYVGNNRYVADVALSVGQHEFKVA
FT                   DAGFSDETTFSLAGDRVAEVPEGAPVALQAAPGVGNNMLLAAERTGLYRFELSATDRSA
FT                   PVLLVSLREIAPYRNPMLLRGTFGGLARDVPLGFEGEGRYATTEALEAGTHAFKVTDLG
FT                   FSDDATFVLDPEGDALRVGTTVLLIAGTRGEPDLELTLEQAGSYRFELQVVVNPATPLL
FT                   TVTAAIPR"
FT   sig_peptide     487684..487797
FT                   /locus_tag="Hoch_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.956 at
FT                   residue 38"
FT   gene            complement(488576..490225)
FT                   /locus_tag="Hoch_0351"
FT   CDS_pept        complement(488576..490225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0351"
FT                   /product="membrane-associated zinc metalloprotease"
FT                   /note="KEGG: scl:sce7888 membrane-associated protease;
FT                   TIGRFAM: membrane-associated zinc metalloprotease; PFAM:
FT                   peptidase M50; PDZ/DHR/GLGF domain protein; SMART:
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12992"
FT                   /db_xref="GOA:D0LIW3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIW3"
FT                   /inference="protein motif:TFAM:TIGR00054"
FT                   /protein_id="ACY12992.1"
FT                   /translation="MSIVYFLLLVGVLVVIHELGHFIAAKLLDFKVLRFSLGFGRPLLR
FT                   TRLGETEYQLGIMPLGGYVRILGEDGGDDVPSSDAVRSFRGKPLWQRLIVVFAGPMANL
FT                   VFPVIIYFTLFAGHSQLPAAVVGDVLADAPAARAGLAPGDRVETINGEPVRYWEELENA
FT                   VKDSIGQELRLGLRRGDKSFEKYIAPVEQIVRTRDGGATRQGFIGVTHAPFLPLVGVVD
FT                   PGSPAAQAGLRTGDLLISIDGESVANWTEVKAKLARNTRRTSLVYLRGRAAPGVSSVHL
FT                   LEAQFADLVPEIRRSVSGRQRVYTGLEPAEMFVAQVDPGSPAAAAGLRPGDLITALDGE
FT                   PIDHWMVLDQRLQARPEHTWTLTWQRADGDQVVMRSGELRQRWIEERDEYGHTQTRLAF
FT                   GAHSDFERGRGELVPIKGRVQYAFEKAMGRSAETVGAMVSGFTEILRGQVPGDSVGGPL
FT                   MMYRVASVSGHKGWDSFLLMLALISVNLGLINLLPVPVLDGGHLVVFAAEAVRKRPLSL
FT                   AARARVQYVGLAVVGVITVLALRNDVVRYLLQ"
FT   gene            490250..491332
FT                   /locus_tag="Hoch_0352"
FT   CDS_pept        490250..491332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0352"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12993"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIW4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12993.1"
FT                   /translation="MSARLDTSFVARKTKYNADERGAELSEMLDTVEHLLERTKVLYEQ
FT                   YFLGIQRIPPAQLHRDIERKIRELTQAQVRNTALRFRLTTVTQKFGSYNTYWHRTMRAI
FT                   EQGRYTRDIVKARRRALRRGEDVPDELLVSMPKAIRDRIKRDRDSLARRHEREQQGAES
FT                   FDYDVDYDAEDFDLDAAMVRESKPEQPRVHQIDDDGGFDDQFDELFAALTQEAEAAVAR
FT                   IEQPKPSPPPAAKPAPAPAPRTAAAERPRPAPRRPDSVPPPGPAPQAARPAPQTARPRP
FT                   ASAPPPPGMTEDETRHLYERYRQARQNVGAKDVSYEKLKRTLNEQAPKIMEQYKARGVK
FT                   YDVVVKNDKVVLKAIPDSGK"
FT   gene            491569..492402
FT                   /locus_tag="Hoch_0353"
FT   CDS_pept        491569..492402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12994"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIW5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12994.1"
FT                   /translation="MFSPRSFARRLTPFLATLALAAPLAGCGIETVIITPPDNGGPSIP
FT                   PVDGGLGGPTPDASPGQPDQRLDGFHIDTFFSDIEPQLFNSCVVAGCHAEGSSARPPEL
FT                   RPPSDYAGPAYNLEKVIAYIDLSREPFDARATEFYVKAVDSHLGTVIESPEALEQWILD
FT                   AYDYTVGPPQFGRFDREVFETQVQPMLDAGGCAVAGCHGDDPGVGGFHLNLNAAPGSVE
FT                   SGVNLQNVIEYVRLEQPGEQSVIYLRATDGHRGTVISDPEVLVDWIEAARATPAD"
FT   sig_peptide     491569..491649
FT                   /locus_tag="Hoch_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.385 at
FT                   residue 27"
FT   gene            492421..493782
FT                   /locus_tag="Hoch_0354"
FT   CDS_pept        492421..493782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12995"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIW6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY12995.1"
FT                   /translation="MKPMGSVAVLLVSMLGLPAVLHAQTAPAAPAAPAVEDAWGDASEL
FT                   DEASADDALAALSGVLPFTRAELEEALVPRLRAAPIAVRAAVYRQRVAVRGATGDAEVM
FT                   LGARARTIPLGAREGAAAARIIALVLVDLASRSAASDSAPLPLPFPLPAPAPAEAEADA
FT                   EPASEAPPATPPSPAANREETTPTSATVAAPAPPPVAVASPPEDAPGARGGAPSAASSL
FT                   QNAVTRAFPPPPPPRASGGPSPAVSAPAQESPSPLSPASPSSPTPSVATAAQAGPHGAD
FT                   SPRTLRFAAFGGMALGAVSEDGLLRSVGVGVGVGVGGWRLAGELAWVHLSAAALEPSSG
FT                   AAVTTALDGAGLRVELGRALGPLELSLGALAAPYALRVAVADSMDENRRSVLLAGTAAL
FT                   RGQFVLRGPWRLLAGIGVDAFGRKVEVRTTEVVLASTPRVALWGQLGLAWEGRL"
FT   sig_peptide     492421..492492
FT                   /locus_tag="Hoch_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 24"
FT   gene            493779..494423
FT                   /locus_tag="Hoch_0355"
FT   CDS_pept        493779..494423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0355"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: mxa:MXAN_4733 ECF subfamily RNA
FT                   polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12996"
FT                   /db_xref="GOA:D0LIW7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIW7"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACY12996.1"
FT                   /translation="MNGAGFLLMAVAASLDAAPNAPTRAEVDAELIRRSLAGEDAAFTA
FT                   LYRRHVDRVFGRLTRLIGPVPEREDLVQQIFVDVFRALPSFRGDAAFSTLLYRITARAA
FT                   YDHLSRRRRSRTASELPGGVDEYDELLADGLAPELRLQARSEIARAFALLAQLKPKKRI
FT                   AFVLVVIEGMSIAEAAALVGASEPALKQQVRAARRELEALEARHQRMEVVP"
FT   sig_peptide     493779..493832
FT                   /locus_tag="Hoch_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.905 at
FT                   residue 18"
FT   gene            494420..495958
FT                   /locus_tag="Hoch_0356"
FT   CDS_pept        494420..495958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0356"
FT                   /product="FecR protein"
FT                   /note="PFAM: FecR protein; KEGG: scl:sce2186 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12997"
FT                   /db_xref="GOA:D0LIW8"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIW8"
FT                   /inference="protein motif:PFAM:PF04773"
FT                   /protein_id="ACY12997.1"
FT                   /translation="MSDTRDHDDEPVDGAGGLTEPLWQRLREAEPRLDDLRRARLLAGI
FT                   RAQLSEEPSDQADDGHGDDDGDGDGESAFVPAGHRRRLQVALVIGLVAAAAALFLVWRG
FT                   SAPEPGGQGPTLAEIDPLARVQPYLYQGPDAYPTGRPVRALALGDAALLRASLGGQGHF
FT                   TLHGPAQLSVEPSADAGAGDARPAATDHASGDASGDISDNVRLHLERGLLVADYRHAPG
FT                   RSLTVITRDARVLVTGTLFAVEASDDAPTRVSVMRGSVQVTSGSRASRAVAAGQSWTAD
FT                   VGYIGPMSEETRALMEEHAAAPTPMHAGRAPGAPADPGDVHTSGAAAGDGERAAVRRIL
FT                   DAGESAAPALQGTAEELYRDAETAMGKGESARARSLLRALLGRYPDDALVDVAHYELGR
FT                   MAFDAADYARARRHLGAVVERGRDPVFLEPAAYLRCRVELADARASAARQCLRGFRDRF
FT                   PRSPSDAEALWQLATLAAESGGCAAALPLWQAYLRQHAGARHAAEAAQRAQACR"
FT   gene            complement(496037..496894)
FT                   /locus_tag="Hoch_0357"
FT   CDS_pept        complement(496037..496894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0357"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bxe:Bxe_B0443 glucose
FT                   1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12998"
FT                   /db_xref="GOA:D0LIW9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIW9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY12998.1"
FT                   /translation="MAQSQNSPQPDERLPRTKTLPLLRGQKALVSGGSSGIGEAVAIAL
FT                   GEAGADVVVNYRSHPEQAEEVAERIRASGSQAITVQANVAEEDQVETMFQTMFERFGTI
FT                   DILVSNAGLQRDAAFDEMTLDDWKLVLDVNLTGQFLCARAAVREFKRRGVKPEVSCAAG
FT                   KILCMSSVHEVIPWAGHANYAASKGGIMLMMKSLAQEVAPARIRVNSIAPGAIRTPINR
FT                   DAWETESARKELLEKIPYDRIGEPEDIGRAAVWLVSDQADYITGHTLVVDGGMTLYPDF
FT                   AHGG"
FT   gene            496988..497665
FT                   /locus_tag="Hoch_0358"
FT   CDS_pept        496988..497665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0358"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   scl:sce2328 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACY12999"
FT                   /db_xref="GOA:D0LIX0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIX0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACY12999.1"
FT                   /translation="MRAGSQRVRTLKADVVHSGRARGRQARYAGFVKPIVRVADRPGDG
FT                   AAIADIHVASWQHAYRDLLPARYLESLSVHDLAGRWNQRIWAEPLRRPEACNIWVIEDG
FT                   GEVAGFALLGPCRDQDEEPGFAGEVLMIYVHPRRTGRGLGSTLFAHAFELLAQRGYFWG
FT                   VVWVLEGNRSARRFYEGMGLEADGTRHWERFAGRSVAVVRYAKALNPIAGLDALCRGPR
FT                   SYA"
FT   gene            497719..498705
FT                   /locus_tag="Hoch_0359"
FT   CDS_pept        497719..498705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0359"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: ade:Adeh_3773 UDP-N-acetylmuramate
FT                   dehydrogenase; TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; PFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase domain protein; FAD linked oxidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13000"
FT                   /db_xref="GOA:D0LIX1"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIX1"
FT                   /inference="protein motif:TFAM:TIGR00179"
FT                   /protein_id="ACY13000.1"
FT                   /translation="MDPVSRIADADAHSEADTDAGGNPRSALSTDDRAALRACVADIHF
FT                   DAPMSRRTTLRIGGPADALALPASVDELQAVVRACVSRGIPLLAIGAGSNLLVRDGGVR
FT                   GVVLGTRNMRGLRREGDTGIWVECGVSTGKLLSRATEWQLGGLEFLGGVPGSVGGGMRM
FT                   NAGTYLGEFKDVTSSVTTVRLRDAAVRERAAAECGFAYRHSAIPTDEVVVAARLSLTPR
FT                   PRAEIESDVRGLRQRRKEREPAKVSNAGSTFKNPPGDYAGRLIEACGLKGTRVGGAECS
FT                   PAHANWLVNTGTATAADLLQLIERVRDQVRASFGITLEMEVKVIGED"
FT   gene            498692..499684
FT                   /locus_tag="Hoch_0360"
FT   CDS_pept        498692..499684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0360"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="KEGG: acp:A2cp1_3914 D-alanine/D-alanine ligase;
FT                   TIGRFAM: D-alanine/D-alanine ligase; PFAM:
FT                   D-alanine--D-alanine ligase domain protein; ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP- grasp; protein
FT                   of unknown function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13001"
FT                   /db_xref="GOA:D0LIX2"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIX2"
FT                   /inference="protein motif:TFAM:TIGR01205"
FT                   /protein_id="ACY13001.1"
FT                   /translation="MEKTESSTTAAAADPRPHMRCTERRVGVLYGGPSSEREVSLESGA
FT                   GVLAALQERGYECVGVDWTPGSSLPALLVEHRVEVVWNALHGTYGEDGAVQGLCACMGL
FT                   PCTGASIAASAVAMDKILSKRLFESVGVPTPQWRVLRPDEGDTAAVFAEWALPLVIKPA
FT                   YEGSSVGLSLVRERDEIGPALKRARAGQGPVLVERYIEGVELSVGILADRVLGAVEIRP
FT                   TSGLYDYEAKYVRDDTAFLVPPELERGHIDTCEALGLRAYHALGCTGYARADLRVQADG
FT                   SAFILEVNTLPGMTSHSLLPKVAAHAGVDYPTLCERILELALAAAAPSR"
FT   gene            499777..501234
FT                   /locus_tag="Hoch_0361"
FT   CDS_pept        499777..501234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_4123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13002"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIX3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13002.1"
FT                   /translation="MHSRPSSAASLVSAPARAPRAAFSLGSALALGLLALSSSLAGCSL
FT                   YFEQDPPGQPRDAGVMDGYYPPWLPDDAWVPSDASPADAWMWPDAPRVPGVDFWMPIPT
FT                   NLYGSSDIYLELTWTYEGREPRHQIVHIPEDAYSISVADEDAYMLHATLFNDDRWLAST
FT                   TRREGCPADSRMTQPSQVIEVPNDVPTIQGAIDISSEGAIIYVHPGEYVEQLVLKPHLR
FT                   LIGAGAHRTTIRPPAPATGSLIELGESDDVVIRGFTLEDSVDPGVDGCSADGSFTCPAS
FT                   MYDAAVRAESFLEQEDGLYCGASLVLTHNIFANNDNAVNLSRQAVAAIVNNVFTYNTNG
FT                   VLALEHHGTSLIAGNTFYEVERYATVGLFTSLNLVANVFEAVGTILGDGDGLIRDYATC
FT                   NAYGEVEAAGQALDQDGNVNREIRFLNASGDDLRLEDGSDSWDIGCYNSFTGPYFDLVP
FT                   GAYGGPQGDWYEGDIEPGDFDLLFGAI"
FT   sig_peptide     499777..499905
FT                   /locus_tag="Hoch_0361"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.314 at
FT                   residue 43"
FT   gene            501543..503441
FT                   /locus_tag="Hoch_0362"
FT   CDS_pept        501543..503441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0362"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: scl:sce1089 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13003"
FT                   /db_xref="GOA:D0LIX4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIX4"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY13003.1"
FT                   /translation="MTSDVPRKGPGAGDSGSSTALGPSARVATGSPGSTGSPGASDAAA
FT                   SSGPPHTIDPDMAGGPQNVDAVAIGQVVDGRYRIVAKLGEGGMGEVYAAQHEHIEKKVA
FT                   LKLLRHEVLTHPEAVSRFRQEARSASSIGHENIIAIEDFGQLDDGRIYLCMELLEGSSL
FT                   NDILEAQQPPERLLNILIQTCHGLAAAHRKGIVHRDMKPENVFVTIAPDGAEIPKILDF
FT                   GIAKVSGDDRDNNLTRTGTIFGTPYYMSPEQALGQRVDQRADIYAMGVIMYECFTGSIP
FT                   FGGDSFMAILTKHITAEPMMPSQRAMERGRTMPAGIEAIILRALKKDPDERYSSMDELV
FT                   NELIAIHRNVVGPGMSSYMEAHVADPSAAFPALGAGSGAGARYTPMPSPEHGMTPAPYA
FT                   GNASAGVPQAAAPAPTPFPPAVVPGANHESASSSMPVMAGSSMSEPRSGGKGGLIAVVV
FT                   IALVVLAGGAGFFLFANGRKVAGGGSEQADAGTGGAVAVVADAGTTPVVEPPDPPAAID
FT                   AGAALVDPPDTPPVATPVIVLLAAEPSATVFDADGIFIGKTPLNVRITPGKDSAFVLKR
FT                   RGYHDAEVSLDGSESKRVVELDRKRREPKNPKDPKDPEDPKDPDEGNGSKFDFGLE"
FT   gene            503503..504399
FT                   /locus_tag="Hoch_0363"
FT   CDS_pept        503503..504399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0363"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce5808 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13004"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIX5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13004.1"
FT                   /translation="MMKTQRDTMLHRFVACLAAFALLSAPLAASAQPVDPMAEARQQFQ
FT                   NGKQMFDAGDYRGAVRAFETANQLAPAPLLLYNIGLCYENLGDNAQALQYFKAYLTQMP
FT                   EAANRSLVEIKIDRLESAPAGQIPPAPNPYDSSAPQPGQPGTAPQPGTAPQPGTAQPGQ
FT                   PGSAPQPGTAPQPGTAQPQAGMPQPGQQGSGQGAVPLASMGTSSASTGDPMLDRVASVD
FT                   VSWVRDQRAPLMRVPAPAEEPAFEPETPLYKQPWFWVVAGVSVIILYNVASTDDSSAVQ
FT                   AGSYDALPSGGAPLLRF"
FT   sig_peptide     503503..503598
FT                   /locus_tag="Hoch_0363"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.955 at
FT                   residue 32"
FT   gene            504445..505929
FT                   /locus_tag="Hoch_0364"
FT   CDS_pept        504445..505929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0364"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: mxa:MXAN_2624 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13005"
FT                   /db_xref="GOA:D0LIX6"
FT                   /db_xref="InterPro:IPR010502"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIX6"
FT                   /inference="similar to AA sequence:KEGG:MXAN_2624"
FT                   /protein_id="ACY13005.1"
FT                   /translation="MRTASITCLLLSAALSACVDTGPPAPQIDPAYVEKNQLSAAPAQM
FT                   TNVVNADFGGKVVYLGNDVEHSTVAPGEEARVVHYWKVLQPPGERWRVFSHLVGSKKAD
FT                   WSNIDRSDMRLGYGPDKWQAGDIIRDEHVFRIPKGWKSPYAEVALGLYPKGGHAITDRM
FT                   PVVTGTADEERRVHVARIEVSGAGAGKAASEPKLFAVRKTGEAITVDGRADEDVWKRAT
FT                   ESPVFTAAEGSPAMKGETRAKLLWDDEFLYAFVEAEDEDVHSQYTENDSDMWREDVVEL
FT                   FIDADGNRRGYIELQVNPHNAQFDAWFATTRGGPSDKAWSANMKSAVAIDGSLAERGDD
FT                   KGWSVEIAIPLVAVRGAAPSMRVNVPPQVGDTWKLNIVRLDKPEDEKNPAVASWNQISY
FT                   QDFHALDRMLGVVFADETGNTTPAPVTEPENPAQDEAANEGQDPAAADKSDDTTGAAGA
FT                   KAEDKAGAADKAKAGAADKANAADKAGAKAGPTPGN"
FT   sig_peptide     504445..504504
FT                   /locus_tag="Hoch_0364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.703 at
FT                   residue 20"
FT   gene            505943..506881
FT                   /locus_tag="Hoch_0365"
FT   CDS_pept        505943..506881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0365"
FT                   /product="Glutamate--tRNA ligase"
FT                   /EC_number="6.1.1.17"
FT                   /note="PFAM: Glutamyl/glutaminyl-tRNA synthetase, class Ic,
FT                   catalytic domain; KEGG: scl:sce0572 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13006"
FT                   /db_xref="GOA:D0LIX7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIX7"
FT                   /inference="protein motif:PRIAM:6.1.1.17"
FT                   /protein_id="ACY13006.1"
FT                   /translation="MRDCSRFAPSTTGQAHPGTLLAALLCWLDARARGARLLLRLEDVD
FT                   HTRSRPELSQAMGASLAWFGLDWDEVHEQSAHRQRHEQALDALAAQGRLYPCRCSRADR
FT                   RRSGRRAPDGGFAYDNACRERPLPAGGWRASGDNLRARLDDEAIALRDESGFDLSQRPA
FT                   HDMGDPVVLRRDGAIAYHLAVVVDDAAAGVTRVVRGRDLAASTATQVALQRLLGVPTPQ
FT                   YRHHMLLLEPHGGKLAKFHGAVGVDALAPHYSAPALCGVLAHAAGLRASPAPCRPADLV
FT                   SDFDWGRVREDDRVMAWRAPALVLDPPLPPA"
FT   gene            506957..507712
FT                   /locus_tag="Hoch_0366"
FT   CDS_pept        506957..507712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13007"
FT                   /db_xref="GOA:D0LIX8"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIX8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13007.1"
FT                   /translation="MKRLSLWWIVFLSAVVLGMLGSWWIFFPPFVEHTFTVESFDLDFV
FT                   QRVEREDAPCCAIRTLSSPARVAERDDWGVSLYIHTDEGRRGMFDGREPGFEGLVSPVT
FT                   RAGWMWERAAGGAREDVSARLLARESCMEEEMFEPRPRSLQCLVRDAASGEYSLYTEEA
FT                   EGAPSMEPVDLETDPATRYVYAASVVGDVDTLAARLNDNTEGGVSVTYLVYRFWPDAEL
FT                   AAAVESGDQLRLEMEFADGSTVTGTLAVP"
FT   sig_peptide     506957..507061
FT                   /locus_tag="Hoch_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.817) with cleavage site probability 0.429 at
FT                   residue 35"
FT   gene            508559..509512
FT                   /locus_tag="Hoch_0367"
FT   CDS_pept        508559..509512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0367"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   bba:Bd2350 ubiquinone/menaquinone biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13008"
FT                   /db_xref="GOA:D0LIX9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIX9"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACY13008.1"
FT                   /translation="MGVVHRWVHTGPRPEADELRALTQKFEALLETDLANVRAGVYPRS
FT                   LLHGMPLGTYLRQVPTLLREQPVMLRRARANRYDELPADAHPESYPAYYSRTFHWQTDG
FT                   WFSHRSARLYDVTVELLFGGTADIMRRMTLPPLVEFVGDHPHARVLELACGTGRFLGFL
FT                   RRTLPEADLFGVDLSPFYIDHARAELSDAPNVELSVQNAESLEFAEGHFDAVTAVFLFH
FT                   ELPADARRRVVAEAFRVLRPGGVLVIGDAIQAREAGKLLRFLEIFPSIYHEPYFKSHLR
FT                   DDFESMVEGCGFEVVSSEAHYLAKVVCARKPASATA"
FT   gene            509802..510899
FT                   /locus_tag="Hoch_0368"
FT   CDS_pept        509802..510899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0368"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   bba:Bd2350 ubiquinone/menaquinone biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13009"
FT                   /db_xref="GOA:D0LIY0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIY0"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACY13009.1"
FT                   /translation="MLESTLDAPFAVLGRLRDALPDLRTLSPIDLARYQTRHHVLAAAL
FT                   GTYMGVFHRRLQPGPRPEPETFRALTQAFQELLEADLANVRAGVYPRSLIHDIPLGSYL
FT                   RLVPELLREQPVVFRRARSKRHDELPAEANPDHYPAYYRRTFHWQSDGWLSHRSARLYD
FT                   ASVELLFGGAADVMRRMTLPPLVASVSHRVHPRVLDLACGTGRFLDAVRRTLPRAHLFG
FT                   VDLSRFYIEHARAHLGGAPHVALSTQNAESLRFADEDFDAITSVFLFHELPGDVRRRVV
FT                   AEAYRVLRPGGHLVVCDAIQASDAGKLRGFLDSFHRLYHEPYFKGYLRDDLEPLLEGGG
FT                   FEVVSSEVHYLVKVVNARKPVGASA"
FT   gene            511003..512715
FT                   /locus_tag="Hoch_0369"
FT   CDS_pept        511003..512715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0369"
FT                   /product="SCP-like extracellular"
FT                   /note="PFAM: SCP-like extracellular; KEGG: ade:Adeh_1604
FT                   allergen V5/TPX-1 related"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13010"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIY1"
FT                   /inference="protein motif:PFAM:PF00188"
FT                   /protein_id="ACY13010.1"
FT                   /translation="MGWRAALTLGALALASGCGSTSPAGDTRPRQLGQAPSWRQSQEVQ
FT                   EYAPEDPNLVPGIAEPITLAPSTPASPDYNARAVVAVPRAPLSDAVIDAVQRTCAQIGC
FT                   SAPTPDGRLFAAVNELAGVVSENGPLAYPLVEFAMHRHGIIEPSPHLVIVWGPLDDPAP
FT                   MIEQLEPRLPELLRADPSSRPYTRIAIGTSLRDGNDGVAIIALQSSHVDTAPIPRALPR
FT                   GGGFAVEGQVRDGYRQPNVYITRESGKVEHVAKGPGPGFATRVSCDGRQGRQQIEITAE
FT                   DAAGSTVLANFPVWCNEAAPTSITVRPSEDDTNPVTSEAEAESRMLELVNRDRAAHNLP
FT                   PLALDPAVGEVARAHSRDMQATGVVAHVSPNTGSASDRVRAAQITTPLVLENVARAYGV
FT                   SEAQAGLMNSPGHRANMLSHQATHIGIGIVFGTEVAGRREMFVTQVFTRVPPRLGAAEA
FT                   ARNLHAKIVERGGVADDAELSRVAQQYADAIVAGEPPKQVSARLSPKLDAFAKRYSRVV
FT                   TSVIAIGDVEMFSAKDAISETGFNHYGLGVGVAPHAEFGDYALYVVLLLATAR"
FT   sig_peptide     511003..511080
FT                   /locus_tag="Hoch_0369"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.815 at
FT                   residue 26"
FT   gene            complement(512729..514963)
FT                   /locus_tag="Hoch_0370"
FT   CDS_pept        complement(512729..514963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0370"
FT                   /product="cysteine-rich repeat protein"
FT                   /note="TIGRFAM: cysteine-rich repeat protein; KEGG:
FT                   scl:sce3387 glucosyltransferase-I precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13011"
FT                   /db_xref="InterPro:IPR011936"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIY2"
FT                   /inference="protein motif:TFAM:TIGR02232"
FT                   /protein_id="ACY13011.1"
FT                   /translation="MECSPDTGRCYVPGVCGNGELEPGEECDDGNTASGDGCRGDCQSL
FT                   ERCGNGQLDLGEQCDCGDSRGNVRDPGCQGQANSSLEGVCRTDCRLHCGDGELHGDELC
FT                   DGELLGTSCVGLGFDRGQISCNESCIPETEACDLIGWRRETIGIENIYALWGTAADNIY
FT                   AVGEETPEDPYFIHHYDGSQWRNIEARFGNDCAPPVWDCVALYGVWGLGPDSIYALGDK
FT                   GLVLHRSPAGVWNQLDIGVRATLRAIWGTAEDNIYLVGHAGDDGPTLLHYDGARWRSLA
FT                   AELPALPAPVHLDGIAGHGADDIYAVGVVGSSDEGVVLHYDGSAWRTVAAADASYLAHV
FT                   HAAADGHTLAVGLHGYIAERQPDGSFREVSERLSDGLIGAWSSDARQAFAVGRSGDILF
FT                   SDGTAWEPVHSGVSVRLETVWGIAREVLVAAGWNGTLLHYRHQSWLPTPRPSDTDLRDL
FT                   WASDLHIVYAVGNDVFRYRDGAWTAMGADLGVKLHSILGRSSGELMVGGRDGVIGYYRD
FT                   GTWTTVAGGTGAGGRIHALWESASGHVFAVGFPQDSSLGYVMQCQGNACAAAAGWKGRV
FT                   LTDASALYDVWGSSERDVYAVGENGTVLHYDGDGWTRIETGTEEHLFGVWGADDGTLYA
FT                   VGDRATILRREGGQWTEMALPYAAARFSWMPEVQLRSVWGSGPEDVYVAGNRDGLLLHY
FT                   DGAGWAPVRTDTDQPLLRLWGRSQSRAGEHDVDVFIAGESGTVLRLIKRL"
FT   gene            complement(515160..516233)
FT                   /locus_tag="Hoch_0371"
FT   CDS_pept        complement(515160..516233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce3389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13012"
FT                   /db_xref="GOA:D0LIY3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIY3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13012.1"
FT                   /translation="MVRRTIDWQRILSLCAVWLCVSAQARADGNVTQPETQGDAQLETQ
FT                   GDAHAHADAHAGARAMDADADADADAQARTLFEQAAELHERWRLEEAIALYREALHHRQ
FT                   HPQIYLNLARALEKYGDLLAAHRNVQRALEANPRDALSDEQGAIAAQLESQLEARLARI
FT                   EVLCDEPGAEVFVDGKPWPLGAGAHASMVLVGEHVIIAKKPGFFTVTRSQPVMAGQSMR
FT                   VTVHLERDPGHLYQRRWHRALPLTTLATGSAFALAGGWFLRDARNQYRNAADTFDHGCT
FT                   LSCGSQVGAEVRDAVTTQRWGAAALAIGSTVALTGLVMLVLNQPQPYQPSDFGGAELRI
FT                   LPMRGSRTAGVSASWRF"
FT   sig_peptide     complement(516150..516233)
FT                   /locus_tag="Hoch_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.916 at
FT                   residue 28"
FT   gene            complement(516256..519354)
FT                   /locus_tag="Hoch_0372"
FT   CDS_pept        complement(516256..519354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0372"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; aminoglycoside phosphotransferase;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; KEGG: scl:sce3386 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13013"
FT                   /db_xref="GOA:D0LIY4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIY4"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY13013.1"
FT                   /translation="MNSTPQSLSSSQRAARARPAKRARAQHGDADLAATPDGSGRHVQK
FT                   PPAQWEAIPTWQMTEQGQHGEQKPSQPSTRVGQYEIIRPLGRGGMGEVFLARDLRLGRL
FT                   VAVKRLRARSTRLVERLLREARTTARCTHENIVVIHEVGEQNGEPYMVLEYLEGQTLRD
FT                   WLHERASAAGGRAPVPARRAVELMLPVVRALAYAHERGIVHRDLKPENVMLTRAGTVKV
FT                   LDFGIAKLLHGAPPGGVPVREASAGAGTGTGTGAGRERTEVAPGAAVSAGVHSSTLTGT
FT                   WPYMSPEQMNVGVIDHRSDLWTVGIMLFELVVGHHPLSIDSVKGLLSIADVDQPMPSAR
FT                   ELLADRTSEIGPLGDIIDRCLLKRPEHRTASAEALLAELASVLPRRPMPARGEDENPFV
FT                   GLSAFQESDADRFYGRQRDVAALVAKLRSEALITVAGYSGTGKSSFVRAGVIPALKRSG
FT                   EGWSACIIRPGRQPLSALADVLARVSPGVSSVDDGHASGEHGIQLDAPEAIQERLRRLP
FT                   GSLGAELRTWARRTRRRLVLFVDQFEELYTLGTADEDVAAFVACLDGIADDASSPLRVI
FT                   LSVRSDFLDRLAAHRRFVLGATQSLWLLPPLGREELREALVRPIEALGYRYEHAEMVDE
FT                   LLDAVAPTPGALPLLAFSASTLWSLRDRERRLLTRASYAAMGGIAGTFANHADTVLAAM
FT                   SARQVARARTILERLVTAERTRAIASMSELRELPGGADEIEGIVQHLAEGRLVVVEGGD
FT                   DDERVVELVHESLIQSWPTLARWLDENLDDAAFLSRLRTAASEWEKRRCDEGLVWRGAP
FT                   AREALAWAARYHGELSRRERAYLDAVDNVATQFTRKRRQRVAIVIATLSFLLVAATVAL
FT                   IRIQRAEHLATEQAELAQQNAATVRAHLGELSHKEQELRRALSSEQSARAMAENSRRDA
FT                   ERAQTRAEREAGRARAALAESQAARHHAVRAANEARAAERRAREAERAARDAEARAKQE
FT                   QQSAAEAAQQERRARQAMERLIQRVHNGAIEKKLPGSDTARED"
FT   gene            complement(519661..520026)
FT                   /locus_tag="Hoch_0373"
FT   CDS_pept        complement(519661..520026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13014"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIY5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13014.1"
FT                   /translation="MADPKISLQMRTDAQTTEGEMAVKAGTSLEVEVDEWGAAAVEVDY
FT                   SSEDKIKITVDGKLSLKRIGADSLKMEGGVERDLFAEQTTMNGKLELVIDKRISASVDI
FT                   KQAPTTTSVRGLLTVRF"
FT   gene            complement(520057..521292)
FT                   /locus_tag="Hoch_0374"
FT   CDS_pept        complement(520057..521292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0374"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   mxa:MXAN_1261 aminotransferase, classes I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13015"
FT                   /db_xref="GOA:D0LIY6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIY6"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACY13015.1"
FT                   /translation="MFSSRTPADLAPNALAELLAQSSPEAPNAAADAAPDATTDAAPDA
FT                   TPAASPDAAGFIDLTVSNPTAVALPGLAQVRERVAQALAEGARAPYRPDPRGLLSAREA
FT                   VCAYLAARGHDIDPGHIVLTASTSESYSYLFKLLCDPGDEVAIPSPSYPLFAHLAELEG
FT                   VAVRAYPAGGVPAPSARTRAIITVSPNNPTGGFLERPQRDALEDLAAGPRPLAIIGDEV
FT                   FADYIHDPADAARYASVLGCERALSFGLGGLSKAAGLPQLKLGWIALRGPDALRDEALT
FT                   RLEHIADTYLSVATPVQAALPALLRLGAEIRAAIAARVRENLAHLHASRVRARRLRVLP
FT                   SPAGWYALLRLPLGRDDEATATELMRAARVHVYPGYYFDLPSDIDDAYLVLSLLPAPAL
FT                   FAAGVERLAAHL"
FT   gene            complement(521302..521523)
FT                   /locus_tag="Hoch_0375"
FT   CDS_pept        complement(521302..521523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_3286 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13016"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIY7"
FT                   /inference="similar to AA sequence:KEGG:MXAN_3286"
FT                   /protein_id="ACY13016.1"
FT                   /translation="MSKFRGTVKKNDLEGGIWELHAEDGERYQLRGGNDALRTEGEVVE
FT                   VEGTIDKQAFGIGMTGPYLDVSSWKKKD"
FT   gene            complement(521581..523773)
FT                   /locus_tag="Hoch_0376"
FT   CDS_pept        complement(521581..523773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0376"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; TPR repeat-
FT                   containing protein; Tetratricopeptide TPR_4; SMART:
FT                   Tetratricopeptide repeat; KEGG: afw:Anae109_1953 lytic
FT                   transglycosylase catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13017"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIY8"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ACY13017.1"
FT                   /translation="MLARALLALLLASSARAAWAESGAPSPGSAAAGTPAARLGEAWRA
FT                   FETQSFARAYELAAGIERQALIHDDYVRYVLAQSSFFLGRPDEALGHFRALAGAAGSRF
FT                   RELARWRVADCLWALGRTRPASSAYAKLVAAAAKQRSPDGDIGLARYRIAAALVAQKRK
FT                   QPAMRALREFLREHPEHPMAEQATADLRALGGAAAVSLSPRDRLARAQTLTAERRLHQS
FT                   YAELAAIGDEVDAELRRERDYWQAMTLFKMRRRYEDAGRTLLSLYKQLGGRAAMAMFHG
FT                   ARALSRADRDREAIDWYQRVAAEYPRTIWAAEAQFLAGWLAFNLGDYDAAIPLLERTLD
FT                   RYGDTKWQKPAHWFLGFSHFLSGNPERALPHFERLARQRDKLEGGQGRYWHARALQELG
FT                   RVDEANRSYRELVAEHPFSWYALLSRARLGAHGDPAVQVDPFGRPLGQRDDDSRAAARV
FT                   PALDTQPSAAFERDALIRAGDELLAAGLPIEAGVELRRGEYAYLKRHRGDKAAAMAVLL
FT                   ERYRRARNFNRPWMLAVVHGGWRALNSPPVGRARTWWEHAYPRAYRDLVERWHESGGAP
FT                   ANYLYAIMRKESGFDPHLVSYADARGLMQMIPPTTRKVAAALELDYTEDMLYDPALNVR
FT                   VGAWYIGRLFRKFKQQVPIAAGSYNAGPRAAMRWLRRNGQRPMDEYVELISYKQTRGYM
FT                   KKVPETYARYLYLYEGVVYEQPLVVDAEYIDNDLTY"
FT   sig_peptide     complement(523711..523773)
FT                   /locus_tag="Hoch_0376"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.973 at
FT                   residue 21"
FT   gene            523958..524560
FT                   /locus_tag="Hoch_0377"
FT   CDS_pept        523958..524560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0377"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="PFAM: imidazoleglycerol-phosphate dehydratase; KEGG:
FT                   glo:Glov_0825 imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13018"
FT                   /db_xref="GOA:D0LIY9"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIY9"
FT                   /inference="protein motif:PRIAM:4.2.1.19"
FT                   /protein_id="ACY13018.1"
FT                   /translation="MSKRNSRIERNTSETQILVELGIDGTGTRSIDTQVPFLSHMLEAF
FT                   ARHGLFDLALTAHGDIEIDAHHTVEDVGLSLGMAFREALGDRSGITRYGSAILPMDETL
FT                   VTCAVDFCGRPAFVWKVEGLERRWVGGFDCELAREFFAAFATRAECNLHVLLHYGGNAH
FT                   HIIEAIFKAFARACDAASRVDPRLAGQVPSTKGTLSA"
FT   gene            524557..525192
FT                   /locus_tag="Hoch_0378"
FT   CDS_pept        524557..525192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0378"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: glo:Glov_1020 imidazole
FT                   glycerol phosphate synthase subunit HisH"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13019"
FT                   /db_xref="GOA:D0LIZ0"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIZ0"
FT                   /inference="protein motif:TFAM:TIGR01855"
FT                   /protein_id="ACY13019.1"
FT                   /translation="MSAVTVVDTGSGNLRSVTKALAHVGGQPILSADPDVIRRAERLVV
FT                   PGQGAFGAFVAAMHERGLEDALREVIAAGRPFLGICLGLQVLFDDSEEQGPVPGLGVLP
FT                   GRVVRFRPRSHAYKVPHMGWNQVTRPPERADAAADPVLAGIDDGTYFYFVHSYHVAPAD
FT                   ESSVVLWCEYETRFAAAVRKDNLFACQFHPEKSHAPGLRLLRNFVTAP"
FT   gene            525189..525908
FT                   /locus_tag="Hoch_0379"
FT   CDS_pept        525189..525908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0379"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="KEGG: gme:Gmet_0388 1-(5-phosphoribosyl)-5-[(5-
FT                   phosphoribosylamino)methylideneamino] imidazole-4-
FT                   carboxamide isomerase; TIGRFAM:
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase; PFAM: histidine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13020"
FT                   /db_xref="GOA:D0LIZ1"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIZ1"
FT                   /inference="protein motif:TFAM:TIGR00007"
FT                   /protein_id="ACY13020.1"
FT                   /translation="MKIYPAIDLLGGNVVRLHQGKRSEALVYSNEPAEIVRRFASAGAE
FT                   RVHVVDLDGAFSGERAHREALAEMAAASPVPLQVGGGIRDRAALEAVFATGAGFAVLGT
FT                   AAVKNPAFAREACAAHPGCVIVAVDARDGVVAIEGWVESAGITAEELGKRAADWGAAGL
FT                   LYTDVMRDGAQVGPNIATTAALAQAVDIPVIASGGVGTLDDIRALAAAGVPSVVVGRAL
FT                   YENKFTLPEALAAARGE"
FT   gene            525905..526075
FT                   /locus_tag="Hoch_0380"
FT   CDS_pept        525905..526075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13021"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIZ2"
FT                   /inference="similar to AA sequence:KEGG:MXAN_5177"
FT                   /protein_id="ACY13021.1"
FT                   /translation="MSAPFPGSLCHRCRFLRLSGNKRGSVFLQCTEPSLPKYVPQPVRA
FT                   CGHFVAATPGK"
FT   gene            complement(526101..528167)
FT                   /locus_tag="Hoch_0381"
FT   CDS_pept        complement(526101..528167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0381"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: scl:sce7600
FT                   ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13022"
FT                   /db_xref="GOA:D0LIZ3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIZ3"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACY13022.1"
FT                   /translation="MQNMDLAKLNTPQREAVLHGSGPVLVLAGAGSGKTRVITYRIVRL
FT                   LRSGIPPQAIAALTFTNRAAEEMRERVAALLGDRKTASMLTMGTFHSLGLRILRSEHEA
FT                   MGYPRGFVIYDTSDQLGVVRELLRGIDAGRRFDVRAILTRISLAKNAFVFPEEYVPNGD
FT                   DEYDEITAEVYPRYQEALRAYAAVDFDDLLTATVRMFDQRDDVRARWQEKFRFVMVDEY
FT                   QDTNRAQLKFVKTLVAEHENLCVVGDDDQSIYSWRGADPTNILHFDRMFPGARVIKLEQ
FT                   NYRSTPTILRAANAVIANNVNRHGKNLWSDIADGAKIVHASATDTESEARFVAREIGDI
FT                   VGTDNLRYRDVAVLYRSNIQSRLIEESLRSASIPYVMYGGQQFYERKEVKDLIAYLRLA
FT                   LNQRDEIALRRVINYPARGIGATTLKRVEDHARASRTSMWRILEGASQMAESDKMRPST
FT                   VQAIENFVAIIERTRASLDGGARIIDVTRRLIDEIQLYDDLRNASPSAAAAQRRIDNVE
FT                   SLLRSLERHQEKRPGLGALAEYLRRLSLAVESEAGEDPGNKVVLTTLHGAKGLEFPIVF
FT                   MIGLEEEILPHARTLKPQATDVMDLDHVTDVSEERRLAYVGITRAQRKLYLTRTQVRVS
FT                   RGKNLPRTPSRFLQEIPAELLEERDIQAEERAPVSMGEARSLFQDLSAMLDLD"
FT   gene            complement(528371..529807)
FT                   /locus_tag="Hoch_0382"
FT   CDS_pept        complement(528371..529807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0382"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; FAD dependent oxidoreductase; KEGG:
FT                   gsu:GSU0493 pyridine nucleotide-disulphide oxidoreductase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13023"
FT                   /db_xref="GOA:D0LIZ4"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIZ4"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACY13023.1"
FT                   /translation="MATREHTSEYSGARPRVVIIGGGFGGLYAARTLAGSDVEVLVIDR
FT                   ENFHTFTPLLYQVATSALDPSEIAYPLRTIFRKEKNIRCLRGEVCELRPGAKRVVVEVE
FT                   GQRQEEPYDYLILAAGSVTNFFGNDNIAARSFDLKALGDAVRLRNHILKLFERATWTPD
FT                   PEARLALTTMVVVGGGPTGLETAGALYELYNNVLAKEFPGQDLEVRVLLVEAGEELLDP
FT                   YPPSLRQAALEQVRSLGVDVVFKNPVVDVTPEHVELKDGTRIATCTLVWAAGVSASPLG
FT                   DQLGVDLAWQKRVPVEPSLQIKGEPDIYCVGDMAYLEDEAGKPYPGVIQVARQQSIRAA
FT                   ENILNRLSQVEQEPFQYRDLGTMATIGRRRAVAWLFNKIRLRGILAWLAWVVLHLVMLM
FT                   GFRNRLNVFVNWMWNYLTYDRSVRIILEPQQGAPSARPDVPRELGKPAPFGPETMADVP
FT                   VGISDASEIQERADADAASA"
FT   gene            complement(530101..531837)
FT                   /locus_tag="Hoch_0383"
FT   CDS_pept        complement(530101..531837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0383"
FT                   /product="PA14 domain protein"
FT                   /note="PFAM: PA14 domain protein; SMART: PA14 domain
FT                   protein; KEGG: scl:sce2414 no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13024"
FT                   /db_xref="InterPro:IPR011658"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIZ5"
FT                   /inference="protein motif:PFAM:PF07691"
FT                   /protein_id="ACY13024.1"
FT                   /translation="MSRTPIRVLMSCALMTLLTACYVQSAPSGQPATYPSEPPPEYADN
FT                   QPPSQPQQPPASIDCSEQPNRMCCEGQTAECMQCRSQAQDERAQWQAACQPSGQPQPPN
FT                   SGPLIPDDPSYPRDDQARNRTPPAPPPLEKPPARRRTPQRRPPSNNNPGNTTPPAPPPL
FT                   EKPPARTPTMPSQRPDQYVPSRRSRLGNAAKFSIEPTAGPVGTVVTIYGDFRAVNNTRQ
FT                   INVSFQGVRRAEQPIYTAGDRVAVEVPNGAKSGNVIVRVKGKRSWAGRFSVTASDDGIF
FT                   VPTPVDSGLLGAVYQLPENTKNLPDFDSLGDPYATITLPNLSVAARRFENGFPGISDSG
FT                   DDLLEWFGIRFVGMITVPSSGNYQFRINSDDGARLYIDGKRVLDNDGQHAPRARDGSVS
FT                   LSAGVHDIVVEYFQGPRYQIALELFWNQGGSWEIVPASAFSRYVGGYDCDDQPQIYCCA
FT                   GNSASCRQCRDNAAQQRAAWNRFCSGNGGQPPSAPNPGTPVDCDQVPNRVCCQAQTAGC
FT                   QQCRTQAAAERSQWVQACQSTVNCSRRPRPRPCCKALTAQCRTCQRESAAEQDRWNALC
FT                   GK"
FT   sig_peptide     complement(531760..531837)
FT                   /locus_tag="Hoch_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 26"
FT   gene            complement(531991..532551)
FT                   /locus_tag="Hoch_0384"
FT   CDS_pept        complement(531991..532551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   lpn:lpg1536 transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13025"
FT                   /db_xref="GOA:D0LIZ6"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIZ6"
FT                   /inference="protein motif:PFAM:PF03653"
FT                   /protein_id="ACY13025.1"
FT                   /translation="MDYAVTKALHIIGFVSWFAALFYIPRLFIYDVEAEQREPAARVAI
FT                   QEQLRMMQRRLWYAIAWPAMIFTVVFGLWTAVPYFLSDVPIGWLHVKLTLILALVIYHL
FT                   MCGKIRKQLAAGTSRWTSSGLRVWNEVATLLLVAIVFLAVMKNTFDMVKGMVGLFLFAV
FT                   ALMIAIRVYRKARLARAASMQTP"
FT   gene            complement(532614..533624)
FT                   /locus_tag="Hoch_0385"
FT   CDS_pept        complement(532614..533624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0385"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="KEGG: bcj:BCAL2989 adenosine deaminase; TIGRFAM:
FT                   adenosine deaminase; PFAM: adenosine/AMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13026"
FT                   /db_xref="GOA:D0LIZ7"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIZ7"
FT                   /inference="protein motif:TFAM:TIGR01430"
FT                   /protein_id="ACY13026.1"
FT                   /translation="MTATGDWYERIPKVELHVHIEGSIPLPALWQIMGKYGGHEEVGSM
FT                   DALVERFRFRDFPHFIATWLWKDGYLRELEDFTLLAEAVARELRAQNIRYAEAFYSPGG
FT                   YARHGLAVGDITCALRDGLDRVDGIEVALIADLIRDNGPEEGARTLDAVAEVRERGVIG
FT                   IGIGGSEQSFPPAPYAAVYERARALGLRTSAHAGEAAGPASIWDALRALRVDRIGHGTR
FT                   ASEDPALVDYLADSRTAIEMCPISNLRTGVVPDLAAHPIRSFFERGLLVTVNTDDPAMF
FT                   HTSLAHEYRELARVHGFTRDELRALIDNAVAASWLDDAGKAALRSTLRADPAWSE"
FT   gene            complement(533657..534508)
FT                   /locus_tag="Hoch_0386"
FT   CDS_pept        complement(533657..534508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0386"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bgl:bglu_1g22610 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13027"
FT                   /db_xref="GOA:D0LIZ8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIZ8"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACY13027.1"
FT                   /translation="MDPDSFLRSFHAAHPGVTTRAFARGRGDDGRSSYDLLAERCAAAD
FT                   HADHAGHDATGDIVDIGCGDGYLLARVLARGVAPERLVGVDLSAEELAAARARLAPAPV
FT                   RLRCESARATGLASGSAACVLSHLGFTLMSDLEAVVAEIARILRPGGRFATVVGGGPRG
FT                   EDAFALLLDLARDAIRAQPARVPRLGDPRARRDDGLRALFGPHSGFAAELEIADFPLRL
FT                   DGSIAAVWDHLATIYELFYLPESARQALRERFVAAAQPLVRPDGSVPCTAAMRLFACRR
FT                   LR"
FT   gene            534762..535400
FT                   /locus_tag="Hoch_0387"
FT   CDS_pept        534762..535400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0387"
FT                   /product="Peroxidase"
FT                   /EC_number="1.11.1.7"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Peroxiredoxin-like; Redoxin
FT                   domain protein; KEGG: bph:Bphy_2439 peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13028"
FT                   /db_xref="GOA:D0LIZ9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0LIZ9"
FT                   /inference="protein motif:PRIAM:1.11.1.7"
FT                   /protein_id="ACY13028.1"
FT                   /translation="MSLRIGSTAPDFTQESTAGTISFHEWLGDSWGVLFSHPKDFTPVC
FT                   TTELGRASSLVEDFAKRNCKLLALSVDSVEDHNKWIGDIEETQQVKQSFPILGDTDRKV
FT                   SQLYDMIHPEANDTLTVRSVFFVDPKKKIRAIITYPASTGRNFQEILRVIDSLQLTDHH
FT                   QVATPADWKDGDDVVIVPSITDPKEIADKFPKGHKELKPYLRMTPQPNK"
FT   gene            535467..536147
FT                   /locus_tag="Hoch_0388"
FT   CDS_pept        535467..536147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0388"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: ara:Arad_7883 polysaccharide
FT                   deacetylase/methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13029"
FT                   /db_xref="GOA:D0LJ00"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ00"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACY13029.1"
FT                   /translation="MRRFRTTDQLVRVRDVFDEWAESGRADGMERGHGPTAKQAFDALG
FT                   VSPNYRFLDIGCGNGYVVRWAAQTAPSVDAVGIDVSAHMVALARQLTTGQPNARYRRGS
FT                   FPQIDLSRAQFDAIFSMEVFYYLSDLDAGLQAVRDLLAPGGSFACVVDFYRENADSHSW
FT                   PEDLGVDMHLLSAAEWCQAFERAGLEVADQRRLYAPKLPGMPASWKHTTGSLFTLGRRP
FT                   SASR"
FT   gene            complement(536211..536543)
FT                   /locus_tag="Hoch_0389"
FT   CDS_pept        complement(536211..536543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0389"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG:
FT                   bmj:BMULJ_03747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13030"
FT                   /db_xref="GOA:D0LJ01"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ01"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ACY13030.1"
FT                   /translation="MLAFPRASRYHKVMAKVERNAPCPCGSGKKYKHCHLDKPPDVKSP
FT                   RLFIPLLFCIGAIAAGIAIGIQRGPGLGVAVAVGAMLLLGVFLISRNPPPPRDKNDHPG
FT                   AINFGR"
FT   gene            complement(536749..537942)
FT                   /locus_tag="Hoch_0390"
FT   CDS_pept        complement(536749..537942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0390"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="KEGG: hha:Hhal_0725 argininosuccinate synthase;
FT                   TIGRFAM: argininosuccinate synthase; PFAM:
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13031"
FT                   /db_xref="GOA:D0LJ02"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ02"
FT                   /inference="protein motif:TFAM:TIGR00032"
FT                   /protein_id="ACY13031.1"
FT                   /translation="MSNVRKVVLAYSGGLDTSVAVRWIAETYGCEVICYCADVGQGEDL
FT                   EGARQKALSLGASKAIVHDLRETFVRDYVFPALRAGAIYESEYLLGTSLARPCITHGLM
FT                   EAVREEGADAIGHGATGKGNDQVRFELAAYQIMPSVKIIAPWREWEYQGRRQLIDYAAE
FT                   RNIQIEATVEKPYSMDRNLLHISYEGGVLEDPWRAPDPEMFQWTRDPRQAPDDPRQVEI
FT                   GFEEGVPVSVDGEALGPIALLEKLNAIAGEHGVGRVDIVENRFVGMKSRGIYETPGGTL
FT                   LHAARRAIESLTLDREALHLRDDLMPRYARLVYNGFWFAPEREAIQALVDNVARHVTGV
FT                   ARLELYKGSLHVVGRKAEKSLYRPDIATFEEDSVYDQKDAAGFIRLQALRLRVGAER"
FT   gene            complement(538003..539964)
FT                   /locus_tag="Hoch_0391"
FT   CDS_pept        complement(538003..539964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0391"
FT                   /product="Tetratricopeptide repeat protein"
FT                   /note="SMART: Tetratricopeptide repeat; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13032"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ03"
FT                   /inference="protein motif:SMART:SM00028"
FT                   /protein_id="ACY13032.1"
FT                   /translation="MAGSDKLRERAQALIEDGLERYQAGESNKAITAWRHALALDPRAE
FT                   DARDYIKRAQQGLPIAGSDTSADPDASAGGVAATGEPASAAANALAATSAWADKSYPLD
FT                   IIDDRSEPAEQPAEKTLSDADSEDFALEDTSEGPPIDDDDFELEPEFEFEQAMPTPAPQ
FT                   PATPAPQPATPAPRPASPADAAPKPPIQQRSVPRPGAVRGVPAIVPSIIPPIPAAPSPQ
FT                   AQRGVPAASGDRPAPGATPAPLSSPSATKRTQLGVAAPSGGQPPTDVAATQALETAELA
FT                   DPAAEAPDDTAELAANADEESDTARQPSPALDVTQPISAADLGIPDDTPEELPVEDTEP
FT                   TERQDLREHTQSVSMAPTVELARAATKSLGQPAANSHHEHAFGKTLELGDIEAGREDAS
FT                   QFDVGETYQIDVTGLDESALPPVVIEDVDEPSEEEMLREEAEAEARAPTEQLYGIGRSV
FT                   PLPTREQPGVSKSVSRVSIELPDDAEELVLEAVTDDGAEPGEELSAEQMLLAALEEELP
FT                   RRPGDDERENKRVRWLIEQAHAEYVGGDYKTAVKTANLALDEAPDSAAGQAELHHHQDT
FT                   LVEIYAAFEGDPQAIPSVAIAPSEYGNHDLDSRAVFLLSRIDGMLTIDDLLIVSGMPPL
FT                   ETHRYLCHLLFEGILTLR"
FT   gene            complement(540015..541847)
FT                   /locus_tag="Hoch_0392"
FT   CDS_pept        complement(540015..541847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0392"
FT                   /product="Heat shock protein 70"
FT                   /note="PFAM: Heat shock protein 70; KEGG: scl:sce2420 Hsp70
FT                   heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13033"
FT                   /db_xref="GOA:D0LJ04"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ04"
FT                   /inference="protein motif:PFAM:PF00012"
FT                   /protein_id="ACY13033.1"
FT                   /translation="MAREKVIGIDLGTTNSCVGIVEDGTPVVVPNRGGYKTTPSMVAIA
FT                   ENGKRLVGHIAKRQAITNAENTVFAAKRLIGRKWGAAAVRSSVDTMPYRIVEGPHNDVR
FT                   VVLRGQVLAVPEISAYVLQEMRNIAEEYLGEEITKAVVTVPAYFNDGQRQATKDAGRIA
FT                   GLDVIRIINEPTAAALAYGFGRDIERKVAVYDLGGGTFDISVLDIGNGVFDVISTAGDT
FT                   FLGGEDFDRRILDWLIQDFQRAHRVDLRKDKMALQRLKDVAEKAKCELSSVRETEINLP
FT                   FIISTGRNEALHLQAALSREKLEELTGDLVERTLEICKRTLDDAGVKRGEVEDVILVGG
FT                   MTRMPMVQQAVARFFGIEPSKNVHPDEVVAIGAAIQGAALVDDDSDILLLDVTPHSLGI
FT                   MVKGGYFHKLIEQNTTVPTSQSHNFTTVKDNQTSVKILVLQGESERGEENELLGEFVLT
FT                   GLRRAPRGEVEIEIDFHISADGIVSVTARDLETGIEQSITVTATSGLTEGEIQNLVDSN
FT                   KDYMVQERTDLEFEKHHHTAERLLDEIEELFPEVTTIISGSDFGQDAVKKARGVCERAR
FT                   KAIAARDGAQLRETNEALNRTLNMFKGVVSKTRS"
FT   gene            complement(541996..543150)
FT                   /locus_tag="Hoch_0393"
FT   CDS_pept        complement(541996..543150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0393"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; SMART:
FT                   heat shock protein DnaJ domain protein; KEGG: scl:sce2419
FT                   putative DnaJ class molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13034"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ05"
FT                   /inference="protein motif:PFAM:PF00226"
FT                   /protein_id="ACY13034.1"
FT                   /translation="MSTNDEIPGLGGLDERLRQNPKVALERMPLSSEDIFLWSRADGHT
FT                   SLREILLMSGLPRDKAVGILQRLRDFGALLRPGESPEDVAAAARQRMRPELRGEIVVAK
FT                   SQAPARSAPTPAAAPAPAAAPAPAATASANAAATIDSSALGTLSEDEREALAEDVEISD
FT                   KRRVRIVEMRRKLDGDDYFALLGVAEDADARTIRRAYFALSKEFHPDRYYGRHTGRFGP
FT                   WLSAIFAQIKSAYEVLSNDSKRADYQRRRSGGGGRSQSKAEYASDLYDRACANQAKAPQ
FT                   QALTLFSAAIRLDPQVRYLSRGAHCALDAGDSKQALLWAQLAAHQEPENPSMLRLLADA
FT                   QEAGGDLVAAAATLALALGLKTENDALSMAMREALERVRARLDD"
FT   gene            complement(543159..544097)
FT                   /locus_tag="Hoch_0394"
FT   CDS_pept        complement(543159..544097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0394"
FT                   /product="ornithine carbamoyltransferase"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; KEGG: gur:Gura_0227 ornithine
FT                   carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13035"
FT                   /db_xref="GOA:D0LJ06"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ06"
FT                   /inference="protein motif:TFAM:TIGR00658"
FT                   /protein_id="ACY13035.1"
FT                   /translation="MSAKTDFLNLSDLGGKRLRELVDRALVLADLRSRREMVSTLRGRV
FT                   LGMIFEKASTRTRVSFEVATYELGGHAVDLLPNASQMARGEPIRDTARVLGGYCHGLVL
FT                   RTHAHSRALELAKWAPVPVINGLTDLHHPCQVGADLCAVKERRGSIDGLRYAWIGDGNN
FT                   MAHSWIEAAGLLGLDLILACPANFAPDREIVAQAEERIAKLGRGGIAITTQPREAAAKA
FT                   DVLSTDVWISMGDEADSEARRTAFAGYCIDGGLLGEAAQDAMVLHCLPAHRGEEISEEV
FT                   LEGPQSAVWRQAEMRLHFQKALLEALVGVPS"
FT   gene            complement(544094..545335)
FT                   /locus_tag="Hoch_0395"
FT   CDS_pept        complement(544094..545335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0395"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /note="KEGG: dal:Dalk_0407 acetylornithine and
FT                   succinylornithine aminotransferase; TIGRFAM:
FT                   acetylornithine and succinylornithine aminotransferase;
FT                   PFAM: aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13036"
FT                   /db_xref="GOA:D0LJ07"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ07"
FT                   /inference="protein motif:TFAM:TIGR00707"
FT                   /protein_id="ACY13036.1"
FT                   /translation="MNENQQETLIALADRVLLKNYRQQPIVMSHGAGVELWDAAGNRYL
FT                   DMTAGISVCSLGHAHPALTRAVAEQAGKLVHTSNLYFIEQQIRAAEAITERCFAERVFF
FT                   ANSGAEANEAALKLARRYQHVVAEQPERDLVCSTTGSFHGRSFATVSITGQDKYREGFG
FT                   PMFGPVEFVPFGDVEAAARVLETRKACAFIVEPVQAEGGIIEPPPGYLASLRKLCDDTG
FT                   TLLIFDEVQTGIGRTGTWFAHQAENVVPDVMTLAKALAGGVPIGAMVATERAAQGLTFV
FT                   PGGAVPHASTFGGNPLACAAALAVIHTIDSEGLLERAQRVGAYLGDKLTALVERFPDLC
FT                   EESRGRGLLRGLALSQPASELVGQCRARGLLLSVAGGTVIRFAPALIVEESHIDEAIAT
FT                   LTEVLAAAAQGGAK"
FT   gene            545642..546253
FT                   /locus_tag="Hoch_0396"
FT   CDS_pept        545642..546253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13037"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ08"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13037.1"
FT                   /translation="MSCSIRPIAKFVSVLSLALALCILAAPASAQAGSADKTPRGFHIG
FT                   FLGGALFPLRAMSDTHQQGLAGGLRMSYTGNSGFGLEMAAEYSPLLRQDEPAGGGSYET
FT                   QFATLALMPRFTLGSGRLRWWLGAGGGVAFEYERELDSAGAAVGDPEMAYAPAGMGATG
FT                   LELHIVNGVALAALGSYTRTLGDFEYEFVTVTGGLLLTFR"
FT   sig_peptide     545642..545740
FT                   /locus_tag="Hoch_0396"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.803 at
FT                   residue 33"
FT   gene            546354..546527
FT                   /locus_tag="Hoch_0397"
FT   CDS_pept        546354..546527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13038"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ09"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13038.1"
FT                   /translation="MPAFCLHEEPLPAEFRYGDPPSDEHPDGDYSEWGCSWHNPTGYTP
FT                   RALANAVCLPAQ"
FT   gene            complement(546538..547182)
FT                   /locus_tag="Hoch_0398"
FT   CDS_pept        complement(546538..547182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13039"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ10"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13039.1"
FT                   /translation="MTRDNRILDLSWDFDRINARNTKDAWLKKFPGWEEVTGLIGTRPL
FT                   DVPNPILFEADFSVTPDLDFPFTDHAWPIMSRRMLDVLLSVGEFPHRCYPVRFVNNMAF
FT                   ADKRYLPDGSLRPEVVDDRFAAVQLTEYVDAVDWNASEYEREDIGIIEWITFAKLVLRE
FT                   PPGGFPPLFRIREKASMLLVSAEARRALEAAGIRGIAFDPLPGTSGPPQRD"
FT   gene            complement(547179..549671)
FT                   /locus_tag="Hoch_0399"
FT   CDS_pept        complement(547179..549671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0399"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SNF2 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13040"
FT                   /db_xref="InterPro:IPR032871"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ11"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13040.1"
FT                   /translation="MGPEESQGAAPQRPTPPAVPRPTSGSADTSQTDWSTLDQQSKRDL
FT                   LHRAFCGTEPPDAATPSAAAPGQETTRAGSSVQRTPSRPTPVQTAPSPPLPQAAAPRHP
FT                   PAAPVQRKPAQAQETPLARALRTRAADDIKALDDFDSLSDAERLVFIRALLAQGWVGPR
FT                   DERALERIWASFDERILAVAGAHIGLWRQSCARGAQLDELPAVRGMQARFRRDVRARAR
FT                   DVLTRNEAYVRAEMEALGTTERGAVAPTDSVIPADEQADYLASVRERAEDLALARHARD
FT                   KLASVPVGYERFVSKGGSLWLIVRFQPDARPSFAHDSEAVPEARRAEDARSWGEVKAHH
FT                   ERLQAVIAQLASTSPVLYQAAAQEDDEALATMAAAPPAEARGTMAERLADLLSDIRATR
FT                   AKLGGDLDDRDLAPLHEQLFAGAASASGTDWSAPGNRWAAERLLADHESMEFWTQLGLS
FT                   TVAAAAFVVAELASFGSATFFLAAGAGLAAGGTLAAGSWEHAEDLGTAANASTGEGGVV
FT                   SRAQADRAQTTAIVNSALLFLDLIPAARAARGVATASRGARAGAREGAEQAAERAGREG
FT                   AEQAGERAGREGAEQAGGESAEQAAQASRRLQPNEAANWASVARDYVGKPLDEVGPPPG
FT                   YAAYHVGGRSILRRNNADDALFARLSLDEDGIIRAGAPPRVRVSSSLRKAESVGELLTR
FT                   AGHTARPPHHQAHHVIPDEVVRTHPLFRLARERGVFDHDAPENIALLARSEVREPGRAP
FT                   FVPEKIPGLSEGLPRHQGPHGDYTRMIRRLVDEAGESLHARGLRLDAVSDEVLERLIDK
FT                   LTSSAWQTLKTWDRPVLK"
FT   gene            complement(550335..551750)
FT                   /locus_tag="Hoch_0400"
FT   CDS_pept        complement(550335..551750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0400"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; KEGG: ank:AnaeK_3555
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13041"
FT                   /db_xref="GOA:D0LJ12"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ12"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACY13041.1"
FT                   /translation="MYHRGMSRETDPGRAVADVIDAYQGNPFDLEPTRWQAADEALAAI
FT                   NPARCLARLLRQGEVERAKLLLLALGHRRACEHPDAPERVFDDALLPPSVRRRLPRPVG
FT                   DYLRVVMAAGRCYRALSGIRGVSPGIRAARRATWAACFGNSLRHALDLEQVIRDHDILI
FT                   LGETGTGKELFGHTIQVATPGPADGGPAPSAAINAAALPETLVESELFGHAKGAFTGAT
FT                   ESRMGRLRSADGGSFFLDEVGDLPSTTQVKLLRVIETNEVFALGSDTPHTVELRYVAAT
FT                   HKDLESLVAERGFRRDLFERLAGNIIRIPPLRERPEDLRAIALPFVQRYLGASSLDAQL
FT                   ARIEAWIDSPEARGYTWPGNVRELQNALRNLLLGLPAKLGDKEREPVPLAAKAALVSRD
FT                   VAAASAVPRVGDAEQDSEGIPAALRNAAMSMQAVGYWYLRRVVEHARGNLSRAARILGV
FT                   DRSTVRRRMRDEE"
FT   gene            551950..552594
FT                   /locus_tag="Hoch_0401"
FT   CDS_pept        551950..552594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0401"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; K11761 chromatin
FT                   structure-remodeling complex protein RSC7"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13042"
FT                   /db_xref="GOA:D0LJ13"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ13"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13042.1"
FT                   /translation="MLTIYLIALLIGGSLLLVSLFAGGDADADADADFAGGDVDMDMDA
FT                   DIDVDADLDADGDLHGGGFDFGLWLPIASLRFWTFFAAFFGVTGVALTLLDASLGQWPL
FT                   LAIAVAMGYGCGTAAVAAFRYMDRSQTSSSLSLQDYIGESALVRVSVGPNKVGKVRLEV
FT                   KGRSVELMAKTEESDAFAVRERAMVYAVDDDGYALLTRVGQADQKKLTRTA"
FT   sig_peptide     551950..552024
FT                   /locus_tag="Hoch_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.520 at
FT                   residue 25"
FT   gene            552643..554064
FT                   /locus_tag="Hoch_0402"
FT   CDS_pept        552643..554064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0402"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; SMART: band 7 protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13043"
FT                   /db_xref="GOA:D0LJ14"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ14"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ACY13043.1"
FT                   /translation="MQQLIEALPGALTVGAVALVVLFIGIAVIKNLMYICRPNEILIFS
FT                   GSANTTKDGRHVGFRVVPGGRAFKYPFIESVERMDISLINVPMTVQGAYSEGGIPLHVH
FT                   AVANVKVSSDPKSVGNAIERFLGRGRNEIGRVAKETLEGHLRGVLATMTPEEVNEDRLK
FT                   FAQQLSDEAEEDLAKLGLELDTLKIQHVADDRNYLESIGRKRIAEILAEAEVAESDASR
FT                   SAEESEAATDALGEVALTRANANIQRKRNELRQIRAELEAKARSEEERATAAAEAARAT
FT                   AERELQEIRGSLEELRLAADVTIPAEVRQRVQELNASGTAAHIFTDGDAMAQSLRAITE
FT                   AWRESGKDAMDMYVLQNLEEIFGQVAHAAGKLQVREVNLVDGGDGKTLPAYASSYPATV
FT                   GALLGEVTKTLGIDIPSILATNTGEASAPAKRNGQGVSAGAARPASLPGAPGAAGAPAA
FT                   AGTASGNPSFSDAGA"
FT   gene            554120..555412
FT                   /locus_tag="Hoch_0403"
FT   CDS_pept        554120..555412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0403"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; SMART: band 7 protein; KEGG:
FT                   flot1b; flotillin 1b ; K07192 flotillin"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13044"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ15"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ACY13044.1"
FT                   /translation="MFPILFLIALAAAIAIAILVWKNLEICAPNEVLIFSGKRTKYAGR
FT                   EIGYRLVQGGRGFRWPLIEIVDRLDLTNMIIDIRVQGAYSKGGIPLNVDAVANVKIASV
FT                   EPSIGNAIERLLGKSRDHIMTVARETLEGNLRGVLATLTPEEVNQDREKFADSLLQEAD
FT                   HDLSRLGLELDTLKIQNVSDDRGYLDSLGRRQSAAVIMRSRIAEAENKAHAAERSAANL
FT                   ETQEIAKIVAEIEKARADAERRIVDAQTRKDAMVAEARGQVEAQVAKARAEVEVQQARM
FT                   EQVRLQLEADYVKPAEANRQQLIAQARGESATIIERGKATAEALRRVSATWREAGDSAR
FT                   QIFVAQKLNALIGSLMSTVGDISVQKVTFIDESLAKGGSNFAVNAAVTAEQLKHTLGVD
FT                   VPALLERVGGGNGAGATRRTPATPPPKPAQR"
FT   sig_peptide     554120..554188
FT                   /locus_tag="Hoch_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.935) with cleavage site probability 0.522 at
FT                   residue 23"
FT   gene            complement(555452..557281)
FT                   /locus_tag="Hoch_0404"
FT   CDS_pept        complement(555452..557281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0404"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mmw:Mmwyl1_3698 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13045"
FT                   /db_xref="GOA:D0LJ16"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ16"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY13045.1"
FT                   /translation="MTAKRRGAALDGLRQYLGVFRYSGRAISLVWSTNRPLTVGLALLS
FT                   LINGLLPAAVAYVGKLIIDAVVQAATTGAVADRDQALVYVAAELVLVVLLAAGQRGIGI
FT                   FQSLLRAQLGHRVNYMILEKALSLELTHFEDSEFYDKMTRARREASSRPLSLVMRTFGL
FT                   IQNGISLVTYGALLLSFSGWAVGVLLVAALPAFFAETRYSGEAFRLFRWRTPETRQQMY
FT                   LEAVLAREDYAKEVKLYNLGPHLLSRYDDIYQRLYAEDRSLTWRRGVWGYVLGLLSTAA
FT                   FYGAYGWIALATMSGDITLGDMTMYVMVFKQGQSALSSILSAIGGLYEDNLYLSNLFEF
FT                   VEEAVPQAAGTRSEGPEPGDGVRFENVSFVYPGADKPAVENISLHIQPGSKLALVGENG
FT                   SGKTTLIKLLTRMYSPSTGRILLDGLDLAEWDPDALRARIGVIFQDFARYQFIVGENIG
FT                   VGEVDAVNDRERWEEAATKGLARPIIDELPEGYDTQLGRWFKGGRELSGGQWQKIALAR
FT                   AFMRKRADILVLDEPTAAMDAEAEVLIFEHFREITKDQIAVIISHRFSTVRMADHIIVL
FT                   NGGRVVESGSHEALMERDGPYARLFSLQAAGYR"
FT   gene            557412..561287
FT                   /locus_tag="Hoch_0405"
FT   CDS_pept        557412..561287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0405"
FT                   /product="adenylate/guanylate cyclase with TPR repeats"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   TPR repeat-containing protein; Tetratricopeptide TPR_2
FT                   repeat protein; SMART: adenylyl cyclase class-3/4/guanylyl
FT                   cyclase; Tetratricopeptide repeat; KEGG: smd:Smed_3612
FT                   adenylyl cyclase class- 3/4/guanylyl cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13046"
FT                   /db_xref="GOA:D0LJ17"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ17"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ACY13046.1"
FT                   /translation="MRCPSCQNQNPDGVKFCGECGLAFGARCAACGAPNPSSNKFCFEC
FT                   GGALGVAPEQPREPDLPSDERRHVTVLFSDVVGYTAMGENLDPEVVESVVGRIKQESVT
FT                   IVARHGGMVNQFAGDEVLALFGILQAQEDDPVRAVRAAIELHRMVRELRSTLQQDLPQP
FT                   LAMHTGIATGLVVTNQRDNRDGRFGIVGAAVNIGARLKAAAQPDDILVSPATRRMIAPF
FT                   FETEALAEVAIKGKREPMVPHRVLRESETRSRFEAATQRGLSSYQTRASELAELRVHWD
FT                   DACAGKGHLVLIAGEAGAGKSRILYELCAPLAADAVTVLQGNCRGQSRGTSYLPFVEAL
FT                   RGLLEITDEIPPQRLVSHIEARLSALDGALLPQMPQILHLLSLRSEAHRLPEQLAGDAL
FT                   VEAAAESLAAVLLAQAERRPVLLLLEDWHFADATSTATLRTLAARAEGARLLIVVTHRL
FT                   EDTGDWPAEIRHRRIDLRAFDLDGTRELLCDLLDTAEVPGSLLAVIHERTGGNPFFIEE
FT                   LTRALLERGALVIEDGTAHLSAPWTELGLPNSVQAIIRSRFDHLPPPARRLVRLASVIG
FT                   ARSSYRILVHLYEKPAELPEALSALLDAQILDEVSGRAVAERRAQARTNSDREYVFRHA
FT                   LTRDVIYESLRIEPRKQLHGRVARAIEELYASRLDEQVHTLYHHFGRAESWREAVDYGR
FT                   RAADRAVTLSQLDEARAILDQVLEWIPHLRGADGHEVAIDVLLRQEQVLESLGRREAQE
FT                   NVIARMYALMDVSGDDGRLADVATRQGDLHTSMGRYEAAENVLKQALARCEARGDQEAQ
FT                   ARALRSLGFLRWNQGRLSDAVAFNQAALAIDEELGATSAQASDLANMGAVLRNAGDYER
FT                   ALACLERASELYEETAQPTRHALTRYSIANIARDRGDLEGAAREYRRACQRFTENRDHN
FT                   MAARALAGMAGVHWERNEIEDSLLLYREAVDVSCNAGLGDAHAHALRILGERLCQVERH
FT                   AEAVPYLLESAQILAKLGDRKGASALWESLAGMYEQHLDQPERALEAWERVRELFEQDG
FT                   DARGALAALDELARLARERLGDPQRALDYLERAAALAGEVDDAAKRGELANAMGILAWR
FT                   LGKFEMALAHYEHARANYRARGLRAHEGFILNSIGVTLAKIGRTDEALAVLHEALPLHR
FT                   DYQQPLFEGHALAAMGDIQRDSGDYEQAERSYSASLALRTTIADQRGEGWMHHALAQVA
FT                   LAQGNRDSVRLRLDAARAVADALSDDELRQAIAACERELLPSAQPAEAAAAGEDGRARR
FT                   PDSISDA"
FT   gene            561529..561795
FT                   /locus_tag="Hoch_0406"
FT   CDS_pept        561529..561795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mlr4527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13047"
FT                   /db_xref="InterPro:IPR025336"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ18"
FT                   /inference="similar to AA sequence:KEGG:mlr4527"
FT                   /protein_id="ACY13047.1"
FT                   /translation="MPRYIVERTVPKMSQEEWRDVGNRVVQSAAEMPGVTWIKCSISES
FT                   EGKTYCEFEAPNAESLREHSRRASLPYDRVIPVEMQVDPSMFR"
FT   gene            complement(561832..562068)
FT                   /locus_tag="Hoch_0407"
FT   CDS_pept        complement(561832..562068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13048"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ19"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13048.1"
FT                   /translation="MSLLVELRGRHVQQALELLGWTGGMLADAAHLSTSEIAKLLDDRA
FT                   PMLNVVINCIRALEAAGIRFESGPEGVRVRAAP"
FT   gene            562282..564114
FT                   /locus_tag="Hoch_0408"
FT   CDS_pept        562282..564114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0408"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   shl:Shal_4227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13049"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ20"
FT                   /inference="protein motif:PFAM:PF05960"
FT                   /protein_id="ACY13049.1"
FT                   /translation="MRLRRFLSSLLATAALAAIGCGPSQQAPASVPASAAPPAPEYALS
FT                   QETPALRALLEDYWQSLLRNRPTFATRIGERRYDDALGSREHGEILAQQRERRGFLDRA
FT                   RALGERELPRGDRLTLAVFIDELEGGIGTELCEMHLWSISARNNAVTRFHDLPETHRIE
FT                   RFQDASNLLARYRLIPRAIDDEMANLRRGADDGRYSNAESLRRTVALIDAQLAQPTAEW
FT                   SLMKPAREIAGNPALTEGQKELFRAELEELVVEWIRPAIERYRKLLLTELMPRARTATK
FT                   IGVSELPDGKACYRALVRNYLGLDRSPESLHRLGMEEIARVNAEMVALGEKLWGAGDLA
FT                   AVLARLDEERSLYFASEDEVLEAARAALAAAREALPRYFRLLPETECVVEPIPAIAAPY
FT                   TTTAYYRPPGGGEEASGTYFVNTYQPSARPRFEAKVLAYHESLPGHHLQISLAQELADL
FT                   PAFRRYGGSTAFVEGWGLYVERLAGEMGLYEDDLDRMGMLSYDAWRSARLVVDTGIHVM
FT                   GWSRERAEKFLREHTALTDENIRNEVDRYITTPGQAVAYKVGQLEILRLRARARELLGG
FT                   DFDIRSFHDTVLRNGAVPLPVLAEIVDAWIASQR"
FT   sig_peptide     562282..562362
FT                   /locus_tag="Hoch_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.513 at
FT                   residue 27"
FT   gene            complement(564164..565066)
FT                   /locus_tag="Hoch_0409"
FT   CDS_pept        complement(564164..565066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0409"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   pfo:Pfl01_3055 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13050"
FT                   /db_xref="GOA:D0LJ21"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ21"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACY13050.1"
FT                   /translation="MIPNGMVERQVALPGGTFHYLSATPPGREDAPLIVLFHGFPDHPY
FT                   SFGPVMARFVEAGYRVAAPWMRGYRPSVQQGPYHIPRLARDVVEFVDALSPERPVFAVG
FT                   HDWGAAALYGALADAPSRFTAAATMAVPHPQAFFQRLWRSARQLRKSWYMFFFQIRAIP
FT                   ERVCAHGDFSLIDRLWRMWSPGFELPPADRTILHACLRASMPAPIGYYRALLWPPGRAV
FT                   ELARSGPMSRSITVPVFYLHGARDGCIDPSISEGQESYFDALYERAILEHAGHFLQLEA
FT                   PDLVAGYIIDWFQEFPGHA"
FT   gene            complement(565170..566276)
FT                   /locus_tag="Hoch_0410"
FT   CDS_pept        complement(565170..566276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0822 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13051"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ22"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13051.1"
FT                   /translation="MNRLRKRPSPPASRVRPPARVAPALALLLLCLGSTACTEFEVASI
FT                   VLDLRILGMKTSPPEVIIPVEAGFDLGDLPDVDVEVCALVADPGATRELAYRFTACWPT
FT                   QYQRCDEPERENVVLTGTANGGFATLPDPEGGDEALEACATMSSREVLTLLVLDQAEAG
FT                   GSLESVAADILANGNTLDVQLELAIRGADQDASALQYGSKLMRYGLPVPESRTANENPL
FT                   LEQLTATLDADGEDGPGEEGEPFAMPEGRCGDVEPVVLAPRAVLTLEPQAVEDARQDYT
FT                   VVSFSGDVDEFTEYLVYTWYATYGSWEREQSGGPNDFVSDNEPPTDSAWTAPSAAVVGD
FT                   GLEVDLWLVQRDERGGQDWLRTCVRVEP"
FT   sig_peptide     complement(566166..566276)
FT                   /locus_tag="Hoch_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.786 at
FT                   residue 37"
FT   gene            complement(566276..568996)
FT                   /locus_tag="Hoch_0411"
FT   CDS_pept        complement(566276..568996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0411"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; PFAM: TonB-dependent
FT                   receptor; TonB-dependent receptor plug; Gram-negative tonB
FT                   protein; KEGG: mxa:MXAN_0821 TonB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13052"
FT                   /db_xref="GOA:D0LJ23"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ23"
FT                   /inference="protein motif:TFAM:TIGR01352"
FT                   /protein_id="ACY13052.1"
FT                   /translation="MLRTTVVICAAALLSTVSLAHAQDGARRDEGTNEVEVPAPTLTKA
FT                   PALLEAAAPVYPQEALDAGLEATVPVRIHIDETGIVTLVEVIEPVGKGFDEAAVEAAEL
FT                   YVFSPAEFDGTPGPIVVETNIHFTIEVQEEEPPPPPPPPASEEDEAAALGPPSHGGDAR
FT                   LPVTISGQAVERGSRRALAGVIVALAELGVDAITDEDGNFYFHGVPAGTYRVIAVEDRY
FT                   DRLERSLELTADERVEVRLWMRAKGGNPYETIVEGEREVLEVTKRTLERRQLTTVPGTF
FT                   GDPIRVIQALPGMALSPFGTGLLLVRGSNPDDSAVFIDGHRVPLIFHFLGGPSILNAEF
FT                   LESIDLYPGGYPARFGRALGGVVAVETRSSESDGVHGSADIDIFDAGAYLRMPVGDKGS
FT                   FAIAGRRSYLNLVLDQVIPRAAPGAAVVVVPVYYDYQMRFDYDLGAEGSVSLFWLASSD
FT                   RLDVVAVDDETEQSLDLSTSIAFSRLIGTYRRPIGGGLRLTMSPMYGRDRVRFSGGQAE
FT                   SDAAFTGADIIMDTLGYRMRVDGRVNDLLVVDLGIDLESRVTRYDLLIPLFTDVPQQPG
FT                   GPSQLPPEDFEQSVDFFAYGLHADLGWDATDKLKLVPGLRFDGYWLAGEVRKTIDPRIS
FT                   GRYQINDAWTAKGYVGLFHQPPQPETVDSLVGNPDLTLERALHTGLGGEWVPAKAWKVD
FT                   AEVYYVDRYDQAAFNDAGDRIVTEDPRTGEVRVTPVLLENTAASYTTGFELMVQREVTQ
FT                   NLYGWLAYTLSYSRNRERPEDPETPTFFDQRHVLNAVASYRFDNGWEIGGRFRLGTGRP
FT                   ITPIDSGTFIGDETDYDPYPGEMLSERRKTFHQLDLRAEKTWTFNYFTMAAYLDIQNVF
FT                   NVTNEEGVQRDYRFRREAPVQSIPILPTLGVRGQW"
FT   sig_peptide     complement(568928..568996)
FT                   /locus_tag="Hoch_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.929 at
FT                   residue 23"
FT   gene            569214..570050
FT                   /locus_tag="Hoch_0412"
FT   CDS_pept        569214..570050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0412"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13053"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ24"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13053.1"
FT                   /translation="MADSRSGSKLIIAVLAVAVLGLTVALILSLRDPAPEVAAAPPAAE
FT                   APAAPMRTGEGAGSGGFAQARQPSLPGGPPARARNELGQPLDENGRPIGPPHKLQTLRN
FT                   RAIAEGELPMTPPRFDDPAQRAQFKAWWVDEFSRRVAIFETLEPGDYPSAEDTAALLED
FT                   MYDAGEPRSPGESVEDAMNRRRQFRTHMRHFLDVYGVPPYTVVTRAGDPQYGQPSAPPL
FT                   QPPGVSDEPVVPAEPSEMTPPGRGADDPGGTDPVNPNSGPNTGPGTRDGAEQGGAR"
FT   gene            570047..571696
FT                   /locus_tag="Hoch_0413"
FT   CDS_pept        570047..571696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_4060 DsbA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13054"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0LJ25"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13054.1"
FT                   /translation="MKRCPSTGILLSGGLLLAAALLAGCQCTAIEPAGERRAHTVTQSE
FT                   GQSEGQGAGAAAVMPRAEPSAPIPVPRADAARFDLGQSPIRNPLNLFDVAIAGAPDPDT
FT                   AGTVDGVAVTMRDLESQSVGAFARIAERIYEARDRGWRWLIERVALEHVARQAGMPLIP
FT                   YLLSEYAKLPPPTDEQLAGVLQDMAFAEMGEDELLAAGRSVWRLQAWDARRAELVNQGR
FT                   AAVPFERVRRRISDPEFAKPETEVARLGGQPITRAEQRVLAGYQAALAQHEYWRIAKMQ
FT                   FDKYVDRFLLAREAEALAVEVSELEQMERGRMPAVSDAEVRAFIAENPEYKTAQNGFER
FT                   ARDNVRRLREQGAYESLLKRLRAAADIRFLLEEPSFDQIAVEVPGPRWYGDPAASDVVV
FT                   AFHAVGCSTCTRGSRLLGALLRARNGSIKILAGDYFEPGRLDPFRGAMALHCAPPPSRE
FT                   ALRERLTQNFRDARIATLVADAEAVGIDAEGFGACLASDRFLPVITENLAMARRLGLEN
FT                   NVPGLFAKGRRIGDLKDLAGVLKQIDDALAQP"
FT   sig_peptide     570047..570136
FT                   /locus_tag="Hoch_0413"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.708 at
FT                   residue 30"
FT   gene            571764..572615
FT                   /locus_tag="Hoch_0414"
FT   CDS_pept        571764..572615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0414"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ank:AnaeK_3549 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13055"
FT                   /db_xref="GOA:D0LK21"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK21"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY13055.1"
FT                   /translation="MTSPRPEPEAPAPVRAEPNGATASEAVIALDAVSFRYGSDDILSQ
FT                   LALAIAPGQLTCIVGPNGAGKSTLLKLMAGLLPPASGSVRCFGRDPRAHRRRALARRLA
FT                   FVPQHYALAFPFTAREVVLMGRYPHRGAGLLGLERDDDLEAASAAMARCDVAELAARRF
FT                   DTLSGGEQRRVLLAQAFCQEAELILLDEPTAALDPAHAIALFAALRAERDARAATAVVV
FT                   THDLNLAARFGDRLLLIDRARLRGDGAPAEVLASAAAAEAFSVAMHVGHLPGTRTPFVV
FT                   PR"
FT   gene            572623..573696
FT                   /locus_tag="Hoch_0415"
FT   CDS_pept        572623..573696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0415"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   noc:Noc_0838 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13056"
FT                   /db_xref="GOA:D0LK22"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK22"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACY13056.1"
FT                   /translation="MSARGFIGASAGRLTRGRLLAALALGALLTALLAALAPLLGVATS
FT                   GPATLSLLDPGALSAGPGSDAIAARIFWHSRLPRVLAALLVGSGLAAAGCAFQAVLRNP
FT                   LAEPFTLGISSGSALAAVIAVRLGWETSLLGGSAVGLSALAGAGLTVVLVWLLSRVDGT
FT                   LPPATMLLAGITISMFCSAASLLVQYTADFGEIARMIRWMMGGLDWIGYQRLARAAVPM
FT                   ALGLAVMLALARSLNAMSAGPDAAASVGVDASRTTAVAFVVASLLVGAGIALAGPIGFV
FT                   GLLVPHALRALVGPDHRVLLPMSMLAGGALLVVCDTLARLLLMPDQLPVGVVTALLGGP
FT                   FFLFILLREKRRGGLWS"
FT   sig_peptide     572623..572760
FT                   /locus_tag="Hoch_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.379 at
FT                   residue 46"
FT   gene            573987..575195
FT                   /locus_tag="Hoch_0416"
FT   CDS_pept        573987..575195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13057"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR025111"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK23"
FT                   /inference="similar to AA sequence:KEGG:Adeh_2160"
FT                   /protein_id="ACY13057.1"
FT                   /translation="MSDTSAYTLTVRPGHPDFSELPWQHALATWDVAALVPRPAGRSEH
FT                   AVRYLCFGDAVYVIKELPTRTAHREYELLRALEDEGLLVAPPVGLVEGRCGDPEAEHSA
FT                   ALITRYLPFTYSYRELIAQAGLATVRAGLPDAFAGLLVELHSAGCFWGDCSLSNVLLRR
FT                   DADGIDTVMVDAETAFLCERLSDRQRAADLVILVENVNAAMIELAAARGDAALDATLDT
FT                   ALGLGGEIVARYGQLWSELFGAEIIAPGEEHKIAARIERVHALGFDVRELDIETADDGV
FT                   TRTLRLRPGRRHFHAQRLEQLTGVEVAERQARQLLSDLAYYRSLRHSSASANEALAALE
FT                   WRAFAFEPMLERIRAIPGVVDPVQGYCELLVHRYLCSEARGDDVGTDAAFEDWQRCLVP
FT                   RAA"
FT   gene            complement(575241..576986)
FT                   /locus_tag="Hoch_0417"
FT   CDS_pept        complement(575241..576986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0417"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   noc:Noc_1385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13058"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK24"
FT                   /inference="protein motif:PFAM:PF05960"
FT                   /protein_id="ACY13058.1"
FT                   /translation="MHALSRYLLAAVLAAAATACGAKDGNAPTNASAPASAHGDSEAFR
FT                   AFVHEFREATLRERPDMAIDLGRHEFDGQLADWSRTGLDRQIARLHQDLERAHGFSDEG
FT                   LSEPERFERDYLIAYIDRELFWLEEADWPARNPFFYLMRLDPGVYLTREYAPLKQRMAA
FT                   FTQMAEKLPSALEQARENLRTPLPKTYVSLGANMARGAAAFLRDDVPQIFDAVDDKELQ
FT                   RAFDVANLAAALAYEELAVWFAAQEASATDEFALGSELYARMLAQTEMVTTPLDELERI
FT                   GRADLERNLAALASACAEIAPEHSIPACVAMVQADKPEVGPVLRARAQLEELADFLARA
FT                   DLVTVPGPERALVEESPPYNRWNSAYISVPGAFEHNVPSIYYIAPPNPAWTEAERLSYI
FT                   PGETDLLFTSVHEVWPGHFLQGLHANRSEIEFAHIYRSYAFSEGWAHYAEEMMWEAGLG
FT                   DGDPRVHVGQLLNALLRNVRFLSAIGLHTQGMTVAESEQMFREQAFLNPGGARQQAARG
FT                   TFDPAYLNYTLGKLVIRKLREDWTASRGGRAAWKEFHDTLLSFGAPPLSLVRRAMLGAD
FT                   AGPAL"
FT   sig_peptide     complement(576918..576986)
FT                   /locus_tag="Hoch_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.940 at
FT                   residue 23"
FT   gene            complement(577090..578976)
FT                   /locus_tag="Hoch_0418"
FT   CDS_pept        complement(577090..578976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_2824 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13059"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK25"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13059.1"
FT                   /translation="MRHLAPTQFGGAESSRFPEVKYIARLRVYATPAHQAQSSRWQQRF
FT                   ADELDYVNQYLIPNYGLRFEIEGFADWPRTGNDDSLPQMLSELRQLDTAEEVDWVVGLG
FT                   SALNTTSNSFHQIGLASHFDRHMVLRGFEDVAADEALRELDEHHRLRLRGARRQHRQAA
FT                   IFLHEWAHTMGALHVDDRDAFMAPSYRLKTNSFSPETNALLLAVLPARMEAVNANESLR
FT                   AHLAAMRQHLEHNSPQAWDPDELEALRETMADLQSFFDRQDEEKVAAGEVARVDEHGVG
FT                   QVPEEVRELYEQIQALHRSGAHEQARSMLDNLIASYPAHLEFRLSACALALNAPSADAD
FT                   ADADATGATGAGTGTGAAAAPPPDPDALATCARLGLIAPASAAAARADLLAAGALRRAE
FT                   QGAEAATLLAQARERIAANADEPSAAEAWTQLVAGLQALGAVTWVEQAIASAPAGVDTA
FT                   EVQTWATQQRRRYGLPPNAARHRIAPADEGAYLRAVREALAVLYRGDRDGAWRAATSAL
FT                   QRYRNAPGLRAVQCDIELRRQRRGHARAHCQAALAAYSETSWARYLLGILELYARKNRA
FT                   GIAQLERAIELDPSLQQAYRALHQAYGRTSQRAAQEQLEARYLERFGQVLAP"
FT   gene            complement(579176..580132)
FT                   /locus_tag="Hoch_0419"
FT   CDS_pept        complement(579176..580132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0419"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   dal:Dalk_0759 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13060"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK26"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACY13060.1"
FT                   /translation="MRAALAIGLLALACCLPCASGCRDRERDDAAQPAESSEAPTVRRV
FT                   VTLTPSATEIVAALGATELLVGVDGYSDYPPAVRTLPRVGDFLRPNFETIVALQPDLVI
FT                   ADAVHVEVAEGLEAAGVNTLTLPMHTRGDVYRGLDAVGQALGRADAASSARAAIDAELA
FT                   RVAQRAHQLGEGGERRPRVLAVVDRAPDDLGNLVAAGPGSYLDELLALVGADNALADYQ
FT                   VRYPKLSAEQLLRARPELIVDLSPSDNPAHTRRVWAALSEIPAVAAGRVYALDDAALSS
FT                   PGPRIGAAALRLSEVVHGAEADPTTTEQKTASTPKKE"
FT   sig_peptide     complement(580067..580132)
FT                   /locus_tag="Hoch_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.935) with cleavage site probability 0.496 at
FT                   residue 22"
FT   gene            complement(580174..580809)
FT                   /locus_tag="Hoch_0420"
FT   CDS_pept        complement(580174..580809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0420"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; KEGG: scl:sce4391 ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13061"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK27"
FT                   /inference="protein motif:PFAM:PF04379"
FT                   /protein_id="ACY13061.1"
FT                   /translation="MRRRPKRYLQRLVYRFVSSLLRWQEPEDDDDLAAASGSPPGSDPR
FT                   ARRGAAAAETGDTPLASPAPARQSRAVPTLVAEPTSNVITEGIRVTVRSVYLPNQSEPE
FT                   DQRHVFAYTVSISNEGQRPAQLRTRHWIITDGNGQVQEVKGPGVVGETPRLTPGQSFQY
FT                   TSGCVLKTPVGTMHGTYQMYRDDGSQFDAEIAPFTLAMPHSDDGRLMN"
FT   gene            581035..581589
FT                   /locus_tag="Hoch_0421"
FT   CDS_pept        581035..581589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0421"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: afw:Anae109_2953
FT                   GtrA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13062"
FT                   /db_xref="GOA:D0LK28"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK28"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ACY13062.1"
FT                   /translation="MLFRRLFQRFVLPFFTRRFLKFAIVGASGVLVNLGCLALLRALSV
FT                   QINLASAIAIELSLLSNFAVNYLWTFRDVSGGWLRQALRFHLVCLGGAVFQFSSFVIMN
FT                   VVWMLLLWSGDARTEYFAGADTMFERWLWRPLMSPPEVGAWVFLSQLIGIGCGMVWNYL
FT                   LNFYWTWSVHKRAEPGGEHVS"
FT   sig_peptide     581035..581151
FT                   /locus_tag="Hoch_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.882) with cleavage site probability 0.455 at
FT                   residue 39"
FT   gene            581579..582322
FT                   /locus_tag="Hoch_0422"
FT   CDS_pept        581579..582322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0422"
FT                   /product="Dolichyl-phosphate beta-D-mannosyltransferase"
FT                   /EC_number="2.4.1.83"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   afw:Anae109_2588 dolichyl-phosphate beta-D-
FT                   mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13063"
FT                   /db_xref="GOA:D0LK29"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK29"
FT                   /inference="protein motif:PRIAM:2.4.1.83"
FT                   /protein_id="ACY13063.1"
FT                   /translation="MSLEHSGAGALICIPTYNEAENLPLIVPAVLTAVPEAHVLVIDDA
FT                   SPDGTGQIADALARDSEQVHVLHRAGKEGLGRAYLAAFEWALARDYRFVFEFDADFSHD
FT                   PGYLPGFVALLEDEADVIVGSRRIPGGGVENWGALRRFVSWGGSMYARTILGVPVRDLT
FT                   GGFNGFRREALAGLGLEDVSSTGYCFQIELKYRALKRGYRVLEQAIVFPDRVRGVSKMS
FT                   GEIFLEAVRQVWKLRLREDEIRGAE"
FT   gene            complement(582440..582868)
FT                   /locus_tag="Hoch_0423"
FT   CDS_pept        complement(582440..582868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0423"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13064"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK30"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13064.1"
FT                   /translation="MQAEQWRIRNAAVQSNTGQWVFREIAFCADPACNQELTGGTAFDS
FT                   DDSPSWAEPENAFDGDTSTMWKSFDADVAGQSYLGMDFDAITGVHGIYLKTDNTVYSVS
FT                   EIYIEYYDAVSQSWVVADYLSDVPAGSELVYPVLRSAP"
FT   gene            complement(583072..584646)
FT                   /locus_tag="Hoch_0424"
FT   CDS_pept        complement(583072..584646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0424"
FT                   /product="Heat shock protein 70"
FT                   /note="PFAM: Heat shock protein 70; KEGG: gsu:GSU0033
FT                   molecular chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13065"
FT                   /db_xref="GOA:D0LK31"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK31"
FT                   /inference="protein motif:PFAM:PF00012"
FT                   /protein_id="ACY13065.1"
FT                   /translation="MSFRTIGIDLGTTNSVVATIDRDGVPRILTSEEGETTTPSMISVI
FT                   EQQGRQNLAVGAEARRLANHHPQDTIFAVKRLIGRRFDEPDVRRLSVALPYRISCAPNG
FT                   DAWVTASSTTMSPPEVSALILQEMRGVAERFFGEPVGEAIITVPAYFDNQQRQATKDAA
FT                   EIAGLKVRRLLNEPTAAALGYGAHLGESRRIAVCDLGGGTFDVSIVNVESGVFEVISTH
FT                   GDAFLGGDDFDRTIVGQLVGEVWAEYGIDLGTDASALHMLKAEAQAAKHALTNSEDVNI
FT                   ELRSLGSLPSGKPLDFRRSISRRELEQWTEPLVNRLEPPCLEALAHCGLEPGDVGAVIL
FT                   VGGMTRMPAVQRRLAKIFGRQPLKVENPEEIVAVGAAIQCAVLEGGVDGVVLLDVTSRP
FT                   LALSVEGGPARQVIPRNATIPTREHRIITTAHDNQRELSFDVYEVQDGLPVKNRHLGRF
FT                   VCSDLPPAPAGEIVLLVEFTIDFDGILRVTTTELGSGAHPTLRLVATAGLTRADVKRLA
FT                   KSLAPQR"
FT   gene            complement(584643..585929)
FT                   /locus_tag="Hoch_0425"
FT   CDS_pept        complement(584643..585929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0425"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; SMART:
FT                   heat shock protein DnaJ domain protein; KEGG:
FT                   ank:AnaeK_0271 heat shock protein DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13066"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK32"
FT                   /inference="protein motif:PFAM:PF00226"
FT                   /protein_id="ACY13066.1"
FT                   /translation="MRTLKVKCPTWVHVETFYSRKLRKDKTLTLRVPFRPEDGSQLSLG
FT                   LDLPTGEQIPIPGTVINVTPEDDGRRNAMRLFLHGLTPELLARLKALVAEAKESAPEQF
FT                   TMPPPTPPGSSAVPPPVPRAASAPRSAPPPAPPVAPKAPATQAPQEFDLTSALRPMPKA
FT                   ASAALPASRPEDAPVDELIEPPYTPTIDSVSEYERDVFVQLDETLRRLRESSAHEVLGV
FT                   AEDADVAAVREAYFALSKRFHPDLFARYRSTAILHMAQELFILINKAYDRTRDALVAAG
FT                   QAIVAGPALISHEGWLAGFSDIDAADEPGAAEPAADGSGTWSLSDSSVAARYPGIEDVL
FT                   GLVAERKFEEAREQVAAALHFDPRDRRMRAIYHVISGRELMAAGEDSAAVTQFEAALAH
FT                   DRNSREARDGLDELRARGRHSGPYPRTLR"
FT   gene            complement(585994..588669)
FT                   /locus_tag="Hoch_0426"
FT   CDS_pept        complement(585994..588669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0426"
FT                   /product="serine/threonine protein kinase"
FT                   /note="SMART: serine/threonine protein kinase; KEGG:
FT                   scl:sce0848 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13067"
FT                   /db_xref="GOA:D0LK33"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK33"
FT                   /inference="protein motif:SMART:SM00220"
FT                   /protein_id="ACY13067.1"
FT                   /translation="MRSIEGYEYRESLEADFFGQAFRAEAATGGSVHIIEVEQRFAGHR
FT                   EFSMTLLGRGKLLTKFQHPHVVGTRQVSRGDADHLLVVTEAIDSPVRLETLLGGSSDAD
FT                   MQPLPRGVAATIASALLEGLSAAHGQSIVHGALHPRSVLIDASGATKIGHFALGRALAT
FT                   WSQRDSSASFVKAYRGFLAPELAQGGRPDASTDVYAIGALILAMTCGRATNATLAKGLL
FT                   PPAITSVLARALDTNRLHRFANADRLRDEFEIAWTSDGWPRASREEVTAFVAERLRGKP
FT                   TGGDADADEVDLDTALSFLDELSTPPPAAPELVDAMNSMFAELDADDADDDDNTGDADA
FT                   ASAEAAPAAPAPAPVSPPGSDGRSSRKQRAGSEAAALAALAELDQLDDGDDSGVGFESI
FT                   PGLPPRPASDSGSDAAVEAEAEAAAHGSGSLEPVRGTPATPFNAIPDAVATTVSAPADM
FT                   PIPDAEGAGEPTRADSEAAALAALDALDGLDALGEDDGDGPEHSAHGGDDLTAKMDDSH
FT                   MLDEAELLEEIDDGELLEDLEEVADDESFVDDGKTQQIASFVPPDALSEERLAAERPTA
FT                   IAPAEPEPAPAPAPAPAPAPAASAAPGIEASAKSLAERPRVDSWQRPDPGGPGSPAAAA
FT                   AAPLPPAISPVPNAPLKSGRRGVMGAVWAILVIAAAVTLVWVIRTQTSLLEQADERAAE
FT                   QEAEQQRALQEHLAAQPKSGVIAIETEPDRAGVWMQLGRTPLETTLLSASTVHELRLEL
FT                   DGYQTQDLRVQGEHWSGSDDSLHGAIAATMQPGANAEALPAYPPAPPPEASEGLREGSG
FT                   HIQITSEPAGAEVWLLVGITPGVQVTATAGLDYAFKVYLEDHLPGVITIRGSDWSEDGD
FT                   ERRVEHSLTLTPERAQRQKR"
FT   gene            complement(588789..589751)
FT                   /locus_tag="Hoch_0427"
FT   CDS_pept        complement(588789..589751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0427"
FT                   /product="peptidase A24A domain protein"
FT                   /note="PFAM: peptidase A24A domain protein; peptidase A24A
FT                   prepilin type IV; KEGG: ppd:Ppro_0982 prepilin peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13068"
FT                   /db_xref="GOA:D0LK34"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK34"
FT                   /inference="protein motif:PFAM:PF06750"
FT                   /protein_id="ACY13068.1"
FT                   /translation="MFPPSDELVQLAHGAGGYALAFILGALFGSFANVCIYRWPPTDEH
FT                   PGGRSVVTPGSHCPACGHAIRWYDNLPMLGYLLLRGRCRDCGLGIAPRYPLVELLTAVL
FT                   FVSLYHHVMAGAYLYEPLPQQLLHFVVLAAFAFVLVVIAFIDLDHRLILDKITYPGIPI
FT                   FYGLGLLLERPWLDGLIGAALGYGVVRLLADGYRLLTGREGMGYGDGKLLALIGALFGW
FT                   QAVLASLFLGSIIGSVLGITAIALARRAARGRDDTDAAPDAGEANTDAASADQVGGTRG
FT                   EDDELPLRHVELPFGPFLVIGALVYVFVHPFYQLVLAVP"
FT   gene            589799..590857
FT                   /locus_tag="Hoch_0428"
FT   CDS_pept        589799..590857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_0217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13069"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK35"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13069.1"
FT                   /translation="MTCQMRTLRAMAVLAAALALAAAASCRQDDDEVFVDDGKRDDYGG
FT                   LVAALDNEREIDVEAAARTPGALLETLRQPHHDFADALGPHLVRASSAIAVAIDGAPAE
FT                   PEAGAEDGAQDGEAGERLETTVTLAYAAPERYRTLVENSADYGREVVFADAHLYLKPRY
FT                   GNFHRREPNDDTEAERLRDHVFAELVGNLELFASGLAVRDGGETQVGDRPAQRIELALA
FT                   DKPRTVRMANTPQRAWRKHAVVESLEGVVVLDRDTGAPLHAELRGAVRVPRDGQTVRMS
FT                   VQLSHDIENIGQTPEIAVPAEDQWVATPERSRELEERDELLEDIAQPARPAPTPQTEAA
FT                   GGGREGAAQENR"
FT   sig_peptide     589799..589885
FT                   /locus_tag="Hoch_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.510 at
FT                   residue 29"
FT   gene            590854..591669
FT                   /locus_tag="Hoch_0429"
FT   CDS_pept        590854..591669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13070"
FT                   /db_xref="GOA:D0LK36"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK36"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13070.1"
FT                   /translation="MSKAVREDIALRRKHLDDHRPMIVGRSLALGIVGAIPVPLVDDWL
FT                   RETLLRNTYGKLATARHVEIGHEAMQKLIYGREEPPDLAQLFASATLLRLAARAWAKLL
FT                   VFLTVARRVRAVARNFTRITLFDHYCARMHTGIGIDPETGAALHETMARAIDETTGELG
FT                   QRMLRRGISAALRVTLQAPAEVLDIATAGTLRRLLERRRQDGDGTMEFAAAHEVDAVIE
FT                   RELASESSFLGRATRAIDLQLSVQGNPYLDAAIENFERMWRTRQTRSPR"
FT   gene            591672..592829
FT                   /locus_tag="Hoch_0430"
FT   CDS_pept        591672..592829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0430"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="KEGG: ppd:Ppro_2953 gamma-glutamyl kinase; TIGRFAM:
FT                   glutamate 5-kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; PUA domain containing protein; SMART: PUA domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13071"
FT                   /db_xref="GOA:D0LK37"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK37"
FT                   /inference="protein motif:TFAM:TIGR01027"
FT                   /protein_id="ACY13071.1"
FT                   /translation="MDTPTPPASAADAALSEDLSTRREVLGRARRVVVKVGSRLLAESP
FT                   AARPALLADDIARQRRGGERSFLVVSSGAVALGSRVLGFTERPRALPVLQAAAAVGQGK
FT                   LLQHWEHAFAAHDVNIAQLLLTHDDIADRSRFLNARHTLQALLEAGVVPVINENDSVAV
FT                   EEIKYGDNDLLAALVSNLVGADALLILTDVEGLRGADGVRMSLVRDIEREAVPVAKPPR
FT                   ADGVGSGGMASKVQAARAAARSGVVTVVAPGRHPNVIDAVLGGDDVGTVFLPEAARMSS
FT                   RKHWLAYGGKPVGRILVDEGARRALVEGGRSLLPAGIIGVEGSFGLGDLVSLATAESGD
FT                   FARGLVGYRSDDVSQLMGRQSSDIESTLGYKYLDAVMHRDDLVLL"
FT   gene            592944..594290
FT                   /locus_tag="Hoch_0431"
FT   CDS_pept        592944..594290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0431"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase; PFAM:
FT                   Aldehyde Dehydrogenase; KEGG: gsu:GSU3211 gamma-glutamyl
FT                   phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13072"
FT                   /db_xref="GOA:D0LK38"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK38"
FT                   /inference="protein motif:TFAM:TIGR00407"
FT                   /protein_id="ACY13072.1"
FT                   /translation="MSHVTAPANAPSSTDDTGAPARDDAPPREDALAREIAVMSAAARA
FT                   ASRVLAKTSSEQRARALRSIAVAVRDTTDAIVEANQRDLAAGEQAGLSAAMIDRLRLTP
FT                   ERLSSMASAIDEIAGLPEWVGRIEREETRPNGLRIARMRIPLGVVMMIYESRPNVTTDA
FT                   AALCLKSANAVILRGGSEAAHSNLALGEAVAEGLRAAELPAAAAQIVPTRERAAIHHLL
FT                   AREEDIDLVIPRGGEGLIRFVAEHSRIPVIKHYKGVCHLYVHAAADLDMALAIAENGKV
FT                   QRPGVCNALETILVDRAVAERFVPALCERFVDLGVEIRGDEAVQSLGGAAVKPADDSDY
FT                   AAEYLDLIVAVRVVDDFDAAVAHIERFGSNHTESIITADEAVGERFLREIQSSTVMVNA
FT                   STRFADGGQLGLGAEIGISTTKLHAYGPMGAEGLTTTKFIVHGSGQTRG"
FT   gene            594387..594887
FT                   /locus_tag="Hoch_0432"
FT   CDS_pept        594387..594887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0432"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein; KEGG: ank:AnaeK_0226 iojap-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13073"
FT                   /db_xref="GOA:D0LK39"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK39"
FT                   /inference="protein motif:TFAM:TIGR00090"
FT                   /protein_id="ACY13073.1"
FT                   /translation="MRSANESKLPDSELSERRESGEVRVDDDEGLEAVHVALQAALDNK
FT                   ALEPMVLDVRGLCSYTNYLLLVSGRSDRHVESICNGVMKTMREQGHYPLGTEGKKSGQW
FT                   ALLDFGDCVTHVFYHATREHYDLEGLWIEAERVAIEVPEDARITRADDLDDGLDDGHDD
FT                   RLD"
FT   gene            complement(595062..595418)
FT                   /locus_tag="Hoch_0433"
FT   CDS_pept        complement(595062..595418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce0946 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13074"
FT                   /db_xref="GOA:D0LK40"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK40"
FT                   /inference="similar to AA sequence:KEGG:sce0946"
FT                   /protein_id="ACY13074.1"
FT                   /translation="MLRSLLLSFALMTSASFLVACGGDDGDGGSGAIDCDNTTEIAAGR
FT                   QVVEDSCLGCHSSTLAEGSRGGAPVGINFDSDADVNDREDAIRDEAIFEAEMPPGNPLS
FT                   DVEMDALEHYLTCQ"
FT   sig_peptide     complement(595356..595418)
FT                   /locus_tag="Hoch_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.804 at
FT                   residue 21"
FT   gene            complement(595782..596930)
FT                   /locus_tag="Hoch_0434"
FT   CDS_pept        complement(595782..596930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0434"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   reh:H16_B1130 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13075"
FT                   /db_xref="GOA:D0LK41"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK41"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACY13075.1"
FT                   /translation="MKPTSDSAEDALPAFVRVLVIGGGFAGVATAYALARAGCGEVLVL
FT                   EREDTCGYHASGRNAALGRQLTEDEQVTALTTRGAAFLREPPAGFSDTPLWNQTGSVLL
FT                   GDSDAELAEMEARARRWELPHERLAPAELARRWPTLGAALAGVPTAGGVHVPSDGVIDV
FT                   HALLQGFLRGARAGGVRVALGCEVVDMKSDAMTRSRGACVVTVERGGERAAVRCEIVVN
FT                   AAGAWVEELGRRAGARPPHYAPIQRHLFITEPIAALERDAPLVWHVGREEFYLRPEQQG
FT                   FLLSGCDETEVAPYDAVPAANAREALAEKLGPLAPGLAEHGIARVWACLRTFTSDRRPV
FT                   IGWDSDVPWLFWVAGLGGHGATGSAAVGERAAAMLLERLAAR"
FT   gene            complement(596927..598282)
FT                   /locus_tag="Hoch_0435"
FT   CDS_pept        complement(596927..598282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0435"
FT                   /product="threonine synthase"
FT                   /note="TIGRFAM: threonine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: scl:sce9206 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13076"
FT                   /db_xref="GOA:D0LK42"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK42"
FT                   /inference="protein motif:TFAM:TIGR00260"
FT                   /protein_id="ACY13076.1"
FT                   /translation="MGPMYRAWFQCFSGCEGQLPLDSVVYRCPHCNGLLDIVHAREPLR
FT                   RRSAAAWMQLFDSRVMSTQWPYGSGVWGKKEWVAPHVESEHVVSMFEGSTNLMWTGRYG
FT                   ESIGVPNLWVKQCGNSHTGSFKDLGMTVLVSTVKQMIAQGKNIPAIACASTGDTSASLA
FT                   AYAAAAGIRAVVILPRGKITTAQLVQPLSSGALVLAIDTDFDGCMRLVTELAEREGVYL
FT                   ANSMNSLRLEGQKTVAIEMVQQFNWEVPDWVVIPGGNLGNVSALGAGFEMMLELGLIAK
FT                   RPRICVAQAAHANPLYQSFQSKFEQFEPMQAKPTLASAIQIGNPVSYQRAVRALERFEG
FT                   VVEQATEAELADAAARADLAGMFCCPHTGVALAALEKLVARGEVTRDDRVVVVSTANGL
FT                   KFTDFKIQYHEDQLADVPQPRHRNEPIPLADEYEAVRSAVLRDIEARRDASA"
FT   gene            complement(598404..600200)
FT                   /locus_tag="Hoch_0436"
FT   CDS_pept        complement(598404..600200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0436"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: xop:PXO_00679
FT                   sodium/glucose cotransport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13077"
FT                   /db_xref="GOA:D0LK43"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK43"
FT                   /inference="protein motif:TFAM:TIGR00813"
FT                   /protein_id="ACY13077.1"
FT                   /translation="MLGGLDIVLFFLFLGGVMLVGLMSGRHESSSEDYFLAGRKIPWWG
FT                   VAGSIFGTNVSANHLVGMLGVGFSIGFAQSHYELGAIAAILVLCYFFLPVYRRLGIFTL
FT                   SEYLGRRFGDSSRLLYTLILVVLIVVQMTAAFYIGSRSLGLLLADTPLELGYLGGVAVL
FT                   VIITTAYTIFGGLTAVVWTDVMQSLLLLVAGVLVAVLTFAQPEVGGFAAMMARDAALPA
FT                   AEQKMHLYLPSSHPDLPWTGALTGLIALHVFFWSTNQYLVQRALAAKSLTQARVGALTG
FT                   GFLKLLIPLFSVAGGVAAAQLFAARSVSAAPDEAFPVLVNLVIPAGYGLIGIISAGLIG
FT                   AIISSIDSMMNSAATLVTVDIYKHRLRPAADDASMVRVGRWVIVAIVGLSTLLAITSYD
FT                   PDSRDNFFLVVSRQSSYFTPGLIAAFVLGMFYRRANGVGAVLAIACAPVLSLVFELAYD
FT                   GWLHVYFDELLGARLNFMHRVFLTLLASLAVLVVGSRVRPADPERARYLWVEAAGEQPA
FT                   PLAAVVGKLGLFALIQAALAGLLVTGALPPALLAALSAVLTAALFAWHIARYRRPEGLL
FT                   RDDRVLAAALSSATMFMMFAFY"
FT   gene            complement(600223..601371)
FT                   /locus_tag="Hoch_0437"
FT   CDS_pept        complement(600223..601371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0437"
FT                   /product="Alkanesulfonate monooxygenase"
FT                   /EC_number="1.14.14.5"
FT                   /note="PFAM: Luciferase-like, subgroup; KEGG:
FT                   atc:AGR_L_3078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13078"
FT                   /db_xref="GOA:D0LK44"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK44"
FT                   /inference="protein motif:PRIAM:1.14.14.5"
FT                   /protein_id="ACY13078.1"
FT                   /translation="MNIDIRTPDAAVEMAWFADLCNGDYELLGVPESALRSNFTHCADM
FT                   VRTADRLGYQNILLPSSYQVGQDTLSFAAGVAPMTEQISLLTAVRMGEVHPPMLARALS
FT                   TLDHMLAGRLTVNIISSDLPGTQAPSAERYRRASEVVAILRQAWTQERIAFEGEFYQLD
FT                   LPSEPVAPYQQNGGPLLYFGGISDGARALCAEHCDVFLMWPETEAQLRATMSDMSQRAA
FT                   AHGRRIDFGYRVHVIVRESENEARAAARRLVSQLSDERGAELKHRSLDSRSAGVQRQDV
FT                   LREHADDEGYIEDHLWSGIGRGRSGCGSAIVGDPDQVYEKLQRYVDMGVRAFILSGYPL
FT                   IDECELFARYVLPRMRTTRLARVQGRLPEHTPETPLTTAPRR"
FT   gene            601474..602412
FT                   /locus_tag="Hoch_0438"
FT   CDS_pept        601474..602412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5548 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13079"
FT                   /db_xref="InterPro:IPR017208"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK45"
FT                   /inference="similar to AA sequence:KEGG:MXAN_5548"
FT                   /protein_id="ACY13079.1"
FT                   /translation="MGSSDSQSPASSADESAPAGEREVAIAAVDGVPLMATLFAPEPAG
FT                   DARGRVLVGAATGVRRGYYRRFARALAAAGFEVISFDYRGIGDSAPPRLRGFEASMADW
FT                   GARDTEGVLRWALARSDDDGLPLSYVGHSVGGQVLPLAASAQELAAVLLVASSAGPRTC
FT                   WPLPERLVLAVFWWLLVPLCVLIFGRLPGRAMLAGEDLPGGVALQWARWGRHPDYLLGE
FT                   LPEVFDNAQRIAVPVRVISIDDDRYAPRPAVDSLAAWYGPYGAERVHVQPSEIGAEHIG
FT                   HFGYFRAEREGDLWADAIEWLSEAGRRPRGE"
FT   gene            complement(602462..603655)
FT                   /locus_tag="Hoch_0439"
FT   CDS_pept        complement(602462..603655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0439"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: dal:Dalk_3805
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13080"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK46"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ACY13080.1"
FT                   /translation="MLATILERGLRASIDDTQGVSPGAALVYGDGGELCGRLMRGRSHF
FT                   GSDADVFEVTQDTVYDLASLTKPLATTAVLMKLDVDIDAPVGPYLPELVPASRAISFAQ
FT                   LLGHASGLPAHIPYYERLLTGERMGAASPREALLRMVAQTPPVRPAGEAAVYSDLGYIL
FT                   LGFAIERITGMRLDQAMRHYVAAPLGMDSACFFELARPPDGADSANDGDGDGDGRGRRP
FT                   PPSRAVTLPVPDRRARQVAPTEVCPYRGLVHAEVHDDNAHAGGGIFGHAGMFGTADDVA
FT                   RCARALVRTAAGSPEGGFDSDVVRRFMGEQRAPGTTWHLGWDTPSPTAGVSHAGDAWPR
FT                   NSVGHLGFTGTLMWLHPDTGRFAVLLSNRVHPSRAHTGIRELRRAVMDEVWRTLERA"
FT   gene            603728..605776
FT                   /locus_tag="Hoch_0440"
FT   CDS_pept        603728..605776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0440"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: scl:sce4487 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13081"
FT                   /db_xref="GOA:D0LK47"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK47"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY13081.1"
FT                   /translation="MTRYELTERLGAGAMAEIFRGKAVAAGGFEKPVAIKRILPHLSQD
FT                   ARFVEVLIAEANVVSHLRHRNIVQVFDVGMTPDGNHFIVLEFVDGCDLGKMQTALENLN
FT                   RPLPEALGLYIASEVCDALEHAHRAPGPDGDPLRLVHRDVSPSNVLLSRSGEVKLTDFG
FT                   IAKRTEEVTTHGGVRGKFAYISPEQASGRAVDGRSDVYSVGILMFELIVGQRLFSQLSD
FT                   FDALNAVSRGEVPKPRSLNPKLDAKLEGILLKALALDPAHRYASAGELGSDLRSYRYSQ
FT                   PSTSGDPAAELATVVVGIADNSLVPALDADAAAEEFNDFTGGTNTFTLDDDESLVRKTS
FT                   YAQAREKVEQEETRLARAFVAAGEPGSEDSDVFGVFSDDFGPEPEEDEEATRIVGPYLR
FT                   ASGAPQPAPSRPAQPSPQPAPRMEDAADTIATMPRDFDLPDNPALAMTMPAQPAGSSAA
FT                   AAASASSSASPAAAAKPIADGPVGPPETLDISPEQARAVVDAVEQKIAADQAVAQGGAG
FT                   APAGSASAPASAPVATAAPAPSPVVMSAPPPRDSGTAPVQRQAERAGFPRWAVALFIVL
FT                   LVGSILAGLLLSDGGERAKTPAAGAAAAEVTPAGEAADEAADADDADEVEAEAEAAAEG
FT                   GDEGAEAAAVDAGADEDAEARAERRRLRREQRRARRRAREERRARDN"
FT   gene            605801..605944
FT                   /locus_tag="Hoch_0441"
FT   CDS_pept        605801..605944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13082"
FT                   /db_xref="InterPro:IPR011936"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK48"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13082.1"
FT                   /translation="MRAFASIGDIERRAAGGVGSGCSSTCTIEEGYTCEGDFDETSVRT
FT                   LV"
FT   gene            complement(606004..606825)
FT                   /locus_tag="Hoch_0442"
FT   CDS_pept        complement(606004..606825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0442"
FT                   /product="protein of unknown function DUF1264"
FT                   /note="PFAM: protein of unknown function DUF1264; KEGG:
FT                   xcb:XC_2187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13083"
FT                   /db_xref="GOA:D0LK49"
FT                   /db_xref="InterPro:IPR010686"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK49"
FT                   /inference="protein motif:PFAM:PF06884"
FT                   /protein_id="ACY13083.1"
FT                   /translation="MRLAWRKSPWNVLFSLFGYSVVLVGAAFVACTSDTEHPEAMAEGQ
FT                   QVQPPGDETTTKTDVLKAGAEVLQSNSPTDKLDVYVVGFHPMKNDPGHQMEAHHFCRQV
FT                   NEDFAQCALYDSGEADANLNGIEYIISEKLYETLPEGEKPYWHPHNYEILSGQLIAPGL
FT                   PEVAETELMKGKMNSYGKTWHTWFTGGGAHDGQKLPLGEPQLAWSINADGEVDPALVEK
FT                   RDHSLDVSTEDTRAERQALVEMARPQRGVDALADAFPERSKPAGVIDADAQ"
FT   sig_peptide     complement(606727..606825)
FT                   /locus_tag="Hoch_0442"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.680 at
FT                   residue 33"
FT   gene            607043..607918
FT                   /locus_tag="Hoch_0443"
FT   CDS_pept        607043..607918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0443"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_3730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13084"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK50"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13084.1"
FT                   /translation="MDVRRFRIAGLDIALHAPAGTCALAASYDVCALAEEPADWAPALE
FT                   LWCICEPGFARGRARTPAYPAFDVRVTEPRRLALSRFDAEGELELPASADEPVRARFRV
FT                   GESVNSLEAALRIGLSVAAPRRARLLLHASAVHVPALAGALLFAGKSGAGKSTIAAVLD
FT                   RVDGFTRLADELLIVAPAPAPAPAPAAAGWELHVPPFLGGVELPVGARVPLVGAHVLAQ
FT                   APAHERTRLRPAEAVRALLPHVLVYVAEPETAAHVLAAAADLVAAVPGYHLAFAPEPSV
FT                   AEVLLVPPSA"
FT   gene            608076..609281
FT                   /locus_tag="Hoch_0444"
FT   CDS_pept        608076..609281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0444"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   sfu:Sfum_4009 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13085"
FT                   /db_xref="GOA:D0LK51"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK51"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACY13085.1"
FT                   /translation="MKSHRGAADVLAEMARRQNRPITVTFQVTDRCNYECVHCYQTHGQ
FT                   ADELSFDEIADILRQLADFGVLFLSLMGGEFFMRRDADDILRLAHELGFAIKLLTTGHH
FT                   VGDRRADLLAGLRPLQVDMSMYAAGAHAHDRVTQQPGSWQRTLAAARRLIARKVPVLLK
FT                   APVMEGNVAELGALAELARSLGAETSFDAKLTGKEDSDPQPLHMRMRADTLRTFYRGGA
FT                   GGDNGIDAFLAKTYADFDPARELRPLHHTPCRAGQQAVSITPQGKVWPCNALPIECGDL
FT                   RERSFAAVWQDSPPLAEVRELRWAAIAECRRCELRSYCQRCHGMALLEQGELRGPSLEA
FT                   CRHAVAVRDSLRERGLIPRTETAMPPTWARVDRDGQHHRRARERAAGEGGARRSDALRV
FT                   LP"
FT   gene            609385..612279
FT                   /locus_tag="Hoch_0445"
FT   CDS_pept        609385..612279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0445"
FT                   /product="FG-GAP repeat protein"
FT                   /note="PFAM: FG-GAP repeat protein; SMART: Integrin alpha
FT                   beta-propellor repeat protein; KEGG: noc:Noc_2093 integrins
FT                   alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13086"
FT                   /db_xref="GOA:D0LK52"
FT                   /db_xref="InterPro:IPR000413"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK52"
FT                   /inference="protein motif:PFAM:PF01839"
FT                   /protein_id="ACY13086.1"
FT                   /translation="MMTTSHSPVPDGSGCARATTPARGGLRVASWRRAALLLAAFASGA
FT                   TGCGDGPLCASDIAVFIASPDLRSGPLADTDDLPGEYVDVVVRTSLRAGEQVELLVTTN
FT                   GELLRRAGVADAEGIAVFEYVYLPSGSSRVEARGVTAECGSGSDIVDVEVADANLSGLC
FT                   QLELVEVPWGLVGYPAPVFGPANDSNPIAEDFQLNVRVTAPPGTQVNLQMVDTDTGSSS
FT                   SAGSRVVDGSSVARYTLTLDDGARSLFAICQYNDGGRENSDSVAFVVDLEAPVCDVVSH
FT                   EDGLTLTAADDFDQDPSNGFQLEIIGQVNVVSELALESWEPPTFTIGDTVMFIGSEYDA
FT                   VGRSSAVVTLDAGAQYLFGFSADDALANVCNAYVSLRVPADVAGELSLRALNRQALELS
FT                   FPDLAGAGGTYEVRLAEEPVTDENFSEVGVDVDVPPSSGQGGQRVLALEGLRPGREYYV
FT                   GVRMTPELGVPSFLGSAGPLSIDLGRSGARLPVAPEEGQNSLGYQLAAGDFNGDSFSDV
FT                   AAAAPFKQVGGVGGVGAVYVYLGSAEGLPTTPDLTIEGTVAGGQFGNGLAALRWDDDGV
FT                   DDLVVSAPLSGSGQVFVFRGGSDFAASGPGDAAANIEAGSGAGDWFAGSALGFALTSAH
FT                   FDDDERADLVMSAPGGGGGNGGVVVLYGGQATQDAVLSSLGSGGSGALKARVLEDPDPG
FT                   NIFDDPDAPFFGHYAFLLGRTEGALDSTDDIAVGYTENNALVVFRGRPQPDSAGVSIAA
FT                   FDPALDLEIVRNTPDTVTGFGSAVASIEDLNGDGARDLVVGAWRDAANDGRVELYRGNA
FT                   VGAGVSNSSIRLGSLIHDDSLCAEVGCGLGSAVVNNAAGGGAPDIDGDGREDLLVTAGI
FT                   GAGQVRLLVWFGGDIPLGGDEPMGTAQYVIDAPADFVAGAFGSSSESSPIQALWAGDVN
FT                   DDGLEDICWADWSAGERDGAFELLFDPDPEPSPE"
FT   gene            612410..612571
FT                   /locus_tag="Hoch_0446"
FT   CDS_pept        612410..612571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13087"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK53"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13087.1"
FT                   /translation="MNQHDEQQSENPAETRLPYEPPAVLSEEVFETLALSCAKANALSC
FT                   PGGNPDRS"
FT   gene            612585..613010
FT                   /locus_tag="Hoch_0447"
FT   CDS_pept        612585..613010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0447"
FT                   /product="putative phage repressor"
FT                   /note="PFAM: Peptidase S24/S26A/S26B, conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13088"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK54"
FT                   /inference="protein motif:PFAM:PF00717"
FT                   /protein_id="ACY13088.1"
FT                   /translation="MLHDAALHDALLRELSAGPDGAWVTCAGNSMEPTIRRGERVRVRA
FT                   CGRARAGQVVLFRARRGGYVLHRVLLVLPGSGWFAHIGDAGSGDGPGLAHQSWVVGTAA
FT                   VSHRPPTPGQRAAACWRFVRGAQRRVRRRWRERLATS"
FT   gene            613274..613840
FT                   /locus_tag="Hoch_0448"
FT   CDS_pept        613274..613840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13089"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK55"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13089.1"
FT                   /translation="MARQIDIRDTIRFPRQLVFEMYRENLSELDVYLPNIESIKVEKRT
FT                   ELDEHRVEFVNRWQAARTEVPALLRPFIKPEMLQWLDYATWDERDFSCQWRTELPLFNG
FT                   AIKSTGVNYYRALGDDEMEIRLTGSIEVDASKIPGVPRLMYGKVATAMENAVLKVTEPN
FT                   LRAVNQSFARYLTEQRAGSAARAAS"
FT   gene            complement(613962..615755)
FT                   /locus_tag="Hoch_0449"
FT   CDS_pept        complement(613962..615755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13090"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK56"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13090.1"
FT                   /translation="MTTPVANQLAPQRRRWPMRSALAAALLGAALGTSLGGGDAHAQQN
FT                   QQTPDDIADDTDKPDDAETRVIDIRVVEVAGGRAYIQPGEGAGVRLGQNVRIGGRRYRV
FT                   VAVESDYAVIDLGDRTLREGDRGRTRVSIRAMTGSPLPPTVPLSDFEGQWRPATPPALA
FT                   ENPERVPLGPTGAGGNYRLVVFGGAAAFVPLVDEAEPVVYGTLGGRMHAEPWRELPLSF
FT                   DADVAVSLWLGQGLDSDIGADSRPLINVRELAAYYGDDTTPIGVGLGRLRYAASTLGLL
FT                   DGVRLSSPSFGNVRVSAFGGVVPNPLDGSLDFDHRRFGVEATYYAPKASWQPMLSVVAH
FT                   GSMFDGQLDERRVSATASSFFGPVAASAYGEVSMFDEDNPWRNEQIELTAAGVDASVRF
FT                   GKARLGARLDTRMPERSYWLASLLPGAWLCTPWPDSPDVDEACNGSRDARHSAALDAQY
FT                   DLGRLLLSAGGTVVSLSSDDTIEAVTGFADARLLEIFDRYRTELGVYAAHTDFLDTAAV
FT                   RAGFGGPMPLVDALDFSLYYRPAILRYSAAIDDKLDHRVGLDTLYTASPRLDVAFTVEA
FT                   AAGDDILALAAFATAVWRPQL"
FT   sig_peptide     complement(615627..615755)
FT                   /locus_tag="Hoch_0449"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.935 at
FT                   residue 43"
FT   gene            complement(615752..616690)
FT                   /locus_tag="Hoch_0450"
FT   CDS_pept        complement(615752..616690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0450"
FT                   /product="cytochrome c family protein"
FT                   /note="KEGG: acp:A2cp1_2850 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13091"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR029467"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK57"
FT                   /inference="similar to AA sequence:KEGG:A2cp1_2850"
FT                   /protein_id="ACY13091.1"
FT                   /translation="MKRRILSISLASALAGLALCALVIAGPGARAVADDQAPAATTKVS
FT                   PHDRSLIGERDCSECHTPAGWSLSGDGGGFDHAQTGFPLTGTHASVQCIDCHVGNRTIT
FT                   RDCSNCHRDAHQGRLGIQCDQCHNTRNFRDTRAIERHRRTRLPLTGVHAVLPCSSCHIR
FT                   TAGRSSGRTYAPVPATCFSCHEKDYRSDIHPVHQGDANDPSLAQFPRDCEACHRPIAWS
FT                   PAVLDPRSLQRLSTVQQSLRDHDRHFPLSFGKHRGARCESCHLTTANPRLLTCTGCHNH
FT                   SPARLRMSHQGKAVASDAAGCLRCHPGGIAR"
FT   sig_peptide     complement(616589..616690)
FT                   /locus_tag="Hoch_0450"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.635 at
FT                   residue 34"
FT   gene            complement(616695..618560)
FT                   /locus_tag="Hoch_0451"
FT   CDS_pept        complement(616695..618560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afw:Anae109_2645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13092"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR029467"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK58"
FT                   /inference="similar to AA sequence:KEGG:Anae109_2645"
FT                   /protein_id="ACY13092.1"
FT                   /translation="MPTPRLDTLFTARRRPHLLRLAAWVLAAGLVLLAGGNAAHAQLFS
FT                   PGKLHNVHADLEGDDKCTECHERGRRIDQSGCLGCHDDLAARIRQREGLHGRNYRDQRC
FT                   AGCHVEHLGRKGRLIRWPGGKRENLNHAQTGWTLRGEHRQTGCDKCHDKRNKRGNRTFL
FT                   GLDTACTSCHEDEHNGRFGKTCTKCHSETGWKQVDIDEFDHSLARFQLRGKHTSVDCQE
FT                   CHGKPAKYRGLAFQSCNDCHEDPHKGRFKQRCSDCHSERGWDKVEGLRENHPGVRLVNG
FT                   HRQVACADCHDRGNDRVPSKGTECAGCHPPVHKARFGNDCADCHRSIKWLGLPERLGRR
FT                   VHGRTRYPLRGEHREVSCQSCHPRRLPPPRRFRGIEFNRCAGCHEDKHEGRFQKRDGGE
FT                   CAQCHRVTGFRPTTFGVDEHASTQFALDGRHRAVPCSQCHTGERPRLDFRIAERACASC
FT                   HENPHGTQFAAEMQLGGCAQCHSTTGWRNPKVDHSTWPLTGAHAMAACSSCHNVSDEDR
FT                   AAGKAATYRGVPRECASCHRDEHAGQFRLSEPALPCSGCHETKSFRIQSFPHAERTGYE
FT                   LVGQHASTACESCHPQEQLANGSTVRRYRLGYRECRDCHANPHRE"
FT   sig_peptide     complement(618435..618560)
FT                   /locus_tag="Hoch_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 42"
FT   gene            complement(618605..619519)
FT                   /locus_tag="Hoch_0452"
FT   CDS_pept        complement(618605..619519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0452"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="KEGG: acp:A2cp1_2852 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13093"
FT                   /db_xref="GOA:D0LK59"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK59"
FT                   /inference="similar to AA sequence:KEGG:A2cp1_2852"
FT                   /protein_id="ACY13093.1"
FT                   /translation="MASSSPGPGARPSPAPRRKKPKKKKRGIRFTVALTMALLVAAVCL
FT                   WRGWGYYQLSLGERLDHPDYEALRPSGSIGMFYGVVGTVLIFANLLYLARRRLAGFRNF
FT                   GPMRVWLDLHVFTGLVGATFIIFHSTFQARSWPNQVTAISLIVVIVSGLIGRFFYALIP
FT                   KPDVRPFEDALAELEEALPGFSAQVAAAVSQHPPEETRGDPALLRTLRALPGWRRTAHD
FT                   RREAVELILYNSPILESLDPRARSHVRRVTRKLARAAALQAYGVAADAMLRAWRPIHRL
FT                   FAFIMLCTVILHIGVAFYFGYIF"
FT   sig_peptide     complement(619394..619519)
FT                   /locus_tag="Hoch_0452"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.617) with cleavage site probability 0.238 at
FT                   residue 42"
FT   gene            619741..621078
FT                   /locus_tag="Hoch_0453"
FT   CDS_pept        619741..621078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0453"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; KEGG: lch:Lcho_1553 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13094"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK60"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACY13094.1"
FT                   /translation="MTSILLIAGGVMLVVVSHSAWVRFRREHGERAKDVWEDVAALGDD
FT                   LVPASIHPNIDPDICIGSAACVNACPEKDVIGLVHGRAQLINPLACVGHGACAAACPVD
FT                   AINLVFGTAKRGVELPVVDETFQTNQEGVYVVGELGGMGLIRNAIKQGREVGEYIAASE
FT                   RRGGGEVLDALVIGAGPAGISATLSLMNENMRVLLLEREEFGGTIVHYPRAKVVMTGVL
FT                   EIPRYGKVRKRTMRKEDLVGLWEDIRANTDLPVQTGELVESLQQDAQGSWVAASTSGSY
FT                   RAANVVLALGRRGSPRKLEVPGEELGKVYYRLIEPEMFRDKHVLVVGGGNAAAECALAL
FT                   SGDVGDNPHGGRCASISISYRRAEFARLRGQVREQLEAAIAGKRIHALLSTNVTAVSDL
FT                   EVTLERDDGTTFSVYNDAVIIQVGGTPPTQLLNTFGVATETKYGEA"
FT   sig_peptide     619741..619800
FT                   /locus_tag="Hoch_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.926 at
FT                   residue 20"
FT   gene            complement(621290..621838)
FT                   /locus_tag="Hoch_0454"
FT   CDS_pept        complement(621290..621838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_2644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13095"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK61"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13095.1"
FT                   /translation="MQVNREGIRAKLRLAMITILPTRWLGAALAAVLFGSLSTACDTPH
FT                   GANVMEVEGGDCRTCHLADHQKAIFPNHVSGNVPENCEGCHYETFWRPPFLLRLHKERE
FT                   FPLINTDHEEFTCAECHDPNLPDVPSIAGENADCVNCHTGAHLPAEMEEVHEGVLDYPT
FT                   GDQPPNFCLSCHPDGINRL"
FT   sig_peptide     complement(621716..621838)
FT                   /locus_tag="Hoch_0454"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.995 at
FT                   residue 41"
FT   gene            622419..624182
FT                   /locus_tag="Hoch_0455"
FT   CDS_pept        622419..624182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0455"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce1937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13096"
FT                   /db_xref="GOA:D0LK62"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK62"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13096.1"
FT                   /translation="MKISLLNQITSGSAHIGMYRALGIACAGLALSGSACTGQVNADGA
FT                   SGDGIALPRPDGPVDTPQPGSSYELGETVPIVLHPVHLDADGGTELVGFGMPFPRGMLA
FT                   DAEQIAFFDAEGAELPAAVRTILPWRTLGEARDSDGSVRAAQVFVSVAFPDDRPLSIVA
FT                   ELGTRRTQQLELAADAEPSDSWVAVRDDDYAIELAEPAVYATLPPAWLGACELRTVTTP
FT                   AYEDGDWKWFDEFSVGAAHTATNDVPDSVSSDELIELEDNEPWLFDRTATLFGVYARTG
FT                   DITWLRRAHRSARFYLANFTDDGYFAYKDGDLKYVYGLSLLVDLMLTGDAALERTIARV
FT                   AETHLEWRPGYDIDVNFWTERHQTYALLGALSAWELTGDEAHAERVAEIVEASFAAASS
FT                   PPSGWPTDGCMLHTMRAHEGDDSDQPVCSPWMNALFADAMWRYYWHSRDGEALVFLADL
FT                   ADFIVEHGLYDGSDEGVDFLVPWYLVSSVYQYSDAGAWGDLEHTCDVANVVARGAWARK
FT                   QLGEDYSLLADTAVELVSGCQYVLDYWHRPDGVSDGRPEWRLSPARKFNWWFGTTSDMP
FT                   WIFGELGIAPR"
FT   sig_peptide     622419..622547
FT                   /locus_tag="Hoch_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.876 at
FT                   residue 43"
FT   gene            complement(624268..624918)
FT                   /locus_tag="Hoch_0456"
FT   CDS_pept        complement(624268..624918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0456"
FT                   /product="YhhN family protein"
FT                   /note="PFAM: YhhN family protein; KEGG: afw:Anae109_0591
FT                   YhhN family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13097"
FT                   /db_xref="GOA:D0LK63"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK63"
FT                   /inference="protein motif:PFAM:PF07947"
FT                   /protein_id="ACY13097.1"
FT                   /translation="MTAAAACSVAVVAALIGGLIAEARAWRRSYGACKLLASAGFVATA
FT                   LSQGLPATPYGSYVLVGLLFAWLGDACLLTRDARGWWFRAGLVSFACTHLLFAWAFLHQ
FT                   DAEPRLLVLALAAMALPGALVWRWLEPLVAASMRRAVSVYIVIISTMVAAGLSAFAAGA
FT                   PGLLAAGALLFYVSDMFVARQRFVVAEMRNRIIGLPLYYSAQLCLAWTVVLEH"
FT   sig_peptide     complement(624853..624918)
FT                   /locus_tag="Hoch_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.587 at
FT                   residue 22"
FT   gene            complement(624915..625847)
FT                   /locus_tag="Hoch_0457"
FT   CDS_pept        complement(624915..625847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0457"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13098"
FT                   /db_xref="GOA:D0LK64"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK64"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACY13098.1"
FT                   /translation="MTQSIPEIRPYRSDDADAVVAFFKRAVDGDGSIPVLDRAMWDAFV
FT                   EHPSCCAGEDFALAFVDDELAGLLTSVRTDRVRSLRILVHPDYRRRGIASALLARARDQ
FT                   DADDGAAPGSDDEIVLRAACPDTWTAAIPFYEAHGFTAAHRELFMIWHGVRLDERVAVP
FT                   EGYALRPVEAADHARLTALHNQAYRDAYDYHPLSLEDFRHALAQHDSQLTLAEREGELA
FT                   GFVHFTHARGGPGYIDSLVVDVDHRGTGLGRCLLVHAMRELLDAGRDPLGLTVATDNAA
FT                   ALHLYNALGFEGMGQSIMLAAPRSAVVGL"
FT   gene            complement(625867..629283)
FT                   /locus_tag="Hoch_0458"
FT   CDS_pept        complement(625867..629283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0458"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; WD40 domain protein beta
FT                   Propeller; peptidase S9B dipeptidylpeptidase IV domain
FT                   protein; Amidohydrolase 3; KEGG: mxa:MXAN_0075 WD-40-like
FT                   repeat-containing amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13099"
FT                   /db_xref="GOA:D0LK65"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK65"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ACY13099.1"
FT                   /translation="MLHRTRSLPLALTASLGLGLLGACAGANSTAPDSANATPQAHAQA
FT                   APLSFHPPAGAAAAPAKDGEKPKWNVEQPPGPTFEVSIDTDEGTWMSLDLSPDGKEIVF
FT                   DMLGDLYTLPIAGGEAKPLTSGIAWDMQPRYSPDGRFIAFTSDRGGGDNLWIIDRQGEN
FT                   PRQVSSENFRLVNSPAWTPDGQFLVGRKHFTSRRSLGAGEMWLYHIAGGQGVQLTEKQN
FT                   EQKDTGEPVFSPDGRYLYFSQDSTPGPVFEYNKDPHAGIYSIYRLDREEGHLETLISGP
FT                   GGAVRPTPSPDGTRMAYVRRIGLDTALFVYDLASGEQRPVVVGLDRDMQETWAIHGVYP
FT                   TMAWTPDNRSIVFWAGGKIQRVSIGAKAGEDRVSEIPFHVKDTRTVSKALRSPIEVAPE
FT                   RFHTRMLRSVQVAPDGSAAVYQALGHIYLVDLANGQPKGAPRRLTRDDDVFEFYPSFSR
FT                   DGRSIVYVAWSDERLGSVRMIARRGGRSRTLTSQPGHYVEPVLSPDGKHLVYRKVGASS
FT                   VRAQSYTHDTGLYALSLAGGEPERISRSGNSPHFGGDGKRVFFLDTEGGGSAQKFQLES
FT                   VGIDGKDERVHLRSDAALEYAVSPDGRWVAFQEYAAAYVAPFPRTAKPIDISRESKAMP
FT                   VTKVSADAGANLHWSGDSAHLFWSLGPELYTRALTEMFAFVDGAAAELPPLASQGVDLG
FT                   FDVATAKPDSTIALVGGKAVTMNGDEVIDDAVIVIRGDRIAAVGPRASVTIPADARRID
FT                   VSGMSVIPGLIDVHAHGPQGGHGITPQRNWLHYATLAFGVTTVHDPSNDTGAIFAASEL
FT                   ARAGMITAPRIFSTGTILYGANAPIKAVVDSFDDALANLRRMKAVGAFSVKSYNQPRRE
FT                   QRQQIIAAARELDMMVVPEGGSLFQHNMNMVVDGHTGIEHAVPLGRGYADMKQLWGATE
FT                   VGYTPTLGVGYGGLWGENYWYAESDVFAHPRLTSFVPPFAHEARTRRRVLASEGDWNHI
FT                   RIAALCKELLDAGVKIQLGAHGQREGLAAHWELWMLVQGGMSPHEALRAGTLHGAYYLG
FT                   LDGDLGSIEAGKLADLAIVEGDVLSDIRRSENVRYTIAGGRVYDAATMDQIAPVSSKRA
FT                   PFFWERDDGAAHVSRPADSEGHGLGCSCGAH"
FT   sig_peptide     complement(629200..629283)
FT                   /locus_tag="Hoch_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.344 at
FT                   residue 28"
FT   gene            complement(629371..631110)
FT                   /locus_tag="Hoch_0459"
FT   CDS_pept        complement(629371..631110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0459"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /note="KEGG: xac:XAC2436 XamI DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13100"
FT                   /db_xref="GOA:D0LK66"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK66"
FT                   /inference="protein motif:PRIAM:2.1.1.72"
FT                   /protein_id="ACY13100.1"
FT                   /translation="MGPLEHPLEQCPGSPPEQQHELPEARPLADEHALAAVCEALGGRR
FT                   VAGWSAGEEQLVGSGRALDSARLEDIRAALRAGRDPLGEAFCALRAPALRRRDGATYTP
FT                   PAIIAAMLDWARVAFASGNPGAFAAGPARIVDPGTGSGRFLCAAGRAFPQAHLLGVELD
FT                   PLAALMARANLAAAGLAARATVRVGDYRAIALDRAGEGATLFLGNPPYVRHHDIAPRWK
FT                   RWFSDTAASAGLPASQRAGLHLHFLLATLRHARPGDAGIFVTSAEWLDVDYGRLARALL
FT                   CGPLGGQRVDILEPTASAFRDAQSTATIVGFRVGARSASVRLRRARSLAELAPLRGGQP
FT                   VCRELLARSPRWSPLSRPPPPPALPASLADADKLVELGELCRVHRGQVTGANRVWIEDP
FT                   DSPPVPEEFLFPAVTRARELFAAGAALTQAHPLRRVIDLPRDLSALPAQQREAVTAFLA
FT                   WARARGAHESYVARHRRPWWSVKLREPPPILATYMARRPPAFVRNHARARYLNIAHGLY
FT                   PREPLPAASLDALSVYLSRSVDLGDGRTYAGGLTKFEPREMERLLVPTPQALAARAAHS
FT                   DAA"
FT   gene            complement(631128..634106)
FT                   /locus_tag="Hoch_0460"
FT   CDS_pept        complement(631128..634106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0460"
FT                   /product="D-lactate dehydrogenase (cytochrome)"
FT                   /EC_number="1.1.2.4"
FT                   /note="PFAM: FAD linked oxidase domain protein; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   aha:AHA_2556 iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13101"
FT                   /db_xref="GOA:D0LK67"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK67"
FT                   /inference="protein motif:PRIAM:1.1.2.4"
FT                   /protein_id="ACY13101.1"
FT                   /translation="MPAHAPSDAALADALRRVMPAERVLTRRIDRVAYASDASFYRLVP
FT                   RVVVQPSSVDEIHGVFAVSHAQRVPMVFRAGGTSLSGQSITDGILVELGRGWDALELLP
FT                   EAVANASANASSDASSDASLGARVRVGPGVIGSHVNRALAPRGRRIGPDPASIDSCRVG
FT                   GIIANNASGMCCGVVENAYHTLDSLVYLLPGGAVIDSAHPEADAHLREQAGEVAAGIAE
FT                   LRDRVRADAALCARIRDKYQRKNTTGYALNALLDHERPAEILARLMVGSEGTLGFVAEA
FT                   VFRTLPAYRFRRTALLLFADLRHATEATRSLAASGVRAVELLDRVSLRAAQDFPGMPPE
FT                   ARGLPARGAALLVEYQCARAEQQDDMRRASERVLGELPLAAPARFTEEPAEQAALWRIR
FT                   KGLFPLVGATKARGETVIIEDVAFPLERLADAVTDLRALFAAHGYDDAILFGHAKDGNC
FT                   HFVLKQSFNRDDEVARYRAFIDELVELVTKRHDGALKAEHGTGRNMAPFVEAEWGREAT
FT                   AHMRALKALVDPDNLLNPGVVLTDNVNAHVEDLKRLPAIEDEAERCIECGFCEPVCPSR
FT                   RLTLTPRQRIVVRRELARLEAEPGRSSEEQELRRDYAYAGLATCAGDGLCAGACPVAID
FT                   TGALVKRLRGQAQAPRVRGLGGWLSRHPRALERMMRVSLGLAHVASRVLGARALRGMST
FT                   VMARLSKRLLGLRLPQWSPSVPRVPRRLPRTALPPGSGDAAGAEAATLVYLPSCMTRIM
FT                   GHAPGDSDRAQPSLMAVMSTLAERAGVTLWIPDDAPGSCCGLPFGSKGLGDAQRALLGE
FT                   LVARMWRWSDEGRRPVVVDASSCVHVIRHGSGLLDGASEDRLRRMRVLDSVELIASWLG
FT                   GGRLRARALDQRVALHPSCATRKLGLADDLVQVSQRCAREVRVPEALECCAMAGDRGLL
FT                   YPELLASATEREGAEVRAGGFDGHYSTNLTCEIGLSSAIGVPYRSFLYLVEAATRPVGE
FT                   DGI"
FT   gene            634240..635415
FT                   /locus_tag="Hoch_0461"
FT   CDS_pept        634240..635415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0461"
FT                   /product="TraB family protein"
FT                   /note="TIGRFAM: TraB family protein; PFAM: TraB determinant
FT                   protein; KEGG: dol:Dole_2685 TraB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13102"
FT                   /db_xref="GOA:D0LK68"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="InterPro:IPR005230"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK68"
FT                   /inference="protein motif:TFAM:TIGR00261"
FT                   /protein_id="ACY13102.1"
FT                   /translation="MDSEFPASETVTVLEHEGRTLYLVGTAHVSEASVDEVQDVIERLR
FT                   PDVVCVELCQARYNALTSQDAWKNLDIFKVIREGKTLFLLANLAIGAYQRRIGDDLGVK
FT                   PGAELLAAVKKAEEVGARVVLIDRDIHITLKRTWANLGFFDKMALGGAIVQSMFSREQI
FT                   SAVEIENLKQQAHLSEMLSEFAKEMPAVKEPLIDERDQYLMSGVEAAGGDKVVAVVGAA
FT                   HVPGMQANLGKPVDRARLERLPPPSRIVQALKWLIPALVIFFLVRGLLGKQDASFEEIL
FT                   FAWVLPNAVMAGLLTAVAGARLLSILCALVASPLTSLIPVMGAGMVVGLLEAWLRKPTV
FT                   EDCENINRDVQSVRGVYRNPVTRVLLVAVAATLGSALGAWIGIAWIATLLS"
FT   gene            635755..636903
FT                   /locus_tag="Hoch_0462"
FT   CDS_pept        635755..636903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13103"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK69"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13103.1"
FT                   /translation="MAQACGGGLEIVAVAVRLGVVVLVVMGTLAGPAQAQSAIRAGDVS
FT                   QPALVHQDEVTGLVYPDKITRVQPVPEDVLLFEIFENRLYVLPKKGTAPGTEVMLEVET
FT                   RAQRLILWVLVVKQVQDADKRLIVLAPGSPYGDEPDMRRELASSMYEGAEGWETSVAAD
FT                   AGEAEAADGAGAEAAAEDAAVVVVDESENASEPAPTEGQPFELSVHALGGLGVMELGAQ
FT                   GLPASTSRRSYAAMGGRLSIAPPESWWAVEADVGVLFPDGPFTYQTGGAGAGGELSVAG
FT                   PLVRGLASLRMRTGTTWIPSAFAGVGMQAHLRTVDPGLSNRRQVEQIFPRAVVWAFGVG
FT                   LQHRTCSDWLLGFDVVSHQGGPDEYFSVAARFSVGRFLTQRE"
FT   gene            637323..637748
FT                   /locus_tag="Hoch_0463"
FT   CDS_pept        637323..637748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13104"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK70"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13104.1"
FT                   /translation="MKYAVLLLPLLSFAVACGPPDNGPLRNRYRLDWHCVSPDGCERSE
FT                   ELQRIDRAYSTDYEWEFASTVDDSFEEYAMRILTDSLGSGCAWLYDLTLLGYNLQRSRQ
FT                   CYTVAGFELELSIPNEDPATFSEWVVVGRDIDVLGEE"
FT   sig_peptide     637323..637373
FT                   /locus_tag="Hoch_0463"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.861 at
FT                   residue 17"
FT   gene            638029..639174
FT                   /locus_tag="Hoch_0464"
FT   CDS_pept        638029..639174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0464"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13105"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK71"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13105.1"
FT                   /translation="MAQACGGGLEIVAVAVRLGVVVLVVMCTLAEPAQAQSAIRAGDVS
FT                   QPALVHQDEVTGLVYPDTIARVQPMPEDVLLFETFENRLYVLPKKGTEPGTEVMLEVET
FT                   RAQRLILWVLVVKQVQDADKRLIVLAPGSPYGDEPDMRRELASSMYEGAEEWETSVATE
FT                   AGEAEATEGAGVEAAAEDAAMVVVDASENAPEPAPTEGQPFELSVHALGGLGVTALAAR
FT                   RGVGNTRVAHATTGIRLGWAPSASFWEVEADARAAWPTGALTVESDEGDETTTTSGTWL
FT                   RGTVGVKVGAGEVWRSSLRASVGGLAHVRSTVWESVGEQDRSESMPLGAVFSVGAGLER
FT                   RLRGDLVVGIDWELSRSGLDDYLAVGMQVSVGRILEKRSSR"
FT   gene            639722..640009
FT                   /locus_tag="Hoch_0465"
FT   CDS_pept        639722..640009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13106"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK72"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13106.1"
FT                   /translation="MQIDRATQVNVYTLQFASTVDESFGEEALRVQSDTLGVDCWWVYD
FT                   ISLLGYDLERSRQCGTVAGFELELSIPNEEPATSSEWVVVGRDIDILGED"
FT   gene            640180..640524
FT                   /locus_tag="Hoch_0466"
FT   CDS_pept        640180..640524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13107"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK73"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13107.1"
FT                   /translation="MRRSLLALLFVALPLLMAPDCVSYGDGSSNPIDPSDCTANVSECL
FT                   ASDLGSRRGGKWGRSVCVDCLEICEGSVPRRWPHFQQQGKDCRWWLYQIVFAIDEVIEE
FT                   QEVSNESTSR"
FT   sig_peptide     640180..640251
FT                   /locus_tag="Hoch_0466"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.819 at
FT                   residue 24"
FT   gene            641072..644068
FT                   /locus_tag="Hoch_0467"
FT   CDS_pept        641072..644068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0467"
FT                   /product="pyruvate phosphate dikinase PEP/pyruvate-binding
FT                   protein"
FT                   /note="PFAM: pyruvate phosphate dikinase PEP/pyruvate-
FT                   binding; KEGG: dat:HRM2_03500 PpsA2"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13108"
FT                   /db_xref="GOA:D0LK74"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK74"
FT                   /inference="protein motif:PFAM:PF01326"
FT                   /protein_id="ACY13108.1"
FT                   /translation="MSNELLYREPWYRRYQALMPHLVREILLVSSAYDAFVLEEDGPLS
FT                   EQLVTGYTELSLVSIPRITHTRTAEDALRLIDERRFDLVLTVGQVSDAGAAELSRAVKA
FT                   RQPHVAVVLLLFDEGDLRLFPGETLPPTIDLAFLWSGDARTLIAAIKLIEDHANVFDDA
FT                   RTAEVQVLLVVEDNLRAYSTFLSLLYPELLSQSNALLQEAHNLHHRALRMRARPKILLA
FT                   RNYEEAEHCVRMLSEQLLALFSDVRFPRDGEENPRAGLELVEEVRKTLPDLPVLLVSSE
FT                   RNLAAHARDLHVWHLEKSSPTLPTEVRKFLSEAVGFGDFVFRRPDGSVIARARNLYELE
FT                   QSLAEVSSTSVAHHGARHDFSVWLRARGMQALATQIRPLTLDDYGDVEEAREHMLRILR
FT                   AARESDQEGIISDLSAPPSAAETRFMRIGRGSIGGKGRGIAFVRSLIVSHGLATHFPRL
FT                   EIRIPRTVALSTEAFERFVDRNRAHLELDRMQHSGSRARTIDESGRASFARWMAADFDP
FT                   DMARDLEPAVRALQGPLAVRSSSLLEDSRFLAFAGVYATYMLRNSHPDPAVRFAHVLAA
FT                   IKAVYASVYSEAAQSYMAATPHLLEEQRMGVVIQHVVGKPYGERYYPLLSGVAQSRNYY
FT                   PAGSQRAEEGVAAIALGLGEIVSSGGSSLLFSPGCPQVLPQFPDAQSFLRSSQTQFYAL
FT                   DMSQHEFDPLAGPRASLVSCDLADAEADGTLKAIGSTFMPDDGVLRDHLAARGPRVVSF
FT                   NNILRHKSFPLAEALSVLLDLLRSMVGGDVEMEFAVHAPYRGEEHPARLYILQMRPMPP
FT                   YLRQGAAVDLDAVPAERVLIRPDGVLGHGVEEICDVVYVTRTDLGHRDTPEVAMEVRKI
FT                   TAPLHEDGRPYLLIGPGRWGTTDHSLGIPVSWRDISGSRVIVEVPLADRYVEPSQGSHF
FT                   FHNLTSMRIGYLTVGGEGPAAWSRDWFDAQTEVRASERVRHVRLQQPLLVQMDGMNAQG
FT                   AVLKPEQPE"
FT   gene            complement(644072..644866)
FT                   /locus_tag="Hoch_0468"
FT   CDS_pept        complement(644072..644866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0468"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: afw:Anae109_2448 TatD family
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13109"
FT                   /db_xref="GOA:D0LK75"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK75"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ACY13109.1"
FT                   /translation="MQFIDSHAHIDAADFDSDRPEMLARAHSAGVREIVCVGAADDLET
FT                   AERTVAFAETHEGFYATVGIHPHNADAMQPGWWSELETLAARAPVVGVGETGLDYFYDN
FT                   SPREQQRDCFARFLALGRALGLPVVCHVRDAHDDARAILREADAGSIGAVIHCFTGTPE
FT                   DAAAYVDMGLYVSFSGIVTFPGKRSAPVREAVRKVPADRLLIETDCPYLAPVPERGKRN
FT                   EPAFLVHTAEVVAREAGMSLAELADATAANTRRFFGLPTPPA"
FT   gene            complement(644869..645993)
FT                   /locus_tag="Hoch_0469"
FT   CDS_pept        complement(644869..645993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0469"
FT                   /product="HEAT domain containing protein"
FT                   /note="PFAM: HEAT domain containing protein; PBS lyase HEAT
FT                   domain protein repeat-containing protein; SMART: PBS lyase
FT                   HEAT domain protein repeat- containing protein; KEGG:
FT                   scl:sce1810 putative phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13110"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK76"
FT                   /inference="protein motif:PFAM:PF02985"
FT                   /protein_id="ACY13110.1"
FT                   /translation="MTYELRSNTITFEAALRDLGSSRPQTRAQAAHALGDVSGADERTR
FT                   AVPALVEALADERMEVRAEAALSLGELEDAAAVEPLVASIDDTVPAVRQSAVIALGRLG
FT                   YPAAFDAVARALRKGPPDVRFQAATTLAELDAERAREPLRAALDDSDGEVVGAAAVALG
FT                   AIGDADARPRLAALLETWSTPQTRLDIAYALAELGDVRAVDVLGGVVDLEACAWDAIEA
FT                   LERLGTSLTPPGDSAAASDPEAGADDAGGPPALLGGDAADPATVRNAAATYIAPLLRKR
FT                   FKPTLKLRAAAAVLALDPDNPAADSARRTLVTGLRARRREQRGLAIELLGRVGDHDAVL
FT                   ALERLASRRAGRPFGDEIAEAVANIRARNGAAHA"
FT   gene            complement(645990..646514)
FT                   /locus_tag="Hoch_0470"
FT   CDS_pept        complement(645990..646514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13111"
FT                   /db_xref="GOA:D0LK77"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK77"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13111.1"
FT                   /translation="MPTTLYQFRPRYRALALGAMSLGAVLAAVGVVEAGRAATYALAGG
FT                   IIGVLLGTVYLLSPVWRLRVRTDEDGLSVEHPRAAEPRFRLAWSEITRVIASAETRTCF
FT                   VDGGTAERSLLVPGPGASAPYDITGKAALYQTIVERVPAERIEWVALIEQARAAEAAKA
FT                   KDAADPPAGAS"
FT   sig_peptide     complement(646431..646514)
FT                   /locus_tag="Hoch_0470"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.578 at
FT                   residue 28"
FT   gene            complement(647401..647721)
FT                   /pseudo
FT                   /locus_tag="Hoch_0471"
FT   gene            complement(647929..648237)
FT                   /locus_tag="Hoch_0472"
FT   CDS_pept        complement(647929..648237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0472"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   afw:Anae109_4034 antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13112"
FT                   /db_xref="GOA:D0LK78"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK78"
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /protein_id="ACY13112.1"
FT                   /translation="MFIAMNHFKVLEDKGEAFEQAWRERESFLDDVDGFVSFHLVAGAN
FT                   DEDGLRQYASHTVWRDEAAFRAWTESEAFRKAHSQGKLSGILAGPPKLACWTAVPLS"
FT   variation       648055
FT                   /locus_tag="Hoch_0472"
FT                   /replace="t"
FT                   /note="SNP"
FT   gene            648303..649097
FT                   /locus_tag="Hoch_0473"
FT   CDS_pept        648303..649097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0473"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mxa:MXAN_2034 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13113"
FT                   /db_xref="GOA:D0LK79"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK79"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACY13113.1"
FT                   /translation="MSVRCEINGPVTTVILDRPTMRNAVDRVTAQALADAFRAFDADED
FT                   ARVAVLCGAGESFCAGADLHAIAAGQPNRLEPTGDAPMGPSRMILSKPVIAAIAGYAVA
FT                   GGLELALWCDMRVAERGAQFGVTCRRFGVPLIDGGTVRLPRIIGHSRALDLILTGRVIS
FT                   AEEAMLIGLVNRLVAPGSARAEAEALAHELAALPQQAMRGDRLSAYEQWDLSYEAAMAN
FT                   EFEHGRAALAAETRSGAQRFHRGAGRHGSSVAADASSEPSES"
FT   gene            649130..649501
FT                   /locus_tag="Hoch_0474"
FT   CDS_pept        649130..649501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13114"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK80"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13114.1"
FT                   /translation="MRLWLLLALALASVATGCARPGRGTLFHRPTGTCAGACEHYLACK
FT                   AERGDPVDDEQMLTCELECAQVFSGSEPLLAFESLRCEDAIAFVEGESGRGPGEVREAA
FT                   AEEVVTPSEKNPETAPPTP"
FT   sig_peptide     649130..649189
FT                   /locus_tag="Hoch_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.603 at
FT                   residue 20"
FT   gene            complement(649523..651226)
FT                   /locus_tag="Hoch_0475"
FT   CDS_pept        complement(649523..651226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0475"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bba:Bd3149 long-chain fatty-acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13115"
FT                   /db_xref="GOA:D0LK81"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK81"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACY13115.1"
FT                   /translation="MDVTPFLELHPAPHAVFERIANDPALGERPRFHVPAGGGESAAWV
FT                   PVSWNRFAAQIRQVAMYLHDSGFAAGERAAIYAPNSIAWAAAALGIQACGGVMVPVYPA
FT                   STAEQLAYVLRHSDAKAMFVATAPLLERTASIRAQVPMLERVITLGAIGAEPSTPASSD
FT                   SVSWDELCRSGQQAHDSDPEAVARMIAATPLDTPSVMLYTSGTSGPPKGVPLTHENVGV
FT                   NARDWLECNGPLLDEDMVDLLWLPMSHIFGFGELCLGNTLGFTSYTCTPPEVLGRLPEV
FT                   RPSVLMSVPAYWEKIAQAAAAAPEAERCQRLEEVTGGRLQFCLSGGAGLKREVKELFYG
FT                   CGLLIIEGYGLTETSPTLTLNRPGDFRFDTVGKSLPSVELKLADDGEILARGANVFSGY
FT                   HKDPEATAACFTEDGWFCTGDIGRFTEDGFLQIVDRKKDILVTAGGKNVPPANIELRFA
FT                   DDPTIAHLVVYGDGKKYLVAGVWLDRAAAARAIGSESPGPEQLEALVQTRIDAVNTELA
FT                   RHETIKRFCIMDEPLTVEGGQLTASLKLRRKHVYKAFHDQFEALYDAPRS"
FT   gene            651520..652371
FT                   /locus_tag="Hoch_0476"
FT   CDS_pept        651520..652371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0476"
FT                   /product="PHA accumulation regulator DNA-binding protein"
FT                   /note="PFAM: PHA accumulation regulator DNA-binding
FT                   protein; KEGG: bja:blr0227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13116"
FT                   /db_xref="GOA:D0LK82"
FT                   /db_xref="InterPro:IPR012909"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK82"
FT                   /inference="protein motif:PFAM:PF07879"
FT                   /protein_id="ACY13116.1"
FT                   /translation="MSTPTLIKKYGNRRLYDTGDSQYITLEELSRKVREGTDVRVIDAK
FT                   SGEDLTQVTLTQIIIEGRGAARMLPVPLLMQLVRLGDDALAEFFSRYVSDALSVYMQIK
FT                   RGANAVARYNPFVSMPFAAGDALARMWMTTPFGTSRAAEPSPTWGPSPTQARTPSSAPA
FT                   TESPGESAAAAMPATAAPAATAAPEAAAAAPAAAQSDSHTDAQLALLRQELEELRRSVM
FT                   AQRSKVAETADAASPPPAAGAAETGEVAAAETGEAAAAESKAKAKPAATPRKRAPRKRK
FT                   PR"
FT   gene            652845..653408
FT                   /locus_tag="Hoch_0477"
FT   CDS_pept        652845..653408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0477"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13117"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK83"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13117.1"
FT                   /translation="MKKRSKPEVPSASVQIALELLRSQLVDLEAVAHAAEDALQYLPFV
FT                   PRQPAEAGEEAAEAAPPASAQKASAQKASAQEASAQEASAQEASAQKASAQEASAQKAS
FT                   GPGRSYTDAHLGVGRLHAMVVATAAASRLVLEEADGLIKQMHKMRKLLAGVDGNGSSRA
FT                   GENWQPELLYPEVIKFPNDRRESA"
FT   gene            complement(653528..655114)
FT                   /locus_tag="Hoch_0478"
FT   CDS_pept        complement(653528..655114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0478"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: cko:CKO_04669
FT                   sodium/panthothenate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13118"
FT                   /db_xref="GOA:D0LK84"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK84"
FT                   /inference="protein motif:PFAM:PF00474"
FT                   /protein_id="ACY13118.1"
FT                   /translation="MRYLELIAERPRVWALFIGYMLFTMGLAWIGHKKTADIRSFAIGK
FT                   GDMNPVVVGVTLAASIASTATFVINPGFVYVHGVSALIHLAGSVGFGVILGLVAMSTGF
FT                   RRIGAKSGAVTLPQWIGDRYGSRGLSAFFAIINLGTLAFVVLIIGGLSIVMQQTLGLDN
FT                   AESLILMVVFVFGYVFIGGAYAHAYTNTLQGIIMAIIAVIIIASGLPLLSGGFGEVADK
FT                   LRAVDPNLLETINPASSLFGSFFSVYVSGFIIGFALVCQPHIMTKALYVKDDGAVWKYL
FT                   AVTIVVSLTFSSLLIVGLYAHLAEIPAEALSRQDAVMTSYVTYTFSPNMKAIITVALMA
FT                   AGMSTLDGILVALSSMVANDLFLNFAERGVLAEADKRQKGRAAHRVSQLVLVAIGVIAL
FT                   LISWNPPELLGIFGQVGVYGIVAASAVPILFGIAFPLMDRNGALLAALIGGLTHAVLYA
FT                   LGSWAVGAGVDLNTEAQQLGPLTLLLDLSAPQLGFRNPGVTATYGILASAFAAGAWLLR
FT                   IRSRRGAAQAQ"
FT   gene            655385..655810
FT                   /locus_tag="Hoch_0479"
FT   CDS_pept        655385..655810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13119"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK85"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13119.1"
FT                   /translation="MSQEANTQEKKSFDPTKLLTSGAEAWMKLMRDGMQRAQSMSQDAM
FT                   GQASMGTSLSDPMGLWAAGMDSWKQTTREGLERMQNMWTQLGELEETAAARVQQSVTEL
FT                   SEMMTTSAMQIAKLSRDWRELAFDAVRRSTEKFQDKE"
FT   gene            655807..655941
FT                   /locus_tag="Hoch_0480"
FT   CDS_pept        655807..655941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13120"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK86"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13120.1"
FT                   /translation="MSAAAARPYGLRAGRRDGRAARDARVNPVLHEGFLNRDKPSFEE"
FT   gene            655947..656714
FT                   /locus_tag="Hoch_0481"
FT   CDS_pept        655947..656714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0481"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: mxa:MXAN_0211 short chain
FT                   dehydrogenase/reductase family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13121"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK87"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY13121.1"
FT                   /translation="MQLSDLKIIVTGAASGMGAHFVKRLAEAGAQVAAGDINEDGLAAL
FT                   VADVGETAGAVHTRKLDVSDDANIASFIDWAFDAMGGLNGLINNAGVLRDRLLVKQDRN
FT                   TGEILKLSREDWDFVIGVNLTGATMMVRDVVAKMVENKQGKGVVVNISSIARHGNRGQS
FT                   NYVSAKAALAANTVTWAREFSRFGVRVGAVAPGMIETAMTKGMNQKARDALVASVPVGR
FT                   IGEPEDIWRAVQFIVECDYFNARTIDVDGGLSM"
FT   gene            complement(656801..657814)
FT                   /locus_tag="Hoch_0482"
FT   CDS_pept        complement(656801..657814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0482"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; dTDP-4-dehydrorhamnose reductase;
FT                   KEGG: scl:sce0886 NDP-sugar oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13122"
FT                   /db_xref="GOA:D0LK88"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK88"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACY13122.1"
FT                   /translation="MKILVTGANGFLGSALVRRLCARGLKGIRCLVRPGSDRSRLDAIE
FT                   KEYPGSIELCIGTLNRPSDCVRALEGVDLVQHLAAATGGAPADMFQNSVVATKNLLEAM
FT                   LAEKREIRLVFCSSFAVYGVADLPRGTVVDEETPIEANPTQRDMYSHTKLRQEQLVWRY
FT                   HREHRIPTAFVRPGVIYGPGGGSAISARVGLNLFGIFLHLGRNNVLPLTFVDNCAEALA
FT                   VVGEHPESNGQAYNVVDDDLLGAKEYLSRYRAHVAKLRYLTLPFFATRLLSLAVERYYD
FT                   HSGGQLPAIFTRYKTDSQWKGNRFSNAKLKALGWEPLVSTDEGLERHFAYRRELAA"
FT   gene            complement(657811..658917)
FT                   /locus_tag="Hoch_0483"
FT   CDS_pept        complement(657811..658917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0483"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   scl:sce0887 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13123"
FT                   /db_xref="GOA:D0LK89"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK89"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACY13123.1"
FT                   /translation="MSTELKVALVGCGQIADGHVSEIQKLGNAKVLGVCDLEPLMAEQL
FT                   AERYDVPHHYADYHQMLEMVRPDVVHICTPPGSHLALTKAAVDAGAHVYVEKPLALDYD
FT                   QSVELVQYVEKAGRKLTIGHNSEFDPPSLEMRKLLAQGVIGQPVHIESWFGYNLGGPFG
FT                   KVILGSPDHWVHRLPGKLFQNNINHMLNKITEFITDERPEVKAMAWRRDTSQKFGDVRD
FT                   ELMDELRVIIRGEKVSAYGTFTAAVKPVAHFSRVYGTESIAHLDFISRTVTVDRGATLP
FT                   SAIGRLAAGFSQAAAQARSALDNARRFAASDYHFFAGMNELIRRFYDSILSDAPLPIAT
FT                   RDMLRIAWIMDEIFAQIGKPGRSHGDAP"
FT   gene            659098..660042
FT                   /locus_tag="Hoch_0484"
FT   CDS_pept        659098..660042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0484"
FT                   /product="sulfotransferase"
FT                   /note="PFAM: sulfotransferase; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13124"
FT                   /db_xref="GOA:D0LK90"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK90"
FT                   /inference="protein motif:PFAM:PF00685"
FT                   /protein_id="ACY13124.1"
FT                   /translation="MMTDMSAPHPPHGRPRSIEEVVSILATMNDPRLAELVTSFQPRAS
FT                   DVFISTYPKCGTTWLQQIVHGLRTGGSMDFDDISLVVPWLEMSPLLGIEPDAEQPGTLR
FT                   AFKTHLGWNLLPRGATYIYVLRDPGDVLVSYYHFLNGTLFERDVFDIEVFARELFLPGL
FT                   LPAGAYWEHLRGWWPHHGRPDVFALSFEQLKRDLAGMVRALAAFLGIEDDPALLSLVTE
FT                   QAGFAFMRAHDSKFNEHTLTDAMERLRGMEPGVVAHPSKVRAGETGASARELSAETRAA
FT                   LERRWQHECAPLGLPSYQAAVEQLEREHAERAR"
FT   gene            complement(660079..660969)
FT                   /locus_tag="Hoch_0485"
FT   CDS_pept        complement(660079..660969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0485"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase; KEGG:
FT                   scl:sce6194 phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13125"
FT                   /db_xref="GOA:D0LK91"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK91"
FT                   /inference="protein motif:PFAM:PF01148"
FT                   /protein_id="ACY13125.1"
FT                   /translation="MPKLGNLASRFAVALIAVPALSFIFYSENPVYTWLFISAASLIAS
FT                   HEFFSMTLSDRGDRNASLLLSFVAASALFWLDPAALAASTDNRALMASSGPLAIFLGTV
FT                   PIAIYYLFRFGDVKTVAARAAASITGIFYVGLLFSFVPLVKRDFGPDGGDVMVFLLLIA
FT                   WMGDTGAYFAGRFLGKRKLYPAVSPNKTWAGAIGGLLMSLLSCAVMKLVVIELRDPPSL
FT                   MHALTWFDVCALAIPGAMLGQIGDLFESLIKRSTGVKDSGSLLPGHGGILDRIDAVLFI
FT                   TPYVYLYLTLRGFGG"
FT   sig_peptide     complement(660901..660969)
FT                   /locus_tag="Hoch_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.787) with cleavage site probability 0.775 at
FT                   residue 23"
FT   gene            complement(660992..661876)
FT                   /locus_tag="Hoch_0486"
FT   CDS_pept        complement(660992..661876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0486"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="KEGG: mxa:MXAN_2555 undecaprenyl diphosphate
FT                   synthase; TIGRFAM: undecaprenyl diphosphate synthase; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13126"
FT                   /db_xref="GOA:D0LK92"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK92"
FT                   /inference="protein motif:TFAM:TIGR00055"
FT                   /protein_id="ACY13126.1"
FT                   /translation="MSFEGTPPPVRRLPRHIGIIMDGNGRWAQQRGLPRLEGHRVGADS
FT                   VRDIVRAARQLDVEALTLYAFSAQNWARPPEEVAGLMGLLRDYIVGERQEIMDNDIRLL
FT                   AIGDIERMPSFVRDPLDALVADSANNRSMRLVLALSYGGRESIVRAAKRAIEAVRGGRM
FT                   NPDELDIDGFSKLLPTGELPPLDLLIRTSGEQRISNFLLWELAYAELIFTDVPWPDFRR
FT                   QQLYDALASYAHRERRFGLTGAQISNADSDLGLEPPSALAGAPSEAAASPVSPTSAEVT
FT                   DHPPPAADATSRD"
FT   gene            661971..662822
FT                   /locus_tag="Hoch_0487"
FT   CDS_pept        661971..662822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0487"
FT                   /product="phage shock protein A, PspA"
FT                   /note="PFAM: PspA/IM30 family protein; KEGG: scl:sce5472
FT                   chloroplast membrane-associated 30 kD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13127"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK93"
FT                   /inference="protein motif:PFAM:PF04012"
FT                   /protein_id="ACY13127.1"
FT                   /translation="MGIFSRLGTLIKSNINDLINKAEDPEKMLNQVLLEMQQQLVEAKK
FT                   SVAVAIADEKKLQKQYNAELEKAKEWERKAMVAVRAGDDGLARQALVRKQEHEEISSQF
FT                   QKQWIAQKQAVDKLKDALRLLNNKIEEAKRKKNILVARKKRAEAHKQIASTMHGLSDTS
FT                   AFDTFDRMSERIDVLEAEAEASSELAGELSGDTLESKFLQLEEGGHGTEEDALLELKAK
FT                   MGLLSSGSAPEAKQLEAPSASSLTEEDLKELEDLDLSSLDIPDDSDSATAGGGSNSGKS
FT                   DS"
FT   gene            662988..664253
FT                   /locus_tag="Hoch_0488"
FT   CDS_pept        662988..664253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0488"
FT                   /product="PDZ/DHR/GLGF domain protein"
FT                   /note="PFAM: PDZ/DHR/GLGF domain protein; SMART:
FT                   PDZ/DHR/GLGF domain protein; KEGG: GH10507 gene product
FT                   from transcript GH10507- RA"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13128"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK94"
FT                   /inference="protein motif:PFAM:PF00595"
FT                   /protein_id="ACY13128.1"
FT                   /translation="MMRLPRCSVVLAALLGWSLPVQAESWTPDVATTTVEAVTAAPSSQ
FT                   TPQMGEVAASSDTPRASVAAIMRETGQALLWDTVRGEYAVVREGQSFREFRVTAIRDEQ
FT                   VVLSRGNQHFVLPRTSDTEELARRAHASIAVRPESSPTPVNRQAETAPEALAPNALAAD
FT                   QDPAAASAAAQPAAPAAPPAANSAQPARPPAPLAPIDPYAAAAPAAAPAATVQPAPAPA
FT                   PAPAAMPTATPAPAPAVVDPYQQNAAPVRPVAPSLPSSLLESTVTSRPSPSQRSSNSNN
FT                   RRNSAAVAPVRRDSAAASAAESAATPEAVASSEAGTASEQQRDLSRKEFDAALVDFDAL
FT                   GKQVSVSQGARGVRVDTLAPGSLPYRMGLRAGDEIVSVDGRKLRDMNDAAAIYARLMEA
FT                   KRFALKVQRGAETIMFRYRFRR"
FT   sig_peptide     662988..663059
FT                   /locus_tag="Hoch_0488"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            664452..665096
FT                   /locus_tag="Hoch_0489"
FT   CDS_pept        664452..665096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0489"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   mxa:MXAN_2528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13129"
FT                   /db_xref="GOA:D0LK95"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK95"
FT                   /inference="protein motif:PFAM:PF07238"
FT                   /protein_id="ACY13129.1"
FT                   /translation="MLRVDLQLEDKSEWVKVFDPRDCTLFVPLDEPPELNSTVRVDLVL
FT                   GDSGPRVLLRGKVMRRQAKANATSPAGCVIALGPKEQEKINYLNGYVRGGMLDLREKRR
FT                   LPVRLPVTYGGIDGPCRSFTRDINEEGVFVISEDPLPEESRIHMLITVPGRDEPLSLHG
FT                   EVSHTVLADDEDIPGMGVVFEQQDRSDELTGIIDRLEKAFLSGTLPESTLL"
FT   gene            complement(665340..665675)
FT                   /locus_tag="Hoch_0490"
FT   CDS_pept        complement(665340..665675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0490"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: xcv:XCV3793 two-component system sensor
FT                   histidine kinase-response regulator hybrid protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13130"
FT                   /db_xref="GOA:D0LK96"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK96"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13130.1"
FT                   /translation="MLVAQRLTDGVHRVREGGIDLIFLDPGENPKGLDYFVLALSRLPD
FT                   PPPFVLISSSPKAPQISAQIGAAGFLPKPCTGDDIVELASRFASSPVQEPIIDDEPTQP
FT                   RRELFRI"
FT   gene            complement(666070..669282)
FT                   /locus_tag="Hoch_0491"
FT   CDS_pept        complement(666070..669282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0491"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: scl:sce2470 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13131"
FT                   /db_xref="GOA:D0LK97"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK97"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY13131.1"
FT                   /translation="MGAQEPQSGNELIGRILGGKFKLRCLVGAGSSGTVYQADQITLGR
FT                   TVAVKLLNPELASDQRLVSRFHDEALAASRLNHPNTVSVIDYGQAEDGLLFIVMEYLRG
FT                   VTLTRMIREESPFRPERLVEVASQILSGLEEAHEAGVVHADLKADNIVVERRRGGWYLV
FT                   KVVDFGIARIIGAPRSKEDESTICGTPEYMSPEVISGNDPTFASDLYAVGVTLYEMLTG
FT                   VTPFVGGSSIEVLTRHIRETPIAPSARCPERSIDSKLEACVMRALAKHPNDRFASATEF
FT                   RKALEATLVQRQTRTEDQILCSGCGVYSAARFRFCPECGYPRGAVVQQEASYFDTVPLL
FT                   ASAPVPVAPVPGGFKDPPTLHDAAGAGAGAGSGRAEADVGGSIFPLPLIGRDTALDAIL
FT                   EFVDGSGNTMLALFGPTGMGRTRLLQEARERLEDHPDVTLYCGAEDPTGLKAPFYPIRN
FT                   LVASVLALPPVCPYDRLSAGLELLGLSRRDLPGVAELFGHHGELWQLEPEVRRRELFAS
FT                   TIRVLKAATDGRGKAVFLLDDVDRYDQPSRTLLEALAALEEESNLRVVVTHSPELAGSW
FT                   PECVVRLGLPALDEDDFAGLAVHLEQLGRDNLPSARTMAVRTRGNPTHLQHLMRFLVEG
FT                   GQIDQAPTQLADLIAERIAGMPHPARVLCQSAAVFGNEVHRDLLRHALRQRLEGAALKT
FT                   ALSVVKARGLMYERPDSQTLAFGHNLIRDVVYDATPADVRRELHANAIKALEPTTADPL
FT                   PLGHHYELAGHFEKAAQLLLRAGDDAIHQLDDAGAIALYQRAHAIARQLMLAEIDGPHR
FT                   INFVVLSVKLADALRVNGQLTLARGIVEEAKASSRGAPRLEAQLLQASAHLNVCEHRYS
FT                   DAIEALDRGIGLVIPVGDMELLAQLYLDLSSVYIRNQNHDKAVKELREGIDVVTLGEDP
FT                   ESTEGPKLLWRMLLRLAQLHSSAERLPQAVQFAELALIHTRRTRSRIGSARVQSLLAGY
FT                   YEQIGDLRLADKYRQAAVSEMRRLGDRRGTAELLLSGVIPTRTLMRINPANLYEARTLA
FT                   DEIGWTEGVLQASRKTSQLEDL"
FT   gene            complement(669339..670547)
FT                   /locus_tag="Hoch_0492"
FT   CDS_pept        complement(669339..670547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0492"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.174"
FT                   /note="KEGG: geo:Geob_0100 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13132"
FT                   /db_xref="GOA:D0LK98"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK98"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACY13132.1"
FT                   /translation="MSTAYLVDGLRTPFGRHGGALASVRADDMAGHVIAKLVERTGVPP
FT                   DRIDDVIFGCANQAGEDNRNVGRMGALLAGLPVSVPGVTVNRLCGSGMQAFADAVRQVM
FT                   LGEADLIIAGGVEQMTRAPLVMPKSGAAYARGNQTLFDTTLGWRMVNPRMDAMHETLGL
FT                   GMTAERVAEREGISREEQDEFAFASQQRAGRALAEKRLERELVPIVTGKNRKTGEEYIC
FT                   AEDEHPRPEVTLEKLGKLPPVFAKDGTVTAGNASGINDGAAAMLVASEAAVKEFGLRPL
FT                   ARYVSWGVAGVAPSYMGLGPIPASRKAFERAGLKAADIGLAELNEAFAAQAIPCVRGLE
FT                   LDPERVNVNGGAIALGHPLGASGARIVLTLMHELKARNERYGLASMCIGVGQGIATIIE
FT                   CVA"
FT   gene            670690..671157
FT                   /locus_tag="Hoch_0493"
FT   CDS_pept        670690..671157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13133"
FT                   /db_xref="UniProtKB/TrEMBL:D0LK99"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13133.1"
FT                   /translation="MQLSERVISSTTTRPDADIGWFAARQPAVLRFLEDRLVHAGRLWD
FT                   HDAYAVALDAAQRLAAMFEEALGVPAQRISHALLERAEEAVLSEGQRAAAGAAARDGLA
FT                   ARQPALMVWLARLTAEPAVPLSVDETRALGLALAAVAYAFDEVASGRPVSA"
FT   gene            671275..671904
FT                   /pseudo
FT                   /locus_tag="Hoch_0494"
FT   gene            complement(671951..672460)
FT                   /locus_tag="Hoch_0495"
FT   CDS_pept        complement(671951..672460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0495"
FT                   /product="SNF2 superfamily protein"
FT                   /note="KEGG: SNF2 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13134"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKA0"
FT                   /inference="similar to AA sequence:KEGG:CHLREDRAFT_6783"
FT                   /protein_id="ACY13134.1"
FT                   /translation="MSGAGRGALVALAMALASAGCAGGGEGRRAAELGSPSAETGAETG
FT                   AETGAAAAARDLEPGAPALDEAAARQLLAERFRAAGLRVRYDVLVARAGAYELTVDGYD
FT                   PERRTGYEYVAERERERDLEAGERAQLARAPEVRILVLDAASATEIAARADAFLAALAD
FT                   AESARP"
FT   sig_peptide     complement(672386..672460)
FT                   /locus_tag="Hoch_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.517 at
FT                   residue 25"
FT   gene            complement(672457..672885)
FT                   /locus_tag="Hoch_0496"
FT   CDS_pept        complement(672457..672885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0496"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: pau:PA14_38340 putative
FT                   ring-cleaving dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13135"
FT                   /db_xref="GOA:D0LKA1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKA1"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACY13135.1"
FT                   /translation="MKPNLTHIARQVRDMSATVAFFEEFCGMRVVHERSDGSSAVVWMA
FT                   EPGRERSFVLVLLSGGEPQAQAETDYGHLGFALGSRAEVDALAARAEQRGCLVWAPRQE
FT                   AYPVGYYCGVRDPDGQFVEFSYGQPLGPGAPPLDTEAP"
FT   variation       672774
FT                   /locus_tag="Hoch_0496"
FT                   /replace="a"
FT                   /note="SNP"
FT   gene            673014..674609
FT                   /locus_tag="Hoch_0497"
FT   CDS_pept        673014..674609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0497"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: scl:sce4952 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13136"
FT                   /db_xref="GOA:D0LKA2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKA2"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY13136.1"
FT                   /translation="MIGETLGSYRVVSRLGTGGMGVVYLGEHTLIGRKAAVKVLHPEFS
FT                   QKSEIVERFFNEARASTAIDHPGIVQIFDFGYHQNGSAYLVMELLSGEPLDARLDRVGK
FT                   LGEDDAVRITRQCASALEAAHAAGIIHRDLKPANIFVVQDPEMEANERAKILDFGIAKL
FT                   TDENIAGDLRTRTGSMLGTPVYMSPEQCRGAGGVDQRSDIYSLACVLFRMVCGRPPFLG
FT                   QGVGDIIASHLREPAPSVRSFVPTLSTSLDQLVFRGLAKDPAERFQSMEELATALKALR
FT                   QGGSIPPLGGRAGSMGGRPSTAAPVPDDDSVAPTAPLPAFAVPGYAAGSNTTLGGAAAA
FT                   PQHTVPAAKKSRRWVALTAATGILGGLVGLVAVLGGESPGSAGAGLGDDAGIVTLSGIA
FT                   DAAVANEDPAGRGEDVLAAGEGGEPVADAPPDAAPVAPPTEVEIESQPSEVAVFAPDSD
FT                   EPIGLTPLSYRLPEGVTRIELTLKRKGFVDASVEIVEGQEEALSVVLERRAPPPSSPPR
FT                   RPPRRPKSNPLDSM"
FT   gene            674660..675766
FT                   /locus_tag="Hoch_0498"
FT   CDS_pept        674660..675766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce6026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13137"
FT                   /db_xref="GOA:D0LKA3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKA3"
FT                   /inference="similar to AA sequence:KEGG:sce6026"
FT                   /protein_id="ACY13137.1"
FT                   /translation="MNDGRNAGEMRASQRRTTRAARGAWIARRVGALAAVLLGLLLAAP
FT                   QAAQAQAADNELAARRAAKPLFEEGRTLMDQGDFRAAADKLQQAQDTFPAVGTLLNLGV
FT                   CRRELGETIAAWEAFREAAELAERTKDERVDYARERMRELRPMLFLLVVEVPEEVRSDD
FT                   LEVTHKGESIPPERWGQPFPVEFGDNLVRATRPGYEPFSTEVALAGRGKETTVSIPALS
FT                   EASAEPEPVASAVDLSASGERDGGGMPSGRKIALTSAALGVVGLTVGTIFGVRAGSQYD
FT                   QAEDICSIDGVAMCEDFERDESQALRDDARGSATIATVSMSLGVVAAAAGAVLWFMNPG
FT                   DGASSTESAHFAPLLAPGTAGLSVRVGF"
FT   sig_peptide     674660..674812
FT                   /locus_tag="Hoch_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.706 at
FT                   residue 51"
FT   gene            675862..680187
FT                   /locus_tag="Hoch_0499"
FT   CDS_pept        675862..680187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0499"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: E1-E2 ATPase-associated
FT                   domain protein; cation transporting ATPase domain protein;
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   hch:HCH_00429 cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13138"
FT                   /db_xref="GOA:D0LKA4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKA4"
FT                   /inference="protein motif:TFAM:TIGR01494"
FT                   /protein_id="ACY13138.1"
FT                   /translation="MLNLRKRLPRWLKPATRALRRGGRKVWRNDSRIHLALREVGRHQA
FT                   EELVEALQAALADVEGVDWVRVNAHLAHAIVSLAPAVSSAHTGDAASDDTAEDAAEALV
FT                   DRLLAAVAEVEAQLELERHPFPSKHPEQHPGDALPILRAGAELVARVGALGTSSVLRLM
FT                   RVEPPAYDVNLAAFLALVHNVPGVRKTLERYVTIAGAELILDLFGAAVNILRQSETGPV
FT                   LGVLQRTLRLRELYLRQRAWENWEPLMCAEPHQHAPTLPELSPRPTELPDAPIERYMDT
FT                   ASMASLSAFGLGLLATGNMESASGLLFAGAPRPARLGRGAFAAHIGARLSHAGILVLEP
FT                   HVLRRLSRFDCVVVDAALLDDTPDARKLVHAARQAKLTLVAACEDGDSVRWAGIGDITG
FT                   GDIVDAIRNWQARGRGVCFVGRGAHLAYVAADCGIGVWDSEAGACWGAHMVCRDSAQVA
FT                   ALFTMMATARKADDHSTQLAMLEAAVGVTLSYTGLDGKTTRRIMKVGQGLSILAMGNAV
FT                   RLAAAIDIPEHDPHAAAAAAALPWHNMDIAEVLSAVRTSDDGLSESVALQRRPPPALEP
FT                   SKVSHWLHMFGEELATPMVPILAAGAGLSILAGAFTDAALVAAALGINGVFGGAQRYHV
FT                   EKALREFSRNEQRRVRVRRAGRIVEMDTAALVVGDIIELSSGEVVPADCRIASAEHLEV
FT                   DESSLTGESLPVTKDAKPVDTDVIAERRSMVYEGTAVTTGTVTGVVVAIGDDTEARRAL
FT                   RLGENAPRSGGVEERLGELLALTGPVAAAGGVALAAASMVRGQSWRDVFSSAVGLAVAA
FT                   VPEGLPILATLSQLAAAGRLSKHGILVRNPRAIEALGRVDVLCADKTGTLTEGRIQLAL
FT                   LSDGQEQHALDEHGGELSAELRAVLAVALRASPLDDDEPIPHLTDRALVAGARALGVTV
FT                   EGEDGDGNGEGPRERVVELPFAPSRGYHAGLSRAQGGLLISAKGAPELIVERCTQVRRG
FT                   DEITALDDAGREALLAESGRLARQGFRVLAIAERETDVDTLSEYDVAALCFRGFVAFAD
FT                   PVRESARKAVDDLLRAGVAIVMVTGDHPSTAQAIAEELGIANADAVMTGAEIEALDDQA
FT                   LAASVEKVGVFARVTPMHKVRIVRALQQAGRVVGMTGDGANDAPAIRLADVGIAVGQNS
FT                   TTAARQAADMIITDERIETVAHAALEGRALWLSVRDAVAILVGGNLGEILYTLVGGIVS
FT                   RKPPLNVRQILLVNLITDTFPALAIALRPPAHTSPEELVREGPDASLGDELTRDILWRA
FT                   GITAGSASAAWIAARLGGRRGANSVGLLALTGSQLAQTLAVGTHSAPVVLTSVGSFAAL
FT                   VAIVQTPMLSAFFGCRPLGPVGLAQAGAAIAAGMGAYLVLPKAPELIAAAGERVRAWRR
FT                   GAADEGEGEGYVDAAVLVEDDEDDNPYIEPPIGQPMTVH"
FT   gene            680445..681476
FT                   /locus_tag="Hoch_0500"
FT   CDS_pept        680445..681476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0500"
FT                   /product="tol-pal system protein YbgF"
FT                   /note="TIGRFAM: tol-pal system protein YbgF; KEGG:
FT                   dat:HRM2_30540 putative aspartyl/asparaginyl
FT                   beta-hydroxylase (aspartate beta-hydroxylase) (peptide-
FT                   aspartate beta-dioxygenase)"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13139"
FT                   /db_xref="GOA:D0LKA5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKA5"
FT                   /inference="protein motif:TFAM:TIGR02795"
FT                   /protein_id="ACY13139.1"
FT                   /translation="MREVDARSRVAQRKVDALELELATLKRRLIDAEENQLPSLPVEVL
FT                   APEAAAAAAEPVEDYPADPALDGEYAQVVGIDEDGYEIVYAGDAARPGSVTARLPRQRS
FT                   ARSSASRSSSASRGSAPTIDNQLEAVAQTDERLTVTGRVGPTVAARVDEIPAPPPVPPA
FT                   PAPRSSDERDDDGDSAASPAPSHAPVRARRTKRRVRPSTPTRRAAAPSVPAAAEGVDPA
FT                   GLYRRHLEALRDGKHDAAEAGFQAFLDMYPRHDLSDNAQYWLGESLYDRKQYREALAAF
FT                   LAVKQRFPRGNKVPDALLKAGFCRIALGEHAQARAALAHVIELFPESQPAAIAAERLES
FT                   LEE"
FT   gene            681488..682777
FT                   /locus_tag="Hoch_0501"
FT   CDS_pept        681488..682777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0501"
FT                   /product="Peptidoglycan-binding lysin domain protein"
FT                   /note="PFAM: Peptidoglycan-binding lysin domain; KEGG:
FT                   ade:Adeh_2701 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13140"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKA6"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ACY13140.1"
FT                   /translation="MGRISTLVIAAPLLLVGARGAFAQDVPQTLEPGVTAPARSAPAPA
FT                   PAPAPAPQPQTVVIPVPEGTTLPPPAEDESGFFYLPDDFVTDPQQEGFQPGPAPEVHEV
FT                   RSGDTLWDICFLYFNNPWDWPRIWSYNPEITNPHWIYPGDLVRLYAEGEGPRVNDLTPL
FT                   DNLPVDPEGDFEDPEAPLIVGNQNPRPSRDEGVRLRQLTFVGQEVRENSFTIVGAIEER
FT                   SLLSAGDSVYLEYPEDRPPEQGKRYAIYTETVPVRHPDNKSAVTDVGSYARILGELQVV
FT                   SVREGKRARAFITDSFDVIERGDKVGPLRSTFRTVEPQPNEVELQGTLVALVGGEQLIG
FT                   ENQVVFLDRGSEDGLRVGNRLYVVRRGDARGTTTSYFEGIGQNDQRFPARAIGEVMVVE
FT                   TGKKVATALVTLSLQEFGVGDRVLMRKTAP"
FT   sig_peptide     681488..681559
FT                   /locus_tag="Hoch_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(682784..684757)
FT                   /locus_tag="Hoch_0502"
FT   CDS_pept        complement(682784..684757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0502"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: tyrosine protein kinase; SMART:
FT                   serine/threonine protein kinase; tyrosine protein kinase;
FT                   KEGG: scl:sce5013 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13141"
FT                   /db_xref="GOA:D0LKA7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKA7"
FT                   /inference="protein motif:PFAM:PF07714"
FT                   /protein_id="ACY13141.1"
FT                   /translation="MSEQPAETSFPAAPWGESHPLAGLRGDDLRRKDAVFHHGTQLYRT
FT                   TGQHLSHGGMGSVYLLERRDERGGACEEVVGKIFHPQYLYQLRTDEVARRDFELTVTTQ
FT                   AAIGRIGHPSLLPIYACEPVADNHLLITPRKADTLLERIARGTLSPRRRVALLIQALEG
FT                   LAAMHEHRIIHRDFTLRNILVDREGLRSFLFDFDLALPLDHVIGVTYGAHYQGRIFGSP
FT                   GFSVAPEIVDDGLADRAITPRLDVYAIGGALFRMFSDHNPHGETQDMWGLLMRIADGLV
FT                   IRGHSHIEYPSALPAPLRPIIERCLERDPGHRIGSVNLVIEQLAECLGQLDDHAPQGDF
FT                   DTIEPTVQADREAVLRRARSIPGVAKMPSVTPGFLDLLASALQRYGYRAERSFGQIDGK
FT                   PLFLAAPIPELVASGQFPYANTYPKIVTAINLNLEPDTQAALDRWFGTYLPVLEKVRQG
FT                   SFTSLYKAIYDEFTGYLLLFSEFVDDPRFGSDLAKLELGLIEAFALGFWIARQVGQLHE
FT                   HALAHNNITASSLLLKGLPLTRRVVPSMAGLVEPSSEPEAMRSDVRDLAGLVVSWLHPE
FT                   ALATADFHVRDRLEELRDTLAQIAAGEQADAGIDLLFALVARGLSLVDPNFQVLRENRG
FT                   DLEDYVQLRLSHRLYHRLWPGT"
FT   gene            685064..685960
FT                   /locus_tag="Hoch_0503"
FT   CDS_pept        685064..685960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0503"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: mxa:MXAN_5318 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13142"
FT                   /db_xref="GOA:D0LKA8"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKA8"
FT                   /inference="protein motif:TFAM:TIGR01473"
FT                   /protein_id="ACY13142.1"
FT                   /translation="MRPGEQLIGQPIGRLPSLADAVALMKPNIMLMALLTAAGGMSLAP
FT                   GAARPVTWLALMLGTALIVGAANTLNMYLERDLDCLMARTKNRPLPAGRMAPNFALVVG
FT                   VIQAFIAAPILTFAINPLTGLLGVIALICYVMMYTPLKQRTTLATLIGSVPGAMPALMG
FT                   WTAITGGIDVRGLAVFGVLFLWQMPHFHAIAMFRRKDYDRAGLKTVPGELGESAARWRI
FT                   AIYLVAQVALSLVLYPLGVTGVVYLIVAILSGAAYLGYGLLGLATRGGPRWARRLFFAS
FT                   ILYLPVLFTAMVFDGRL"
FT   gene            686007..686570
FT                   /locus_tag="Hoch_0504"
FT   CDS_pept        686007..686570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0504"
FT                   /product="protein of unknown function DUF420"
FT                   /note="PFAM: protein of unknown function DUF420; KEGG:
FT                   ank:AnaeK_0947 protein of unknown function DUF420"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13143"
FT                   /db_xref="GOA:D0LKA9"
FT                   /db_xref="InterPro:IPR007352"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKA9"
FT                   /inference="protein motif:PFAM:PF04238"
FT                   /protein_id="ACY13143.1"
FT                   /translation="MQPNDPRPPAAEAGPPFFGNPFMWLVFALVLLALPLIGYMLQSDM
FT                   HWERVHPAINAILNGASTVFLFAGFLAIRRRNIQFHKRCMVAAFTTSSVFLASYLIRFA
FT                   ISGTHRYPGTGFDKTLYLIILFSHMILAALAVPIILRALYLAWRGRYAEHAKIARITWP
FT                   IWMYVSVTGVIVYLMLYPLAEALY"
FT   gene            complement(686737..687207)
FT                   /locus_tag="Hoch_0505"
FT   CDS_pept        complement(686737..687207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0505"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   2-like protein"
FT                   /note="KEGG: hha:Hhal_0168 peptidylprolyl isomerase, FKBP-
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13144"
FT                   /db_xref="GOA:D0LKB0"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKB0"
FT                   /inference="protein motif:COG:COG1047"
FT                   /protein_id="ACY13144.1"
FT                   /translation="MKIENGRRVRLKVQLKAVGGDIIEKSVVEYIHGGGTMLPGLERVL
FT                   DSMESGTKKEGVIQAANAFGDPSFQREKRMSRKEFPKDAKLKVGDRFVAKGVDNQQNVV
FT                   LEISKVGSDEVRVQLRHPLADNDIEYKVHVLQVTDPRPPPLPPEALGARADD"
FT   gene            687464..688558
FT                   /locus_tag="Hoch_0506"
FT   CDS_pept        687464..688558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0506"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: dde:Dde_2655 biotin synthase; TIGRFAM: biotin
FT                   synthase; PFAM: biotin and thiamin synthesis associated;
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13145"
FT                   /db_xref="GOA:D0LKB1"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKB1"
FT                   /inference="protein motif:TFAM:TIGR00433"
FT                   /protein_id="ACY13145.1"
FT                   /translation="MHASPFTAGPWHEFAARSLAGEALSREECRAVLAAPADATLALLD
FT                   AAFAVRREHFGRTVHIHVLENAKRGSCPEDCSFCSQSKRYGSPGGEGPMKSVEELVDGA
FT                   RRAAASQAKRYCMVTATRGPSGRDLDVICEASRRIKDEFQLEICASLGLLTPDKAKRLA
FT                   EAGVDRFNHNLETSERYFGKVVSTHSWDDRVATLRMAKEAGMTTCCGGIVGLGESEDDL
FT                   IDLALSLRELAVDSVPLNFLDPRPGTPLSAREQISPMYALRALCLFRFLHPRADLRVAG
FT                   GREVVLRAAQSMALYPANSLFTSGYLTTDGAMPDHDHQMIRDMGFEIELVGGAAPPAPE
FT                   PVAPAPAAAGPSLPVLSQRPGPAA"
FT   gene            688632..689207
FT                   /locus_tag="Hoch_0507"
FT   CDS_pept        688632..689207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0507"
FT                   /product="ATP/cobalamin adenosyltransferase"
FT                   /note="TIGRFAM: ATP/cobalamin adenosyltransferase; PFAM:
FT                   cobalamin adenosyltransferase; KEGG: acp:A2cp1_3628
FT                   ATP/cobalamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13146"
FT                   /db_xref="GOA:D0LKB2"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKB2"
FT                   /inference="protein motif:TFAM:TIGR00636"
FT                   /protein_id="ACY13146.1"
FT                   /translation="MVRINRVYTKSGDRGETSLIGGERVSKAAPRIDCYGTVDELNATL
FT                   GLVRSALENSPAGETLLPIISRVQNELFNLGAQLATPDPERRAQMPAVETRHVEALEAE
FT                   IDTLNDELPELTSFVLPGGGWSSAYFHLARTVCRRAERLVVAVAASEDVGETSLLYLNR
FT                   LSDALFVMGRWAAKSDARAEPLWQPENT"
FT   gene            689270..690628
FT                   /locus_tag="Hoch_0508"
FT   CDS_pept        689270..690628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_4180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13147"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKB3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13147.1"
FT                   /translation="MSDTEQERKKAERAARERFERAMTELRDGSYRFASRARGQAALVV
FT                   EELIDPEGEAVAGLADVEGDAGALALAIPLEVITFETWLLAQIGDEEALDLENTAHWEF
FT                   WFNFGAWIGETLRRRHGGHWLIAADDPKTWRLGFSKIMLEIAPFRFAEQLLQIGAGTAQ
FT                   KLIAEIERLRLGHEEQKARDGGEEIDRFTAQTYIRLHTVPLGQWMAMDFPHVARMWNQA
FT                   TVRDLVKEIKKVAKQANPANLPLLERLVQAIEQADPMKPLAEQTNDRALFETIAQVVGL
FT                   RRATAPLAMDVIERFVLPAVHIGIPDSFPPLDEDDLELLRKGAEFFALFVEVVPHKYQA
FT                   ADDGFLRSIPQEDLASPYRDRTRLDVGKGDWVIVNPRHFKQMLMEFDSQRMLEKFDSFV
FT                   TYVRENPAAPRRRDDGRMLVETVARAVADLQACTMAASKDGIVLVFRMLPPPP"
FT   gene            690641..691753
FT                   /locus_tag="Hoch_0509"
FT   CDS_pept        690641..691753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0509"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /note="KEGG: afw:Anae109_2471 dihydroorotate dehydrogenase
FT                   2; TIGRFAM: dihydroorotate dehydrogenase; PFAM:
FT                   dihydroorotate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13148"
FT                   /db_xref="GOA:D0LKB4"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKB4"
FT                   /inference="protein motif:TFAM:TIGR01036"
FT                   /protein_id="ACY13148.1"
FT                   /translation="MLYRRLIRPLLYRFDAERIHGAVFAALTAGQSVPGLVRLLRALCV
FT                   PDDPRLRTEVLGMRLPHPVGLAAGFDKDAQAHEILGALGFGFVEIGTVTGNPQPGNPRP
FT                   RLFRLPEDRALINRMGFNSGGAEAAALRLATPRSVALGVNIGKTKATPPEQAIADYVHS
FT                   TGLLGPLGDYLVVNVSSPNTPGLRDLQAVESLRPLLAAVRAELDRASPNRRVPLLVKLA
FT                   PDLADADLDAVADLALEQGIDGIIATNTTIARTGLRSSAAAVEGCGAGGLSGAPLAARS
FT                   LDVLVRLRRRVGARLTLIGVGGIERPEDAWARIRAGASLVQVYSAFIYEGPLLARRLAL
FT                   GMAALAERDGFARVQDAVGVDVDELGARSS"
FT   gene            complement(692779..693846)
FT                   /locus_tag="Hoch_0510"
FT   CDS_pept        complement(692779..693846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0510"
FT                   /product="Anion-transporting ATPase"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG: mxa:MXAN_5817
FT                   anion-transporting ATPase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13149"
FT                   /db_xref="GOA:D0LKB5"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKB5"
FT                   /inference="protein motif:PFAM:PF02374"
FT                   /protein_id="ACY13149.1"
FT                   /translation="MPPWPDDVLSFCYKGPAFMASLLDSRIILIVGKGGVGRSTVAAAV
FT                   AAATARRGRNTLLLESNANDRFGPFFGKPAVGTEIVRLAPQLHAVNSNPAAALEEYGMM
FT                   VLRFRRVYKMVFENRVTRYFLRAIPGLDDYSILGKAWYHTTETERGRPKWDTVVFDMPA
FT                   SGHSLSMLRLPKVILDTVPEGPLTRDARTMRDLFLDPAKSSILLVTLAEEMPVNEAREL
FT                   TSALRDELGMRVSHLLVNQVYPERFAEDSAAAQVQSALASEAGLAPRDLGAPGPGADEA
FT                   RIAGVDEGAQSDLAALVAHSELARGRRRLNERYLEELARTLEVPQSELPLLFVPTLGRD
FT                   QIDLLSKQLERQLER"
FT   gene            complement(693920..694249)
FT                   /locus_tag="Hoch_0511"
FT   CDS_pept        complement(693920..694249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13150"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKB6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13150.1"
FT                   /translation="MVSVTARKIRDHGSERVSVGVGRIYTGYLISYPVIGRGMVIFRDP
FT                   HGHRMITTPVKRILGEHEGQRLYVETENSVYRLEIHGEPVQSSRAASQGDRVADPASSN
FT                   SSSAH"
FT   gene            694471..695418
FT                   /locus_tag="Hoch_0512"
FT   CDS_pept        694471..695418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0512"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   scl:sce7106 metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13151"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKB7"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACY13151.1"
FT                   /translation="MDELYRQVRSHLAQPSPPGSADPPRAEEVERPRTVAPGVVVFPVR
FT                   TPTLPPATHTNCYAIGDREIVLIDPASPDPGEQSALDACVDAWAHDGRRVVAVWLTHHH
FT                   GDHIGGAAHVAARLKVPIAAHAATAKHIAHRVEVDELLDDGHTLELAGSPACRLRAVFT
FT                   PGHASGHLCFFEEHSRVLVAGDMVAGVGSILIEPGDGNMSLYLDSLARMKALDASMLLP
FT                   AHGPMIENPNEKLDAYVRHRLWREERIAAALESLGSAANAALLPLAYADVPPLLYPLAE
FT                   RSLTAHLLKLVADGRIVQFGDTWRTLALGGTSHE"
FT   gene            695415..695663
FT                   /locus_tag="Hoch_0513"
FT   CDS_pept        695415..695663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0513"
FT                   /product="protein of unknown function DUF329"
FT                   /note="PFAM: protein of unknown function DUF329; KEGG:
FT                   scl:sce1672 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13152"
FT                   /db_xref="GOA:D0LKB8"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKB8"
FT                   /inference="protein motif:PFAM:PF03884"
FT                   /protein_id="ACY13152.1"
FT                   /translation="MTTMSKSSKNKSVSKSATPCIVCNEPALPRPDNAAHPFCSPRCQM
FT                   VDLGRWLDGDYCIPGEPLEDISSEPEGGSGGGFGFPH"
FT   gene            complement(695716..696153)
FT                   /locus_tag="Hoch_0514"
FT   CDS_pept        complement(695716..696153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0514"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce5949 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13153"
FT                   /db_xref="GOA:D0LKB9"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKB9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13153.1"
FT                   /translation="MGDAKRVRHTPGRRGAHPNRATPCGDPRCCSPLLFHALEVDCGDQ
FT                   ETYLFTYLRELEATYIFVRTTRPRAPGTAVHMRFQHGDAAIPLTLDGQVIWVNPYRPAD
FT                   ARQLNNPGMGIRFLDLEGDQRLHLMGLVKRLAFLDGAAAAL"
FT   gene            complement(696271..698886)
FT                   /locus_tag="Hoch_0515"
FT   CDS_pept        complement(696271..698886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0515"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce5950 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13154"
FT                   /db_xref="GOA:D0LKC0"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKC0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13154.1"
FT                   /translation="MWPLLVVVLAALVLLPRLDSAGFWEPSEIAVADEAHKQLEAASAD
FT                   PAAEAAAAEAADAEGDAATPPAKQPDTQSEPPLRGWLVGYGMKLIGGDKELGARLPMAL
FT                   LGVLLVALCFFLGRRLASARAGLLSALIALSFPLLVLQSRQLLSHLDLAVSTALVVYGL
FT                   AGLAWPPREYGAPPAWHRALDVVWVVLGTVAGYFAGGALLGIVVPFGGLGLAALSALPQ
FT                   IPAARPQTPAGPVRGGRMLTGAALVLAGVAVLLLAEPLALERPLWLLLGIAPAAVGVLL
FT                   FASALVPRASSDGATPTTTTTTTTTTTTTTTSAGARAQRPRLVAVAALSLLLAAAALMW
FT                   TLAAIFDLRPPIPGERALLGYSIVSSNDYVAPLGGIWRARDDLQATFDTLFEQIAYGLF
FT                   PWSALAPLALVHLAMGQRRARASFTGFVPLAWAALAWALATVMARKLGPMQYPALAAVA
FT                   VGIGMWLDALLGAREQADATSDSDTAASRAFGMPLRLPVVALFVALGAMALGKDIQGFP
FT                   EEVTTLNALSTVEYPKDMRVLGVPARIYWLLAGVAFGLAMACGLWLWQRHRGREARPSW
FT                   YPLGRRGIAAGVLVGLGFALFLVHGWLPALSQKLSSKDLYAVYDDLRQSGEPLGVLGDP
FT                   GSGLSYYASDGYEELGNRSQLEDYLQREQRVFALAPASELCALHRTLSGDTEYYVLDNS
FT                   HAKFLLLSNQLSSGEIDRNPLATAILREPPEDLGRAMRVNYDDRVELVGVKMPDEAERG
FT                   SSFEVTLVFRVLRPLSGAWKVFMHFDGGGLRFQGDHEPIEGRCSTAYWQAGDYIVDTFQ
FT                   VDAGDLSYQATDYRVYLGFFRGTHGSWKNLAVKRAADAQGQQLTVDDNDRVLLGSMRLR
FT                   "
FT   sig_peptide     complement(698821..698886)
FT                   /locus_tag="Hoch_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.675) with cleavage site probability 0.343 at
FT                   residue 22"
FT   gene            complement(699035..700807)
FT                   /locus_tag="Hoch_0516"
FT   CDS_pept        complement(699035..700807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0516"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase
FT                   fold-like protein"
FT                   /note="KEGG: geo:Geob_0519 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13155"
FT                   /db_xref="GOA:D0LKC1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKC1"
FT                   /inference="protein motif:COG:COG2220"
FT                   /protein_id="ACY13155.1"
FT                   /translation="MHRSMPQAAQPATPSEGDDTAAASTRRGSSEVVLASERYQERKRA
FT                   LASAHRQRRVRRYRSLVSHWMSRWPRRPRPMAPATVPEVTPGQVSISFGGHATVLLRYA
FT                   ERTVLCDPMLGNWVKGAKRAAAPGLSAESLREVDLVLISHTHADHLHRPTLEQLPRSAT
FT                   LVLPPGGAAKVSGLGFARVVEIEVGQSIQDRGIDIATAPVRHGDQDAMRALSYIIRGDG
FT                   PSIYFCGDSGYFSGFAEIGERHQPDIALLPIGGYFPLSFRERHMSPLDALYALEDLRAR
FT                   VMIPIHHGAFALSYERLDEPRRWLSELVAERRLEDFVIELAPGESRVFVPPRRQRESAD
FT                   AHGLRDPAVAAPTPAADTPPGPGAGPGSGRGPRSGRRADSQSDTRVRGLRGADKGATRG
FT                   VVQPLPALRAALRIRESGLHPGSGPVWVHAAPMLSELAEQARTPAWAQPARARWEPVEL
FT                   GEIATPSPIADALIADAAAAEVAAAAAAAETAAADAVVAEEVAVDAILSETMVGSMPMR
FT                   ALTPEPDEIEPNELELGAIDDVPDFEFEAGVVLDAIVDPERVSASRHRASALLDDHEDA
FT                   RGIDAALDSLFAAV"
FT   gene            700929..701660
FT                   /locus_tag="Hoch_0517"
FT   CDS_pept        700929..701660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0517"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mxa:MXAN_1944 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13156"
FT                   /db_xref="GOA:D0LKC2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKC2"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACY13156.1"
FT                   /translation="MSTHAESPHVSIVIPVYNEEGILREAITELRAQLESFPWRYEILI
FT                   CENGSSDRTMALAEHLASEHEEVRCLSAGEPNYGLAMRQGILAAAGQYVICDEIDLCDT
FT                   DFYRRAMDLLEHQDADMVVGSKAMKGAFDQRPLMRRLATRVINGMLRVAVDFRGTDTHG
FT                   LKAFRREPLLPIARQCVIDRDLFASEFVIRAGRDGLGVVEIPVQVAEKRRPAINLVKRV
FT                   PHVLQGLARLTYAIRYQRGDE"
FT   gene            701670..702665
FT                   /locus_tag="Hoch_0518"
FT   CDS_pept        701670..702665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0518"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   mxa:MXAN_1945 polysaccharide deacetylase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13157"
FT                   /db_xref="GOA:D0LKC3"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKC3"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ACY13157.1"
FT                   /translation="MVRASRPLPFSSPQCAVSIDVDGLDCYYRIHALGEPPAHLRDVIL
FT                   RRALPRFAEIFARRGIHATFFLVGRDLDPAAPGADTPGNDVAGARAIAADLARAGHELA
FT                   SHSYSHRYEMARLSSAEAGAEIELAHALIGELASAAPVGFRAPGYDISPAMLGHLVRLG
FT                   YSYDSSIFPAPVYYAAKAVVMAALAAAGKRTGAVLTNPRALLAPSEPYRPSLTAPWRRG
FT                   RADIVELPVAVTPRIRAPVIGTSLLVAPDWMRARMLAAVRGCALFNFELHGIDLIDARD
FT                   DDIPAELVARQPDLRVPLIHKRERFERILSYLETHFELRPLRDLAIPMSE"
FT   gene            702865..703917
FT                   /locus_tag="Hoch_0519"
FT   CDS_pept        702865..703917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0519"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; KEGG: scl:sce6501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13158"
FT                   /db_xref="GOA:D0LKC4"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKC4"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ACY13158.1"
FT                   /translation="MNPAEESSEATNEATAEAPAEAASASATKVDTARFQERFQNLRAE
FT                   VGKVLVGQEDMLHRLLLGFLAGGHVLLEGVPGLAKTLVVRTLADAIHGKFTRIQFTPDM
FT                   LPGDVTGTQIFNPKEGSYSVKQGPVFGNLVLADEINRAPAKVQAALLEAMQERQVTIGD
FT                   KTFSLSEPFLVLATQNPIEQEGTYPLPEAQLDRFMLKVKVGYPTKADEIKILDRMAGAG
FT                   PAPSAQRVMELGDILAARAAADQVFVDDKVKRYVVDLVAATRDPEAAGMPQLASLIENG
FT                   ASVRASINLVKVAKAHALLQGRDYISPHDIKSIAHDVLRHRVLVTYEAEAEGKSADDLV
FT                   DIILDNVEVP"
FT   gene            703973..704959
FT                   /locus_tag="Hoch_0520"
FT   CDS_pept        703973..704959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13159"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKC5"
FT                   /inference="similar to AA sequence:KEGG:MXAN_5665"
FT                   /protein_id="ACY13159.1"
FT                   /translation="MLPAEIVQQVKRIQFHTGRQVSDVLAGAYLSVFKGRGMEFEEVRP
FT                   YVPGDDVRTIDWNVTARMGDTYVKRYVEERELTVLLLVDISPSLDFGSSGRSKREAAVE
FT                   LSALLAFSAIKNNDKIGLLLFHGEAEEYIPPRKGQKHALRVVREVLARGREEAPARERG
FT                   AKANPWNLPRALWRRFRALKDKTRRPAARSTSIAHALEFCRRVLPRRAVLFLISDFLDD
FT                   GYLQILRSASRRHDLVGVVVTDEREMGFDKAGLIALEDAETGQVRLVDTASRELRETLA
FT                   AQAEGRIDNLGRELRRSGIDLIRVDATRPVIDPLLAFFRMRERRLRR"
FT   gene            704956..706125
FT                   /locus_tag="Hoch_0521"
FT   CDS_pept        704956..706125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0521"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5664 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13160"
FT                   /db_xref="GOA:D0LKC6"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKC6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13160.1"
FT                   /translation="MSRPTMRRAGRTRRPALAAALTLAALSVLAALGGCGETRQAEPAS
FT                   EVAAATSVAESKLSELGPVRATVSIGPEEPRIGDPLTLTLEVTAEPGVDVEMPAFGEAL
FT                   GRFQIARFVPREQIAADGGLVATQVYTLQAPMSGRLRVPPLRIEFLDERANSAPAADTA
FT                   AGDDEAVNAAAGAAAGASAGGMSEIQELLTEELAIEVASVAPEGAATDALAGLAEPLVP
FT                   PSRARVYLLLALLALAVCGLGGYLAVRTWRRAARRQVRISAYDKAMAKLRVLEQRGLPQ
FT                   QGDDDAEIDAWYVELSSIVRRYLEDRYGLRAPELTTEEFLREAQRSGLLSSTHRARLSD
FT                   FLSRCDRVKFARYKPGEEETREVLASARSFLDDTRLSTEPVQPAVQQGA"
FT   sig_peptide     704956..705048
FT                   /locus_tag="Hoch_0521"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 31"
FT   gene            706137..707177
FT                   /locus_tag="Hoch_0522"
FT   CDS_pept        706137..707177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0522"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: dps:DP0638 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13161"
FT                   /db_xref="GOA:D0LKC7"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKC7"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACY13161.1"
FT                   /translation="MEALLGEIEFREPWLLVLGLLAVPVFLWARRSPGRVLFSSLSLVP
FT                   ARITSWRVRLAWLPDLALALAVLGLSVAAAGPRVAVGENTIRREGIAIMMVVDTSGSMR
FT                   ALDLADGGLDQTRLEVVKDVFRAFVAGEDGLDGRSNDTIGLVSFAGFADTRCPLTLNHG
FT                   SLLTILDDLEIVRERAEDGTAIGDGLGLAVERLRESEASSRVIILLTDGVNNAGIETPL
FT                   EAAELASRLGIKVYTIGAGTDGVAPVRVTNPLTGAEELRPMPVEIDEATLEAIAEHTGG
FT                   RYFRATDGDGLRQVYEQIDRLERTEISERRLREYREFFQVPLALGMLLAALGWLLRATV
FT                   FRRLPC"
FT   gene            707171..708205
FT                   /locus_tag="Hoch_0523"
FT   CDS_pept        707171..708205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0523"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: dat:HRM2_29490 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13162"
FT                   /db_xref="GOA:D0LKC8"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKC8"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACY13162.1"
FT                   /translation="MLGDVVFAHASMIHLLWPVLGAIALLAWLELRGGEVLGRFVSAVM
FT                   QRRLSWRPSLGQRLARLALMLGCLVLAVLALMQPQIPGRTETVTSSEVSADIMVVLDVS
FT                   RSMLADDVAPTRLARAKAEVAELSSALRGHRIGLVAFAGRASVLAPLTPDYGFFRMILD
FT                   GVDTKSVSRGGTEIGQALRKAVRSFDPGPGAKMILLITDGEDHGGYAEDAAREALEAGV
FT                   RVVAIGFGSEQGSQITLVDPDTGARALLTDGDGAPVVSRLDGELLRSLALTTEGVYVPA
FT                   GVSAIDLETIVSQHIEPLMAAADDRSIVRKQPRQLYPWFVLGSLLGLLGAVLLGASAGR
FT                   RQAL"
FT   gene            708202..710754
FT                   /locus_tag="Hoch_0524"
FT   CDS_pept        708202..710754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0524"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kinetoplast-associated protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13163"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKC9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13163.1"
FT                   /translation="MNTPIRSLLWPYVLALGLATLLFAGCEDEGERAALGRYNQAVEAY
FT                   RAGDIEAALEGFHEARDRAGADAELRFRASYNLGLAYAREADASEPAPAAGRDGAGDGA
FT                   AAAGGPEAAIRSLEQSAGWFRDAVRLDPESEDARKNLETVLRRIQVLSDQLNQGQNKLE
FT                   ARLERIIEDQRGLRDAIRVLMQRVADSGAAAEPVAMQSEFDALAVRQRALLADVGTVSD
FT                   LAGDEIAVIEAKAEEARTPQEQSRVVQLENLEVYLHSARGFLGDARRSLRRLLGDRAHR
FT                   RADAGLAALKRAREQLLDPVTVLRGIVQEQSQVMGQTTGLDQLGQADIDLAAGLASDNE
FT                   AGEGGEDGEDGASPAAPATPAAPAVPVPAWLTAEHLGERQDILEQRSREVVARFQAGVD
FT                   AAAQQDPNDPAAAAADPREQRVLAQAADAIPFVASAAEHMQRAEDALAGEALREAAEAQ
FT                   AAALADLLRAIERFSDIRGLIELVYRDHALTQALLTPPEELAAMLAAMGQALPPEFAEL
FT                   STEERSARIRELVGQDVDRLSRLEGLFQDELAALDAQAAQAGAGQAMPGQQPGAQPGAQ
FT                   PMSPEQLESAKQQYVQAEELRVSAISALQQLDAAVVAAGASSVADARAAGDEAMTDIEE
FT                   LRRLFYSIVEHLKELLQNQTATHDQAGSAAAGPQDELAGRLGALVAPQSEHASIGQALA
FT                   QALAAQADAAAQAPQDPGQPSGDQAERLGQAASEVDSAVVQMQGAAELLGKDAEEAASM
FT                   SVDISPTLEAQTQAMAHLEEAIRLLSPPPPQQDQQQDQEQNQDQEQQQQQQQQQQQQEM
FT                   SRQQAERRLQEIRDREAERQRDKKEQQRAATEPVEKDW"
FT   sig_peptide     708202..708276
FT                   /locus_tag="Hoch_0524"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.678) with cleavage site probability 0.591 at
FT                   residue 25"
FT   gene            710758..713451
FT                   /locus_tag="Hoch_0525"
FT   CDS_pept        710758..713451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0525"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; KEGG:
FT                   dps:DP0640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13164"
FT                   /db_xref="GOA:D0LKD0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR025738"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKD0"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ACY13164.1"
FT                   /translation="MSKRFVAALSMSIFALVLLAAGAAHAQRATLHLQSGDAHEGLPFI
FT                   VAVSAEGFAPEPQPEIEEFAIAGAELSFLGVTPNVSSSVMIRNGRRSETRRVEFVYRYR
FT                   IVAPKAGLYRVPAIRVSQGSVQASTRPSSIRVTAVPSSEDMAFRLDLPERAVSVGETFD
FT                   LGIEWLLRRDPSEHSFSVPLLDDGEWFDVHVPPPVSGRRQTLSVPAGDRQLELPFTQDR
FT                   VTVSGREYTRVRMAVSVTPVQAGTYEVAPAQAVAELEVGTGRDRFGFPVARTQLFRARD
FT                   TARTLEIRPLPLANRPPSFAGAVGTSFSIKVQASRSVVSVGEPIDLDILVRGDGRMEGL
FT                   SLGPLIASDRLSEDEFSVVDGALTGTLSEDDNGKRFHVTVRLKSPDVREIPPLAFSYFD
FT                   PARNAYETVRSEPIALQVAGSAVVGAADVVSAAAAKREGEGGDAAAEGAAQDAAGGARS
FT                   GTFAGAEFALSAADETLDEAATTAGLLPLILAIYGLALLVAAGRTWQVRTRAARGQSSE
FT                   LRQAKKRVDEAVRRAESQPAREAAPEVLAALRHLARLTEQRASGEVIARLETEAYAPAA
FT                   AEQPLAADLRDDIGALASSWMRAQRESDGAATGRRAGAAALLLLVGAALSAAPARAQQG
FT                   AQPGAQQGDGQAPAAADAAPAASAATGAASLEAARALYAEALGESSREARARGFAQAER
FT                   LFGALVEQYPDRPELLADWGNAALGAQDLGRAALAYRRALAHDPGNQRAARNLDWVRAR
FT                   VAVGSAAADASSDVIFWRYLLSPAERHVLGALAFALGLLLLAPWAGWRLRWRALLAALP
FT                   LLLWLAMLLSLATDPDPADDAVVLGDGVTLRTADSAGAPQALASTLPAGAEVRVDEIRG
FT                   EWTRVVLGDDLAGWLPSSALAPVMAR"
FT   sig_peptide     710758..710838
FT                   /locus_tag="Hoch_0525"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 27"
FT   gene            complement(713501..715000)
FT                   /locus_tag="Hoch_0526"
FT   CDS_pept        complement(713501..715000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0526"
FT                   /product="tRNA (cytosine-5-)-methyltransferase"
FT                   /note="PFAM: Fmu (Sun) domain protein; KEGG: aeh:Mlg_0620
FT                   Fmu (Sun) domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13165"
FT                   /db_xref="GOA:D0LKD1"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKD1"
FT                   /inference="protein motif:PRIAM:2.1.1.29"
FT                   /protein_id="ACY13165.1"
FT                   /translation="MTPWSSEELRTVATISARYRELVDEWTNLRDALLAPQVPCLWLHP
FT                   LRASAERVPTWLRADGAALEPMSWHPGGYRWRGARTPGLHWSYQAGLYHVQEEASMVPV
FT                   ALLAPEPGERILDLCAAPGNKTAQIALALGNRGTVVANDRSGGRLAAIQNAVTRLGLCN
FT                   VSMTGCDGTRYPRQRRRFDKVLVDAPCTAEGAVRKLRPTRVCSDSFRRQITAVQRQLLA
FT                   RAICLTRPGGRIVYATCTFAPEENELVVDAVLRALPGAARLLPAEIPGLATAPGITAWQ
FT                   GRALAPELSRTLRLWPHLSDSGGFFCAVLERSEVDIDGQDGGPAESTPTSEIAGADAAA
FT                   GTDHAPRPALDDARVAAVWQRHGVDADQLSDIDVVRGGRYLRFLAADHQPPDNVRVHAS
FT                   GLPAMPCKARQPRLSTAGALAFGAGAQRDAVMLEPNQVDDYRRGQTLALTPKQHAASGG
FT                   GFVLVTHPSGAPLGIGLLRLSDTGAWLESEVAKGRQLVAEV"
FT   gene            complement(715090..715536)
FT                   /pseudo
FT                   /locus_tag="Hoch_0527"
FT   gene            715637..716149
FT                   /locus_tag="Hoch_0528"
FT   CDS_pept        715637..716149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0528"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smd:Smed_2748 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13166"
FT                   /db_xref="GOA:D0LKD2"
FT                   /db_xref="InterPro:IPR025565"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKD2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13166.1"
FT                   /translation="MYDIGKIAALVSLVAWLCAAYGMLPRYGDTSVGFSRSRAIYAWFI
FT                   PLFNLVLPYQVLRETWHGSAPPREGDESAHERARDWLPATFPAWLASWLAVLASSMFSD
FT                   TWPELPGDTVSRSKMVLTVLGAAANLVFAVLSMIVIRQIHQRQMQRAPLVATVRLPAAA
FT                   SDSAPAE"
FT   sig_peptide     715637..715723
FT                   /locus_tag="Hoch_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.790) with cleavage site probability 0.585 at
FT                   residue 29"
FT   gene            716258..716518
FT                   /locus_tag="Hoch_0529"
FT   CDS_pept        716258..716518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:716297..716299,aa:Sec)
FT                   /locus_tag="Hoch_0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; KEGG:
FT                   mmb:Mmol_0442 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13167"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKD3"
FT                   /inference="protein motif:TFAM:TIGR02174"
FT                   /protein_id="ACY13167.1"
FT                   /translation="MKKFPVSIEYCVQUNYTPRAVRLTDELLTQFTHQIETLTMIPSGR
FT                   GRFEVLVGDVLVFSKAELGRHAEPGEVVKLVAAELAARAGS"
FT   gene            716812..716946
FT                   /locus_tag="Hoch_0530"
FT   CDS_pept        716812..716946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13168"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKD4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13168.1"
FT                   /translation="MKLADAECQTLRGVLGVSSLAARGPPGDGLRRAGNADLPVLGQL"
FT   gene            717058..718152
FT                   /locus_tag="Hoch_0531"
FT   CDS_pept        717058..718152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce1407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13169"
FT                   /db_xref="GOA:D0LKD5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKD5"
FT                   /inference="similar to AA sequence:KEGG:sce1407"
FT                   /protein_id="ACY13169.1"
FT                   /translation="MFAFARLHTAIIVSAALLCLLATPRAFAQQADDTTAAAEALFEQG
FT                   RQLMDAGQFAEACEKFAASNEADASVGALLNLGACQERIGRLASAWTSYRQAATLARRD
FT                   KDRRRANFASKRAAELEQQLSYLVIEVPDDSNAEGLRVLRDGNEVPAALWNQRIPVDPG
FT                   EFSVVVEAPGYRAWTTQVSIAPRAGGGSEVTRVSVPALEAAPHDLPGGSTQAPQTARPG
FT                   QAPAAAVDGSAANDEGLASDMGTGRWLALANGAIGVAAVAGGVTLALQSQSKQDEAFDS
FT                   GFCNQDNVCDERGVALIDDSRSSAQLSYIFYGVGAAALTAGVVLWILSDPAESDAPAFQ
FT                   VGETAQLRSIVGPDVVGLELTGSF"
FT   sig_peptide     717058..717144
FT                   /locus_tag="Hoch_0531"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 29"
FT   gene            718154..718936
FT                   /locus_tag="Hoch_0532"
FT   CDS_pept        718154..718936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0532"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A0741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13170"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKD6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13170.1"
FT                   /translation="MHTTRASSSNDFVQAAGFARRLLPALAAALFLAACPANPPEVTLG
FT                   LTDATPGVDAPGPGPVVDAAPDGDGSVPIDAPVDGNVDPPIDAPPIDAPPIDAPAPPPI
FT                   EEFGRPNAFNGAFDLPPDNVILQRVSLDISGGLAYFGFIADTGTSNVELQMALYSESGG
FT                   VPSSLVAETGSFRVNAGDNQRPSLGDPSPPPFIEAGNYWIAVLPRNALRVRQSGSITDT
FT                   LRSFGRTFAQGFPGTVPSSTTNNLGVFNLYIGIAPPPQ"
FT   gene            718976..721186
FT                   /locus_tag="Hoch_0533"
FT   CDS_pept        718976..721186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0533"
FT                   /product="Myxococcales GC_trans_RRR domain protein"
FT                   /note="TIGRFAM: Myxococcales GC_trans_RRR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13171"
FT                   /db_xref="GOA:D0LKD7"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKD7"
FT                   /inference="protein motif:TFAM:TIGR03382"
FT                   /protein_id="ACY13171.1"
FT                   /translation="MRFASRAPLCKIAFALAPVCLLALPSAASAAPAICVPQAVGVPGN
FT                   SGPPVWWDPGDLYSSTLPTDKDPRWKGALRIAHGSGFDERVSLRALYHPSEPDGQPHLF
FT                   LSWKVEAANYSSTVQRVMVAFAPVCTRESPCDENERYVIAADLGHSNGAAAREVASSPA
FT                   WFETYLYEFSGSTNASGQEIYDAVASKPAWLSDARIWYSSDPAEMTWSVNLLVPIDDNL
FT                   ADGLPITDDFYMTYGTRIRSALGPSLATYPRDQMCGGSCPIDSSFSHDPVFTNQALVPL
FT                   RDYWSAFHLGTNAECVEGISLSAQDIGILPEGAADPLTATLDYSIDREDENIFVARPEN
FT                   NTGATVGASTLRAVFRMANWGSTPTGGTIIDEGQWLDIYDDRPGEPPILNSSDILDGDK
FT                   GVLEAEWHPETNTEMCLFGASGAGDCTGITEKAKHQCILVELMSNGGNYLFTNDSVHRN
FT                   MNFIDAEAGASSFAFQAFISPRGAPRLPNGISRGVYVRVDARNMPKAVDPKDYERMIGK
FT                   LDERFAKWRETGGSYADLARFMPTMIFHVYHETGERASDREYEGAPVLREQAAFGLFVN
FT                   PPRKFMPEGWRVAIDGAVQIDEDLYRMEVSDFGTAVVQTRLKALSKDDMKFRSPDFYWR
FT                   SEKHEDTRCMELDPELCEALNKPQSKKVYFGDALPVLHGDETEAYGADEAFGDGDVPPT
FT                   AGCQAAPGGNAGSLGTLLLGLMVAAWLGLRRRASVIARRPRR"
FT   sig_peptide     718976..719068
FT                   /locus_tag="Hoch_0533"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 31"
FT   gene            complement(721236..722600)
FT                   /locus_tag="Hoch_0534"
FT   CDS_pept        complement(721236..722600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0534"
FT                   /product="protein of unknown function DUF472"
FT                   /note="PFAM: protein of unknown function DUF472; protein of
FT                   unknown function DUF470; KEGG: mxa:MXAN_6818 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13172"
FT                   /db_xref="GOA:D0LKD8"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:D0LKD8"
FT                   /inference="protein motif:PFAM:PF04331"
FT                   /protein_id="ACY13172.1"
FT                   /translation="MATRAHPPDAVVALLRRYGRETTSFQTLEPGLSYWLDPDGDACVA
FT                   YADTGAAWVAVGAPLAEPARRDEVAARFLEAARAAGRRARFFGVEDGDFGGAAFTCQHV
FT                   GEQPCWDPRAWPEVLRKKRSLREQLRRARAKGVRVRRLAAAELSDRGNPIRRELDALVA
FT                   EWQGAREMAPMGFVVQIALDLLPEERRVFVAEFSGQVVAFLGAVPVYARGGWFFEDVLR
FT                   RGGAPNGTVELLIDHAMRALAEDGCDYVTYGLAPLARTPSPVLGWIRDHTRWLYHFDGL
FT                   RAFKDKFQPAAWQPVYLAYPRRERGLRATVDLLAAFACGSFARFGWATLVHRAAAVTRW
FT                   LAWLLLPWTALLIAADSARWFPSPAVKAAWIAYDLLLFTGLLSLARRWRPRLATALAGG
FT                   AALDFSLGSVQAGLYNAERVRGPVDLLFLVLALGAPLFAALFLWSARHRGAGGKR"
FT   gene            722859..724688
FT                   /locus_tag="Hoch_0535"
FT   CDS_pept        722859..724688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0535"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13173"
FT                   /db_xref="GOA:D0LLF6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D0LLF6"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ACY13173.1"
FT                   /translation="MENVSTRDEEQNQSESAQAAPASTESPAAESATSESADAASLQAD
FT                   ESAAEAAEGGEAGASSAENESQAAEGGEAAEGGDAAEGGKAPLRKSRSRGGRRGGRGSG
FT                   GGGQNDPTPELLKLVDLSVKFPDIGPALAELAFKLGNSEIGERVLSMGLSSDRPGLEFY
FT                   FVAAHAARRERRYEDALRASIDAVRAYADAADDAIAADDAQRLLHLVRLGFNTLMFEIG
FT                   DVEKHPWFTRDLIAELTRAEPRLGEDSFFRSLLAQALWFEDRERSEAEWQRAHELGAPE
FT                   TTWNARGTWYREAENDLVKAEEAYRKGLEAASDSALLNHNLAQVLIDRARGLEDDKEQV
FT                   KALLQEAETLLRDALREDGPKGLRRHIHATRDRLFELRRAVVPRSRRRGGKKEADAPVN
FT                   KEPPAVGDTVQGRVRSVAAFGAFVVLPSGHVGLVHKSELRTGQVNDATEEVNVGDEFEV
FT                   KVLDVSPDGDSNRLRIGLSRRVLMPGGDKERERERAKGDERGKGGGRGRGGGGGRGGGE
FT                   RGKSGGGGGGGGGGGRGRGAGERGKGGGGRGPRRGGGDEPRGARDDGDRRPRRDGDDRR
FT                   SPRESEADRKKQEKLASLGEMLLAKMNEDDSKS"
FT   gene            complement(724836..725885)
FT                   /locus_tag="Hoch_0536"
FT   CDS_pept        complement(724836..725885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csa:Csal_1174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13174"
FT                   /db_xref="GOA:D0LLF7"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:D0LLF7"
FT                   /inference="similar to AA sequence:KEGG:Csal_1174"
FT                   /protein_id="ACY13174.1"
FT                   /translation="MNLRWLRIALQLAVTVALLGVLWRLSGGSLLERLRSADLVWCLGG
FT                   VLFASGAVIAGSLRWLYTARRVGMELDARRAVGEFYLAGFLNQVLPGGISGDAVRAWRH
FT                   GKRSREQPAATQPEPAEQPDGDSSLVRRADTAEDAKPGPAARASSLSDVTGKRVGIGPA
FT                   VRVVLIERVANQMVVAPAMLASMSLWPLLPGAGPAAQVWGPLIGAAAAIALLLLVIYAL
FT                   SQRRSGGRIQRFFRDTRSALLNRRSMAAQFALGGLLLGCCLGTFYCAAQAVNATLPLLY
FT                   LLALVPGVMFSLSLPISIAGWGLREATSVALWAMAGLPYAEAMASSVLYGILGLLASLP
FT                   GALVLLLGR"
FT   gene            complement(725928..726887)
FT                   /locus_tag="Hoch_0537"
FT   CDS_pept        complement(725928..726887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0537"
FT                   /product="fatty acid hydroxylase"
FT                   /note="PFAM: fatty acid hydroxylase; KEGG: oan:Oant_3860
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13175"
FT                   /db_xref="GOA:D0LLF8"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:D0LLF8"
FT                   /inference="protein motif:PFAM:PF04116"
FT                   /protein_id="ACY13175.1"
FT                   /translation="MDPELPNVIQLAVPFFVLLIAAEMVLWKRRGNVVYETRDATTSLL
FT                   MGVGNLVAGLLTGGLVVLIYFAVYRHRVFDLGYEWWMFVLVLVVRDFVFYWGHRLSHTC
FT                   RWFWANHVVHHSSQHYNLTTALRQPWTSGISLLYVLGIPVIWLGVPPALYFFAGGVNLV
FT                   YQFWIHTEAVGRLGPLEWVLNTPSHHRAHHATNPRYLDSNYAGMLIIWDRIFGTFVPED
FT                   PADPPRYGLVKNLHSFNPVRVAFHEYASIVGDLRRARSLSEIGGYVLGPPGWSPDGSRQ
FT                   TSAQIQDAWRRRARAQSEAQTAAQTAAQVDESAIQGAK"
FT   gene            complement(726900..727382)
FT                   /locus_tag="Hoch_0538"
FT   CDS_pept        complement(726900..727382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0538"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mll1067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13176"
FT                   /db_xref="UniProtKB/TrEMBL:D0LLF9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13176.1"
FT                   /translation="MDPLALALPLVGVVALVVLCALAGGTAREALADADDALARLRSDE
FT                   PDFAAGAVWLAGDGRSALVCEARGEAIAVVLILGDKHVTRVLRPGSVRALRERRRRDGA
FT                   RVLRVLTRDASCARIDLLCPEPTADTDTLESGPWRQALERLQAPPAQHANALTPAP"
FT   sig_peptide     complement(727311..727382)
FT                   /locus_tag="Hoch_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.630 at
FT                   residue 24"
FT   gene            complement(727472..728026)
FT                   /locus_tag="Hoch_0539"
FT   CDS_pept        complement(727472..728026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0539"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acp:A2cp1_2430 sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13177"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D0LLG0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY13177.1"
FT                   /translation="MRPRHTILLLTSLSTFVALFVLLVQVRADAEVAVPDDALTRARQM
FT                   FERHSRVRQAGAATPSSAPRTTPVPPPSVATATPARPSARPTAPSRRPRAQMAGSSGDS
FT                   GELSIDDVRAFYDRGNFFDALEAAERYLRANPDQAYIRRVAVTSACAVGEEATARRYYE
FT                   QMSKRDQRTVGIRCGRYGVRF"
FT   sig_peptide     complement(727940..728026)
FT                   /locus_tag="Hoch_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.721 at
FT                   residue 29"
FT   gene            complement(728242..728628)
FT                   /locus_tag="Hoch_0540"
FT   CDS_pept        complement(728242..728628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0540"
FT                   /product="6-pyruvoyl tetrahydropterin synthase"
FT                   /note="KEGG: noc:Noc_1077 6-pyruvoyl tetrahydropterin
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13178"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:D0LLG1"
FT                   /inference="similar to AA sequence:KEGG:Noc_1077"
FT                   /protein_id="ACY13178.1"
FT                   /translation="MFSLRIADYLKCAHSFKGEIFGIAQILHIITYEVEAVFIVEELDE
FT                   NNLVVDFGASQQALTAIIGTMNYKNLDELPELNGKNTTTEFLCRYIHEYMSKAVEDLFS
FT                   GTLRITMRESTVAEVSYEKPVTKS"
FT   gene            complement(728982..730865)
FT                   /locus_tag="Hoch_0541"
FT   CDS_pept        complement(728982..730865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0541"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: scl:sce6414 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13179"
FT                   /db_xref="GOA:D0LLG2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D0LLG2"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY13179.1"
FT                   /translation="MQAPVEVGDVIAGKYEIERHLAAGGMGIVVVARHVQLDRQVAIKF
FT                   MLPELREIAVDPDALERFLREGRAASKLRGENVARVLDVDTLDEAGQVPYMVMEYLHGV
FT                   DLGRHIKDHGPLPLSEAVDHLLQACVAMAEAHQLGIVHRDLKPSNLFLTRRPDGVPLVK
FT                   VLDFGISKLFSDIGDGSQTGTAMLMGSPSYMPPEQARAARNADVRSDIWSLGVILYEAA
FT                   AKKLPFTGSESTAALLAKLIYEAPVPLRQAAPSLPAAFCTVVDRCLQRDPDARYQSVGE
FT                   LASALLPFAGAHGRSAAHSVHAIIGGSSAAAAQPAPAAPPAATSADASAASPAAELALH
FT                   DTALGHADTYPTGAQSSASDDAGALRGDTPARADTAGAEAAGADAAGAEPLLELDPEAV
FT                   ASLRGDQAATAGKDAKADAKAGKRDQNSADKRSKRPAVAPMVAGDGRNLVVEAAAAQLR
FT                   RPRGRGVRSIATLALFAVLGVLTCVIALGDGIAALDAIDRSMFAAAHDLASELLRKLPK
FT                   WMLIAASLVLLMPAIALIILRALGLRVLAASAAWWLGQSTVYVSRQLARAVGEESSWLP
FT                   DAPAYWLELIDEAALRNSVNNAAQVLFGVGTALMIGALLYLLRQGSRRRRW"
FT   gene            complement(730972..732027)
FT                   /locus_tag="Hoch_0542"
FT   CDS_pept        complement(730972..732027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0542"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   csa:Csal_1176 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13180"
FT                   /db_xref="GOA:D0LLG3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D0LLG3"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACY13180.1"
FT                   /translation="MPVPVPASQTASASAPGFLLVAPPTANPWTGGYLYNAQCAAHAPA
FT                   LSLAFAEADELSEIVEQAAPARCLLDSIYLASPSPVVDRVAAEHAPLWMLHCLPHYLVH
FT                   PDERERVRECSARRLAHARGAITSSGFLAERVRAFVGPGLAVEIVRPGLAPIPRPAQAG
FT                   THVARDPVRVLSVANLAPHKGVLELARALAAARDLAWRWDIVGDAAVAPEHTRAIEALL
FT                   GDAGVADRVRFRGLVAREQLGAHYAEADLFALLARDEAYGMVFAEAQSFGLPVLALREG
FT                   GPCEIVEHAGTGLLCAPDDPDDAARALRALLGDQGMRSRLSENARQLRFPGWPETAAAF
FT                   TAACARLSQSA"
FT   gene            complement(732050..732757)
FT                   /locus_tag="Hoch_0543"
FT   CDS_pept        complement(732050..732757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0543"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   noc:Noc_1080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13181"
FT                   /db_xref="GOA:D0LLG4"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:D0LLG4"
FT                   /inference="protein motif:PFAM:PF01066"
FT                   /protein_id="ACY13181.1"
FT                   /translation="MGREGEALHSWSLAMAVVGLLALALWLWAPALLSPVAMSAAVALW
FT                   ALLGFGVLFVRIGGYRRWADRVTAVRVLLCIALFASCALDPQPGWSKVGISTLILVLDG
FT                   VDGALARHFGPTERGAVFDMESDAFYTLISAAVAYLYLEVTVWVLLIGALRPLYVCGWA
FT                   VLERFFPQRSPNAKGSPWARIIFLIVAITLIANLASIVPLPVKQVLSIASAVLLSLSFL
FT                   QHLLASIDRSAPV"
FT   sig_peptide     complement(732638..732757)
FT                   /locus_tag="Hoch_0543"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.808 at
FT                   residue 40"
FT   gene            complement(732763..734382)
FT                   /locus_tag="Hoch_0544"
FT   CDS_pept        complement(732763..734382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0544"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: csa:Csal_1105 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13182"
FT                   /db_xref="GOA:D0LLG5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D0LLG5"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACY13182.1"
FT                   /translation="MDRRTLTDPITTALALVFLHLAIAIFYWLAAPAPATLLAPTWEIL
FT                   GLVGVLLLVGWIGTVVQIRGLDSVLTVLVLAYFVLGLAQGFARREFGYDVIVALHAPYV
FT                   PELFRMLYNGETLGMFLLYCALLAVVLIALLAGIYAAVRKLVQQSASTRRSRLLIGGGV
FT                   AVYAAITIPLFGIQGPLTKNLIEQVDLAVNLDQRIDETARRIELETAWIKQRNPFAKLD
FT                   KPPRILLFIIESYGRALYDDEDFANFQKLAQASADKLAEGGYAVRSRYLTAPVFGGSSW
FT                   LSDTALLCGVRIPDQKHFRGMHASHAKCLPHILDDAGYHTVVAAPNTKTLDGTFDEGLG
FT                   FETIYYRENLAYQGPRFGWSFMPDQYAIQRVHEDVLAKGGERPEFVTYILTSSHHPWNK
FT                   LPPLIDQWDEIGDGAIFSKRRPRRFSNSFVGGRQVKKAFMASIEYSFETVIEYLLRLDD
FT                   RETIIVITGDHQPRTPIADLNTDPWDVPFHIISRNPALVERFASAGYEATLEPRSDAPA
FT                   QGSEGFLLQLFRAFSDADTNRR"
FT   gene            complement(734455..735099)
FT                   /locus_tag="Hoch_0545"
FT   CDS_pept        complement(734455..735099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0545"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="KEGG: dvl:Dvul_1858 GTP cyclohydrolase II; TIGRFAM:
FT                   GTP cyclohydrolase II; PFAM: GTP cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13183"
FT                   /db_xref="GOA:D0LLG6"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:D0LLG6"
FT                   /inference="protein motif:TFAM:TIGR00505"
FT                   /protein_id="ACY13183.1"
FT                   /translation="MKNLVMQKPRSVSLEKYATSKLPTIHGQFEVTVYRYGPDSEEALA
FT                   VTLGSFAPDEPTFVRVHSECYTGEVLGSLKCDCREQLELALTRIQELGRGVLVYLRQEG
FT                   RGIGLGNKIRAYALQDQGADTVQANHQLGFATDLREFDVAAEILKDLGVARIHLHTNNP
FT                   EKIQAMEDHGIELVSREPAHGVINPHNRRYLETKHHTLGHDFAALLSGPKK"
FT   gene            735575..736807
FT                   /locus_tag="Hoch_0546"
FT   CDS_pept        735575..736807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0546"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   mxa:MXAN_3559 ribosomal protein S1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13184"
FT                   /db_xref="GOA:D0LLG7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D0LLG7"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ACY13184.1"
FT                   /translation="MSSPDEQEDFAALLDAFEKEHSADEKPGRKRPQVGDTVTGQVVSV
FT                   GSEAAFVQVDGKTEAFLGLDQITDENGEILVQEGDTVEARIVEMRGDMPVLRTVVAGGR
FT                   SAGHGPDAVAELEQAHAHGLPVEGQITAVNKGGVEVQVGGVRGFCPISQLSDSFVEDAG
FT                   EYVGKKLSFRITRLETSRKQANLVLSRRALLEEAKAAIAAETRARLREGVTIRGTVTSM
FT                   KPFGAFVDIGGLEGMIHVSELGFGRVDHPEDVLHVGQEVDVQVLRIEETRDKDAKRRER
FT                   IALSMKALADDPWDAIEQRYGNGGQAKGRVVRLQPFGAFIEIEPGIEGLAHISQLGAGR
FT                   RIQHPREVLKVGDEVEVNVLGVERERRRISLSIGGATDEHEAGASEVAAHAARSTSGGN
FT                   LGTFADLLKKR"
FT   gene            complement(736863..738899)
FT                   /locus_tag="Hoch_0547"
FT   CDS_pept        complement(736863..738899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0547"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: mxa:MXAN_2738
FT                   serine/threonine kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13185"
FT                   /db_xref="GOA:D0LLG8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:D0LLG8"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY13185.1"
FT                   /translation="MRAALARAQRLTVAELLRVPGTGAVPWVSVRSPARHSISGPDGES
FT                   VSIALESSDECIGANTAVAFLDGELSLEEADAVEAHAAHCEECRQHLAALSASDSQADL
FT                   VPTSPLGAEGHLILERGEKVGRFEVLGRLGTGGMGVVWSAYDRRLERKVALKLLRSPKD
FT                   GGVEAESARLRLLREAQAMARLSHPGVISVYDVGTYKNEVYIAMELVEGDTLTRWLSRY
FT                   ERPWQDILGKFLEAGTVLAEAHVGGLLHRDFKPDNVLVGSDERVRVMDFGLARSLLFDA
FT                   PLEAGEGASVAQPPSNILGHPLTRTGMLVGTPRYMAPEQFAGRDTDARTDQFSFCVALY
FT                   EALYRRHPFEGEHAAAVTAETEVPPPPAGNAAPAWLHTALVHGLAHAPGERFPTMQALL
FT                   RALAPPPPRPSPLRRAWPAGVLLALALAAYAFAAWSTALGDNARLGGEVAAAQGRIIEL
FT                   ERDIGEILELVSELEGRAGEREDLIAELEQRLAAAGGELEQARAALSESRAPAAAAQSI
FT                   SSAQPVRAPRSEPPAAISQPPPAPVGLSRGQLMAPLEQVHRDLAVCFREWLERSPDTRL
FT                   LLGMRVRVEPSGAPALDKVAGLADPVLRACASGNLLRLRFPAAEAVTLADYKFYGSTSG
FT                   GLFTRVDVVAALPPEPDDTAEFDESPSAIESSAAGAGSRSLAP"
FT   gene            739066..741153
FT                   /locus_tag="Hoch_0548"
FT   CDS_pept        739066..741153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0548"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small GTP-
FT                   binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor G domain protein; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: ade:Adeh_2292 elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13186"
FT                   /db_xref="GOA:D0LLG9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D0LLG9"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ACY13186.1"
FT                   /translation="MITDLSKVRNIGISAHIDSGKTTLTERILFYTNRIHAIHDVRGKD
FT                   GVGAKMDSMELERERGITIASAATHCEWKKHHVNIIDTPGHVDFTIEVERSLRVLDGAI
FT                   LVLCSVAGVQSQSFTVDRQMRRYHVPRIAFVNKCDRTGANPLRVRDQLREKLGHNPVLL
FT                   QLPIGLEDDHRGVVDLVTLKALTFHGDNGETIKEEDIPANMADEVAAAREELLDSVSMY
FT                   SDELMEAMLEEAVTVEMLRNAIRTATLAHKITPVLMGSAYKNKGVQPLLDAVTYYLPDP
FT                   TEVENKALDLERDEAEIVLESDPEKPLVLLAFKLEDGRYGQLTYLRIYQGTVRRDDFIV
FT                   NSRTGKKHKVGRLVRMHSNEMEDIQDTGAGDIVAIFGIDCNSGDTFTDGSLQATMTSMH
FT                   VPEAVISVAIKPVDNAAETKMSKALRRFSKEDPTFRVAVDAESGETIISGMGELHLEVY
FT                   IERMKREYSANVTTSPPQVAYRETLSKHTNFDYTHKKQTGGSGQYGRVVGYVEPYEDGD
FT                   FEFIDEIKGGVIPRQFIPSVEKGFKSMLEKGQLIGYPVVNVRVCINDGNAHSVDSSDVA
FT                   FQEAARGAWRSFYAKAKPKLLEPIMRVAVEGPTEHSGNVLTTLMQRRGMIIGSQEDGTM
FT                   ARIEAEVPLAEMFAYSNTLRSATQGKAEFSMEFSRYLEVPAAIAEELIAKAQEDAKAGK
FT                   K"
FT   gene            741165..742460
FT                   /locus_tag="Hoch_0549"
FT   CDS_pept        741165..742460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afw:Anae109_2814 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13187"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LLH0"
FT                   /inference="similar to AA sequence:KEGG:Anae109_2814"
FT                   /protein_id="ACY13187.1"
FT                   /translation="MYRKEVNEHSPLRILDKSIHGGLGKGNLGVVMARAGVGKTACLVQ
FT                   IGLDDLMRDRPVLHLTLEQSVEHVQSWYDALFDDLALQNDLEDQESERARLAAQRLIYS
FT                   FSDHELWPERLEKTVAMFKKHLDFDPAAILVDGYDWAAHSVTENAAMIGAFKAYAKMLG
FT                   AELWMTAQTHREGTGDHPNKVPPPCDAYANLIDVAVFLEPHGELVALRLLKDHGNAAPH
FT                   DTRLNLHPDTLRLADSEDKNRNPRMPPSAFTLLSGGAEGAEACFGRCAEKWGLMELNFS
FT                   FDGRTPKRTRGLVRLSDAELAQGAVSQVYMEAHMHRSYPATPLFQKTLQSIWHQVNTAQ
FT                   EVFTVGVLLEDGTVKGGTGWAAELARVWNKPVYVFDQERNAWFSWQEKEWVKEDAPVIK
FT                   ARRFTGTGTRYLSDQGRAAVEELFERSFGKQS"
FT   gene            742665..743501
FT                   /locus_tag="Hoch_0550"
FT   CDS_pept        742665..743501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0550"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   scl:sce9034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13188"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D0LLH1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACY13188.1"
FT                   /translation="MTFAVTFWGTRGSIACPTPRHLIYGGNTSCVQLQLGTRQVVLDAG
FT                   TGIRELGAWFLQNGIRKAVMLLTHAHWDHINGFPFFAPAFRKESELLIMAGSLRASGGV
FT                   YAALEGQMTKPMFPVPLDAMHSDCTFEDFDAGQRFSLGDGIEVQTVLLNHPSGATGYRI
FT                   EYGGKSLCYVTDTEHVRGQRDKNILRLIDGADLVIYDSTYTDETFEPKIGWGHSTWQEG
FT                   VRLCREAKAKRLVIFHHDPEHTDDIMAAIEKRASEEWSETIVAREGMRIDLLDPEQ"
FT   gene            complement(743607..744740)
FT                   /locus_tag="Hoch_0551"
FT   CDS_pept        complement(743607..744740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0551"
FT                   /product="Peptidoglycan-binding lysin domain protein"
FT                   /note="PFAM: Peptidoglycan-binding lysin domain; SMART:
FT                   Peptidoglycan-binding LysM; KEGG: scl:sce7917 putative
FT                   penicillin-insensitive murein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13189"
FT                   /db_xref="GOA:D0LLH2"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D0LLH2"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ACY13189.1"
FT                   /translation="MSTIRASSGHPPLVPSTESNAPPRRSAPAQRRTLRIGWLRATLVA
FT                   ACALLASSSDARAEGKGRAHVVEAGQTLWEIAQSYGCKVDELQAVNEIDGLLIQPGQRL
FT                   RVPRCKQQGGSSSKGLHVLSHEVSSGDTLYEIARRYDTSLDDLRRRNDIKGNVIHPGQT
FT                   LRVAVGKDGEGRPVAGQSVGSVVRGRLVNGMQLPEGRGYYRRRPHRAWGASHTIHHIRR
FT                   AIASVRNRLPKVHEVAIGDISTHDGGQLADHRSHQSGRDVDIGLYYKKRPRGYPKSFIR
FT                   GDQQNLDLQATWALIEALANTSKVAGGVDIMFLDYDLQGHLYKWAKKHGVSKRKLGEIL
FT                   QYPRGESSASGLVRHEPGHATHVHVRFKCPKSDEKCW"
FT   sig_peptide     complement(744564..744740)
FT                   /locus_tag="Hoch_0551"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.690) with cleavage site probability 0.574 at
FT                   residue 59"
FT   gene            complement(744882..745562)
FT                   /locus_tag="Hoch_0552"
FT   CDS_pept        complement(744882..745562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0552"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: mxa:MXAN_1349 DNA-binding response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13190"
FT                   /db_xref="GOA:D0LLH3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D0LLH3"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACY13190.1"
FT                   /translation="MSQHKILIVEDDEAIAAGLALNLKIAGYQTTVVHDGLEALKRLEE
FT                   SSPHLILLDINLPSENGIGVLGTLRQSGNQVPVIILSARDDEYDKVAALRLGADDYITK
FT                   PFGLAELMARVAAVLRRVGTQEISALHRFGSVEVELETRSVVRQGEAIKLTHLEFELLA
FT                   FLVKNPSRVFSREELLRQVWKQSSGTLRTVDNFVAQLRSKLESDPENPRFFITVRGSGY
FT                   RFDS"
FT   gene            complement(745617..746582)
FT                   /locus_tag="Hoch_0553"
FT   CDS_pept        complement(745617..746582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hoch_0553"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: ank:AnaeK_0438 integral membrane sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hoch_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACY13191"
FT                   /db_xref="GOA:D0LLH4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL: