(data stored in ACNUC28527 zone)

EMBL: CP001807

ID   CP001807; SV 1; circular; genomic DNA; STD; PRO; 3261604 BP.
XX
AC   CP001807; ABUL01000000-ABUL01000004;
XX
PR   Project:PRJNA29281;
XX
DT   06-NOV-2009 (Rel. 102, Created)
DT   16-DEC-2013 (Rel. 119, Last updated, Version 3)
XX
DE   Rhodothermus marinus DSM 4252, complete genome.
XX
KW   .
XX
OS   Rhodothermus marinus DSM 4252
OC   Bacteria; Bacteroidetes; Bacteroidetes Order II. Incertae sedis;
OC   Rhodothermaceae; Rhodothermus.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-3261604
RX   DOI; 10.4056/sigs.46736.
RX   PUBMED; 21304669.
RA   Nolan M., Tindall B.J., Pomrenke H., Lapidus A., Copeland A.,
RA   Glavina Del Rio T., Lucas S., Chen F., Tice H., Cheng J.F., Saunders E.,
RA   Han C., Bruce D., Goodwin L., Chain P., Pitluck S., Ovchinikova G.,
RA   Pati A., Ivanova N., Mavromatis K., Chen A., Palaniappan K., Land M.,
RA   Hauser L., Chang Y.J., Jeffries C.D., Brettin T., Goker M., Bristow J.,
RA   Eisen J.A., Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.P.,
RA   Detter J.C.;
RT   "Complete genome sequence of Rhodothermus marinus type strain (R-10)";
RL   Stand Genomic Sci 1(3):283-290(2009).
XX
RN   [2]
RP   1-3261604
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K.,
RA   Mikhailova N., Ovchinnikova G., Saunders E., Brettin T., Detter J.C.,
RA   Han C., Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F.,
RA   Hugenholtz P., Woyke T., Wu D., Pomrenke H., Schneider S., Tindal B.,
RA   Goeker M., Klenk H.-P., Eisen J.A.;
RT   "The complete chromosome of Rhodothermus marinus DSM 4252";
RL   Unpublished.
XX
RN   [3]
RP   1-3261604
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K.,
RA   Mikhailova N., Ovchinnikova G., Saunders E., Brettin T., Detter J.C.,
RA   Han C., Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F.,
RA   Hugenholtz P., Woyke T., Wu D., Pomrenke H., Schneider S., Tindal B.,
RA   Goeker M., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (27-OCT-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 1b1fecae5da3261cf47d9e5d2a2a6f63.
DR   BioSample; SAMN00002700.
DR   CABRI; DSM 4252.
DR   EnsemblGenomes-Gn; EBG00001104722.
DR   EnsemblGenomes-Gn; EBG00001104723.
DR   EnsemblGenomes-Gn; EBG00001104724.
DR   EnsemblGenomes-Gn; EBG00001104725.
DR   EnsemblGenomes-Gn; EBG00001104726.
DR   EnsemblGenomes-Gn; EBG00001104727.
DR   EnsemblGenomes-Gn; EBG00001104728.
DR   EnsemblGenomes-Gn; EBG00001104729.
DR   EnsemblGenomes-Gn; EBG00001104730.
DR   EnsemblGenomes-Gn; EBG00001104731.
DR   EnsemblGenomes-Gn; EBG00001104732.
DR   EnsemblGenomes-Gn; EBG00001104733.
DR   EnsemblGenomes-Gn; EBG00001104734.
DR   EnsemblGenomes-Gn; EBG00001104735.
DR   EnsemblGenomes-Gn; EBG00001104736.
DR   EnsemblGenomes-Gn; EBG00001104737.
DR   EnsemblGenomes-Gn; EBG00001104738.
DR   EnsemblGenomes-Gn; EBG00001104739.
DR   EnsemblGenomes-Gn; EBG00001104740.
DR   EnsemblGenomes-Gn; EBG00001104741.
DR   EnsemblGenomes-Gn; EBG00001104742.
DR   EnsemblGenomes-Gn; EBG00001104743.
DR   EnsemblGenomes-Gn; EBG00001104744.
DR   EnsemblGenomes-Gn; EBG00001104745.
DR   EnsemblGenomes-Gn; EBG00001104746.
DR   EnsemblGenomes-Gn; EBG00001104747.
DR   EnsemblGenomes-Gn; EBG00001104748.
DR   EnsemblGenomes-Gn; EBG00001104749.
DR   EnsemblGenomes-Gn; EBG00001104750.
DR   EnsemblGenomes-Gn; EBG00001104751.
DR   EnsemblGenomes-Gn; EBG00001104752.
DR   EnsemblGenomes-Gn; EBG00001104753.
DR   EnsemblGenomes-Gn; EBG00001104754.
DR   EnsemblGenomes-Gn; EBG00001104755.
DR   EnsemblGenomes-Gn; EBG00001104756.
DR   EnsemblGenomes-Gn; EBG00001104757.
DR   EnsemblGenomes-Gn; EBG00001104758.
DR   EnsemblGenomes-Gn; EBG00001104759.
DR   EnsemblGenomes-Gn; EBG00001104760.
DR   EnsemblGenomes-Gn; EBG00001104761.
DR   EnsemblGenomes-Gn; EBG00001104762.
DR   EnsemblGenomes-Gn; EBG00001104763.
DR   EnsemblGenomes-Gn; EBG00001104764.
DR   EnsemblGenomes-Gn; EBG00001104765.
DR   EnsemblGenomes-Gn; EBG00001104766.
DR   EnsemblGenomes-Gn; EBG00001104767.
DR   EnsemblGenomes-Gn; EBG00001104768.
DR   EnsemblGenomes-Gn; EBG00001104769.
DR   EnsemblGenomes-Gn; EBG00001104770.
DR   EnsemblGenomes-Gn; EBG00001104771.
DR   EnsemblGenomes-Gn; EBG00001104772.
DR   EnsemblGenomes-Gn; EBG00001104773.
DR   EnsemblGenomes-Gn; Rmar_R0001.
DR   EnsemblGenomes-Gn; Rmar_R0002.
DR   EnsemblGenomes-Gn; Rmar_R0003.
DR   EnsemblGenomes-Gn; Rmar_R0004.
DR   EnsemblGenomes-Gn; Rmar_R0005.
DR   EnsemblGenomes-Gn; Rmar_R0006.
DR   EnsemblGenomes-Gn; Rmar_R0007.
DR   EnsemblGenomes-Gn; Rmar_R0008.
DR   EnsemblGenomes-Gn; Rmar_R0009.
DR   EnsemblGenomes-Gn; Rmar_R0010.
DR   EnsemblGenomes-Gn; Rmar_R0011.
DR   EnsemblGenomes-Gn; Rmar_R0012.
DR   EnsemblGenomes-Gn; Rmar_R0013.
DR   EnsemblGenomes-Gn; Rmar_R0014.
DR   EnsemblGenomes-Gn; Rmar_R0015.
DR   EnsemblGenomes-Gn; Rmar_R0016.
DR   EnsemblGenomes-Gn; Rmar_R0017.
DR   EnsemblGenomes-Gn; Rmar_R0018.
DR   EnsemblGenomes-Gn; Rmar_R0019.
DR   EnsemblGenomes-Gn; Rmar_R0020.
DR   EnsemblGenomes-Gn; Rmar_R0021.
DR   EnsemblGenomes-Gn; Rmar_R0022.
DR   EnsemblGenomes-Gn; Rmar_R0023.
DR   EnsemblGenomes-Gn; Rmar_R0024.
DR   EnsemblGenomes-Gn; Rmar_R0025.
DR   EnsemblGenomes-Gn; Rmar_R0026.
DR   EnsemblGenomes-Gn; Rmar_R0027.
DR   EnsemblGenomes-Gn; Rmar_R0028.
DR   EnsemblGenomes-Gn; Rmar_R0029.
DR   EnsemblGenomes-Gn; Rmar_R0030.
DR   EnsemblGenomes-Gn; Rmar_R0031.
DR   EnsemblGenomes-Gn; Rmar_R0032.
DR   EnsemblGenomes-Gn; Rmar_R0033.
DR   EnsemblGenomes-Gn; Rmar_R0034.
DR   EnsemblGenomes-Gn; Rmar_R0035.
DR   EnsemblGenomes-Gn; Rmar_R0036.
DR   EnsemblGenomes-Gn; Rmar_R0037.
DR   EnsemblGenomes-Gn; Rmar_R0038.
DR   EnsemblGenomes-Gn; Rmar_R0039.
DR   EnsemblGenomes-Gn; Rmar_R0040.
DR   EnsemblGenomes-Gn; Rmar_R0041.
DR   EnsemblGenomes-Gn; Rmar_R0042.
DR   EnsemblGenomes-Gn; Rmar_R0043.
DR   EnsemblGenomes-Gn; Rmar_R0044.
DR   EnsemblGenomes-Gn; Rmar_R0045.
DR   EnsemblGenomes-Gn; Rmar_R0046.
DR   EnsemblGenomes-Gn; Rmar_R0047.
DR   EnsemblGenomes-Gn; Rmar_R0048.
DR   EnsemblGenomes-Gn; Rmar_R0049.
DR   EnsemblGenomes-Gn; Rmar_R0050.
DR   EnsemblGenomes-Gn; Rmar_R0051.
DR   EnsemblGenomes-Tr; EBT00001696665.
DR   EnsemblGenomes-Tr; EBT00001696667.
DR   EnsemblGenomes-Tr; EBT00001696669.
DR   EnsemblGenomes-Tr; EBT00001696671.
DR   EnsemblGenomes-Tr; EBT00001696673.
DR   EnsemblGenomes-Tr; EBT00001696676.
DR   EnsemblGenomes-Tr; EBT00001696678.
DR   EnsemblGenomes-Tr; EBT00001696680.
DR   EnsemblGenomes-Tr; EBT00001696683.
DR   EnsemblGenomes-Tr; EBT00001696685.
DR   EnsemblGenomes-Tr; EBT00001696688.
DR   EnsemblGenomes-Tr; EBT00001696690.
DR   EnsemblGenomes-Tr; EBT00001696692.
DR   EnsemblGenomes-Tr; EBT00001696694.
DR   EnsemblGenomes-Tr; EBT00001696695.
DR   EnsemblGenomes-Tr; EBT00001696698.
DR   EnsemblGenomes-Tr; EBT00001696699.
DR   EnsemblGenomes-Tr; EBT00001696702.
DR   EnsemblGenomes-Tr; EBT00001696704.
DR   EnsemblGenomes-Tr; EBT00001696705.
DR   EnsemblGenomes-Tr; EBT00001696707.
DR   EnsemblGenomes-Tr; EBT00001696710.
DR   EnsemblGenomes-Tr; EBT00001696713.
DR   EnsemblGenomes-Tr; EBT00001696716.
DR   EnsemblGenomes-Tr; EBT00001696718.
DR   EnsemblGenomes-Tr; EBT00001696721.
DR   EnsemblGenomes-Tr; EBT00001696724.
DR   EnsemblGenomes-Tr; EBT00001696727.
DR   EnsemblGenomes-Tr; EBT00001696729.
DR   EnsemblGenomes-Tr; EBT00001696730.
DR   EnsemblGenomes-Tr; EBT00001696731.
DR   EnsemblGenomes-Tr; EBT00001696732.
DR   EnsemblGenomes-Tr; EBT00001696733.
DR   EnsemblGenomes-Tr; EBT00001696734.
DR   EnsemblGenomes-Tr; EBT00001696735.
DR   EnsemblGenomes-Tr; EBT00001696736.
DR   EnsemblGenomes-Tr; EBT00001696737.
DR   EnsemblGenomes-Tr; EBT00001696738.
DR   EnsemblGenomes-Tr; EBT00001696739.
DR   EnsemblGenomes-Tr; EBT00001696740.
DR   EnsemblGenomes-Tr; EBT00001696741.
DR   EnsemblGenomes-Tr; EBT00001696742.
DR   EnsemblGenomes-Tr; EBT00001696743.
DR   EnsemblGenomes-Tr; EBT00001696744.
DR   EnsemblGenomes-Tr; EBT00001696745.
DR   EnsemblGenomes-Tr; EBT00001696746.
DR   EnsemblGenomes-Tr; EBT00001696747.
DR   EnsemblGenomes-Tr; EBT00001696748.
DR   EnsemblGenomes-Tr; EBT00001696749.
DR   EnsemblGenomes-Tr; EBT00001696750.
DR   EnsemblGenomes-Tr; EBT00001696751.
DR   EnsemblGenomes-Tr; EBT00001696752.
DR   EnsemblGenomes-Tr; Rmar_R0001-1.
DR   EnsemblGenomes-Tr; Rmar_R0002-1.
DR   EnsemblGenomes-Tr; Rmar_R0003-1.
DR   EnsemblGenomes-Tr; Rmar_R0004-1.
DR   EnsemblGenomes-Tr; Rmar_R0005-1.
DR   EnsemblGenomes-Tr; Rmar_R0006-1.
DR   EnsemblGenomes-Tr; Rmar_R0007-1.
DR   EnsemblGenomes-Tr; Rmar_R0008-1.
DR   EnsemblGenomes-Tr; Rmar_R0009-1.
DR   EnsemblGenomes-Tr; Rmar_R0010-1.
DR   EnsemblGenomes-Tr; Rmar_R0011-1.
DR   EnsemblGenomes-Tr; Rmar_R0012-1.
DR   EnsemblGenomes-Tr; Rmar_R0013-1.
DR   EnsemblGenomes-Tr; Rmar_R0014-1.
DR   EnsemblGenomes-Tr; Rmar_R0015-1.
DR   EnsemblGenomes-Tr; Rmar_R0016-1.
DR   EnsemblGenomes-Tr; Rmar_R0017-1.
DR   EnsemblGenomes-Tr; Rmar_R0018-1.
DR   EnsemblGenomes-Tr; Rmar_R0019-1.
DR   EnsemblGenomes-Tr; Rmar_R0020-1.
DR   EnsemblGenomes-Tr; Rmar_R0021-1.
DR   EnsemblGenomes-Tr; Rmar_R0022-1.
DR   EnsemblGenomes-Tr; Rmar_R0023-1.
DR   EnsemblGenomes-Tr; Rmar_R0024-1.
DR   EnsemblGenomes-Tr; Rmar_R0025-1.
DR   EnsemblGenomes-Tr; Rmar_R0026-1.
DR   EnsemblGenomes-Tr; Rmar_R0027-1.
DR   EnsemblGenomes-Tr; Rmar_R0028-1.
DR   EnsemblGenomes-Tr; Rmar_R0029-1.
DR   EnsemblGenomes-Tr; Rmar_R0030-1.
DR   EnsemblGenomes-Tr; Rmar_R0031-1.
DR   EnsemblGenomes-Tr; Rmar_R0032-1.
DR   EnsemblGenomes-Tr; Rmar_R0033-1.
DR   EnsemblGenomes-Tr; Rmar_R0034-1.
DR   EnsemblGenomes-Tr; Rmar_R0035-1.
DR   EnsemblGenomes-Tr; Rmar_R0036-1.
DR   EnsemblGenomes-Tr; Rmar_R0037-1.
DR   EnsemblGenomes-Tr; Rmar_R0038-1.
DR   EnsemblGenomes-Tr; Rmar_R0039-1.
DR   EnsemblGenomes-Tr; Rmar_R0040-1.
DR   EnsemblGenomes-Tr; Rmar_R0041-1.
DR   EnsemblGenomes-Tr; Rmar_R0042-1.
DR   EnsemblGenomes-Tr; Rmar_R0043-1.
DR   EnsemblGenomes-Tr; Rmar_R0044-1.
DR   EnsemblGenomes-Tr; Rmar_R0045-1.
DR   EnsemblGenomes-Tr; Rmar_R0046-1.
DR   EnsemblGenomes-Tr; Rmar_R0047-1.
DR   EnsemblGenomes-Tr; Rmar_R0048-1.
DR   EnsemblGenomes-Tr; Rmar_R0049-1.
DR   EnsemblGenomes-Tr; Rmar_R0050-1.
DR   EnsemblGenomes-Tr; Rmar_R0051-1.
DR   EuropePMC; PMC4943939; 27471502.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001807.
DR   SILVA-SSU; CP001807.
DR   StrainInfo; 121270; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083220
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Rhodothermus marinus R-10, DSM 4252
CC   Culture Collection ID :: DSM 4252, ATCC 43812
CC   GOLD Stamp ID         :: Gi02303
CC   Funding Program       :: DOE-GEBA 2007
CC   Assembly Method       :: Newbler version 1.1.02.15, Phrap
CC   Sequencing Depth      :: 8.8x Sanger; 23.8x 454
CC   Gene Calling Method   :: Prodigal 1.4, GenePRIMP
CC   Isolation Site        :: Submarine alkaline hot spring at Reykjanes
CC                            in Iceland
CC   Collection Date       :: 1988
CC   Isolation Country     :: Iceland
CC   Latitude              :: 63.88
CC   Longitude             :: -22.5
CC   Depth                 :: 2-3 meters
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Nonmotile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Thermophile
CC   Temperature Optimum   :: 65C
CC   Salinity              :: Halophile
CC   pH                    :: 7
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Hot spring, Marine
CC   Energy Source         :: Heterotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3261604
FT                   /organism="Rhodothermus marinus DSM 4252"
FT                   /strain="DSM 4252"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:518766"
FT   gene            165..1676
FT                   /locus_tag="Rmar_0001"
FT   CDS_pept        165..1676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: bha:BH0001 chromosomal replication initiation
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46910"
FT                   /db_xref="GOA:D0MJZ7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D0MJZ7"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACY46910.1"
FT                   /translation="MERTPEAIWHACLEIIRDNVNRQSFKTWFEPIKPVSLTEEDDQIK
FT                   LTVELPSRFYYEWLEEHYYSLLRKTITKVLGPKGRLFYKIVIEKEDPQSGFEGISVNMP
FT                   AHPPETTPPPPPPRTRPVSPTAPPITPESPVEVAEQEPPVPTNPFAIPGIIRKIQVDSQ
FT                   LDPKYTFERFIEGDCNRLARSAALAIAQQPGATSFNPFLVYGGVGLGKTHLIQAIGNYA
FT                   RQHHTAETIRYVSSEQFTNEFVQAIQHNRINEFSLFYRHIDLLIVDDIQFFGGKEKTQE
FT                   EFFHIFNALHQTGKQIVLSADRPPKDIPGIEERLLSRFQWGLMADVQPPDLETRIAILR
FT                   RKAEDEGIELGDDVIEFIAHHVKSNFRELEGALLRLVAHAAYQRRDIDLALAREALRDL
FT                   IKESRVTLTIDQIQQLVCEYFDIEPDLIRSKTRKREIVQARQVAMYFCKQFTQHSLKSI
FT                   GLHFGGRDHSTVIHACQSVENLMETDPKFREIIEELRHKISLYSR"
FT   gene            1734..2873
FT                   /locus_tag="Rmar_0002"
FT   CDS_pept        1734..2873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: aba:Acid345_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain; SMART: DNA polymerase III
FT                   beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46911"
FT                   /db_xref="GOA:D0MJZ8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D0MJZ8"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACY46911.1"
FT                   /translation="MRFTVSSNDLLKALTAVAGVVPSKATMPILECILFEAEDGALRLS
FT                   ATDLEISIVERLPIQLELQNGKEGARRVAVPARRLLETLRALPDLPVQFSADESFNVTL
FT                   TTDQGHYKMVGFDGADYPALPELDEAHSLTVDAALLRRAIQKTAFAVSKDTLRPAMMGI
FT                   FFQVQPEEGRVVATDGHRLVRLRLRELVSETPLEFIVPEKATSLVAKLAAQLDGTCTIR
FT                   VDERHVAFEMGPVRIISRLIDEVYPNYEAVIPVENDRRLVVDRDAFLSAVKRVGLYASS
FT                   TTNQVRLTLEPDHVEIAAEDIERASEAYERVPCAYDGEPMVIGFNAGYLTEVLGNVDSD
FT                   EVVLEFSSPNRAGVVMPHEQAEGEDLLMLIMPVMLNTYA"
FT   gene            complement(2875..3924)
FT                   /locus_tag="Rmar_0003"
FT   CDS_pept        complement(2875..3924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46912"
FT                   /db_xref="GOA:D0MJZ9"
FT                   /db_xref="UniProtKB/TrEMBL:D0MJZ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY46912.1"
FT                   /translation="MKETLGDKILRYPWLSRETQREIEQEALRDPAWRELLEAVQSIMP
FT                   LLQSLPLTPEGPMSEEMLAFYLVTRRLSDRPLPPSLAALFARLEAQLEADPTLRSRCEE
FT                   MARQLDELVRKFDAPAHFERLTGRSLERETEPALIVAEESASFAAPEGGRAVVDAPNRL
FT                   TQRPELAGAPDRPAQRLARRSAWRWVERGAFVVVVLSVIYGGLFWWSRASQSELERLGF
FT                   IAPAQLEVEQYRGEAAPGASEAERTYQEALREIRAAHRSFLGLFPHYDAERLARAESLL
FT                   VAVVTAAPESSLLRQEAQWLLGKVRLLRHDVDGARQVLQEVAAREGPYTEAARQLLTQL
FT                   RCLETPELC"
FT   gene            complement(4029..4661)
FT                   /locus_tag="Rmar_0004"
FT   CDS_pept        complement(4029..4661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0004"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 4
FT                   domain protein; KEGG: rpi:Rpic_0920 RNA polymerase,
FT                   sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46913"
FT                   /db_xref="GOA:D0MK00"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK00"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACY46913.1"
FT                   /translation="MAVHDELGGLEALAARLPFHPDDQAAVVALYERWCTSRHPKDFRL
FT                   LELWLYCFVGRYFMIRMLREPHLSEVELEQLIGDTFLRLRRQLDSVREPERFVSWVGTA
FT                   CRNAFLNYLRNLRRRPIPEPDDPPFEAPEAEAHLVRDDLTRLLPVLAAAVERLPDFLRE
FT                   VARLALLEGLTYHEISRRLKRPPGTVRVYLSRAFRRLRQDPALQEFL"
FT   gene            4892..5335
FT                   /locus_tag="Rmar_0005"
FT   CDS_pept        4892..5335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0005"
FT                   /product="ribosomal protein L13"
FT                   /note="TIGRFAM: ribosomal protein L13; PFAM: ribosomal
FT                   protein L13; KEGG: csa:Csal_2207 50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46914"
FT                   /db_xref="GOA:D0MK01"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK01"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ACY46914.1"
FT                   /translation="MDVNSYKTYSAKPGEVTRNWYVIDAEGQVLGRLASRIATILRGKH
FT                   KPTYTPHVDMGDFVIVINADKVRLTGKKELQKQYFQHSGYPGGERLRTPAYMRKHRPEF
FT                   LIEHAVKGMLPKGPLGRRMLRKLKVYAGPSHPHGAQKPIELTL"
FT   gene            5356..5757
FT                   /locus_tag="Rmar_0006"
FT   CDS_pept        5356..5757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0006"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: mxa:MXAN_1994
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46915"
FT                   /db_xref="GOA:D0MK02"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK02"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ACY46915.1"
FT                   /translation="MATATLTQWIAVGRRKTATARVYLRPGNGQITVNRRPFEEYFPLE
FT                   WRRKVILAPFEVTGTTGQFDVLVNVQGGGLTGQAEAIRHGIARALVAYNPEFRKPLRDA
FT                   GFLTRDPRMVERKKYGQPKARKRFQFSKR"
FT   gene            5927..6757
FT                   /locus_tag="Rmar_0007"
FT   CDS_pept        5927..6757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0007"
FT                   /product="ribosomal protein S2"
FT                   /note="TIGRFAM: ribosomal protein S2; PFAM: ribosomal
FT                   protein S2; KEGG: nis:NIS_1537 30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46916"
FT                   /db_xref="GOA:D0MK03"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK03"
FT                   /inference="protein motif:TFAM:TIGR01011"
FT                   /protein_id="ACY46916.1"
FT                   /translation="MAEAAAETSAPESQPTHRVSIEELLKAGAHFGHLTSRWNPKMRPF
FT                   IFMERNGIHIIDLVQTQQLLDRAAEAAARFARQGKKILFVGTKKQARDIVRKYAEACGQ
FT                   PYVVERWLGGTLTNFQTIRQSIRRMEELARMEEEGILDQLKKKERLMKRREREKLERTL
FT                   GGIAQMAKLPGALFIVDVVREHIAVSEARKLGIPIIAIVDTNADPELIDYPIPANDDAV
FT                   RSIELITSVIANAITEGAKQREQEEASRKAEREKRAADAEAAKETRARRRKKGS"
FT   gene            6790..7620
FT                   /locus_tag="Rmar_0008"
FT   CDS_pept        6790..7620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0008"
FT                   /product="translation elongation factor Ts"
FT                   /note="TIGRFAM: translation elongation factor Ts; PFAM:
FT                   Translation elongation factor EFTs/EF1B dimerisation;
FT                   ubiquitin-associated- domain-containing protein; KEGG:
FT                   aeh:Mlg_1862 elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46917"
FT                   /db_xref="GOA:D0MK04"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK04"
FT                   /inference="protein motif:TFAM:TIGR00116"
FT                   /protein_id="ACY46917.1"
FT                   /translation="MGISAQDVKRLREMTGVGMMDCKRALEEAGGDFEAAVEILRKKGQ
FT                   KVAAKRADREAKEGLVVTAVSEDGRAGAIVEVNCETDFVARNEEFASFAQQVAQLILEQ
FT                   RPADLDALLKLQLPDGRTVEEALIDLTGKIGEKIAIRRFDVLTTDSGRIISYVHPGSRL
FT                   AVLVEVVGDGQLEEAGRDVAMQVAAMNPVAVRREEVPEEVRQKELEIAREAARNEGKPE
FT                   HIIDRIAQGKLERFYKDHVLLEQAFIKDAAITVQERLQQAGIDVRRFVRYALGE"
FT   gene            7752..8537
FT                   /locus_tag="Rmar_0009"
FT   CDS_pept        7752..8537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0009"
FT                   /product="uridylate kinase"
FT                   /note="TIGRFAM: uridylate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: gbm:Gbem_2754
FT                   uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46918"
FT                   /db_xref="GOA:D0MK05"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK05"
FT                   /inference="protein motif:TFAM:TIGR02075"
FT                   /protein_id="ACY46918.1"
FT                   /translation="MAGESDTSNNRPRPRYRRILLKLSGEALMGRKPYGIDWHVLETYA
FT                   REIRQVVELGVAVGIVIGGGNIFRGVQNASRGMKRAHADYMGMLATMINAMALQDALEQ
FT                   AGLDTRLQSSIKMEQIAEPFIRRRAIRHLEKGRVVIFGAGTGNPYFTTDTAAALRALEI
FT                   EAEVLLKGTRVDGVYSADPERDPNARLFTTIHGREVIQRDLRVMDMTAFTLCREAGLPI
FT                   IVFNMNKPGNLLRVVCGEPVGTLVYWTETPPSFAETAQA"
FT   gene            8563..9141
FT                   /locus_tag="Rmar_0010"
FT   CDS_pept        8563..9141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0010"
FT                   /product="ribosome recycling factor"
FT                   /note="TIGRFAM: ribosome recycling factor; PFAM: ribosome
FT                   recycling factor; KEGG: bha:BH2424 ribosome recycling
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46919"
FT                   /db_xref="GOA:D0MK06"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK06"
FT                   /inference="protein motif:TFAM:TIGR00496"
FT                   /protein_id="ACY46919.1"
FT                   /translation="MVAIPNEHLQLILDDAREHMEKSLAHLRTELAALRAGRATPAMLE
FT                   DVRVEYYGTMTPLMQLASITAPQPDLLIVQPWDRSALGAIERAIINANLGLNPSNDGNI
FT                   IRIPIPPLSEERRKELVRAARIRAEEARVAIRNIRRHAKDHIKKAKEEEHLPEDLCHAA
FT                   EEELQKLTDTYIEKVNQLLERKEAEIMEV"
FT   gene            9193..9283
FT                   /locus_tag="Rmar_R0001"
FT                   /note="tRNA-Ser1"
FT   tRNA            9193..9283
FT                   /locus_tag="Rmar_R0001"
FT                   /product="tRNA-Ser"
FT   gene            9350..10228
FT                   /locus_tag="Rmar_0011"
FT   CDS_pept        9350..10228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0011"
FT                   /product="YicC domain protein"
FT                   /note="PFAM: YicC domain protein; domain of unknown
FT                   function DUF1732; KEGG: gme:Gmet_2328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46920"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK07"
FT                   /inference="protein motif:PFAM:PF03755"
FT                   /protein_id="ACY46920.1"
FT                   /translation="MIASMTGFGRGQAERDGFTATVELRSVNNRYLDVSVRLPRIASLY
FT                   EPDVLAAIRQAFSRGRITAQIDLKLPPEAGLLPRLNLDVARQYLAQLEALRAATGLSDP
FT                   IRLEHLLTLPDLFERPEVPEEDDRIRQVLMEALSRAIEALQATRRQEGALLQADLEARL
FT                   EAIARRVEAIEARAPERLVEAREKLRARVQELLRDDQIDPDRLELEIVLLADRLDITEE
FT                   CVRLRAHLQHFREALQAEEPSGRRLNFLTQELHREANTIGAKANDATIALLAVEIKEEV
FT                   EKIREQIQNIE"
FT   gene            10232..10801
FT                   /locus_tag="Rmar_0012"
FT   CDS_pept        10232..10801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0012"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="KEGG: afr:AFE_0563 guanylate kinase; TIGRFAM:
FT                   guanylate kinase; PFAM: guanylate kinase; SMART: guanylate
FT                   kinase/L-type calcium channel region"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46921"
FT                   /db_xref="GOA:D0MK08"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK08"
FT                   /inference="protein motif:TFAM:TIGR03263"
FT                   /protein_id="ACY46921.1"
FT                   /translation="MPEPRIVILTAPSGAGKTTLARRLQEALPQLRFSVSATTRPPRPG
FT                   ERHGVDYYFLSEDEFRRLIEQGELIEYEEVYPGRFYGTLRREIEQASRDHPVLLDIDVK
FT                   GALRVKELFGDEAFAIFVQPPSLEALAERLRNRGTEDDATLRQRLERARMELALADRFD
FT                   AVVVNDDLERAAAETLRLVRSFLERP"
FT   gene            10813..12039
FT                   /locus_tag="Rmar_0013"
FT   CDS_pept        10813..12039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0013"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="KEGG: sfu:Sfum_0467 phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase;
FT                   TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; PFAM:
FT                   DNA/pantothenate metabolism flavoprotein domain protein;
FT                   flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46922"
FT                   /db_xref="GOA:D0MK09"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK09"
FT                   /inference="protein motif:TFAM:TIGR00521"
FT                   /protein_id="ACY46922.1"
FT                   /translation="MVPESLASLEGRHLLLGVTGSIAAYKAAELVRLFKKAGAEVQVVM
FT                   TPDATRFITPLTLGTLSEREVLVDLFPENEPGSWTKHVHLGRWADLAVVAPATAQTLAR
FT                   LAHGFCDTMLAATLLSARCPVLLCPAMDHDMYHHPATQRNLELLRRYGYEILPPEFGEL
FT                   ASGLKGDGRLPDPERIAAHVAALLARRHSLAGKHVLVTAGPTREMIDPVRCLTNPSTGT
FT                   MGFALARAAARRGARVTLVTGPTLLPTPPGVTRIDVTSAQEMYEVVLQHADTADFVFMA
FT                   AAVADYTPVETAPSKLKKEADELVLRLRRTPDILAELGRRRRPDQVLVGFAMETDNALE
FT                   NAREKLRRKNLDWIALNRLNEPGAGFGTGTNRLTLLHRSGHLEELPLLPKDEAAEALLD
FT                   RVLREIPSG"
FT   gene            12117..12908
FT                   /locus_tag="Rmar_0014"
FT   CDS_pept        12117..12908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0014"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   gme:Gmet_2671 phage SPO1 DNA polymerase- related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46923"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK10"
FT                   /inference="protein motif:TFAM:TIGR00758"
FT                   /protein_id="ACY46923.1"
FT                   /translation="MQELLHAVRDALLQEYALLGPLGFWKTPVAMSTPEHAPSNQDLFG
FT                   QPQPPPESAPADPYARIEALIPPESPLRAMRTLDEVARYVAETVLIPIDARRTNPVFGV
FT                   GNPEADLMVIGEAPGAEEDRQGEPFVGPAGQLLNKMLKAIGFEREEVYITNVLKSRPPH
FT                   NRDPQPDEIEAHLPILYKQIALVKPRIILCVGRIAGNALLGRNGSLRALRGKVHDFHGL
FT                   PVVVTFHPAALLRNPQWKRLAWEDLQLLRAHYDRLMGTATR"
FT   gene            12925..15762
FT                   /locus_tag="Rmar_0015"
FT   CDS_pept        12925..15762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0015"
FT                   /product="replicative DNA helicase"
FT                   /note="KEGG: aeh:Mlg_0587 XRE family transcriptional
FT                   regulator; TIGRFAM: replicative DNA helicase; PFAM: DnaB
FT                   domain protein helicase domain protein; SMART:
FT                   Hedgehog/intein hint domain protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46924"
FT                   /db_xref="GOA:D0MK11"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK11"
FT                   /inference="protein motif:TFAM:TIGR00665"
FT                   /protein_id="ACY46924.1"
FT                   /translation="MAEFEERPRLSIGEEEAPPYPLEKLTGGRRRTRAQIHALHQQAGR
FT                   VPPQAVELEQAVLGAMLIEPEAIPRALEILTPEAFYDGRHQRIFRAIVRLFEQNRGVDL
FT                   LTVTEELRRTGELEQAGDTIYLSELTTRVASAANVEYHARIIAEKALLRRMIEVMTLLV
FT                   GRAYDPAADAFELLDEVEAEIFRLSDVHLRKAARSMNEVVKETLERLEAIHGRPGGITG
FT                   VPSGFHQLDALTGGWQRGDLIIIAARPSMGKTAFALSCARNAALHPHYGTGVAIFSLEM
FT                   GAEQLAQRLLTAEARVDAQAARTGRLRDEDWRKLARAAGRLSDAPIFIDDTPSLGVLEL
FT                   RAKCRRLKAEHDIGLVIVDYLQLMQASHMPRNANREQEIAQISRSLKALAKELNVPVVA
FT                   LSQLSRAVETRGGDKRPQLSDLRESGCLAGDTLITLADGRRVPIRELVSQQNFSVWALN
FT                   PQTYRLERARVSRAFCTGIKPVYRLTTRLGRSIRATANHRFLTPQGWKRVDELQPGDYL
FT                   ALPRRIPTASTPTLTEAELALLGHLIGDGCTLPHHVIQYTSRDADLATLVAHLATKVFG
FT                   SKVTPQIRKELRWYQVYLRAARPLAPGKRNPISDWLRDLGIFGLRSYEKKVPALLFCQT
FT                   SEAIATFLRHLWATDGCIQMRRGKKPYPAVYYATSSYQLARDVQSLLLRLGINARLKTV
FT                   AQGEKGRVQYHVKVSGREDLLRFVEKIGAVGARQRAALASVYDYLSVRTGNPNRDIIPV
FT                   ALWYELVREAMYQRGISHRQLHANLGMAYGGMTLFRQNLSRARALRLAEAAACPELRQL
FT                   AQSDVYWDPIVSIEPDGVEEVFDLTVPGPHNFVANDIIAHNSIEQDADVVLFIYRPERY
FT                   GITVDENGNPTEGIAEIIIGKQRNGPTGTVRLAFINQYARFENLTMYQPEPGTPLPETP
FT                   DETILPSGPPDEAPF"
FT   gene            complement(15803..15876)
FT                   /locus_tag="Rmar_R0002"
FT                   /note="tRNA-Cys1"
FT   tRNA            complement(15803..15876)
FT                   /locus_tag="Rmar_R0002"
FT                   /product="tRNA-Cys"
FT   gene            complement(15964..17640)
FT                   /locus_tag="Rmar_0016"
FT   CDS_pept        complement(15964..17640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0016"
FT                   /product="Mannan endo-1,4-beta-mannosidase"
FT                   /EC_number="3.2.1.78"
FT                   /note="PFAM: glycoside hydrolase family 26; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46925"
FT                   /db_xref="GOA:P49425"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49425"
FT                   /inference="protein motif:PRIAM:3.2.1.78"
FT                   /protein_id="ACY46925.1"
FT                   /translation="MTLLLVWLIFTGVAGEIRLEAEDGELLGVAVDSTLTGYSGRGYVT
FT                   GFDAPEDSVRFSFEAPRGVYRVVFGVSFSSRFASYALRVDDWHQTGSLIKRGGGFFEAS
FT                   IGEIWLDEGAHTMAFQLMNGALDYVRLEPVSYGPPARPPAQLSDSQATASAQALFAFLL
FT                   SEYGRHILAGQQQNPYRRDFDAINYVRNVTGKEPALVSFDLIDYSPTREAHGVVHYQTP
FT                   EDWIAWAGRDGIVSLMWHWNAPTDLIEDPSQDCYWWYGFYTRCTTFDVAAALADTSSER
FT                   YRLLLRDIDVIAAQLQKFQQADIPVLWRPLHEAAGGWFWWGAKGPEPFKQLWRLLYERL
FT                   VHHHGLHNLIWVYTHEPGAAEWYPGDAYVDIVGRDVYADDPDALMRSDWNELQTLFGGR
FT                   KLVALTETGTLPDVEVITDYGIWWSWFSIWTDPFLRDVDPDRLTRVYHSERVLTRDELP
FT                   DWRSYVLHATTVQPAGDLALAVYPNPGAGRLHVEVGLPVAAPVVVEVFNLLGQRVFQYQ
FT                   AGMQPAGLWRRAFELALAPGVYLVQVRAGNLVARRRWVSVR"
FT   gene            17779..19092
FT                   /locus_tag="Rmar_0017"
FT   CDS_pept        17779..19092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0017"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   tcx:Tcr_0946 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46926"
FT                   /db_xref="GOA:D0MK13"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK13"
FT                   /inference="protein motif:PFAM:PF01957"
FT                   /protein_id="ACY46926.1"
FT                   /translation="MWPLLLWLMLLPMPAQTPAPVVYRLALEDEPITPATFRFIRRGLR
FT                   EATENGAVCLVVEMDTPGGLVEATRDIVQLFLRSPIPVVVYVTPPGARAASAGVFITLA
FT                   AHVAAMAPGTHIGAAHPVQLGGGPAAPPDTARVDPMSEKILNDAVAWARALAQYRGRNA
FT                   DWAARAVSESQTLTAREAVAQNVVDLLAPSLDSLLVLLDGRNVALDGQTVTLQTAGATV
FT                   HMIERWWGERILAALSNPNIAFLLLMLGFYGLLFELYTPGWGIPGTLGAIFLMLGFYGL
FT                   SILPVNYVGLALLVLGLGMLVAEAFVPSFGLLTVGGVVCLILGGLMLVESPMGFPKVSA
FT                   ALVVPVALATALIALFLLGNALRIQRRPARVGDETLIGQQAVAREDFTPEGDHFQGYVF
FT                   VHGEWWRACSTAPVRAGQPVRIERREGLRLWVSPIVST"
FT   gene            19118..19873
FT                   /locus_tag="Rmar_0018"
FT   CDS_pept        19118..19873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0018"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; SMART: band 7 protein; KEGG:
FT                   sat:SYN_02180 membrane protease subunit,
FT                   stomatin/prohibitin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46927"
FT                   /db_xref="GOA:D0MK14"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK14"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ACY46927.1"
FT                   /translation="MLSSTGIVIGLIVLYFISCIRILYEYQRGVIFRMGRALPEPKGPG
FT                   IVLVFWPIDRMVRVSLRTFVHDVPEQDVITRDNVSVRVNAVVYFRVVDPMKAVLEVEDY
FT                   RYATTQLSQTSLRSIVGQVELDELLAEREKINRRLQEVIDQQTDPWGIKVSLVEVKHVD
FT                   LPEHMKRAMAKQAESERERRAKVIHAQGELQAAEQLAQAAAMLEAHPMAMQMRFLQTLV
FT                   EVGSENNTTIVFPIPLELIRPLLEPKKQR"
FT   gene            complement(19903..19979)
FT                   /locus_tag="Rmar_R0003"
FT                   /note="tRNA-Arg4"
FT   tRNA            complement(19903..19979)
FT                   /locus_tag="Rmar_R0003"
FT                   /product="tRNA-Arg"
FT   gene            complement(19988..20065)
FT                   /locus_tag="Rmar_R0004"
FT                   /note="tRNA-Pro3"
FT   tRNA            complement(19988..20065)
FT                   /locus_tag="Rmar_R0004"
FT                   /product="tRNA-Pro"
FT   gene            complement(20138..20302)
FT                   /locus_tag="Rmar_0019"
FT   CDS_pept        complement(20138..20302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46928"
FT                   /db_xref="InterPro:IPR025379"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK15"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY46928.1"
FT                   /translation="MAKVSKNQRTDRVKNRQQVKMAKIVVAEKKPNGQYRFRERIVPLE
FT                   AVNQAVQAG"
FT   gene            complement(20306..20479)
FT                   /locus_tag="Rmar_0020"
FT   CDS_pept        complement(20306..20479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0020"
FT                   /product="ribosomal protein L33"
FT                   /note="TIGRFAM: ribosomal protein L33; PFAM: ribosomal
FT                   protein L33; KEGG: predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46929"
FT                   /db_xref="GOA:D0MK16"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK16"
FT                   /inference="protein motif:TFAM:TIGR01023"
FT                   /protein_id="ACY46929.1"
FT                   /translation="MAKKGKEARVQVILECTEAPGTSRYVTTKNRRNTPGRLELRKYNP
FT                   VLRRHTLHREVK"
FT   gene            complement(20497..20733)
FT                   /locus_tag="Rmar_0021"
FT   CDS_pept        complement(20497..20733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0021"
FT                   /product="ribosomal protein L28"
FT                   /note="TIGRFAM: ribosomal protein L28; PFAM: ribosomal
FT                   protein L28; KEGG: pfo:Pfl01_5537 50S ribosomal protein
FT                   L28"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46930"
FT                   /db_xref="GOA:D0MK17"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK17"
FT                   /inference="protein motif:TFAM:TIGR00009"
FT                   /protein_id="ACY46930.1"
FT                   /translation="MARRDQLTGKGPVSGHNVSHANNKTKRRFLPNLQKKRFYIPEEKR
FT                   WITLRVSAKTMKTINKKGLKAVLDEARRQGIKI"
FT   gene            complement(20862..21638)
FT                   /locus_tag="Rmar_0022"
FT   CDS_pept        complement(20862..21638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0022"
FT                   /product="Phosphosulfolactate synthase"
FT                   /EC_number="4.4.1.19"
FT                   /note="PFAM: (2R)-phospho-3-sulfolactate synthase ComA;
FT                   KEGG: (2r)-phospho-3-sulfolactate synthase; K01767"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46931"
FT                   /db_xref="GOA:D0MK18"
FT                   /db_xref="InterPro:IPR003830"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036112"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK18"
FT                   /inference="protein motif:PRIAM:4.4.1.19"
FT                   /protein_id="ACY46931.1"
FT                   /translation="MLQKLPSMPERPERPRTFGLTLMLDKGLSVRQVEDVLEVAGPYID
FT                   LVKLGWGTALLTPCLERKLACYRAAGLPVYLGGTLFEAFYLRGELDAYCRLVERLGLTH
FT                   VEVSDGVLTIPLEEKLRVIRRLAAHFVVLSEVGSKDAERILPPYRWVQQIQAELEAGSW
FT                   KVICEARESGTVGLYRPSGEVRAGLVDEIVAMVPPAQLIFEAPRKVQQVWFIRHLGPNV
FT                   NLGNIAPEEVLPLETLRRGLRADTLLDGYRQASSAS"
FT   gene            complement(21648..22904)
FT                   /locus_tag="Rmar_0023"
FT   CDS_pept        complement(21648..22904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0023"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   dde:Dde_1366 LolC/E family lipoprotein releasing system,
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46932"
FT                   /db_xref="GOA:D0MK19"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK19"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACY46932.1"
FT                   /translation="MDVRLLLARRYLMARHQVTLIAVITGISVLGVAVGVAALIVVLSV
FT                   MNGFYRVVRDLLVSVDPHVRIVSVAPGGLAVDDSLEQYLRRLPHVTEVTAYVEGKALLL
FT                   YEGEGEVNKVVIVRGVEPEALEAMGAARVFGSVDLQRREGRPGILVGMPLARRLGLLPA
FT                   SSTEPASQVGLLSAPALEQLLTQPLAPPPLIRFEVRGLYQLTSGYDESHVFVALEEARR
FT                   LFRMGDRVDGIALRLDDVAHAAALKALLEQRLDTTRYRVQTWYDLQRGLYDVMRLEKWG
FT                   ASLILALIVVVAAFSIVGALTMVVIEKRRDIGVLQAMGLSRKRVRQVFLLAGLLIGVAG
FT                   AGLGLLLGVGLALLQQHFQLVPLPGAEAFLIHAYPVAIEITDLLGITLAALVLCVLAAL
FT                   YPAARAAAIEPAQAVHLDI"
FT   gene            complement(22909..23739)
FT                   /locus_tag="Rmar_0024"
FT   CDS_pept        complement(22909..23739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46933"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK20"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY46933.1"
FT                   /translation="MRFYAVLLLMLLAGCRTRPAERPEAVDSVMIPVHTRADSLALRVY
FT                   RACGGPEVWQALPYVRFDYAVAHDGPRRLLAHHLWHRPSGRYRLEWVREDDSLYVALFN
FT                   VRTRRGQVYRNGRPLAEAANRRLLEEAYRRFANDTFWLLLPVRLFEPEVQRFYEADSAT
FT                   ATHEVLRLELTRARWLPARRFWLYVDRQDGLIAELAYPAHDNPEALPARYRWEGYETWE
FT                   TPFGPVRLATRKVYRYAPLIIFTDNLAFPDALPEALFTDPLPRLGQPLTPTSER"
FT   gene            23861..24937
FT                   /locus_tag="Rmar_0025"
FT   CDS_pept        23861..24937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0025"
FT                   /product="glycoside hydrolase family 5"
FT                   /note="PFAM: glycoside hydrolase family 5; KEGG:
FT                   cja:CJA_3369 cellulase, putative, cel5C"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46934"
FT                   /db_xref="GOA:D0MK21"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK21"
FT                   /inference="protein motif:PFAM:PF00150"
FT                   /protein_id="ACY46934.1"
FT                   /translation="MRVLALLLLLLAISATAQPQKDNFYDDRIDTTAKAPPKETPRTYS
FT                   LPFIRVEGNRFVDEQGRTVVFRGVSIADPDRLERLGRWDRRIFEVLKNDWNANIVRIPV
FT                   HPRAWRARGEEAYLKLLDQAVEWANELGLYLIIDWHSIGNLRTELFQHPMYNTTKTETF
FT                   RFWKTIAEHFRHNPIVAFYEVFNEPTRYNGTLGRMSWEEYKQIVEDIIYIIYAHDRTVI
FT                   PLVGGFDWAYDLTYVRESPIAFPGIAYTAHPYPQKRQPPWEEKWEHDWGFVADTYPVFV
FT                   TELGFMSADEPGAHVPVIGDETYGEAIVNYMEKKGISWTAWVFDPVWSPQLIKNWDFEP
FT                   TTQGRFFREKMRQLNPRN"
FT   sig_peptide     23861..23914
FT                   /locus_tag="Rmar_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 18"
FT   gene            25187..25891
FT                   /locus_tag="Rmar_0026"
FT   CDS_pept        25187..25891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46935"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK22"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY46935.1"
FT                   /translation="MRAVWMCGLLFLLSGWTARAQLPADTGRTDPYGTGAGFQILLTNS
FT                   GFGLGGYYHRSVGRDLRLLFDFSLGSGKDEREQKFYNALTGASYIQNKANYLLLVPIQF
FT                   GLQQRLWREQIADNFRPYLQISAGPTLGWVYPYFRDRNGNRRYDPEIGERIYDVFQGLP
FT                   KGHLRAGVGGMIVLGAYFGQSLRTTQGLRFGYALHYFPHPIQLLEGDAPPRRFFGTPVI
FT                   SLTFGRLYGVRR"
FT   sig_peptide     25187..25249
FT                   /locus_tag="Rmar_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.964 at
FT                   residue 21"
FT   gene            complement(25881..26981)
FT                   /locus_tag="Rmar_0027"
FT   CDS_pept        complement(25881..26981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0027"
FT                   /product="GTP-binding protein YchF"
FT                   /note="TIGRFAM: GTP-binding protein YchF; PFAM: Protein of
FT                   unknown function DUF933; GTP- binding protein HSR1-related;
FT                   KEGG: gsu:GSU0664 translation-associated GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46936"
FT                   /db_xref="GOA:D0MK23"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK23"
FT                   /inference="protein motif:TFAM:TIGR00092"
FT                   /protein_id="ACY46936.1"
FT                   /translation="MPLRCGIVGLPNVGKSTLFNALSRAGAESANYPFCTIEPNVGVVP
FT                   VPDERLERLAELAGSAKVTPTTIEFVDIAGLVAGASKGEGLGNQFLAHIREVDAILHVV
FT                   RCFEDPNIVHVSGSVDPARDIEIIQTELLLKDLETVERRIERTARAAKSGDKKLREELA
FT                   FYERLRDHLSSGAPARLFTVSDLEAPWLRSLFLLTVKPVLYVANVAESDLPEGEGNPHV
FT                   ATVREIAEKEGAQVVVICAELEAQLAELDEEERRAFLKELGLERPGLERLVRAAYELLG
FT                   LITFFTVGPKEARAWTIRRGTRAQQAAGIIHSDFERGFIRAETISYEDYIRYGSEAAAR
FT                   EAGAMRSEGRDYVVQDGDVILFRFNV"
FT   gene            27092..27598
FT                   /locus_tag="Rmar_0028"
FT   CDS_pept        27092..27598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46937"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK24"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY46937.1"
FT                   /translation="MHRARATLIALLLAFSCSAVAQPVPPDRGRVLQAGLAAAPGLGVQ
FT                   LGYISPRSIYTLEGIFYLDTAPSFAGGEGNTQLSLAFGSAFRITGLIRTMGNAPILYDL
FT                   DVGLRLGPGLLFTPGETRAQKNQQFGLFLEPFFRFVSAFGTRRFFFGEAGLHRPFFRAG
FT                   LWFVF"
FT   sig_peptide     27092..27157
FT                   /locus_tag="Rmar_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(27599..28255)
FT                   /locus_tag="Rmar_0029"
FT   CDS_pept        complement(27599..28255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0029"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: pca:Pcar_0412
FT                   protein phosphatase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46938"
FT                   /db_xref="GOA:D0MK25"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK25"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACY46938.1"
FT                   /translation="MALIAIGDIHGCARTLDALLDRLAPTRDDQLVFIGDYIDRGPDAR
FT                   GVIERLLRLREEISCVFLRGNHEALMLNYLDRGEADLWFINGGLTTLNSYRNDGIRIPE
FT                   EHEAFIRETLLYYDTPDFFFVHGGLKPDLTIAENLRRFAHTDLFLWEREHLNAPRFAWE
FT                   KPVVCGHTPVPEPINREKLIAIDTGCVYPHPGLGRLTAVRLPERTFISIPRQDLI"
FT   gene            complement(28262..28759)
FT                   /locus_tag="Rmar_0030"
FT   CDS_pept        complement(28262..28759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0030"
FT                   /product="NusB antitermination factor"
FT                   /note="TIGRFAM: transcription antitermination factor NusB;
FT                   PFAM: NusB/RsmB/TIM44; KEGG: bha:BH2785 transcription
FT                   antitermination protein NusB"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46939"
FT                   /db_xref="GOA:D0MK26"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK26"
FT                   /inference="protein motif:TFAM:TIGR01951"
FT                   /protein_id="ACY46939.1"
FT                   /translation="MHSRREVRERVLQALYAYEVGHDTAEHVIDTVLRPALKDDREALR
FT                   FATQLFLRTINYSEEADRLIADHVKNWDLTRIALIDRLLLRMAICELLAFEDIPPKVSI
FT                   NEAIELAKKYSTEKSGQFVNGVLDAVVLDLQRQGRLKKSGRGLIGMETLLQRLAEQQSS
FT                   KS"
FT   gene            28915..31308
FT                   /locus_tag="Rmar_0031"
FT   CDS_pept        28915..31308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0031"
FT                   /product="DNA internalization-related competence protein
FT                   ComEC/Rec2"
FT                   /note="TIGRFAM: DNA internalization-related competence
FT                   protein ComEC/Rec2; ComEC/Rec2-related protein; PFAM:
FT                   ComEC/Rec2-related protein; beta-lactamase domain protein;
FT                   KEGG: ade:Adeh_1270 DNA internalization-related competence
FT                   protein ComEC/Rec2"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46940"
FT                   /db_xref="GOA:D0MK27"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR004797"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK27"
FT                   /inference="protein motif:TFAM:TIGR00361"
FT                   /protein_id="ACY46940.1"
FT                   /translation="MPSLRTAPLFWTALGLVLGILVADARPIPAGWWLLGAACTGTLAL
FT                   VALVVDQKRRRAIPSWPIPLLLCVLFVGAARHRLQMAPPPPFPLDTTAVVRAEVQKTPE
FT                   ATAYGLRFPARTRLLLIGHDTLADRVLLDVRLVADSLPALACGQRVLLGGRLEPLRVPR
FT                   NPGLPDRTAQWRRQGVVARLVVDDPRLVQVLDARRCFTDRLVSLRDSITSVLQRYMPRP
FT                   EARHVVQALLLGDRSGLSPDVRNRLGRAGLAHLLAISGLHVLLVGLVLYGLLRPLLLRL
FT                   GLSWWSMEWTRTVLTLLVLSGYVLLAGAPASAVRALVMTALFLGATLFQTPPHPLNALG
FT                   AAAVVLLLADPAQLFEPGFQLSFAAVIGLLLGWLPLQQRLPAVIFRRPALRYLTGTLLV
FT                   TLTATLATAPFVLYHFGYVSLAGLPLNLLGIPLAAGALAGGLLSVLSAPFSPALAELFG
FT                   QAATLCAYLLLQLGELGLRLLRPLVLHVPEPPWWMLIAPPVLLGLWSRSPGIRRRSGLV
FT                   LLGVLSLGLWTTPPAAPHLDVLFFDVGHGDAVLIRAPGGRHLLIDTGGRYGGRVAAEWS
FT                   LLPFFRRYGIDRLNAVLITHPDADHAGGLPLLLRRLEVGRVLDSGTVDSSALSLEIAHL
FT                   IDSLRLPRQSLQAGDTVRLDPALVLQVLAPAPNARDVPDNERSVVLRMVFGRTRWLFLG
FT                   DAERELERQLTQAYGDLLASDVVKVAHHGSRTSSTPELVQQVIPTRAHPVRAVISSGWR
FT                   GVSDSVRVRWERQGARLWITADSGALWLRSDGWRIWPVAWRRAQ"
FT   sig_peptide     28915..28992
FT                   /locus_tag="Rmar_0031"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.797 at
FT                   residue 26"
FT   gene            complement(31302..32141)
FT                   /locus_tag="Rmar_0032"
FT   CDS_pept        complement(31302..32141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0032"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: rpa:RPA1515
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46941"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK28"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACY46941.1"
FT                   /translation="MIRRILVALDPDTDTGIAVRYAAELARQHDASVTGLAVVDTGHIE
FT                   ASARGGGIGSMYYAEKLREQMTEEARAVARRLIEEFDDVAEKEGLRHRNTVAEGVPFRR
FT                   ILEDMKVHDLLVVGKEPHFFYSHPEEKTRTLVRVVRESVGPSFIVGTEYRPIQRVLIAY
FT                   DGSDTAARTMQRFAQLRPFGTEVSVEVLTVYDDEEAETRLMLSLVQEYLQEHGFKVTTT
FT                   ARKGDRPEEAIVAFAQEIQADLIVAGAYATTGLKKLLFGSSTSALIEKTTVPLFLYH"
FT   gene            complement(32631..33926)
FT                   /locus_tag="Rmar_0033"
FT   CDS_pept        complement(32631..33926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0033"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   bha:BH3343 glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46942"
FT                   /db_xref="GOA:D0MK29"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK29"
FT                   /inference="protein motif:PRIAM:5.3.1.9"
FT                   /protein_id="ACY46942.1"
FT                   /translation="MIRYDLSTALSFLEAHDLEAVRPRAEAAHRMLLERTGPGHEMLGW
FT                   RDLLLQPDDALLEDIDTTAAEIREQADVFLCLGIGGSYLGARAVIEALAPQFRSPVEAE
FT                   TERPRLPEVLFAGHHLSGRYLKELLAYLEGKSVYVNVISKSGTTLETMLAFRVLRPWLE
FT                   ARFPDAARRIIVTTDPARGRLHDMAETFGYRRYAIPPGVGGRFSVLTPVGLLPIAVAGI
FT                   DIRSLFYGAVEMCERLTDASDNPALDYAALRYLFHERGYAIELLAVFEPRLSGIGAWWQ
FT                   QLFGESEGKAGKGLYPDAIQYSTDLHSLGQYVQEGRRHLIETFLMVEREPEPLTIPDTG
FT                   DDRDGLAYLAGRTVQEVNRKAYEGTRKAHADGGAPVSTVWLERLAPGPLGACLYFFMHA
FT                   VAISGYLLEVNPFDQPGVEAYKREMYRLLGKP"
FT   gene            34005..35228
FT                   /locus_tag="Rmar_0034"
FT   CDS_pept        34005..35228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0034"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: MoeA domain protein domain I and II; MoeA
FT                   domain protein domain IV; molybdopterin binding domain;
FT                   KEGG: gsu:GSU2703 molybdopterin biosynthesis protein MoeA"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46943"
FT                   /db_xref="GOA:D0MK30"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK30"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ACY46943.1"
FT                   /translation="MREFISVEEARNIVLEQVTPLPVERVPLAEALGRRLAEAVVSRDD
FT                   IPPFPNAAMDGYAVRLADVQQVPATLRVVADVGAGQLPPESIPPGACIRIMTGAPVPAW
FT                   AEAVVPVEWTEAGANGTVRILQAPAANENIRPAGQDVRAGERFFEVGQRITPPAVAMLA
FT                   TLGVAEVPVFRRPRVAIVATGDELIDAGQPLTPGHIRDSAGPGLAAQARWLGAEVIGPQ
FT                   RVPDDRAALEQAVEQALEADVLVFSGGVSVGLYDLVRQVLDGRGTRWLFWKIRQRPGKP
FT                   MAFGLLAGKPVFGLPGNPVSSALCFDQYVAPALRRMQGQQEVLRPRFSAVLEAPTPKKA
FT                   GLHFYTRGVARPGSDGRLLVRDTGPQGSNLYHSMVRANCLIHLPEALEEAPAGLEVEIE
FT                   WLPWTLEP"
FT   gene            35283..35897
FT                   /locus_tag="Rmar_0035"
FT   CDS_pept        35283..35897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0035"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   bba:Bd2764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46944"
FT                   /db_xref="GOA:D0MK31"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK31"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ACY46944.1"
FT                   /translation="MMRLHTRLWLVGLLGLAFMLPGPEKELEIGAKAPLVDLKMRDVSG
FT                   KMLSLKDVAGENGLLVIFSCNTCPWVAAWEDRYLIVAQKAKELGIGMIAVNPNEAYRDR
FT                   GDGFEDMQRRAKEKGYTFPYVLDEGSKLADAFGATRTPHVFLFNKDLVLVYRGAIDDNA
FT                   RNPEAVKHHYLLDAMEALAAGKPIPVATTRSIGCTIKRVES"
FT   gene            35926..36534
FT                   /locus_tag="Rmar_0036"
FT   CDS_pept        35926..36534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46945"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK32"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY46945.1"
FT                   /translation="MRPTLLTAILGWLLPGCISLGAFQGPDVLPEGKTEVGVGIVGGGS
FT                   LEEGGGGVGMFELYGRRGMTPRLELGARTTGFLATEGIATGAIMVEGKYQLVTTRPLVS
FT                   AGMGVSFYALEVDDDSFYTIGLYPALWIGSPNLFAGVRMIVVTMGAENSDEVGTGSLVG
FT                   LTIGGRLGDRVPFRPELTLFAPLGGPPLLVGGLGIAVRL"
FT   sig_peptide     35926..36000
FT                   /locus_tag="Rmar_0036"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.666 at
FT                   residue 25"
FT   gene            36538..37227
FT                   /locus_tag="Rmar_0037"
FT   CDS_pept        36538..37227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0037"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rpc:RPC_4436 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46946"
FT                   /db_xref="GOA:D0MK33"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK33"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACY46946.1"
FT                   /translation="MRIQTVSPLLLPREAAQVFVACASEEDLELPEGTLLWETPEQAAA
FT                   TCPEGKLWVVAVPPGGAVRNGESWQLQRSLPVSAVRNRSPYRPPITVPAAGGVVVRSAE
FT                   APEVLLIHRRGHWDLPKGKCDPGESPEACARREVSEELGISPEALRLRKPLGRTIHAYP
FT                   LDGHYAVKPTWWFLMETTATTFTPQAAEDIREVCWFPLEEACRRVRYPTLQALLQHLAE
FT                   LAGSGLL"
FT   gene            37270..38448
FT                   /locus_tag="Rmar_0038"
FT   CDS_pept        37270..38448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0038"
FT                   /product="Cupin 4 family protein"
FT                   /note="PFAM: Cupin 4 family protein; SMART: transcription
FT                   factor jumonji jmjC domain protein; KEGG: ppg:PputGB1_3622
FT                   cupin 4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46947"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR039994"
FT                   /db_xref="PDB:4CSW"
FT                   /db_xref="PDB:4CUG"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK34"
FT                   /inference="protein motif:PFAM:PF08007"
FT                   /protein_id="ACY46947.1"
FT                   /translation="MQLPETILGGLAPEEFLANYWQKRPLLIRQALPGFRSPITPEELA
FT                   GLACEEGVTARLILEKGGAYPWEVRYGPFEPEDFVALPPTHWTLLVQEVDRLVPEVAAL
FT                   LETVRFVPNWRLDDIMVSYAPEGGTVGAHIDNYDVFLVQAWGRRRWQINHRPVEREELV
FT                   PGLEVRLLAHFEPDAEWILEPGDVLYLPPRIPHYGVALEDCMTFSIGFRAPDQAELAEA
FT                   MPRMAAWLDGGRRYADPDLTPADEPGEITPEALDQIQALLRALIDDRERLARWFGCIIT
FT                   EPRRGLPPEPPGRPLSAKQLHRRLQQGATLRRNAIPELAYVRHADGSATLFASGEAYEL
FT                   SPELADVAPLLTGRRPLTAETLRPWLERDDFLELLQTLIHSGILSLIPARKR"
FT   gene            38450..39001
FT                   /locus_tag="Rmar_0039"
FT   CDS_pept        38450..39001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0039"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: sat:SYN_00539
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46948"
FT                   /db_xref="GOA:D0MK35"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK35"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACY46948.1"
FT                   /translation="MPGPWKCLHREVLADYKVFRIWREQVQPPRAPRPYDFYLLEAIDW
FT                   VNVIPITPDGKVVFVRQYRYGTREVSLEIPGGAVDPDDPSPLEAARRELREETGYEAER
FT                   LVYLGAVAPNPAILTNRCHTFLAENVRPVGPQQLDDAEEIEVVLLDPAEIPERIRRGEI
FT                   NHALVVAAFYLYEHRDEGQP"
FT   gene            38998..39816
FT                   /locus_tag="Rmar_0040"
FT   CDS_pept        38998..39816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0040"
FT                   /product="Ion transport protein"
FT                   /note="PFAM: Ion transport protein; Ion transport 2 domain
FT                   protein; KEGG: pca:Pcar_0515 ion transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46949"
FT                   /db_xref="GOA:D0MK36"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK36"
FT                   /inference="protein motif:PFAM:PF00520"
FT                   /protein_id="ACY46949.1"
FT                   /translation="MNRSIRRRHPLRDRLHEIIFESDTPAGKAFDVALIAVILLSVVAV
FT                   MLESVEPIRARWGAALRIAEWVFTVLFSIEYVLRLYCVDRPLRYARSFFGMVDLLAVLP
FT                   TYLSVLLPGAQYLLVIRLLRVLRVFRVLKLVTYLNEAAQLMEALRASRRKITVFVFTVL
FT                   TLVVILGSLMYLIEGPANGFTSIPRSVYWAIVTLTTVGYGDIAPKTTLGQALAAIIMVI
FT                   GYGIIAVPTGIVTVELSRVERRVSGQACPGCGAEGHDPDARFCKYCGSAL"
FT   gene            39813..40469
FT                   /locus_tag="Rmar_0041"
FT   CDS_pept        39813..40469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_B0252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46950"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK37"
FT                   /inference="similar to AA sequence:KEGG:Mpe_B0252"
FT                   /protein_id="ACY46950.1"
FT                   /translation="MSQVLIEPFRKVWAAFERRLFPVPSSDRLFNLYRDRHPELDRPEA
FT                   PAIRRRNLWRYLAAYETPPTVFLLAEAPGPWGCRFSGVPLTSEAQLLDPDFPLAGEASG
FT                   RAERPHREYSARIYWRVMRPYFPRFFTWSTVPLHPHRPGVPLSIRTPTQREVRDWLPLV
FT                   ADLIEALKPAQVIAIGRKAEFALQSLGIPCTYVRHPSQGGARLFEAGVRALLGDP"
FT   gene            40554..42062
FT                   /locus_tag="Rmar_0042"
FT   CDS_pept        40554..42062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0042"
FT                   /product="2-methylcitrate dehydratase"
FT                   /EC_number="4.2.1.79"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: bba:Bd2500
FT                   2-methylcitrate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46951"
FT                   /db_xref="GOA:D0MK38"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK38"
FT                   /inference="protein motif:PRIAM:4.2.1.79"
FT                   /protein_id="ACY46951.1"
FT                   /translation="MQKHIVRVYSSKEHLPREEQLAWKLARVATDEAPIDEEAAAMVIN
FT                   RIIDNAAVAVAALNRRPVANARTQALAHPNPEGATLFGLPSTQRFSCEWAAWANGVAVR
FT                   ELDFHDTFLAADYSHPADNIPPILAVAQQTGRSGADVLRGILAAYEVHISLVKSICLHK
FT                   HKKDHIAHLAPAATVGIGALLGLPTEIIYQAVQQAVHVSFQTRQSRKGEISSWKAYAPA
FT                   FAGKQAVEAIDRAMRGETSPSPIYEGEDSVIAWMLDGPDAVYEVWLPEPGEPRRQILES
FT                   YTKEHSAEYQAQALIDLAFRMREKIDDFEKIKEIVIYTSHHTHYVIGSGSGDPQKYDPN
FT                   ASRETLDHSIMYIFAVALQDGTWHHERSYAPERARRPDTVRLWRKIRTVEDPEWTARYH
FT                   HPDPSKKAFGGRVEITFEDGSKLVDEIDVANAHPNGARPFRRPDYIRKFDTLTEEIIDR
FT                   AERDRFLGLVERLPELTPEEVLELNVVVPRDWLTHAERDRRGIF"
FT   gene            42135..42317
FT                   /locus_tag="Rmar_0043"
FT   CDS_pept        42135..42317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46952"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK39"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY46952.1"
FT                   /translation="MDPSDERQRLAEQVRRLCLETMQRAYEEARMQGLCAEGAFEAAVS
FT                   AVAMLDLQTLLDRPE"
FT   gene            42314..43504
FT                   /locus_tag="Rmar_0044"
FT   CDS_pept        42314..43504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0044"
FT                   /product="PKD domain-containing protein"
FT                   /note="KEGG: pin:Ping_0512 PKD domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46953"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK40"
FT                   /inference="similar to AA sequence:KEGG:Ping_0512"
FT                   /protein_id="ACY46953.1"
FT                   /translation="MKRWLLWLALLLVACSARAQLVPLWPLPVPDTSADNAFGEAVALG
FT                   PDRAVVGAGGVYGCGPASGAVYVYERRNEAWTLAAVLQPDDCAPGRHFGRAVALDGDRI
FT                   LAVAAGQPYRTEVADAAYVFERDADGHWRQTVRLTPPDVTTGAFGAAVTLDGRRAVVST
FT                   WGDPARQRPGAAYVFTQQPDGFWKLEATLTDTLAPGGPWPGGAVALDGDVVALAAPSYR
FT                   YDRSSAVLLFVRQPDGSWRRDTTLSGIRDFNPALALTDGELLVGERLGGRHSGGRVRHY
FT                   RRRGGRWTLVATLDPPQPYPNGGFGAVLAFDGRRALVSGFDEQLGLDFNVDQVVYVFVH
FT                   TADRWCFWRRIDPGEKAFGAALSLHGDLALIGVPREGAPGAAYLIPLDAARCKTSF"
FT   sig_peptide     42314..42373
FT                   /locus_tag="Rmar_0044"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.959 at
FT                   residue 20"
FT   gene            complement(43505..45157)
FT                   /locus_tag="Rmar_0045"
FT   CDS_pept        complement(43505..45157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0045"
FT                   /product="protein of unknown function DUF524"
FT                   /note="PFAM: protein of unknown function DUF524; KEGG:
FT                   bat:BAS0874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46954"
FT                   /db_xref="InterPro:IPR007505"
FT                   /db_xref="InterPro:IPR018633"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK41"
FT                   /inference="protein motif:PFAM:PF04411"
FT                   /protein_id="ACY46954.1"
FT                   /translation="MRYFTIETDHVRLTWEGPLRQPSAFPLTVEVRALDTGAEPTLHYA
FT                   AEAPGLIEQTRYRLLLESRDGRPVALRHANPALLRDLHALEGGRIWHGSLHFGTYAGHT
FT                   AFIVWHDDRPHLRLELEIFPTRLAYRADYEAMLADLETWTVEPALRFGSGVRQPGRVLA
FT                   GPPDELPGWIARLAAVLDALEVAFRRIAHRPLTEVRMSRCWQPLEAVRRPDAALRRAMQ
FT                   TGGGQGPEVHLAGVRTHRLHRAPRAVLTTDTPEHRWLAWQLDHTLRQVQRLADRLARPD
FT                   AFARTRRQALMELATRLENLQQRLPATTLPPIPPSPTPRLLRAEGYRQAYRIFQWLRRR
FT                   LSLLGGLLSFEVGQIHTLYEYWCYLTLVRLLSRMTGRSLPPHRLFTLSDDGLQLRPVRG
FT                   RPLSFPLSDGGRLRLVYNPRWSARALLVPQQPDLLLSRFRPGVPPVHYVLDAKYRLDAS
FT                   PAYVRRYGVPGPPTDALNDLHRYRDALSSYFTRQGKGTVAQALALYPYRDGEAGCFAKS
FT                   RLARALAEDGVGALPLLPGATEHLEHWLQQVLA"
FT   gene            complement(45161..46867)
FT                   /locus_tag="Rmar_0046"
FT   CDS_pept        complement(45161..46867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0046"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_5; KEGG: bcb:BCB4264_A0970 ATPase, AAA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46955"
FT                   /db_xref="GOA:D0MK42"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK42"
FT                   /inference="protein motif:PFAM:PF07728"
FT                   /protein_id="ACY46955.1"
FT                   /translation="MAETPTTYRPREGRAWLWAIPPQHYPAFLQTGTFAVHRVGRAALH
FT                   RLRPGDRIFAYLSGSKVLVGMFEVTGEPFEDHTPLVPGVAYPHRVRVRPLVVLSEEAWV
FT                   PFEAFADKLEVVRNYPDFRSVVQQVLHPLPRVDEKVLEFLIRARAADLERAMSALEELR
FT                   RLRAERPAPVVRERRVRYRAEAFDRAAALETLLGYLEGRGFVYAPWIVAAYVAAVRTKP
FT                   LVILAGPTGTGKSKLPLLVAEATGSAAQLIPVRPDWADSAELLGYVDLQGRFRPGTLLR
FT                   LMREAQQQPDRFFVGVLDEMNLARPEQYLAEALSRIEDRRPLPEGGWTTEPLLQLSLAP
FT                   ADQGWARVAWTANFALVGTVNVDETTHGFSRKVIDRAFTLELTEIDLAATPASSAVEPE
FT                   PWPVTAWWPRALRLAELPTPSDAERRQLDRVLETLQTLNRWLQPAGFPVAYRTRDEVAL
FT                   FVLHAAEMPEAFRTRTGEPVDPLDLAFWMKVLPRLQGSSPPLRRALRALLGWAVTGAPT
FT                   ERDDELRALLDTWTAAGYPDRWPEAAFPMTAARLAHMWLRLESEGFASFWE"
FT   gene            46961..49024
FT                   /locus_tag="Rmar_0047"
FT   CDS_pept        46961..49024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0047"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="KEGG: bha:BH3595 excinuclease ABC subunit B;
FT                   TIGRFAM: excinuclease ABC, B subunit; PFAM: helicase domain
FT                   protein; UvrB/UvrC protein; SMART: DEAD-like helicase;
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46956"
FT                   /db_xref="GOA:D0MK43"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK43"
FT                   /inference="protein motif:TFAM:TIGR00631"
FT                   /protein_id="ACY46956.1"
FT                   /translation="MEGAVENRKFELVAPFEPTGDQPRAIAELTEGILRGDKYQTLLGA
FT                   TGTGKTFVLSHVIQNVQRPTLVMSPNKTLAAQLYGEFKQFFPNNAVEFFISYYDYYQPE
FT                   AYIPATDTYIEKDLAINERIDRLRLRATSALVSGRRDVIVVASVSCIYGIGSPDEYREQ
FT                   IVPLHVGQQIERNELLRRLVNIYYTRNDVEFKPGTFRVRGDVVDIFPAYAEESAFRIEF
FT                   WGDEIDRIARLDPTTGELGAEETAITIYPAKIFVTPRDRLERAIASIEEELRWRLAVLR
FT                   AEGKLLEAQRLEQRTRFDIEMLREVGYCSGIENYSRHLSGRAPGERPYCLFDYFPDDYL
FT                   LIIDESHVTIPQVRAMYNGDRARKLTLVEHGFRLPSALDNRPLTFEEFEALHHQVIFVS
FT                   ATPGDYELEKSGGVVVEQIIRPTGIPDPEVEVRPTEGQIDDLLEEIRQVVARGERALVT
FT                   TLTKRMAEDLAEYLDRFGVRVRYLHSEIDALERVDLLRGLRLGEFDVLVGVNLLREGLD
FT                   LPEVSLVAILDADKEGFLRSERSLIQTAGRAARNANGKILLYADRITEAMQRMIDETNR
FT                   RRAIQLEYNRKHGITPRTVYKSREEILKSTIVAEEKYRPLVDSPRYEEPEVPPIVADPV
FT                   LKELTPEQKRELIEQLRREMLEAAENLEFERAAELRDTILALERELDAHEAG"
FT   gene            49085..49639
FT                   /locus_tag="Rmar_0048"
FT   CDS_pept        49085..49639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0048"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="KEGG: acp:A2cp1_0252 RNA polymerase, sigma-24
FT                   subunit, ECF subfamily; TIGRFAM: RNA polymerase sigma-70
FT                   factor; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   regulatory protein LuxR; Bacterio-opsin activator HTH
FT                   domain protein; sigma-70 region 4 domain protein; SMART:
FT                   regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46957"
FT                   /db_xref="GOA:D0MK44"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014327"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK44"
FT                   /inference="protein motif:TFAM:TIGR02985"
FT                   /protein_id="ACY46957.1"
FT                   /translation="MTDDLQTLCRRLVDSDRAALEELFRRMREPLLRYVCAIVAEATVA
FT                   HDLVQDVFLDLWLRRTTLDPEQPLRPYLYRMARNRALRHLRDERRRARKRAEQLPKTPP
FT                   VEPLSPDDHVASRQLETLLARWLDELPERQREVLVLSRWHGLSHREIARVMGISPRTVN
FT                   NHMLRALETLRRRIQALALTP"
FT   gene            49636..50586
FT                   /locus_tag="Rmar_0049"
FT   CDS_pept        49636..50586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0049"
FT                   /product="anti-FecI sigma factor, FecR"
FT                   /note="PFAM: FecR protein; KEGG: pzu:PHZ_c2172 probable
FT                   FecR, iron siderophore sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46958"
FT                   /db_xref="GOA:D0MK45"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK45"
FT                   /inference="protein motif:PFAM:PF04773"
FT                   /protein_id="ACY46958.1"
FT                   /translation="MNGRPTSRLPRELEEALQERSPEERRQMAALWERLGALEPPVGDV
FT                   PSTEAAWAELSARLASTPRPARPPRRALRRRWPVAVGLLLVLGLIGAYVLLRPRAVIVP
FT                   PGTIQTVTLADGSTITLRAGSRLRYAATLPWRRPRRVHLTGEALFEVVPGRPLTVETAQ
FT                   ARVEVLGTRFTVRAWPEASETRVTLLEGRVRVRSVRTPRQPLVLEAPGQSVRVGAKAEL
FT                   LPERMTPDQVLAWRRGGFVVIDEPVGVVLRELERTFALRIEVAGPLPLDRRVTVLYQQQ
FT                   ARPEAILQDLCLTLPCHYRRTSRGFVVEAEPSSGR"
FT   gene            50598..53306
FT                   /locus_tag="Rmar_0050"
FT   CDS_pept        50598..53306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0050"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="PFAM: TonB-dependent receptor plug; Secretin/TonB
FT                   short domain; KEGG: ank:AnaeK_1508 TonB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46959"
FT                   /db_xref="GOA:D0MK46"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK46"
FT                   /inference="protein motif:PFAM:PF07715"
FT                   /protein_id="ACY46959.1"
FT                   /translation="MLLGSVGTAAAQDGGRFTLVVRDVPLQEALEALARTARINLVYPS
FT                   ELVRGRTTSCALRNAPVEELLRCLLAGTGLDFVRSSSGTYVILEARELPPRLGLLTGQV
FT                   IDGTTGAPLPFAHVLLADAVTGTVTNEAGMFTISGLLAGPHRLVVSYVGYRPRVDSVRV
FT                   DPDRPAHVRIALEPTLLEAPPIVIDGLSRRPLSAELGRAYLTAEQLQQAGTTGDLLHAV
FT                   ERLPGVQVPHPLAELHLQGGDSGEHLTRLDGVPVRNPVSLGRYLSAFSPLAIGRLTVHR
FT                   AGYGVALGSQLAGVIELEHDLNVPGPLEAVARVDPLAANVRLRGRYRNAAALVAFRRSV
FT                   WDLYQEPGLRTLLRQWNTIDPLMAARWLGEPIAREGLQAYHWTPRAAFSDLHVAGRVQP
FT                   DPFQTLHIAVYRGTNRLEAGQQTRYAAAGADSARLILTEDAYRWLNEAFRLRYDRLPGA
FT                   RVLLGLQLRGSWHASSYRYRAREGTAPQGDPAAWEALEARLREELARAPGTSERNTIRE
FT                   LALEVSLHYSPSARWQLESGLVLEQVQARFRLGNVFVAPFRHAITAWQPATYLTATWTP
FT                   AEGLSVEPGVRLTWLPVRVTVYAEPRLAVRRDLQLGPFALAVRLAGGVYRQFVNQFELT
FT                   SVGATAIVPSVLFWLPPDATVAPPWSYHLTGELLLARGDTWTLETTLYQKGQPHLLFVD
FT                   YPRLLARLPARRPVPEATPLVQRDFLRHSRGVARGLNLRIRHRGPHHRATLAYSYDHTL
FT                   RAYPDSRGTLRLVPAPWNEPHRIRLDLSRELPAGLMLLGSGQVQWGRRWAFRRLYYDYL
FT                   RYSGTPTIGGYDLDRPERHRLPGRYRLDLGLSWHGRVRAAHLQLQLLVRNVLNRRDVYD
FT                   RSLTLTELVSPTPVDRLLPGRQWLLTVQVAY"
FT   gene            53381..53860
FT                   /locus_tag="Rmar_0051"
FT   CDS_pept        53381..53860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0051"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   ade:Adeh_3146 Rieske Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46960"
FT                   /db_xref="GOA:D0MK47"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK47"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ACY46960.1"
FT                   /translation="MKLEKSSRREFLRWVGGLSMGTVVISLVGCDTSGMEGTGDQPPNP
FT                   PSPGGNSGITIEGNTVTLDLTGSEARKVAEPGGFLHIDEADMLVVNVDGTIRAFSAICT
FT                   HQGCEISSFQNNRFTCWCHGSQFDTSGRVVRGPATRALTEYSVERNGNIVRITKG"
FT   gene            53873..54592
FT                   /locus_tag="Rmar_0052"
FT   CDS_pept        53873..54592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0052"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acp:A2cp1_3341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46961"
FT                   /db_xref="GOA:D0MK48"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK48"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY46961.1"
FT                   /translation="MRYALVGALLGVLTVALVQAQPALQVRPGLAHHPPEALFSQKEPP
FT                   APVSAYAPPVLAAPDPTDSLPDGMPLNTRLLWGRKGLFRLLGLAPATRKRELEIRRTML
FT                   QWHQRLALVTFAALTTQVILGEVLASNRARYYQDLQPVHRTLGYATFGLYLTTASLSLG
FT                   APPARRYTPGFSSIKLHRWLALIHFTGMMLQPWLGRHLRLAPTPDSYERRLRTHRWVGR
FT                   ITLGAYTAAFLAILLPY"
FT   sig_peptide     53873..53935
FT                   /locus_tag="Rmar_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 21"
FT   gene            54604..55200
FT                   /locus_tag="Rmar_0053"
FT   CDS_pept        54604..55200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0053"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: mxa:MXAN_7382
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46962"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK49"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ACY46962.1"
FT                   /translation="MPRFLILWLLPGLLVGGLNAQPITVAVDSTESVLQYHGHHPLHGW
FT                   TGTSRSVHGTLRLDLDDPSRSSVTIRVPVASFDSGNSNRDANMLDAVEADRYPEVVFES
FT                   SAISVQRWERTASGYEGNWTVGGNLTFHGETHPVTIPVTVRIEGNRFEATGAFSIALSQ
FT                   FKVRRPKLLIWSIRDTIDLEGTIRATLPDSAASRR"
FT   sig_peptide     54604..54666
FT                   /locus_tag="Rmar_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.992 at
FT                   residue 21"
FT   gene            complement(55197..56282)
FT                   /locus_tag="Rmar_0054"
FT   CDS_pept        complement(55197..56282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0054"
FT                   /product="molybdate ABC transporter, ATPase subunit"
FT                   /note="KEGG: afw:Anae109_1572 molybdate ABC transporter,
FT                   ATPase subunit; TIGRFAM: molybdate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; TOBE domain
FT                   protein; Transport-associated OB domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46963"
FT                   /db_xref="GOA:D0MK50"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR011868"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030287"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK50"
FT                   /inference="protein motif:TFAM:TIGR02142"
FT                   /protein_id="ACY46963.1"
FT                   /translation="MSTELDVQIVRRYPSGFEVAAAWRQPIDPAGITVLFGPSGSGKTT
FT                   LLRCLAGLERPDDGRIRLGDTVWFDAVTGRHVPPQRRRIGFLFQDYALFPHRTVAGNIA
FT                   FGLAHLSRTERRRRVAELLALFELEELADRYPHELSGGQQQRVALARALAPRPRLLLLD
FT                   EPLSALDGPTRDVLRRKLRRWLQTLNIPAVIVTHDWLEASTLGQQVLVLDGGRVLQQGP
FT                   VAEVFSRPASTRVAGIVGVETVIPGEVLHVEEGLARVAVGSATLTAMAPTELNGRVYVC
FT                   IRAEEVTLVPAPPEATSARNRLLARVVRVEPEGALVRVELDAGFPLVALVTRPSREELQ
FT                   LEPGRSVWALIKAPAVHLVPR"
FT   gene            complement(56279..56941)
FT                   /locus_tag="Rmar_0055"
FT   CDS_pept        complement(56279..56941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0055"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ade:Adeh_0999 molybdate ABC
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46964"
FT                   /db_xref="GOA:D0MK51"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK51"
FT                   /inference="protein motif:TFAM:TIGR02141"
FT                   /protein_id="ACY46964.1"
FT                   /translation="MDWTAAWVTLRLALWTTGVLCVLGLPLAYWLATTRFPGRGVIEAL
FT                   VTLPLVLPPTVVGFYLLVATAPDSPIGRMLAAVGIDRLAFTFPGIVLGSVLFNLPFAVR
FT                   PFTAAFQSVERRLVEAAWCLGVSRWRAFTGVVLPLAWPGILTGLVLSFAHSLGEFGVVL
FT                   MVGGNIPGVTRTLSIAIYDEVQALNYAAADRMALALVGFALGVLTLVYLLERKGLRR"
FT   gene            complement(56917..57753)
FT                   /locus_tag="Rmar_0056"
FT   CDS_pept        complement(56917..57753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0056"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: sus:Acid_5436
FT                   molybdenum ABC transporter, periplasmic molybdate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46965"
FT                   /db_xref="GOA:D0MK52"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK52"
FT                   /inference="protein motif:TFAM:TIGR01256"
FT                   /protein_id="ACY46965.1"
FT                   /translation="MWKRRWPEVLIGLLLVLVGCYREETPPVRPLEVQVAAAADLRYAF
FT                   ETLRARFEATHPNIRLKISYGSSGQFFTQLRNGAPFDLYFSADADYPRRLIAEGLAVDS
FT                   SFFLYAVGQLVVWVPADSPLELASWDELAGPAVRRLALANPRHAPYGRAAVAALRALGL
FT                   YERVQDRLVLGENVVQAAQFAASGAADAGIIALSLALAPDMQRRGRHRLLPPDVYPPIE
FT                   QGAVVLRRTAARPEVWALWRFVQQPEGRAVLRRYGFFIPDSTAQPTERPWTGPPPG"
FT   gene            complement(57731..58237)
FT                   /locus_tag="Rmar_0057"
FT   CDS_pept        complement(57731..58237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0057"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: abo:ABO_1780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46966"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK53"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ACY46966.1"
FT                   /translation="MIDYVLLGLLAPGPRHAYALYRELRRPDGLWLVWRLKLPRLYAIL
FT                   DRLERAGLIRSETVPQPRRPARRVFRLTPDGEARYRQWRIEPVRRGRDVRQLFLAKLYL
FT                   ARRDGPEVARTLLQHQRDLCRQWLNELRTTGPPADDFARAVWRYRVRHVETILTWLDDV
FT                   EATLA"
FT   sig_peptide     complement(58184..58237)
FT                   /locus_tag="Rmar_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.605) with cleavage site probability 0.581 at
FT                   residue 18"
FT   gene            58336..59550
FT                   /locus_tag="Rmar_0058"
FT   CDS_pept        58336..59550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0058"
FT                   /product="threonine synthase"
FT                   /note="TIGRFAM: threonine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: sus:Acid_0546 threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46967"
FT                   /db_xref="GOA:D0MK54"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK54"
FT                   /inference="protein motif:TFAM:TIGR00260"
FT                   /protein_id="ACY46967.1"
FT                   /translation="MQPVTEHVDRLVCSACGATFAPEPLHTVCTHCGRPLLVSYRLEAL
FT                   CDRFRPEVLAGRVRSLWRYAEVLPVPFDAVRSLGEGWTPLLPQPRLGRQLGLPNLYVKD
FT                   ESLNPGGSFKARGLAMAVAAAALRGVRQVGLASAGNAAGALALYAARMGLSALVFMPEE
FT                   TPEPAVWECRLAGAQVYQVPGTIAEAGAAFEAYRREHPEVFSVATLREPYRVEGKKTMG
FT                   YELFEQLGGRLPDVILYPTGGGTGLIGMWKAFDEMEALGWIGPERPRMVAVQAAGCAPI
FT                   VRAFQEGHETAEFWENARTLAAGLRVPKALGDFLILRALRESNGTAVAVEDDEILEAMA
FT                   RWAQAEGMLAAPEGAATLAALLRLREAGWVQPEETVVLFNTASAHKYPAVVHRVLSRVE
FT                   ATEIR"
FT   gene            59569..60228
FT                   /locus_tag="Rmar_0059"
FT   CDS_pept        59569..60228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0059"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methionine
FT                   biosynthesis MetW protein; UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 12; KEGG: gur:Gura_3459 diguanylate
FT                   cyclase with PAS/PAC sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46968"
FT                   /db_xref="GOA:D0MK55"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK55"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACY46968.1"
FT                   /translation="MPRTTIFDQHVERYDAWFEQHPAVYASELAAVRTLWPPVREALEV
FT                   GVGTGRFAVPLGIRYGVEPSAAMRQKAAARGVQVVAGVAEALPFPDRRFEAVLLVTTLC
FT                   FVDDPRQALREAYRVLRPGGFLVIGFVDRDSPPGRRYLERHRESPFYREARFFSASEIA
FT                   ALMQEVGFGELVWRQTLFSDPDTMTRPDPVREGYGAGAFVVVRGQRPPGSRIFAGR"
FT   gene            60244..60333
FT                   /locus_tag="Rmar_R0005"
FT                   /note="tRNA-Ser2"
FT   tRNA            60244..60333
FT                   /locus_tag="Rmar_R0005"
FT                   /product="tRNA-Ser"
FT   gene            complement(61068..63755)
FT                   /locus_tag="Rmar_0060"
FT   CDS_pept        complement(61068..63755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0060"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nmu:Nmul_A0060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46969"
FT                   /db_xref="InterPro:IPR025048"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK56"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY46969.1"
FT                   /translation="MSLNARSAEKVQLLLGRLEHVREAALTQEDRQRGIVARWMARCPG
FT                   HDDHDPSLGIALTADGRVLIHCFAGCPADRVLASAGLNWRDLAPDASGDGAASKAPPVL
FT                   LHQVDYEVRDASGRLIAVHRRRDYSDGSKRLSWLTPGPDGRLRPGLGGLSPADLPLYGV
FT                   DRLDPSYPGVVVVEGEKAAEALGTIVRNAVGTVTGASSTPGDEALRALLGFERIYLWPD
FT                   NDGPGRDHMLRVGDRLRRLGAKDVRVLEWCDAPEHGDAADFVEHYGDRAREKLRELVAV
FT                   AQPFETWAQDVQAKQAAGPETTATPPQPAETWPGADLPDVGAQLPAWLSEILASLRTQA
FT                   ERDAFLAAALGVLSGALPNVQLLYGGRWHTPALYTLAIGTAGAGKGAAVHARRLVDLID
FT                   ERLRQETRHALEVWERAAAIAREQKAEPPPRPPERFLIVAESASELAITRRLEENPDGL
FT                   VLFSSEADALSTVLGQDWGRWSHLLRKAFHHEAVRRETKAEGLLVVERPVLAVALTGTP
FT                   AQLWRLMEGGVEDGLFSRFLITRLRGDNRWVSQRPTARDRRLQEAVETGQREVYARWET
FT                   LRGRERPLTFELTDEQWDRLDATFEAIFDQVVQHVEAGTAPDALAAVVKRAALAAVRIA
FT                   CILTILHREPDVLERAAVLEADARAFEAALMLAVAFCRASLSIASRALARKLEAEMRAD
FT                   PKLQVLAAMPEVFSTAEWVARATEVKGVTRRAAEMWLRELLESGAIQREARGTYRKMTG
FT                   FGYFGFFGNFGNGTPQTEETEETEETEIRTSEERKCADDDGWFDPFEDEPEPAIDVKPT
FT                   LLPEPVAPHNGNSAPPDGDLETLRACVLALAEAADYPALWLPGFGATHGLPKMWQAAVE
FT                   RLGPEQLKEALEMLENLQRDGAPF"
FT   gene            complement(63811..64023)
FT                   /locus_tag="Rmar_0061"
FT   CDS_pept        complement(63811..64023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0061"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46970"
FT                   /db_xref="GOA:D0MK57"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK57"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ACY46970.1"
FT                   /translation="MLKAEKEQRLDPLLLTPREVCALLRIGRTTLWELRRRGLLRAVYV
FT                   GRSPRFRREDVEQLVERLAVKSPIE"
FT   gene            complement(64222..65199)
FT                   /locus_tag="Rmar_0062"
FT   CDS_pept        complement(64222..65199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46971"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK58"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY46971.1"
FT                   /translation="MRTETLYLAPADVGAVALCASIHYQGAHMGLGFRVPAEGNPEAGV
FT                   FFIETPLRLQVGFPWEGVREPALKGKGWPTSCEALERLILRIERELDEAIAQALEQPAL
FT                   ARAAREAAASFDAPPFCRPLWVGARGVSVRPFPESPLAAFWSREAPDWAPLFDENVFFG
FT                   GGDGLRIDFPEPHLFASRVFQEQVSRALGLLRFWLEAERRLAAKLGLAPRPKGELLPGI
FT                   PLALPQVPVRPAEKGGRPPLSAETLKQTVRVLLELRRRFPNASEVQLRKKAAPALNCSA
FT                   WTVRHRLEEAYSRFYPEAEGAPTDPESLEELLGRIERGEEADLF"
FT   gene            complement(65196..66425)
FT                   /locus_tag="Rmar_0063"
FT   CDS_pept        complement(65196..66425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0063"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: sml:Smlt4077
FT                   putative integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46972"
FT                   /db_xref="GOA:D0MK59"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK59"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACY46972.1"
FT                   /translation="MSVRFYVERVGADGCAPIRMALLKGRRKLTLTLPLRVRPSDWNRR
FT                   RQRLRRTAPGAPEINAALERLAARAGVLLLSGEPLEAVRDRLRSEIGLAGRDRRLAPLL
FT                   EEWLAVKALTLKPSSLEVLRRMQRHLLDFAGNVSLDRIDRAFLERFQAYLTGELGHSPA
FT                   TANRLAQYARTFFLWLEDRGLIAKAPRQLALPEPRREVVFLTPEELRAFQEADLAGLPE
FT                   GYERARTIFLLACFTGLRASDLKAGMRPEAWDTIDLDAGVWHLRERKTEIYRRVPLVEP
FT                   ARRILRGRLESGAPTPVPKLSEQKANIYVKEIARRAGIEAPVRLGDGREVPKHQVLSLH
FT                   AGRRTFVTLVAHAAGTAPLVGLTHADLDTLQKYLGAWDESRRRALEKAFRVVCHPEGAA
FT                   SQERRKQAKK"
FT   gene            complement(67056..67625)
FT                   /locus_tag="Rmar_0064"
FT   CDS_pept        complement(67056..67625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0064"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to Y25C1A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46973"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK60"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY46973.1"
FT                   /translation="MVRSLTSTTSSTARSASRNACCPSACRPIRQSVVAIRCSAIARLL
FT                   AASIWRAVCSASRMICRAALFRPARCCATATHRSACARKSASSTSRAVCRACCRRPALI
FT                   RAVTISESAIARLKALSIPREICKACSKRPASASATAISCSANARWLTCSISWATCSIS
FT                   SRCCSAPGILAILRIASSRKSVLRAV"
FT   gene            67729..68421
FT                   /locus_tag="Rmar_0065"
FT   CDS_pept        67729..68421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mno:Mnod_6109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46974"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK61"
FT                   /inference="similar to AA sequence:KEGG:Mnod_6109"
FT                   /protein_id="ACY46974.1"
FT                   /translation="MGIASYLLEAGRFQEARSVILEIEEPFLKELMLRYLVESLAEAEQ
FT                   LSEALAVTHQIKNDTMHYIALAKIIRAKAKAGNFQEAQDLARQFSDPRRRASAISIVAL
FT                   AKAEAGRFEEALQLAREIELDFWRAFTLSDIAVMMAKNGHFQEAIQVAKGVQNVFSWDV
FT                   ALEEIALAQVKAGRLREAWQTVLEINDLEERVRTLLSMAEVLLGVEQEEIVLTDCPESE
FT                   PESESDGK"
FT   gene            68540..69850
FT                   /locus_tag="Rmar_0066"
FT   CDS_pept        68540..69850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0066"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   dal:Dalk_4861 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46975"
FT                   /db_xref="GOA:D0MK62"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR028351"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK62"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="ACY46975.1"
FT                   /translation="MLTLVGSALAQQVQRITFEEALRLALRRNPAIQQAANERERSEVG
FT                   LASARSNFLPDLSLSISGSRDYGRNFVMDEGRVVDQTTHYFSSGISANLNLFNGFRDLN
FT                   SVSQARFQVAASELNYARQRETVLFNVISTFLSLIEAREQVRIQEENLAAQRALLEQIE
FT                   AFVQVGSRPVADLYQQQAQVASAELELINARRNQQLQEANLIQLLQLDPFGAYEFVIPE
FT                   VDTMALGVREYEAQVLLQAALERRSDLRALEQQIEAAEYGVRVARSSYWPTISLRASYG
FT                   SSYTDLAPLSFQDQFFDRNRRGSIGLSLSFPIFDRFTTRHNVQRARIELDNTRLQLQQL
FT                   RQEIATQVRQAYLDYETARQQYRAAQAQLQAARQALEAAQERYNVGSATLVELTQARAT
FT                   YVRAESDLVRARYTLVFRQKLIDYYVGTLVPELDVLR"
FT   gene            69872..71233
FT                   /locus_tag="Rmar_0067"
FT   CDS_pept        69872..71233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0067"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   afw:Anae109_4295 RND family efflux transporter MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46976"
FT                   /db_xref="GOA:D0MK63"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK63"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACY46976.1"
FT                   /translation="MALSKATRRLLIILAVLLGLLVVIGVGGRALGLFKQEAGIEVEVA
FT                   KAERRDITQVVTASGRVQPEVEVTISPDVSGEIVELPVREGDRVEKGQLLARIRPDFYE
FT                   AQVQQAEAGVAQARATLKQREADLLRAEGEFKRQKALYEKQAISASDFEAARTQYEVAK
FT                   AALEAARYAVESAEAQLREAREQLAKTIIYAPMSGIVSKLDVELGERVVGTSQMAGTEM
FT                   MRIARLDQMEMEVEVNENDVVNVSIGDTATIHIDAYPERTFRGVVTEIANSARITSQGT
FT                   QEQVTNFPVKVRILGTVALPEATPSPVARAEEVPASAELLPPLRPGMSGTVDIYTKTVF
FT                   DAVAVPIQAVTVRDFNRVRPEGETAPADTASNPLALKEDLRKVVFLVENGKAKMVEVQT
FT                   GISDDTYIEITAGLQGGETVIIGPYRAVSQTLRPGMAVRIQQPGRGRRIMATVQ"
FT   sig_peptide     69872..69964
FT                   /locus_tag="Rmar_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.277 at
FT                   residue 31"
FT   gene            71253..71999
FT                   /locus_tag="Rmar_0068"
FT   CDS_pept        71253..71999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0068"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sus:Acid_7937 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46977"
FT                   /db_xref="GOA:D0MK64"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK64"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY46977.1"
FT                   /translation="MTATTDNRRPLIQLRDVTKIYRMGTQQVRALDGVSLDVYPNEYVA
FT                   IMGPSGSGKSTLMNILGCLDTPTGGTYYLNGRDVSRLSDDELARIRNKEVGFVFQTFNL
FT                   LPRVNCLQNVELPLIYAGVRKSQRRALAEAALRSVGLGDRMHHKPNELSGGQRQRVAIA
FT                   RALVNNPSIILADEPTGNLDSKTGEEIMRLFELLYRQGHTLLVVTHEHDIAHHARRIIH
FT                   LRDGRIERDEPVAQPLLADLDLSTAV"
FT   gene            72006..72713
FT                   /locus_tag="Rmar_0069"
FT   CDS_pept        72006..72713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0069"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: atc:AGR_L_1625
FT                   ribosomal large subunit pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46978"
FT                   /db_xref="GOA:D0MK65"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK65"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ACY46978.1"
FT                   /translation="MELPILYEDDDLLAVHKPEGLAAIPERDPSRPSARRLLEAARGER
FT                   LWVVHRLDKEASGVLLFARNAEAHRYMNTLFEQRQVRKVYRALVHGRLEPGQGQIRAPI
FT                   RMYGSGRMGVDPERGKPSETRYRVLEYLDEAYSLIEALPLTGRRHQIRVHCYHIGHPIV
FT                   GDPRYGDRSVQQRYPRLMLHALSIRFRHPNGQELEIVAPVPESFQQVLDALRTELAAST
FT                   TDHSATTSSPSST"
FT   gene            complement(72626..73816)
FT                   /locus_tag="Rmar_0070"
FT   CDS_pept        complement(72626..73816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0070"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   mxa:MXAN_3124 alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46979"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK66"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ACY46979.1"
FT                   /translation="MQTIEALPTPAALIDRQRLLGNLREMQQRATQEGVALRPHAKTHK
FT                   TPELARLQQELGATGITVATVDEAEAFVAAGLTDVRVAYPTVGIDRYERLLALMAQARI
FT                   SFCLDTPEAIRAASDFFAARGRQAEVLLEVDTGFGRTGVRWDDARRLVDCARLIQESPG
FT                   LRLIGLLTHAGQAYHGPGPDESPADALRRVAAEERDRLLAAAVTLQQAGLAHPERFELS
FT                   VGSTPTAHYFTNRTEQGFRITEIRPGNYVFHDVMQVALGSCTRDACALTVLARVVSRKP
FT                   DGRGGWWVFLDAGKKALATDQGYGTRGYGLPLYHPASRTPLPHAVIERLSEEHGWMHVR
FT                   GGTTLQIGDRVQIVPNHACLIAPLLRRFYVLEGDEVVAEWSVVDAASSVRSASSTC"
FT   gene            73892..75469
FT                   /locus_tag="Rmar_0071"
FT   CDS_pept        73892..75469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0071"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; KEGG: gsu:GSU0582
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46980"
FT                   /db_xref="GOA:D0MK67"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK67"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACY46980.1"
FT                   /translation="MEVAEKETKPSTAALPSEVAETFHALQQVITRAAIGAARTAQRLE
FT                   RIGQQFAEARAGVEASARAMQQIRQRVEAVAESARSTADVAHQVARLTEEGRQQSDASQ
FT                   EAVKHLEQQVVAVMERLERLVAQVQGITQISDVIDRIAWKTKLLAFNAGIEAARAGHEG
FT                   QGFSVLANEIKSLSEDTALQTRQIRALINDLVKELQPVEEAIRQSQELLHTTVEQSDRL
FT                   EAALQRIHELAGQAAQHMDRVVTTVDAQLQDAEAVGATLQQALAAVGHVDKEAEHIARD
FT                   TFTLSELVEDAYGYLGRFNGRSLFHRALTLARELAERSRRIFEQVIDEGRCTLDDVLAL
FT                   EYTEIKGREAIASLARLFDVSRVPESGFDPPKYSTRYDHLVDEALQQVMDEILEREPRL
FT                   TFALIIDLNSYAPIHNRRFCQDWTGDPKKDLVGNRIKRFFFDKGVLVRGARVGLPRAAV
FT                   TLPNMARREDFLRVCDLRERPEERDVFLVQTYARDTGQVLSALTVPLYVKGHRYGAVLL
FT                   GWDPERVG"
FT   gene            complement(75470..75898)
FT                   /locus_tag="Rmar_0072"
FT   CDS_pept        complement(75470..75898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0072"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+transporting two-sector ATPase delta/epsilon subunit;
FT                   KEGG: dde:Dde_0984 F0F1 ATP synthase subunit epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46981"
FT                   /db_xref="GOA:D0MK68"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK68"
FT                   /inference="protein motif:TFAM:TIGR01216"
FT                   /protein_id="ACY46981.1"
FT                   /translation="MARTLFVEIVAPDRRVFRGEALSVRAPGVEGSFEVLYNHAPMVAA
FT                   ITVGPIFVTTPSGERITFATSGGFVEVLGNTVTILAETAEPASEIDVERARAAEQRALE
FT                   RLQKAQTPEERAEAEAALERARNRLRVAMGQVGQRIHP"
FT   gene            complement(75901..77406)
FT                   /locus_tag="Rmar_0073"
FT   CDS_pept        complement(75901..77406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0073"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: ank:AnaeK_4484 ATP synthase F1, beta subunit;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46982"
FT                   /db_xref="GOA:D0MK69"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK69"
FT                   /inference="protein motif:TFAM:TIGR01039"
FT                   /protein_id="ACY46982.1"
FT                   /translation="MEIKTDQAVGRVVQIIGPVVDVEFPEGQLPEIYDALVITLEDGSE
FT                   LVLEVEQHLGENRVRAIAMDSTDGLTRGTPVRNLDRPISVPTGTEIRGRLFNVVGQAID
FT                   GLPQPQAEGYRPIHAPAPPFEELATRVEMLETGIKVIDLIQPVMRGGKVGLFGGAGVGK
FT                   TVLIMELINNIAKAHEGLSVFAGVGERTREGNDLLREMLESKVIRYGDAFLESMKAGGW
FT                   DLSKVDFEELKKSQATLVFGQMNEPPGARARVALTGLAIAEYFRDLGGRDVLLFIDNIF
FT                   RFTQAGSEVSALLGRMPSAVGYQPTLATEMGELQERITSTKHGAITSFQAIYVPADDLT
FT                   DPAPATTFAHLDATTVLSRQLAAQGIYPAVDPLESTSRILDPNIVGEEHYRVAQEVKQI
FT                   LQRYKELQDIIAILGMDELSEEDKLVVHRARRVQRFLSQPFFVAEQFTGIPGKYVKIED
FT                   TVRGFRMILDGELDHLPERAFLLRGTIEEVIEAGEKMLKEAEA"
FT   gene            77660..80164
FT                   /locus_tag="Rmar_0074"
FT   CDS_pept        77660..80164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0074"
FT                   /product="peptidase M14 carboxypeptidase A"
FT                   /note="PFAM: peptidase M14 carboxypeptidase A; SMART:
FT                   peptidase M14 carboxypeptidase A; KEGG: smt:Smal_0478
FT                   peptidase M14 carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46983"
FT                   /db_xref="GOA:D0MK70"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK70"
FT                   /inference="protein motif:PFAM:PF00246"
FT                   /protein_id="ACY46983.1"
FT                   /translation="MQKIRRACLLVALGLAPALAAQPLQSPEEFLGYPPGTRFTPHYRV
FT                   VDYFEYVARTSPRVQLVQYGETYEGRPLLLAIISSPENLARIEALREDNLRRAGRMPGT
FT                   PDPDGPVFVWLSYNVHGNEAVSTEAALLTLYALAHPDSQRTGAWLEQAVVLLDPCLNPD
FT                   GRERYVQWYHRMLGVQPDPDPIAREHHEPWPGGRTNHYYFDLNRDWAWGTQQETQARLA
FT                   VYHRWMPQIHVDFHEQGVDEPYYFAPAARPIHPLITDWQRALQDTIGRNHARYFDADGR
FT                   LYFTREVFDLFYPGYGDTWPTFNGAIGMTYEQGGGGRAGLAIRTAEGDTLTLAERIRNH
FT                   YTTGLSTIETAVRQRRTLLDRFARYFAETQTQPAGRYRAFLIRGDAHPDRLAALTALLD
FT                   RQGIRYGTLTRARAVEGLDYATDARQRLEARPGDLVVSVYQPAGTLAQVLFDPDPVLPD
FT                   SLTYDITSWALPYAFGLEAYALSERLEPDRAGWARPTPTPPTEAQPYAYLVRWGGMDAA
FT                   RFLADVLRQGVKVRVTEAPLALNGRRFEAGTLILTRAGNEHLGARFDRIVHEAARRRHQ
FT                   QLYTTRTGFVDEGPDLGSSRVRFLRKPRVYLLAGAPASAYAVGEIWHFFEQVLHYPITL
FT                   VERDELDELLLDEGDVLILPHGFYNAREMPLESLLEGVRRGARLIALEGALDLLAGQQG
FT                   VALKRRQRDDSEQDTAARPRRYEMREREAISDQVPGAIYRVQLDPTHPLAFGLARYFTL
FT                   KRSTRAYELLEDGWNVAWLEEGRPRSGFAGHRTVERLRETLVVGTQRLGRGTLVFFVDD
FT                   PLFRGFWHAGQLLFTNAVFFGE"
FT   sig_peptide     77660..77722
FT                   /locus_tag="Rmar_0074"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.565 at
FT                   residue 21"
FT   gene            complement(80168..81508)
FT                   /locus_tag="Rmar_0075"
FT   CDS_pept        complement(80168..81508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0075"
FT                   /product="pyrimidine-nucleoside phosphorylase"
FT                   /note="TIGRFAM: pyrimidine-nucleoside phosphorylase; PFAM:
FT                   glycosyl transferase family 3; Pyrimidine nucleoside
FT                   phosphorylase domain; Glycosyl transferase, family 3-like;
FT                   KEGG: afw:Anae109_0662 pyrimidine-nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46984"
FT                   /db_xref="GOA:D0MK71"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK71"
FT                   /inference="protein motif:TFAM:TIGR02644"
FT                   /protein_id="ACY46984.1"
FT                   /translation="MPDVVELIITKRDGGHLAPDDLRWLVQAYTRGEVPDYQMSAFLMA
FT                   AFIRGLNEAEMDALTDAMLHSGHVLDLSDLPGRKVDKHSTGGVGDKVSLILAPLVAACG
FT                   VPVPMISGRGLGHTGGTLDKLESIPGLRTDLSIEAFRRQLRELGVVMIGQTDEIAPADR
FT                   KLYALRDVTGTIESIPLIAASILSKKLAEGADALVFDVKCGRGAFMQQEADARRLAETL
FT                   VGIATRAGRPAVAWLTDMNVPLGRAVGNWPEVVESLRALRGDFEGIEDLIEVTLALAGE
FT                   MLWLGGAAETPEAGRRLARVALTDGRAFERFCAMVRAQGGDVRVLERPETRPDTEPAGE
FT                   VRAPDGARGYVADLDARAVGRLAVHLGAGRRVKEDPVDPTAGLVLHRKPGDPVAPGDVL
FT                   ATLYTRRRDRLVDFRQALLAAYRFAETPPPPRPLLLARYAEGRWTLP"
FT   gene            complement(81510..84023)
FT                   /locus_tag="Rmar_0076"
FT   CDS_pept        complement(81510..84023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0076"
FT                   /product="glycoside hydrolase family 9"
FT                   /note="PFAM: glycoside hydrolase family 9; KEGG:
FT                   aba:Acid345_2677 glycoside hydrolase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46985"
FT                   /db_xref="GOA:D0MK72"
FT                   /db_xref="InterPro:IPR001701"
FT                   /db_xref="InterPro:IPR004197"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK72"
FT                   /inference="protein motif:PFAM:PF00759"
FT                   /protein_id="ACY46985.1"
FT                   /translation="MRRYLLLLSWLLVRAGFGQSEGFVLNEREYFEREGVSVMVFQDFY
FT                   PEGHQSGVTLVQHGERVAANGDVRLEATPGQWQPVPRLLRREVHPERNEIVAYLAYPDP
FT                   DRDRKGFNPIFYPDLHLTYRVRVRGETDGVRIIVDLDEPLPEAWAGRVGFNLELFPGAL
FT                   FGKSWYMDDAAGIFPRQPNGPVRINDAGEVEAVPLATGRRLLVAPESDALRLEIESLRG
FT                   ELALYDGRVQHNNGWFVVRTAIPAGSTTNAVEWVVRPHVIPGWRYTPVLQVSQVGYHPR
FT                   QPKVAVLELDARDDLQGTVYLLRLGEDGTTDTVLAGPPVPWNGRFLRYRYAHFDFSRVT
FT                   RPGLYMLAFRGVRSHPFRIAPDVYRRHVWQPTLEFFLPVQMCHMRVEQQYRVWHGACHL
FT                   DDARMAPPDTNHIDGYVQGPELRAPYAPGEHVPGLNVGGWHDAGDNDLRIESQADEVFI
FT                   LATMYELFEVLKTYDNTTIDQRRRLTQIHQPDGRPDVLQQIEHGVLSILGGYRALGRLY
FT                   RGIIAPTLKQYVLIGDPANSTDNRIYDPSVPPETLSALRVDARDPRWVVTTADDRWVFT
FT                   ESNPAHEYKGIAALAAAGRALRSYNPELARACVEAAEALWQQERDTSRGFDERVVAAVE
FT                   LFRTTGRDLYRRTLLNDRDRIVARIGSVGWAVGTILPTLGDSAFTVAVQAAVARYMDEV
FT                   HRLQQENPYDVPYRPRIWGAGWDIQRFGVRQYLLHRAFPDLVPPDYVFNALNFVLGVHP
FT                   GRNTAAFASGVGARSVTVAYGFSRADWTYIPGGVVSGTALIRPDFPELKEFPYLWQQVE
FT                   YVMGGGATHFMFLVLAADQLLNATR"
FT   sig_peptide     complement(83961..84023)
FT                   /locus_tag="Rmar_0076"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.527 at
FT                   residue 21"
FT   gene            complement(84141..84392)
FT                   /locus_tag="Rmar_0077"
FT   CDS_pept        complement(84141..84392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0077"
FT                   /product="ribosomal protein L31"
FT                   /note="TIGRFAM: ribosomal protein L31; PFAM: ribosomal
FT                   protein L31; KEGG: neu:NE1036 50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46986"
FT                   /db_xref="GOA:D0MK73"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK73"
FT                   /inference="protein motif:TFAM:TIGR00105"
FT                   /protein_id="ACY46986.1"
FT                   /translation="MKKGLHPEYNLITVRLADGTEFQIRSTLKGPVYVSDVDATNHPFY
FT                   TGVRQFVDRAGRVEKFMRRYGKVTSQGHQKPEAEEEGK"
FT   gene            complement(84474..86357)
FT                   /locus_tag="Rmar_0078"
FT   CDS_pept        complement(84474..86357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0078"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiC; PFAM:
FT                   thiamine biosynthesis protein ThiC; KEGG: mca:MCA2710
FT                   thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46987"
FT                   /db_xref="GOA:D0MK74"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK74"
FT                   /inference="protein motif:TFAM:TIGR00190"
FT                   /protein_id="ACY46987.1"
FT                   /translation="MIPKPPAAIRRVYVSGNRYPELRVPFKEVQLSPTRLPDGSLEPND
FT                   PVLLYDTRGPWGDPDFHGDIRQGLPPLRRPWIEARGDVEEYDGRPVQPIDDGYRSEEER
FT                   RRAEQRGKLHRWPGPRRRPLRGKNGAAVTQMHYARQGIITPEMEFVAIRENQRRERLIE
FT                   LQKELGDRWSLAFQHPGQPWGAQIPPVITPEFVRDEVARGRAIIPCNVNHPECEPMIIG
FT                   RNFLVKINANIGTSAVSSSIDEEVEKLLWAIYWGADTVMDLSTGKNIHETREWIIRNSP
FT                   VPIGTVPIYQALEKVGGKPEELTWEIFRDTLIEQCEQGVDYMTIHAGVRLAYIPLTANR
FT                   RTGIVSRGGSIIAKWCLAHHRENFLYTHFEEICEILRQYDVSISLGDGLRPGSIQDAND
FT                   EAQFAELKTLGELTRIAWKYDVQVMIEGPGHIPMHLIKENVDRELEDCYEAPFYTLGPL
FT                   VTDIAPAYDHITSAIGAAMIGWFGAAMLCYVTPKEHLGLPNKNDVREGVIAYKIAAHAA
FT                   DLAKGHPGAQYWDNALSKARFEFRWEDQFNLSLDPERAREYHDETLPAEGAKLAHFCSM
FT                   CGPKFCSMKITEEIRAMAAEKGVDARQVIEEGLEEKAREFREKGAEIYTAP"
FT   misc_binding    complement(86441..86546)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam(RF
FT                   00059), score 68.05"
FT   gene            complement(86599..87219)
FT                   /locus_tag="Rmar_0079"
FT   CDS_pept        complement(86599..87219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0079"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3603 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46988"
FT                   /db_xref="GOA:D0MK75"
FT                   /db_xref="InterPro:IPR025517"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK75"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY46988.1"
FT                   /translation="MKQVQRNFVVDLAAFVAFVLLTTTGVLLRYILPPGSGRFTTLWGL
FT                   DRHTWGQIHFWIALILLGILAIHLVLHWKWIVCMVKGRPTEGSGWRMALAVVGLIGLLG
FT                   LAVAPLLSPVERKELPAGQRGVAATEQRETVVPLVTGAMRLEDVARRLEVPVPTLLRTL
FT                   GLPEDIPPETRLSQLRRRYGLTLREVRRRLQTLITTRADSLKP"
FT   gene            87405..88790
FT                   /locus_tag="Rmar_0080"
FT   CDS_pept        87405..88790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0080"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /EC_number="3.1.5.1"
FT                   /note="KEGG: spl:Spea_2917 putative
FT                   deoxyguanosinetriphosphate triphosphohydrolase; TIGRFAM:
FT                   deoxyguanosinetriphosphate triphosphohydrolase; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46989"
FT                   /db_xref="GOA:D0MK76"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="InterPro:IPR027432"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK76"
FT                   /inference="protein motif:TFAM:TIGR01353"
FT                   /protein_id="ACY46989.1"
FT                   /translation="MLDWKKLLSTRRKGKEDEEWTSYRPPFLRDFDRIVFSNPFRRLQD
FT                   KTQVFPLIAHDHVHNRLTHSLETASVRRSLGIIAWQCVQEKVEKIGEISDRDIGDIVSA
FT                   AALAHDIGNPPFGHLGERAIGEWFEENEERVRRVVEFGNDKQEWILCELKKFEGNAYGF
FT                   HLLLNDKSLRLTYATLGAFTKYPYDALIAKNNDLKKYGYFCLDADDFENIMTTLCLRRK
FT                   ENGVYMRHPLSYLVEAADDICYLILDLEDGIRMDIFRDEEKEIFDVMEKILFKFNEMIG
FT                   EGRFCCDLINRKSYYKMEEYKKLNKNEKIAVYRARVIDALVHDVADVFVRNYNEIMNGV
FT                   FDSSLIDKSSFCCELEEIRKWEKESIYQERHVIAKELSGYRIVRELVDIFFSSLFERKN
FT                   SYEDRFWKLFRKRISGLENKEHFSKNYDSLLKVIGYVAGMTDSFALTTYRYLKGIEVPE
FT                   YIP"
FT   gene            complement(88795..91740)
FT                   /locus_tag="Rmar_0081"
FT   CDS_pept        complement(88795..91740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0081"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: mag:amb2469 excinuclease ABC
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46990"
FT                   /db_xref="GOA:D0MK77"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK77"
FT                   /inference="protein motif:TFAM:TIGR00630"
FT                   /protein_id="ACY46990.1"
FT                   /translation="MQDCIVIRGAREHNLKNIDLDIPRERLVVITGLSGSGKSSLAFDT
FT                   IYAEGQRRYLESLSAYARQFLGMLERPDVDFIDGLSPVIAIEQKTVSQNPRSTVGTVTE
FT                   VYDFLRLLYARVATAYSHISGKPMRRQTDDEIINHILSFPEGTRLLILAPVVRGRKGHY
FT                   RELFEQIARQGFERVRVDGELREITPGMKLDRYKTHDIEVVVDRIVVRPDIRPRVHDSV
FT                   QIALGMGGGVLIAHVLNPDGMGTDHVFSRHLYCPEDGVSYDDPSPNTFSFNSPYGACPA
FT                   CNGLGTRLEIDPDLVIPDPSKSINEGGLAPLGRPRDVWIFSQLRAVAAAYGFDFDTPLG
FT                   ALTEEQRRVLLEGAGDREFEIEYRFKDRTLRYRHRFGGIYEYLHHLREHAGSVSQRRWA
FT                   ESFMREMTCQACGGARLKPESLAFRIGGKNIAELAHMDLVSLRRFLSELQFEGQKALIA
FT                   RPILKEILERLGFLIEVGVGYLTLDRPARTLSGGESQRIRLAAQLGSQLTGVLYVLDEP
FT                   SIGLHPRDHHRLIDALKLLRDLGNSILVVEHDREMIEAADYVIDLGPGAGEHGGHVVAA
FT                   GPPDRLEVRDGHVSLTAAYLKGARYIPVPRERRTGNGHRLVLYGARGHNLKGDPLVLPL
FT                   GTFICVTGVSGSGKSSLINQTLYPILARHFHNARLVPLPYERIEGLEHLDKVIDIDQKP
FT                   IGRTPRSNPATYTGLFSHIRDLFARLPEAQLRGYKPGRFSFNVKGGRCETCKGAGVVKL
FT                   EMNFLPDVHVTCETCRGRRYNAETLEVRYRGKSIADVLEMTVDEALAFFENMPRIARKL
FT                   RTLQAVGLGYIRLGQPATTLSGGEAQRIKLARELSRPGTGNTLYILDEPTTGLHFEDIR
FT                   HLLAVLRALVRKGNTVLVIEHNLDVIKVADHVIELGPEGGDAGGHILFAGTPEELAAQD
FT                   THTGRFLRKELARAAALADGADEELIDLDQLVTDEETPEEEIEDELLDEEE"
FT   gene            91909..92502
FT                   /locus_tag="Rmar_0082"
FT   CDS_pept        91909..92502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0082"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: sat:SYN_01458 MarC family integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46991"
FT                   /db_xref="GOA:D0MK78"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK78"
FT                   /inference="protein motif:PFAM:PF01914"
FT                   /protein_id="ACY46991.1"
FT                   /translation="MNAYLETFLPLFVAINLPGILPFFIALTEGLSAADRRRLLVRAVA
FT                   TAFVVAVLILFAGQLIFETLGITLNDLRVGGGLILLVLSITDLVFADYRRRDPRDGADA
FT                   ADVGVVPLGIPLIIGPAAITTILVAQQTYGYLPTLVSLVANLLLVTAAFAAGPWVIRKL
FT                   GPVAVRAIAKVASLFLAAIAVAMIRAGVAGMLAG"
FT   gene            92583..92900
FT                   /locus_tag="Rmar_0083"
FT   CDS_pept        92583..92900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0083"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical LOC482158"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46992"
FT                   /db_xref="GOA:D0MK79"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK79"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY46992.1"
FT                   /translation="MALKTLDIDALAAKTGNLYETVAILSKRARQIATQMKQELDEKLS
FT                   YFEGLGLEDDPRHQEEQRRISIEYELKPEPTEIAVEEFLRDEIYYRDASKERSEEEEEL
FT                   R"
FT   gene            complement(92982..95411)
FT                   /locus_tag="Rmar_0084"
FT   CDS_pept        complement(92982..95411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_2479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46993"
FT                   /db_xref="GOA:D0MK80"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016518"
FT                   /db_xref="InterPro:IPR027414"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK80"
FT                   /inference="similar to AA sequence:KEGG:XC_2479"
FT                   /protein_id="ACY46993.1"
FT                   /translation="MKGMGLALAAGPYWLRRALAQPSASSSPFVEARIPERGMYSLQPA
FT                   ARWEEALVAGNGTLGILVYGDPLNERIIFNHELLYEPLRDERVPPPNLAPYLPRIRALM
FT                   LEGRYREAVAYSLEMAQREGWPGLLWTDPYHPAFALVLEMPTETPTEYLRRTAFDTGEI
FT                   GVFWRTATDTYTRRAFVSRTDGVVVLELSAEAGPLPDLTLHLEVQDVRPPEQREGYHPP
FT                   EITAAPGWLSYRCAYVHTRRGYEGLVRVEAEGGTQTVRDGRLHVRGARRVLLLARVWTL
FT                   DDVAASRLAEEQAALAAFPADYDLLFAPHAAAHGALFRRMKLDLEAGDDRRKSSETLLA
FT                   EQQTHETILPALLEKLFDMGRYVLISSCGHWPPNLVALWTGEWRPPWSGDFTLDANLNL
FT                   QMAAASIGAVPEAVASLTRLLEGLLDDWRDNARRLYGCEGVLSGSRTDGRCGWHTHFNA
FT                   DYPLHFWTAGAGWLAQPLHEYAEVYGDEAFVREHLIPYLREVARFYETFLTVTDAEGHV
FT                   VFVPSYSPENRPGNLDTPGSINATMDIAVCREVLSTLIALCEARGLEADSLPRWKALLD
FT                   RLPPYLINEDGALKEWAHPDLADNYDHRHLSHLYPVWPGHEITPEATPELFEAARRAAY
FT                   LRGHENDSAHGLVHLALIGARLKDPELAYRSLRDLIRNGYLLPSLFSLHYPGNVYNADL
FT                   INSLPAIVIEMLLYSRPGLLELLPAVDERLPRGTLHGARARGRLRVERLRWDLPARHVE
FT                   LALVSDTDRTLTLRVRRGIAELQAIEGPTPERTSATDATLQLAARTPATLQIRLAG"
FT   sig_peptide     complement(95349..95411)
FT                   /locus_tag="Rmar_0084"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.877) with cleavage site probability 0.875 at
FT                   residue 21"
FT   gene            95686..96744
FT                   /locus_tag="Rmar_0085"
FT   CDS_pept        95686..96744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0085"
FT                   /product="WD40 domain protein beta Propeller"
FT                   /note="PFAM: WD40 domain protein beta Propeller; KEGG:
FT                   mmr:Mmar10_1114 peptidase S9 prolyl oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46994"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK81"
FT                   /inference="protein motif:PFAM:PF07676"
FT                   /protein_id="ACY46994.1"
FT                   /translation="MKKLRWKWSSLWMAGLLLAACSLFEPEKKTRFDYGGDPLPGTENL
FT                   YNLRLSPDGEWVALIRAYTPERLDPPNQLWLVHRDGRKMRFLGPSIGSADWSPDGKRLA
FT                   LTYEPGLCCDVHVVTLDLESGQVVVWTGADTLLLSHPTASFPHWFQDGQRLLVSVIGKA
FT                   YGQLYETGIYVLNLVHRQVEGPLVKSMVGAQLGGRDRFAVGIMPQPQGRVYRENAVRYE
FT                   FATGALTVLTDFGPEEAYRFAVSPSPVEDLIVLERRVEGVPQLFLMDGKGRILRQLTER
FT                   GGHNPRWSYDGRAVLFLRDVEAGPGARNVPFVYWLDEDREEPLWPMLPDSVPAFPVLDT
FT                   LLAGCMLCGKLP"
FT   sig_peptide     95686..95757
FT                   /locus_tag="Rmar_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.883) with cleavage site probability 0.533 at
FT                   residue 24"
FT   gene            complement(97028..98026)
FT                   /locus_tag="Rmar_0086"
FT   CDS_pept        complement(97028..98026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0086"
FT                   /product="voltage-dependent potassium channel, beta
FT                   subunit"
FT                   /note="TIGRFAM: voltage-dependent potassium channel, beta
FT                   subunit; PFAM: aldo/keto reductase; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46995"
FT                   /db_xref="GOA:D0MK82"
FT                   /db_xref="InterPro:IPR005399"
FT                   /db_xref="InterPro:IPR005400"
FT                   /db_xref="InterPro:IPR005983"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK82"
FT                   /inference="protein motif:TFAM:TIGR01293"
FT                   /protein_id="ACY46995.1"
FT                   /translation="MEYRHLGRSGLKVSALSYGAWVTFGDQIDEGLAEECMHAAYEAGV
FT                   NFFDNAEAYAGGKAEIMMGNILKRSGWKRSDLVISTKIFWGGKGPNDVGLSRKHIIEGT
FT                   KAALERLQLDYVDLIFCHRPDPETPIEETVWAMNYVLDQGWAFYWGTSEWSAEQIRYAY
FT                   EFARREHLIPPTMEQPQYNMFHRVRVEREYAPLYRDYELGLTTWSPLASGILTGKYNEG
FT                   IPEGSRMSLPGYEWLRKRLESEEGRRQIEKVRRLMPIAEELGCTMAQLAIAWCLKNPNV
FT                   STVITGASRPEQVRENMKALEVARRLTPEVMERIEAILENRPEPEINWRER"
FT   gene            complement(98092..99030)
FT                   /locus_tag="Rmar_0087"
FT   CDS_pept        complement(98092..99030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46996"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK83"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY46996.1"
FT                   /translation="MQPTQPPMAELPIHTVLSEAEARARAAAHEARLRPVLDPYLAARR
FT                   RGEKQPVMDFLFEYYTFRPSRLLRWRPGLGVAVQGTDARRWLEDPDFVETPEGVTVDPA
FT                   RFPAHRIPSLRWVVTLLERTAARRPHLGCCGMHEWAMVYRTERPRHAHVPLRMDPDTLA
FT                   AFVESHPITCTHFDAFRFFTEAARPLNRFQPTRDTIHELEQPGCLHANMDLYRWAYKFY
FT                   PWVGSDLIADAFLLACRIRTLDMQASPYDLRAYGLEPIPIETPEGRRRYRALQEQFYRE
FT                   AQPIRRRLLQTLRSLLELAVTNAPTHADGVA"
FT   gene            99133..99315
FT                   /locus_tag="Rmar_0088"
FT   CDS_pept        99133..99315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46997"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK84"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY46997.1"
FT                   /translation="MKRVFRALLLSALATGAFAWVLSRLHPRPEPATVRPGEVDADELP
FT                   PEAQERLLEELDRLL"
FT   sig_peptide     99133..99192
FT                   /locus_tag="Rmar_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 20"
FT   gene            99431..102196
FT                   /locus_tag="Rmar_0089"
FT   CDS_pept        99431..102196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0089"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   ade:Adeh_3381 peptidase M16-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46998"
FT                   /db_xref="GOA:D0MK85"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK85"
FT                   /inference="protein motif:PFAM:PF00675"
FT                   /protein_id="ACY46998.1"
FT                   /translation="MNLLRRLSAGLLLLLCTMPALAQTEEATDLPVEIPYEKFVLDNGL
FT                   TLIVSPDHKAPIVAVNIWYHVGSKNEKPGRTGFAHLFEHLMFNGSEHFNDDWFQALERV
FT                   GATDLNGTTNRDRTNYFQTVPVNALDLVLWLESDRMGHLLGAIDQAKLDEQRGVVQNEK
FT                   RQGENQPYGKVWNIIAEHTYPEGHPYSWPVIGYMEDLDAATLEDVHEWFKTYYGPNNAT
FT                   IVIAGDIDPQTALEKVKKYFGSIPPGPPLAKPKAWVAKRTGEQRMTMEDRVPQARLYKV
FT                   WNVPEWGHPERDYLDLAADVLASGKTSRLYRRLVYTDQIATDVNAFVYTGEIGSQFMII
FT                   ATARPGVPLEKVEQAVDEELARFLQEGPTADELERVKADFIAGFIRGVERIGGFGGKSD
FT                   ILAQYEVYGGDPGLYKVTLRRMQQATPAQVLEAARKWLSDGVFVLEVHPYPKLQASGED
FT                   VDRSQLPPVGTPPEVSFPEVQQATLSNGLKVLLVERHAVPVVNFQLILDAGYAADQFAQ
FT                   PGTATLAMNMLDEGTTSRTALEISDELDRLGARLGTDSDLDVSTVYFSALRDKLDPSLE
FT                   LFADVVLHPAFPEADFQRLKQQQLVAIQREQVSPVQMALRVFPRLLYGEGHAYGLPLTG
FT                   SGTIESVQQITRDDLVRFHQTWFKPNHATLVVVGDITMDELLPKLERLLAEWNPGDVPQ
FT                   KNIQDVPQKDRSVVYLIDRPGSEQSIIFAGHVAPPEANPRELAIKAMNTVLGGAFTSRI
FT                   NMNLREDKHWSYGARSMLMSARGPRPFIVYAPVQTDKTAPAMLEIKKELDGIVNGQKPV
FT                   TPEELDKVQRNLTLRLPGRWETANAILDDLSYVVQFGWPLDYWRTYPDAVRALTLEDVN
FT                   AAAREVLHPDRLVWVVVGDRSRIEDEIRQLELGPVYLIDTEGNLLASLSE"
FT   sig_peptide     99431..99499
FT                   /locus_tag="Rmar_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.956 at
FT                   residue 23"
FT   gene            102297..103082
FT                   /locus_tag="Rmar_0090"
FT   CDS_pept        102297..103082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0090"
FT                   /product="phage shock protein A, PspA"
FT                   /note="PFAM: PspA/IM30 family protein; KEGG: mxa:MXAN_5703
FT                   PspA/IM30 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACY46999"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK86"
FT                   /inference="protein motif:PFAM:PF04012"
FT                   /protein_id="ACY46999.1"
FT                   /translation="MSLWARFKRWIRSIFGGAISALEDPRLILEQNIRELNDQIPKMNE
FT                   NIATVKANVLLLQKEVRRNEQEIERLVARIKAAIQAGRDDIAQQYAIQLQKAKETLART
FT                   KEQLQYAEAAYEKALQVKQAFLREKERKIQEAKEALRAHERAKWQAKVADALEQFEVGG
FT                   LDQTHEEMVQRLREETARSEARLELALDSVDADALKIEADAEALRAAELVRQFKLEMGL
FT                   LEPEQKPALESPAREAEQEAPEQARETEETKTIGRQRTR"
FT   gene            103084..103491
FT                   /locus_tag="Rmar_0091"
FT   CDS_pept        103084..103491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0091"
FT                   /product="CG33484-PA-like protein"
FT                   /note="KEGG: similar to CG33484-PA"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47000"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK87"
FT                   /inference="similar to AA sequence:KEGG:660472"
FT                   /protein_id="ACY47000.1"
FT                   /translation="MRPEDYQRLKEAEKEHLRALRRLKEAVRLLRRRRAIDEALARLER
FT                   QTEATLAAHDEALERLALETAYQEARLELALEGHEPPPDDALDPERTRRRAQELLRQLR
FT                   DESETSAAADSSAPAEARTEKTLGRLRPPGS"
FT   gene            103491..104408
FT                   /locus_tag="Rmar_0092"
FT   CDS_pept        103491..104408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5701 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47001"
FT                   /db_xref="GOA:D0MK88"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK88"
FT                   /inference="similar to AA sequence:KEGG:MXAN_5701"
FT                   /protein_id="ACY47001.1"
FT                   /translation="METTGMNDRPINYTREAFLHPWNLTFLIAALVTALGISFTDSPDW
FT                   LFDAVLLFTTALELLYLGIMPRQERFRRAVRARRAAEHARPPSQKELFQLLSRSSQRRY
FT                   VRLRNLEKQIRANYQKLSYASQGLLESHLQKIDELLRSYLNLLYQKERYEFYLAQTSED
FT                   ELVEALQALQEDMADDAPRVRAIKERRRRILEQRLARIKKVRENLEIIEAQLDTIDDVI
FT                   RYIHEQSLTLRNPEEITFQLDTLLSEVEETEAAVAEIEDVFASPSALLGELSAELEPPR
FT                   MESEATEPSEKTPPEAVRRQRQRS"
FT   gene            104417..104755
FT                   /locus_tag="Rmar_0093"
FT   CDS_pept        104417..104755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47002"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK89"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47002.1"
FT                   /translation="MYRLLLLALLSGCSMWAPVLEEPPTIWVAREFTGGRQCSDETYTP
FT                   PDTRELLAAAGVRVYDVWVEHLAVIAVCGAPSYAAVHYARIAEADLERARQLGFEKSDP
FT                   PNKTPQTE"
FT   sig_peptide     104417..104482
FT                   /locus_tag="Rmar_0093"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.798) with cleavage site probability 0.729 at
FT                   residue 22"
FT   gene            104752..105549
FT                   /locus_tag="Rmar_0094"
FT   CDS_pept        104752..105549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0094"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bvi:Bcep1808_4573 short chain enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47003"
FT                   /db_xref="GOA:D0MK90"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK90"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACY47003.1"
FT                   /translation="MSTETTALQTVRYEVDSDGFALITINRPDKHNALNHQVLTELDRC
FT                   IRQARQDEAVKGVIITGAGEKSFCAGADIQQFRELDAYSGHRFALYGQAVFNRIEEMPK
FT                   PVIAAVNGYALGGGCELAIACHLRVAADHAVFGQPEVSLGLIPGYGGTQRLPRLIGRGL
FT                   AAELILTGERISARWAFEIGLVNRVVPIEHLLDTARELLQKITSKAPVAVALALEALRQ
FT                   SDLPLRQGLRLEAALFGQACGTEDFREGVDAFLNRRKPVFKGR"
FT   gene            105549..106799
FT                   /locus_tag="Rmar_0095"
FT   CDS_pept        105549..106799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0095"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: mgm:Mmc1_0912 protein of unknown function DUF21"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47004"
FT                   /db_xref="GOA:D0MK91"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK91"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACY47004.1"
FT                   /translation="MTVLLLIGAFVLAMLVAGAEAALVAANRLRLEVLARQGSRTARLA
FT                   QALLDAPATPLLTMLAGLTLAQVLLAMGLSTPLLHGRGFTSALAAWGSALLLVLIGGLS
FT                   FYLGGLLLPTAVAREQANRLVQPGAVLLRVAAYLLWPLVRPARAVSERLARRLSVEADT
FT                   VATFMQQELAWQVQEVEAETAPARDLDETESRLLANALAFEKLRVRDCMVPRTDIVAVE
FT                   EHTDLETLRQRFIESGYSRLPVYREHIDQIIGVVFAYDLFRQPSSLAEMIRPVRFVPES
FT                   KPAHALLKEFLQTNTSIAIVIDEYGGTAGLVTQEDLLEELIGDIQDEFDVDEDEEYLLR
FT                   RLDERTWLVSGRVDIDELREAGLDLPEGDYDTVAGYLLEKLGTIPKPQEEFELDGYRFT
FT                   ILKASQNRIELVRITRL"
FT   sig_peptide     105549..105614
FT                   /locus_tag="Rmar_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.537 at
FT                   residue 22"
FT   gene            106883..107431
FT                   /locus_tag="Rmar_0096"
FT   CDS_pept        106883..107431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0096"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bxe:Bxe_B0918 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47005"
FT                   /db_xref="GOA:D0MK92"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D0MK92"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ACY47005.1"
FT                   /translation="MERCEAIRQTVQQKFGFVPQLFEELLRTNPAVAEAYLQAGAALQQ
FT                   GVLSPPEQQIVQLTVAAWNACHYCTAAHGTAALGMGLSPETVDAILEGRLPEDERLALL
FT                   VEATRAVLERRGWLDEDALQKLEARGLDRAALYEIIALIGVKTITNYINHLAHTPVDEV
FT                   FRPVTERTAYRRLVESTTV"
FT   gene            107466..107933
FT                   /locus_tag="Rmar_0097"
FT   CDS_pept        107466..107933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0097"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: atc:AGR_C_3945 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47006"
FT                   /db_xref="GOA:D0MCP6"
FT                   /db_xref="InterPro:IPR021329"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCP6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47006.1"
FT                   /translation="MQSFPIKRILLAGVVGTLLFDLFGLMASTMMGNPTWWDIPALLAG
FT                   KLGLPLFFGVLAHYLNGIVLAVIYAAVAPFLWGSKWARAFTYITAETVLGVWLFMAPLL
FT                   GMGIAGVSGPMGAMFAIVSLVRHWVYAVALAAFIPVPAAAPQTNATASATA"
FT   sig_peptide     107466..107549
FT                   /locus_tag="Rmar_0097"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.737) with cleavage site probability 0.711 at
FT                   residue 28"
FT   gene            complement(108023..108730)
FT                   /locus_tag="Rmar_0098"
FT   CDS_pept        complement(108023..108730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47007"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCP7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47007.1"
FT                   /translation="MRCYWLGLLALVGCGLLGAKEERREALLEVEAYAEITLNGQPWRP
FT                   DSTLGKIELRPPEAFGPGTLPPAYLLLSFIVRDPTPELPFYEANLRLHIWERPPRTDTT
FT                   YYLFNSHPYIRELVVHGTESEKSLGLMGSFAEVEGDVSLTNYWIAREDSLRSWVRFSRI
FT                   DTVQTEPFLLVFYEGRFELVVSPVSWDPAWSRYPNEKLHFAGRFRVPAVPWEYVYRCWR
FT                   EGYCPLRVRLRTL"
FT   sig_peptide     complement(108671..108730)
FT                   /locus_tag="Rmar_0098"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.851) with cleavage site probability 0.835 at
FT                   residue 20"
FT   gene            complement(108811..110880)
FT                   /locus_tag="Rmar_0099"
FT   CDS_pept        complement(108811..110880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0099"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcv:XCV1064 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47008"
FT                   /db_xref="GOA:D0MCP8"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCP8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47008.1"
FT                   /translation="MLLLGLWLALSTTLQAQPVPLFEEVAASLQALGPQAQQRQQVLQR
FT                   LPMVTQLQVVRLPAQLWRYRSFELAVNAAGRLVPGRGKGLGTLTVRRGELSVLSEEAVA
FT                   WNGRIYVGMDTSEAVGEVSLVVLRTGAVTGQVLLGDAEYWVRPLGGGLHALVTIDPSKY
FT                   PKERPTSPYHDGGGPGEAGLNDAAESVQPEKAVEQETQAFVGSCAQEEALGAGAVVQSR
FT                   CSPEVVRVLVLYTPAAAQGRDIDGIIYAAINDANQAYYNSRINDRLPANRLKLELVHKQ
FT                   SFSFTVQNIPTDDVERLAGDAQARALRDQYQADVVVLLIDDNEGSGGWSTTLGVAGAIP
FT                   HGSSGEAIVNVSEVNQKAYAIVKVSYASGGRYTLAHEIGHIQGAQHHPDDPIDPQGIPY
FT                   ARGHRFVAPVIRCINDPPYGRRCFQEYTYNATVMAYTPWPYVRIKHFSNPEVMYYGVFT
FT                   GRSDRNNARVLRETADMVADFRDPNELRATFFYTSDNFPYEGSYTFTAQPCGGRGTLSY
FT                   QWRKCADPFTCGPVLGTGATFTTYLAPGSNYIQLTVQSSAGQAYTVLREVYVLDSSCGE
FT                   EIFCAQAVGGDTLQVVQERLSAERLPAEPELEGLYPNPAGDRVVVRFGLPEASEVELMV
FT                   YDVLGRAVVRRRPGRMEAGWHREVLMTDGWPAGRYVVVLRVGERTLSKTLMRIR"
FT   sig_peptide     complement(110830..110880)
FT                   /locus_tag="Rmar_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.979 at
FT                   residue 17"
FT   gene            complement(111302..112435)
FT                   /locus_tag="Rmar_0100"
FT   CDS_pept        complement(111302..112435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0100"
FT                   /product="2-methylcitrate synthase/citrate synthase II"
FT                   /EC_number="2.3.3.5"
FT                   /note="KEGG: bba:Bd2511 methylcitrate synthase; TIGRFAM:
FT                   2-methylcitrate synthase/citrate synthase II; PFAM: Citrate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47009"
FT                   /db_xref="GOA:D0MCP9"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCP9"
FT                   /inference="protein motif:TFAM:TIGR01800"
FT                   /protein_id="ACY47009.1"
FT                   /translation="MAETTEVKKGLAGVIADESAISNVIPEKRALYYRGYPVHELAEKC
FT                   RFEEVAYLLLYGELPTRAQLEAFEQEERSQRALDETVHRLLELIRTDAAPMDVLRTAVS
FT                   LLGANDPEATGADIDTIRRKAIGLMARLPTIVAADRRRRHGLDFIPPREDLTFAENFFH
FT                   MYFGEVPDAEVVKAFDVSLILYAEHSFNASTFTARVITSTLSDYYSAITGAIGALKGPL
FT                   HGGANEEVMRMLKPFRSPEEARRWVEEALARKQKIMGFGHRVYRYGDSRVPIMERYTRR
FT                   LAERLGFQNLMAIYDAIQEVVVQQKGIYPNLDYPTGPAYYMMGFDIETYTPIFVMSRIT
FT                   GWSAHVMEQLADNRIIRPLSRYVGPPERPVPPLEARG"
FT   gene            complement(112447..113373)
FT                   /locus_tag="Rmar_0101"
FT   CDS_pept        complement(112447..113373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0101"
FT                   /product="methylisocitrate lyase"
FT                   /note="TIGRFAM: methylisocitrate lyase; KEGG: bba:Bd2502
FT                   2-methylisocitratelyase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47010"
FT                   /db_xref="GOA:D0MCQ0"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCQ0"
FT                   /inference="protein motif:TFAM:TIGR02317"
FT                   /protein_id="ACY47010.1"
FT                   /translation="MLFATTPPEAKRRALREALRSGRLLRFPGAFSPLVAMLIERLGFD
FT                   GVYISGAVLSADLGLPDVGLTTLTEVAWRSRQIARVTGLPAIVDIDTGFGEVLNVARTV
FT                   QELEEMGLAGCHLEDQVNPKRCGHLDHKALVPVEEMERKVRAAVQARRDPNFLIIARTD
FT                   ARGVEGLEAAIERARAYVAAGADMIFPEALQSEEEFAAFRKALPDVPLLANMTEFGKSP
FT                   LLSAERLEALGYNLVIYPVTGLRLAMKAVEEGFRHLLEAGTQEALLDRMQTRKELYELL
FT                   QYERYTVFDQNVYNFRLEETTSSSENQ"
FT   gene            113744..114442
FT                   /locus_tag="Rmar_0102"
FT   CDS_pept        113744..114442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47011"
FT                   /db_xref="GOA:D0MCQ1"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCQ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47011.1"
FT                   /translation="MKTLRLDGLLKIVIVLAIASLGASVFVLLDPWHWIGATAERVGIS
FT                   QALSTALALLLGTIAIIVAVTVERTEYRAQEALRSDVVELAATLHSVLTKTAAWYARRG
FT                   QTGTPPPAPDFEAERYAIGRFLCSPTGFAFLCRAAEKSAEAGRRNAPEVWRGFSLVLAD
FT                   LQMLQGTALARFVYEARDAFFEMVDLIGHLSAHDLRQIRRFLEDFEHAMPFYRQAMAES
FT                   VLVRAFRNLH"
FT   sig_peptide     113744..113833
FT                   /locus_tag="Rmar_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.878) with cleavage site probability 0.641 at
FT                   residue 30"
FT   gene            complement(114670..115395)
FT                   /locus_tag="Rmar_0103"
FT   CDS_pept        complement(114670..115395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0103"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG: bsu:BSU30210
FT                   dithiobiotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47012"
FT                   /db_xref="GOA:D0MCQ2"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCQ2"
FT                   /inference="protein motif:TFAM:TIGR00347"
FT                   /protein_id="ACY47012.1"
FT                   /translation="MNGLLVTGTDTGVGKTVVAAGLARLLHEAGYRVGVLKPVETGWEG
FT                   PPGNWPPDARMLAEGARVDNPPEQVAPCVYAEPLAPLVAARRAGRPVDLERIEAAWRWL
FT                   QDRDWVLVETAGGLSVPLTDTLDYASLAARWKLPVLVVSRPGLGTLNHTFLTVHYARSR
FT                   GLPVVGVVLCGYPEQPDVAEQTNPAMIEEMCHVPVLGRVPRRPAITSADEAAAAVAEGL
FT                   RLEAFLARYEELQQRVLHD"
FT   gene            complement(115392..116780)
FT                   /locus_tag="Rmar_0104"
FT   CDS_pept        complement(115392..116780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0104"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoateaminotr
FT                   ansferase"
FT                   /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   bcy:Bcer98_2818 adenosylmethionine--8-amino-7- oxononanoate
FT                   transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47013"
FT                   /db_xref="GOA:D0MCQ3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCQ3"
FT                   /inference="protein motif:TFAM:TIGR00508"
FT                   /protein_id="ACY47013.1"
FT                   /translation="MKETRTIIDALDELAPETLVVWDKTYVWHPFTPMKQYMAGDPVII
FT                   RRGRGVKLEDIHGNWYYDGTASIWLNVHGHNVPELNAAIEAQLRRVAHATMLGQANVPA
FT                   VALAKRLIDVAPKGLQRVFYSDSGATAVEIALKMAVQFWANQGRRTKRYVLGFLNNYHG
FT                   DTLGAVGVAPDPLFHWPFLDLLPGHPRVPYPYPHDRLTESLEAVEDVLRTRRDELAAVI
FT                   VEPVEGAGGILPAPPGFLRELRALCDRYDVLLIVDEVATGFGRTGRLFACEADGVTPDL
FT                   LCLGKGLTGGYLPLAATLTTERVFEAFLGEVEERKTFFHGHSYTGNPLGCAVALASLEL
FT                   LLELLPALPAKVERIRAGLAPLADHPFVAEVRQAGFMVGIEIVADRATRTPFPYGAQVG
FT                   FIVARHAWRRGMLVRPIGSVLIFMPPLAATETELDEMTAILRASFEDALPELESLAQQI
FT                   RQQA"
FT   gene            complement(116795..117826)
FT                   /locus_tag="Rmar_0105"
FT   CDS_pept        complement(116795..117826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0105"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="KEGG: xau:Xaut_2921 3-oxoacyl-(acyl carrier protein)
FT                   synthase II; TIGRFAM: 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein; 3-Oxoacyl-[acyl-carrier-
FT                   protein (ACP)] synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47014"
FT                   /db_xref="GOA:D0MCQ4"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCQ4"
FT                   /inference="protein motif:TFAM:TIGR00747"
FT                   /protein_id="ACY47014.1"
FT                   /translation="MLPEQSLTTPLPATATAAPARRAAVLGVGAALPAHREPSTETERR
FT                   LGLPPGWIARRTGIRERPLVGPDEATSDLAVRAGAAALAQAELSPERIGLLLLATSTPD
FT                   HLLPPTAPVVAHRLGLKHAGAVDLAGACSGFLYALALADGYVRLQRTCVLVIGANVLSR
FT                   RTNPDDPKTSALFADGAGAVVLGPSEGSRGIVACWLGADGSCWDDLYIPAGGSRRPLTP
FT                   ERVARGEHLMYMKDGRALFRRAATGMAEAGRRVLQQAGLDLDDVAWWIPHQANHRLIEE
FT                   ARRQLGMPEARTVNLVDRIGNSSAATIPLALALEAHRFAPGDLLLLTAVGAGLLSAAVL
FT                   IQW"
FT   gene            complement(117816..118994)
FT                   /locus_tag="Rmar_0106"
FT   CDS_pept        complement(117816..118994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0106"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="KEGG: afw:Anae109_3561 8-amino-7-oxononanoate
FT                   synthase; TIGRFAM: 8-amino-7-oxononanoate synthase; PFAM:
FT                   aminotransferase class I and II; aminotransferase
FT                   class-III; aromatic amino acid beta- eliminating
FT                   lyase/threonine aldolase; Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47015"
FT                   /db_xref="GOA:D0MCQ5"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCQ5"
FT                   /inference="protein motif:TFAM:TIGR00858"
FT                   /protein_id="ACY47015.1"
FT                   /translation="MEWLTRQLRQLEAKGLRRTLRPLAAGPYVERDGRRLLNLASNDYL
FT                   GLSTDPRLTAAAREALERWGVGAGAARLVVGDRPVHEALEAALAALKETEAALVFPSGY
FT                   AANVGVLSALAGPRDQIFADALNHASLNDGARLSRARFRYYRHRDLEQLERLLQGPGPA
FT                   PGGRRFIVTDAIFSMDGTVAPLPELAELAARYDAVLVVDDAHGTGIVGPEGRGTAHHLG
FT                   VADRIPVQVATLSKALGVQGGAALGSRALVDYLLHRARAFIYSTGISPVLAAAALEAVR
FT                   LVQSDEGARRRHRQQAHVARLKAGLEALGYTVRHEPPAPMLAVLVGAPEAALRLSAMLE
FT                   TRGVLAPAIRPPTVPPGTSRIRLAPMATHTDDDIEAALAAFPEAEAIQPHVA"
FT   gene            complement(118960..119994)
FT                   /locus_tag="Rmar_0107"
FT   CDS_pept        complement(118960..119994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0107"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: bha:BH1748 biotin synthase; TIGRFAM: biotin
FT                   synthase; PFAM: biotin and thiamin synthesis associated;
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47016"
FT                   /db_xref="GOA:D0MCQ6"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCQ6"
FT                   /inference="protein motif:TFAM:TIGR00433"
FT                   /protein_id="ACY47016.1"
FT                   /translation="MEIAWDQLVADALEDRPPTRDVARALLQLPDEDTLRLVEAAWRVR
FT                   RHFFGNRVKVNVLLNAQSGICPEDCHYCSQSRISKAPIPRYRMLSVEEILDRARKAYAA
FT                   GAQRFCIVTSGRGPHRRELETVLEATRRIKAELPLEICACMGILDEEQARQLREAGVDA
FT                   YNHNLNTSPRHYARICSTHTFEDRIRTVQTALKAGLQTCTGVILGMGETDEDVLDMAYA
FT                   LREAGATSIPVNFLIPIKGTPLGDGQTVRHLTPWACLRYLSVFRFVNPKAEIRASAGRE
FT                   LHLRSLQPLALMVANSLFLGDYLTEKGQAAEADWQMIEDLGFVPETPQPARPHGVAHPA
FT                   TPAA"
FT   gene            complement(120014..120949)
FT                   /locus_tag="Rmar_0108"
FT   CDS_pept        complement(120014..120949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0108"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="KEGG: afw:Anae109_1479 biotin--acetyl-CoA-
FT                   carboxylase ligase; TIGRFAM: biotin/acetyl-CoA-carboxylase
FT                   ligase; PFAM: biotin/lipoate A/B protein ligase;
FT                   Helix-turn- helix type 11 domain protein; biotin protein
FT                   ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47017"
FT                   /db_xref="GOA:D0MCQ7"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCQ7"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ACY47017.1"
FT                   /translation="MKEVALLACLNETFTSGALLARRLGLSRVAVWKQAHRLQEAGYPI
FT                   EIVQGRGYRLRPGSPAPHLLQPLLQGRFGRAYRYLGRTTSTQDELRAWAEAGAPEGAVV
FT                   LAEQQTGGRGRRGRRWVSPPGAGLYFSVLLRPRLPLTDLLRLSLAAGVALAETAEVGGL
FT                   KWPNDLLAPDGRKLAGVLVEADLRGEEVRYLLLGIGLNVHEAPLPPEAACLETYRPDLR
FT                   RVDLLARLLARLEHWYDRLADAGAVLDAWRRFSYTLGRPVRIETPAGPVEGLAEDVEPS
FT                   GALRVRLPDGTRRTVSAGDVALLQPVATNP"
FT   gene            121072..121902
FT                   /locus_tag="Rmar_0109"
FT   CDS_pept        121072..121902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0109"
FT                   /product="glycoside hydrolase family 16"
FT                   /note="PFAM: glycoside hydrolase family 16; KEGG:
FT                   swd:Swoo_4377 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47018"
FT                   /db_xref="GOA:D0MCQ8"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008263"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCQ8"
FT                   /inference="protein motif:PFAM:PF00722"
FT                   /protein_id="ACY47018.1"
FT                   /translation="MMRRVAFILCSLLFGCSILDGDQPIRLPHWELVWSDEFDYNGLPD
FT                   PAKWDYDVGGHGWGNQELQYYTRARIENARVGGGVLIIEARRESYEGREYTSARLVTRG
FT                   KASWTYGRFEIRARLPSGRGTWPAIWMLPDRQTYGSAYWPDNGEIDIMEHVGFNPDVVH
FT                   GTVHTKAYNHLLGTQRGGSIRVPTARTDFHVYAIEWTPEEIRWFVDDSLYYRFPNERLT
FT                   NPEADWRHWPFDQPFHLIMNIAVGGTWGGQQGVDPEAFPAQLVVDYVRVYRWVE"
FT   sig_peptide     121072..121137
FT                   /locus_tag="Rmar_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.928 at
FT                   residue 22"
FT   gene            complement(121928..122373)
FT                   /pseudo
FT                   /locus_tag="Rmar_0110"
FT   gene            complement(122567..123466)
FT                   /locus_tag="Rmar_0111"
FT   CDS_pept        complement(122567..123466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0111"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: sde:Sde_2639
FT                   fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47019"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCQ9"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACY47019.1"
FT                   /translation="MAERPLLGGLEAGGTKFVCAVGTGPDDIRALERFPTTTPEETLGR
FT                   VIDFFRRQPEPIAALGIGSFGPVDPDPGSPTYGYITTTPKPGWAHTDVAGTLRRALNVP
FT                   VAFDTDVNAAALGEQRWGAGRGLHTFVYLTIGTGIGGGVIVNGRRHHGRQHPEIGHLFI
FT                   PRLPGDDRPGHCPFHGDCLEGLASGPAIAARWGRPAPELPPNHPAWDEVAQYLAFGLAN
FT                   LILTLSPQRLILGGGVMHQTHLFPRIRRHVAACINGYVALPDLDTFIVPPALGDRAGVL
FT                   GALALAEEVMSGLKHGIL"
FT   gene            complement(123482..124618)
FT                   /locus_tag="Rmar_0112"
FT   CDS_pept        complement(123482..124618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0112"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   bcy:Bcer98_3338 histone deacetylase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47020"
FT                   /db_xref="GOA:D0MCR0"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="InterPro:IPR003085"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCR0"
FT                   /inference="protein motif:PFAM:PF00850"
FT                   /protein_id="ACY47020.1"
FT                   /translation="MVPVVYHPDYLTYCFGPEHPFSPVRLEMLWTLLEALGCAPTPIRP
FT                   PEATRADVLRVHAEDYVARVEAASRGEYVPDAEAFGLDTPDVPVFPDMDRAARILVGGT
FT                   LHGARLIADGRATTVLQLGGGFHHAHPARASGFCVYNDLSIAIRALTDAGLRVAYIDID
FT                   VHHGDGVQAIHYREDTVLTISLHETGQYLFPGTGFIDEIGEGRGQGFSLNVPLQPFTDD
FT                   ESYLEVFERVVPHALVMFRPDVLVVQCGADAHFQDPLADLLLSTRAYEQLFRRLKALAD
FT                   EHTGGRALFTLGGGYDFDATVRVWALLYLVLQDRPFPERLPLSWRIEWEQRLERPLSPT
FT                   LHDTARPLTLTPERRRQIAQQNLHTARRLMDTLAYYWY"
FT   gene            complement(124585..125235)
FT                   /locus_tag="Rmar_0113"
FT   CDS_pept        complement(124585..125235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0113"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; amino acid-
FT                   binding ACT domain protein; SMART: CBS domain containing
FT                   protein; KEGG: bha:BH3236 acetoin dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47021"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCR1"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACY47021.1"
FT                   /translation="MLVQDVMQRPVQTIAPDATLAAAYRLMQEHAIRHLPVVDEGRLVG
FT                   IVTDRDLRLATSALHPHPFPPDARVASVMQRRVVTAAPLDPVEEAARLMRMRRIGCLPV
FT                   LDGDELVGIVTVTDLLEALLRLSGADRPSGRIEVRLAHTPGRLAALASAVAAHHVNILS
FT                   VLSYPESSEWLRVVLRVDTNRTHPLADALRQEGFEVIWPPHKPWSPSSITPTT"
FT   gene            125362..125790
FT                   /locus_tag="Rmar_0114"
FT   CDS_pept        125362..125790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0114"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; KEGG: pae:PA4485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47022"
FT                   /db_xref="GOA:D0MCR2"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCR2"
FT                   /inference="protein motif:TFAM:TIGR00413"
FT                   /protein_id="ACY47022.1"
FT                   /translation="MRHARLLFWGLWIGLLALVAGRMPASEARRGPGPDTLQVALYVAE
FT                   GRASYYGTRWAGQRTASGEAFDPEALTAAHPTLPFGARVRVTNLRNGRSVVVRINDRGP
FT                   HVPGRIIDVSYAAARALGMVRSGTVPVRIEWLPETAVD"
FT   sig_peptide     125362..125445
FT                   /locus_tag="Rmar_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.685) with cleavage site probability 0.396 at
FT                   residue 28"
FT   gene            complement(125787..126179)
FT                   /locus_tag="Rmar_0115"
FT   CDS_pept        complement(125787..126179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47023"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCR3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47023.1"
FT                   /translation="MEGPAFVPAYNRPKKPGIWMNFDNTVSIYHVVGPDDSFEEAAQAL
FT                   FQLLREAQERFPDWPRLLFLDIVGHEGDRAGFDDDFFEFQQEFLFSTLAPFVTALDTPL
FT                   TGPLLNPAPQRNDLPDRLVIRTPGTN"
FT   gene            complement(126321..127007)
FT                   /locus_tag="Rmar_0116"
FT   CDS_pept        complement(126321..127007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0116"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: bam:Bamb_1995
FT                   ThiJ/PfpI domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47024"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCR4"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ACY47024.1"
FT                   /translation="MGRVLFVVTNHSELGSTGQKTGYYLSEVAHPFHVLHEAGYEIDFV
FT                   SPKGGKAPMDPKSYKLDDPINKAFWETHGKRLDETLAPEQVDPSRYVAIFYAGGHGTMW
FT                   DFPESEAIARIAASIYERGGAIGAVCHGPSGLIPIKLSNGRPLVEGRRINSFTNEEEQA
FT                   VQLDKIVPFLLETRLKELGAIHVSVKNFAAHVEVDDRIVTGQNPASAEGVGRALVEVLN
FT                   RLSVPA"
FT   gene            complement(127169..127399)
FT                   /locus_tag="Rmar_0117"
FT   CDS_pept        complement(127169..127399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0117"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: bpe:BP3871 putative cold shock-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47025"
FT                   /db_xref="GOA:D0MCR5"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCR5"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACY47025.1"
FT                   /translation="MAQRGRVKWFNIDKGYGFIEPNDGSKDVFVHRNNVPGLGWDEGLR
FT                   EGEEVSYEVERTPKGLSAMNVERLSRSSELF"
FT   gene            127667..129145
FT                   /locus_tag="Rmar_0118"
FT   CDS_pept        127667..129145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0118"
FT                   /product="peptidase S10 serine carboxypeptidase"
FT                   /note="PFAM: peptidase S10 serine carboxypeptidase; KEGG:
FT                   cps:CPS_0603 serine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47026"
FT                   /db_xref="GOA:D0MCR6"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCR6"
FT                   /inference="protein motif:PFAM:PF00450"
FT                   /protein_id="ACY47026.1"
FT                   /translation="MQRIAIFILTGWLVAVAAEAQSRRPPIDTTVVTRHTVTVKGQRIP
FT                   YRAEAGMQPVWDEWGRPIATMFYVYYEREDVQDRARRPLIFSFNGGPGSASVWMHIGYT
FT                   GPRRVRIDPEGFPIQPYGIEENPYSILDVADIVYVDPVNTGFSRILSDTVDRRQFFGVN
FT                   EDVTYLADWIAAWVSRHDRWRSPKFLIGESYGTTRVAGLAGALQERHWMYLNGVILVSP
FT                   TGLGIERDGPVGQALLLPYYAAAAWYHRKLAPELQQRDLEALLPEVEAFTVEEYLPALV
FT                   RGGFLEPERRREIARRVATYAGLSEEVVLQYNLAVPRNVFWKELLRDEGFTIGRLDSRY
FT                   RGIDRQAGGERFDHDPALSAWNHAFTPAINYYLREVLGFRTDLEYWIFGPVRPWNREGN
FT                   ETGEQLRRAMAQNPYLHVLVQAGYFDGGTDYFSARYTLWQLDPSGKLRDRLFFKGYRSG
FT                   HMMYLRDEDLATANDDLRAFIQKALEAARTPARY"
FT   sig_peptide     127667..127729
FT                   /locus_tag="Rmar_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.522 at
FT                   residue 21"
FT   gene            129171..130760
FT                   /locus_tag="Rmar_0119"
FT   CDS_pept        129171..130760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0119"
FT                   /product="Alpha,alpha-trehalase"
FT                   /EC_number="3.2.1.28"
FT                   /note="PFAM: glycoside hydrolase family 37; KEGG:
FT                   lpp:lpp1844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47027"
FT                   /db_xref="GOA:D0MCR7"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR018232"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCR7"
FT                   /inference="protein motif:PRIAM:3.2.1.28"
FT                   /protein_id="ACY47027.1"
FT                   /translation="MRFRAVWLSVLLLGLVPRLQAQDRVACQVPLPSVERIEAVRAYIR
FT                   QSWDVLTRSHRDLLAAVQDPKIEHEPGTPWPLYIAATEDSVAVWHRLQQELPDSVLQQI
FT                   VLRVLPEDPVAHLDEIHPHGLLYLPEPYVVPGGRFNEMYGWDSYFIVVGLLRDGRVDLA
FT                   KAMTDNHLYQVRHYGKVLNANRTYYLTRSQPPFLSAMVLAVYAHTQDRDWLAAAVPLIE
FT                   RYYAYWTTPPHLAGETGLSRYYDLGEGPAPEVVAGERDAQGRTHYDRVREYYRMHEVTA
FT                   YDESLYYVAEADSLTPLFYKGDRSMRESGFDPSNRFGPFSVDIIHYAPVGLNALLYRME
FT                   TDLARIHEILGDTAAAAAWRARAEARRERVDRYLWDSERGLYFDYNFRTGRRSDYVFAT
FT                   TFYPLWVGMASPEQAARVAANLYLLEAPGGLLTSTHISGSQWDAPYGWAPLYLIAVEGL
FT                   RRYGYDEAADRLTAKFVSMIVEDFERTGVILEKYDVVQRRSDVALRYGYTSNEIGFGWT
FT                   NAVFAELLAQMD"
FT   sig_peptide     129171..129236
FT                   /locus_tag="Rmar_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.990 at
FT                   residue 22"
FT   gene            130765..131394
FT                   /locus_tag="Rmar_0120"
FT   CDS_pept        130765..131394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0120"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; KEGG: rme:Rmet_4066 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47028"
FT                   /db_xref="GOA:D0MCR8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCR8"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACY47028.1"
FT                   /translation="MNRRAHWERIYATQPVERVGWYRPHLDTSLTWIQELNLPRRARIL
FT                   DVGGGASTLVDDLLTLGFEDITVLDLSATALAHARARLGARADRVTWMEADITEAALPE
FT                   AAYDLWHDRAVFHFLTEPDDRAHYLERLRRALRPGGFLILATFSPEAPPTCSGLPVVRY
FT                   DLETLVRTIGPGFHLVRHGREHHVTPGGIAQPYLYTCFQRNEEEKP"
FT   gene            131391..132407
FT                   /locus_tag="Rmar_0121"
FT   CDS_pept        131391..132407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0121"
FT                   /product="zinc-binding alcohol dehydrogenase family
FT                   protein"
FT                   /note="TIGRFAM: zinc-binding alcohol dehydrogenase family
FT                   protein; PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   KEGG: gsu:GSU0573 alcohol dehydrogenase, zinc- containing"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47029"
FT                   /db_xref="GOA:D0MCR9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCR9"
FT                   /inference="protein motif:TFAM:TIGR02822"
FT                   /protein_id="ACY47029.1"
FT                   /translation="MTRALPATMRAMVLEAPGRPLVLRELPVPAPGPGEVLLRVEACGV
FT                   CRTDLHIVDGELPEPKLPLIPGHQIVGRVVRLGEGVTRFREGDRVGVPWLAETCGTCRY
FT                   CRRGQENLCPNACFTGYTRDGGFAEFTTALADYCYSLPDDVYDAPHAAPLLCAGLIGYR
FT                   TYRLAGPHVERLGLYGFGAAAHLIIQVAVARGQQVYAFTRPGDTAAQDFARKLGAVWAG
FT                   ASTERPPEPLDAALIFAPVGALVVEALRSVDKGGVVVCGGIHMSDIPSFPYRLLWEERV
FT                   IRSVANLTRQDGEEFLKLAPTIPVRTEVTCFPLEEANEALRRLREGQLQGAAVLVMG"
FT   gene            complement(132410..132673)
FT                   /locus_tag="Rmar_0122"
FT   CDS_pept        complement(132410..132673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0122"
FT                   /product="Transglycosylase-associated protein"
FT                   /note="PFAM: Transglycosylase-associated protein; KEGG:
FT                   abo:ABO_0802 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47030"
FT                   /db_xref="GOA:D0MCS0"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCS0"
FT                   /inference="protein motif:PFAM:PF04226"
FT                   /protein_id="ACY47030.1"
FT                   /translation="MGILSWIVMGLLAGALAKWIMPGKDPGGIIVTILIGIVGALIGGF
FT                   LAGLLGIGEGRAVDFDLGSLILAVIGALILLWLYRKVAGRPA"
FT   gene            complement(132794..133624)
FT                   /locus_tag="Rmar_0123"
FT   CDS_pept        complement(132794..133624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0123"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   hha:Hhal_2333 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47031"
FT                   /db_xref="GOA:D0MCS1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCS1"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACY47031.1"
FT                   /translation="MQLTYLLLLLGIGLLGGFLAGLVGVGGGIVFAPVLFFYFQAIGVP
FT                   ASVVTPLTLGTSLFCTLLASLSSAWFQYRRQAVVPAVALGAGLFSALAITLTTRYVTTQ
FT                   PWYNGTAFRLVFGLVLLSVALRMLRGEAHNPGTTPTFRLRWPVLAGAGTVAGAVAAAAG
FT                   VGGGIILVPLYHRLLGLPMHRAVGTSSATIVLISLVGILSYALSSPAASPGMPTLGHVD
FT                   VLHGLLLAVPATISARFGVQTAHRLRTVWLRRIFAVLALFIAGRLLLQALSQIW"
FT   sig_peptide     complement(133550..133624)
FT                   /locus_tag="Rmar_0123"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.882) with cleavage site probability 0.261 at
FT                   residue 25"
FT   gene            complement(133624..135285)
FT                   /locus_tag="Rmar_0124"
FT   CDS_pept        complement(133624..135285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0124"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: probable carboxyl-terminal protease; TIGRFAM:
FT                   carboxyl-terminal protease; PFAM: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; SMART: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47032"
FT                   /db_xref="GOA:D0MCS2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCS2"
FT                   /inference="protein motif:TFAM:TIGR00225"
FT                   /protein_id="ACY47032.1"
FT                   /translation="MKTPQRNLTPLLLVLLLGLGIGFVAPRSDTFFALQKHFRIFGALY
FT                   ETLVTDYIDPIDPGRLMRKGIDAMLAELDPYTTFFDEADRGEIELLTRGRYGGVGLNVG
FT                   IRNGRLTVLAPIEGTAGYRQGIRTGDIITHIDGQPTDGLSLETVRQMLRGQPGTTVTLT
FT                   VEREGEPLPLQFVLTREEVQLKNVTYVGFLNDDTTEGLGYIRLERFALGAGEEVRRAIE
FT                   QLQAAGPLRGLVLDLRDNPGGLLEAAVEVAGLFVPQGAPIVSTRGRTPDRTRVYRNESA
FT                   PLYPDLPLVVLVNEFSASASEIVAGAIQDLDRGLIVGTNTYGKGLVQIIRPLPYNTALK
FT                   LTTAAYYTPSGRSIQAIDYSRHDGHGQLVPDSLRRTYYTRNGRVVRDGHGIEPDVVVAP
FT                   PEPGPLEAALRRQAAFFFFANYYVARHPEPPTPDVRVDDRILQEFRAWLNGRNFDYQIA
FT                   AEHTLASLETQLEAADYTQALAALQNVRDALARAKKAAFEREADALRRQLRQELLARYL
FT                   SPEQRLRYLLADDPVVQRAAELLRDTRTYAALLSPN"
FT   sig_peptide     complement(135199..135285)
FT                   /locus_tag="Rmar_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.931) with cleavage site probability 0.553 at
FT                   residue 29"
FT   gene            complement(135292..136071)
FT                   /locus_tag="Rmar_0125"
FT   CDS_pept        complement(135292..136071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0125"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: dds:Ddes_1808 sec-independent protein
FT                   translocase, TatC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47033"
FT                   /db_xref="GOA:D0MCS3"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCS3"
FT                   /inference="protein motif:TFAM:TIGR00945"
FT                   /protein_id="ACY47033.1"
FT                   /translation="MAEMSFLDHLEELRWRLIKGLAGVLASTILCSFFSKWIIDNILLG
FT                   PTRPDFFMYRVFHLDAKPLELLNRTITGQFFAHIGTILFVGVIIGSPVLIYQIWKFIEP
FT                   GLYPHEKQGMRFAAAFATGFFILGVLFGYLVITPLALQFFANYTISEQIVNQFDITKYF
FT                   NMVTMWAFGVGLLFELPVIVYFLAKMGLITGDVLRKGRRYALIVALVLGALFTPPDPIS
FT                   QVLVAIPLLLLYELSIHIATIVSRRREEELRRALYGP"
FT   gene            complement(136203..136811)
FT                   /locus_tag="Rmar_0126"
FT   CDS_pept        complement(136203..136811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0126"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG:
FT                   aba:Acid345_1176 orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47034"
FT                   /db_xref="GOA:D0MCS4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCS4"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ACY47034.1"
FT                   /translation="MAERTLSPSAYADLVDLGRRLYARALVRREQEPITDPRGQPIGWL
FT                   LDTRIPMLEGDTFREVGRVLAERVRARGVRQVAGFGFGAYALVCAILSAPPPPGAPELR
FT                   GGFIREQRKPYGRHRLVEGPLSREEPVVLVDDILNSGRSAARAVALLRSDGFEVCGVLT
FT                   LFNFTWSSGRSRLEAEGLWVDSLLDLNLRDGPRSASDSL"
FT   gene            complement(136898..138205)
FT                   /locus_tag="Rmar_0127"
FT   CDS_pept        complement(136898..138205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0127"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: glycine hydroxymethyltransferase; aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase; KEGG:
FT                   pde:Pden_0920 glycine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47035"
FT                   /db_xref="GOA:D0MCS5"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCS5"
FT                   /inference="protein motif:PRIAM:2.1.2.1"
FT                   /protein_id="ACY47035.1"
FT                   /translation="MSVLEIQDPEVFQAIQKEVERQNNGLELIASENFVSRAVLEAMGS
FT                   PLTNKYAEGLPGKRYYGGCEYVDIVEELARERARKLFRCEWVNVQPHSGAQANAAVYLA
FT                   TLKPGDTFLGLDLAHGGHLTHGSPVNFSGILYHAEYYGVEKDGPLAGRIDMDKVRDKAR
FT                   KVRPRLISIGASAYPRDFDYKAFREIADEVGALLWMDMAHTAGLIAAGVLNDPMPYAHI
FT                   VTTTTHKTLRGPRGGMILIGRDFDNPFGITAPKSGRIKKMSELLDSAVFPGTQGGPLMH
FT                   VIAAKAVAFGEALKPEFKEYARQVVRNARAMAEAFLERGYNLVSGGTDNHLVLIDLRNK
FT                   GLTGREAEALLGEAGITVNKNMVPYDDKSPFVTSGIRIGTPAMTTRGFKEEEFRQVVDW
FT                   IDQVLSHPGDEALRRRIRQEVEALCRQFPLYDFVVA"
FT   gene            complement(138295..138621)
FT                   /locus_tag="Rmar_0128"
FT   CDS_pept        complement(138295..138621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47036"
FT                   /db_xref="InterPro:IPR025578"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCS6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47036.1"
FT                   /translation="MRIGLVLLLTVAGVLYLYNPKPRAFEEYVRNRAAEHLQQELGSSA
FT                   VGRAFADAGADLAAVLARKAARRDNYYLWSIYTVDPDGDDGEKDYWRFLGIGGQFFLIE
FT                   RPVR"
FT   gene            complement(138632..139309)
FT                   /locus_tag="Rmar_0129"
FT   CDS_pept        complement(138632..139309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV0090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47037"
FT                   /db_xref="InterPro:IPR025297"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCS7"
FT                   /inference="similar to AA sequence:KEGG:XCV0090"
FT                   /protein_id="ACY47037.1"
FT                   /translation="MTRTLLLLGVLFAVALPLRAQDDYTFRIAAVKYGGGGDWYQAVSP
FT                   LPNLLRFVREHTNIDVAPQADVVELSSDRIFSYPFLFLTGHGNIVLTDDEARRLRRYLE
FT                   NGGFLYIDDDYGLDPYIRREMKKVFPEQEFVELPFSHPIYHIHFDFPNGLPKIHEHDGK
FT                   PPQGFGLFHNGQLVVFYTYETNISDGWEAPSVHGDPPEKREAALRMGTNILVYALTRLK
FT                   PPT"
FT   sig_peptide     complement(139247..139309)
FT                   /locus_tag="Rmar_0129"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            139449..140510
FT                   /locus_tag="Rmar_0130"
FT   CDS_pept        139449..140510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0130"
FT                   /product="protein of unknown function DUF1028"
FT                   /note="PFAM: protein of unknown function DUF1028; Putative
FT                   peptidoglycan binding; KEGG: bha:BH2194 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47038"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR014927"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCS8"
FT                   /inference="protein motif:PFAM:PF06267"
FT                   /protein_id="ACY47038.1"
FT                   /translation="MRKQAALRLLGVLLGGLALIFVPMHSAGDRTPLVATFSIVGYDPA
FT                   TGELGVAVQSKFPNVRPIVPWARAGVGAVATQSYAELDYALKGLELMANGATAEEALRI
FT                   VLRQDEGRQLRQVGIVDAHGNAASWTGTECFPWAGGRVGQRTGEPAAATPGHVVTGYGY
FT                   TAQGNILVSEETVVAMARAFEETQGPLAERLLAALKAGQEAGGDRRGQQSAALLVVREG
FT                   AGYDGLDNYIDISVYDHPRPIDELIRLYELNKLYFTPGRPEDLIPVTPEIARELQQIWK
FT                   DRGFYDGPINGVVDTTFQRILIDFMGWENYDMRIPAIEAVDLTAGDTLKIDRVMLEHIR
FT                   KVYREGRWVPRRR"
FT   sig_peptide     139449..139535
FT                   /locus_tag="Rmar_0130"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.889) with cleavage site probability 0.878 at
FT                   residue 29"
FT   gene            complement(140529..141065)
FT                   /locus_tag="Rmar_0131"
FT   CDS_pept        complement(140529..141065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47039"
FT                   /db_xref="GOA:D0MCS9"
FT                   /db_xref="InterPro:IPR024461"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCS9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47039.1"
FT                   /translation="MAILTVPKVLREKLGDDGVEALITLLNEAAHHERNNLLGILEERF
FT                   ERRVTEEGARLDKRIAEEVARLEVLLAATEKRLDQRITEEVAKLQQQIAAVDNRITEEV
FT                   AKLQQQIAAVDNRITEEVAKLQQQIAAVDNRITSEMAKMGERIAGVRADLIRWMFIFWV
FT                   GQIGTLIALLFAFLR"
FT   gene            complement(141141..142082)
FT                   /locus_tag="Rmar_0132"
FT   CDS_pept        complement(141141..142082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0132"
FT                   /product="L-lactate dehydrogenase"
FT                   /note="TIGRFAM: L-lactate dehydrogenase; PFAM:
FT                   Lactate/malate dehydrogenase; KEGG: tgr:Tgr7_1919 L-lactate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47040"
FT                   /db_xref="GOA:D0MCT0"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCT0"
FT                   /inference="protein motif:TFAM:TIGR01771"
FT                   /protein_id="ACY47040.1"
FT                   /translation="MRQRRVVGLVGTGHVGVAAAYALFIKGLASELILIDKDARRAEGE
FT                   AMDLMHGQSLVGSMTVRAGTYADLQEAQIVIISAGVAQRPGESRLALLNRNAEVFREII
FT                   GELDRHAPGAILIVATNPVDILTYVAQELSQRPAEHIIGTGTLLDTARFRALLGQYYGV
FT                   DPRSVHAYILGEHGDSEVAIWSQVAIGGQRILDRTVLGRPFDRERMQQIFEEARRAAYA
FT                   IIERKGYTNTAIGVVIARLVEAILDDEKSVLPVSVRLNGEYGIRVVCLSIPCVIGLQGI
FT                   EGRVLPELAPDELEGLRRSAEILQQSLRALSL"
FT   gene            complement(142239..143420)
FT                   /locus_tag="Rmar_0133"
FT   CDS_pept        complement(142239..143420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0133"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aba:Acid345_3984 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47041"
FT                   /db_xref="GOA:D0MCT1"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCT1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47041.1"
FT                   /translation="MNRNRWHMTLRPLRWGLLGLLLFALGCHDEGLLPPEPTGGALFAR
FT                   YVAIGNSITAGYQSGGINATLQQQAYPVLLAKAMGTPFNLPLLRDPGCPPPLVNILTGE
FT                   RLGGLPDDFCAYRQVPLPRIINNVAVPGAKVIDVLTNLGEGTSANTLTLLLLGGRTQLE
FT                   TAAEARPTFVSVWIGNNDVLGAAIAGNPALITPVNTFQQRYTQMLNELQAMGVQGGLLI
FT                   GVANVTVIPHFSPGIAYAQAEQAGAFPPTFDVADNCATTGATALVPFSYAFGELLADAM
FT                   QGQSVTLDCVNDPRLLSPDETNTIVQTVQQYNAFIQQQADRLGWAYLDPNVKLLELKNQ
FT                   GQIPIFPNVNSSEPFGPYFSLDGVHPSSAAHRLVAQEAAAAINAVYGTNLQVQ"
FT   gene            complement(143448..144863)
FT                   /locus_tag="Rmar_0134"
FT   CDS_pept        complement(143448..144863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0134"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: sfu:Sfum_3234 membrane
FT                   protein involved in aromatic hydrocarbon degradation"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47042"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCT2"
FT                   /inference="protein motif:PFAM:PF03349"
FT                   /protein_id="ACY47042.1"
FT                   /translation="MRIATGAVLPRHRKRFLVGLCSLLLSLPALGQGFSLNPPGTCTLG
FT                   RGGTGVAQPCTDGSAVALNPAGLALVNRLAVASGATLYLSRGSFTDDYTEQETRLEEHP
FT                   VLVPHLFAAVQAAPGLSVGFGAYMPYGMELRWPRTFEGSFVSYRTRVQTTYLQPTLAYR
FT                   FSDRVMVGAGPVLAVSTVALWQQLDLSQQEALPGVPFAALGIPVGTSFANVKMESDEAY
FT                   GLGGHVGMLIQVTEQFRIGLRYLSAIKLNYTGTIRFSPLSTGIIIPATVELSGQTIPAG
FT                   TPLDVVLASLGLFGSQGPLADRDAETELTMPAQFAAGFSWQATPDLTLLFDYQWTGWGE
FT                   FERLVIEPEGSDPIVRIQDYRNTHTLRTGLLFQASSILEVRLGYTHAQGAAPSKTVTPL
FT                   LPDANRNLITLGTGWRLGRGVMLDLAYQYVRQDDRRGRVVDPTPGTEPTPALNSGLYQI
FT                   GAHVASVTVSVSL"
FT   sig_peptide     complement(144768..144863)
FT                   /locus_tag="Rmar_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 32"
FT   gene            145023..146033
FT                   /locus_tag="Rmar_0135"
FT   CDS_pept        145023..146033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0135"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="PFAM: D-alanine--D-alanine ligase domain protein;
FT                   protein of unknown function DUF201;
FT                   phosphoribosylglycinamide synthetase; KEGG:
FT                   afw:Anae109_1418 D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47043"
FT                   /db_xref="GOA:D0MCT3"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCT3"
FT                   /inference="protein motif:PRIAM:6.3.2.4"
FT                   /protein_id="ACY47043.1"
FT                   /translation="MHPNGLMRIGIVYDLFDDYPWEVGEPPDADAENEPPETVDVLAAA
FT                   IRKLGHKPVRIGTAYDLLVELPDLRIDCGISIAEGARGRNREAYAPMLFEMAGIPYIGS
FT                   DPLTLSLSLDKAWTKDLVAAAGVPTPPYRTYAGPEDVDPHDLPGPFPLFVKPRYEGSSK
FT                   GITAASKVHSLEALREQVARLTATYRQEVIVEPFIEGSEFTVAVIGNNPPEPLPVLQRA
FT                   VEATTGIGLHALEHRGMKPAAALEAAPYVPLTDELERCLQQLAVRVYEKLQCRDFARLD
FT                   FRVDREGKPWFLEINPLPTFAPDGTFAILAELMQRPYVEFLAEILQRGLRRLGLA"
FT   gene            146068..147258
FT                   /locus_tag="Rmar_0136"
FT   CDS_pept        146068..147258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0136"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number="5.4.3.2"
FT                   /note="KEGG: sfu:Sfum_0711 lysine 2,3-aminomutase YodO
FT                   family protein; TIGRFAM: lysine 2,3-aminomutase YodO family
FT                   protein; PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47044"
FT                   /db_xref="GOA:D0MCT4"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCT4"
FT                   /inference="protein motif:TFAM:TIGR00238"
FT                   /protein_id="ACY47044.1"
FT                   /translation="MACPPFDSSHPEWRDWRWQMRHRIHTAEELSRWIRLTDEERRAIE
FT                   ATRGVFRWNITPYYASLMDPEDPNCPIRRQVVPRLEELAPDLIGVMDPLEEVAHSPVKN
FT                   LIHNYRDRVAFCVTSECAIYCRYCLRKRMVGDAAFMMRKAELQAAIDYIAAHPEIRDVL
FT                   LTGGDPLTLSETHLAWILDQLRAIPHVEIIRIGTRMPVKLPYRITPELCRLLERYHPLW
FT                   INTHFNHPKELTPDAAEAIDRLLRAGIPVGNQTVLLRGINDDVATMKALCEGLVRMRVR
FT                   PYYLYQAQLIGGTAHFRTPIEKGMAIMRALQGRTTGFAIPKYVLDTPYGKVPLDGSYVR
FT                   GRAGDYVIVETPRGVLWAEPNPIPPDEDLPFRLPEIPWPEEVDTIDVEQPLYTGAR"
FT   gene            147344..148663
FT                   /locus_tag="Rmar_0137"
FT   CDS_pept        147344..148663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0137"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47045"
FT                   /db_xref="GOA:D0MCT5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCT5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47045.1"
FT                   /translation="MIRAMLWLLSLIELLLGFTLSQPWLYVAGAALLLVLVVVALVGWL
FT                   RRRRRRKTPPVVIPPPPSSPEEELQSLGILEIRPRPRTRPSESPAPETKPETAASGLTP
FT                   SETASSGPEAPGIPKVAAETPAEKSASRSEEVIPSASEEVRDPVLTPCLDALRAALEAQ
FT                   TVALLVQEDVSLEYRVLGISSVVAGEVPPGWTFTAPVPLLAPSMVDRPVTVREVSGELY
FT                   EALGYYVETPPRVAEMALSPIPFTREGALYFLVADAPEPGRFDRLSASTLLIEFGRLLA
FT                   TVLELQQPRKAAEARAYRPRREIIAEEMTWARSRGEPLALALVHLNRADAIAAEGPVAL
FT                   AAAEQALKAAIQESAPDQRVERFGELTYGVFYRAPVPEVEAWAARLQAQLAEASGWLEG
FT                   GVSIGVAMLQERHQTPEQFRADATEALREAYETGTCTILE"
FT   gene            148738..150162
FT                   /locus_tag="Rmar_0138"
FT   CDS_pept        148738..150162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0138"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: pca:Pcar_0086 TrkH family potassium uptake
FT                   protein; TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47046"
FT                   /db_xref="GOA:D0MCT6"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCT6"
FT                   /inference="protein motif:TFAM:TIGR00933"
FT                   /protein_id="ACY47046.1"
FT                   /translation="MLGLKWSARRSSALLVKQPRRESFWRRLSPPQLFVGSFLLLILLG
FT                   TLGLKTLPGLYTGAPLSWLDALFTATSAVCVTGLIVVDTATYFTVWGQAFILLLIQLGG
FT                   LGIITFTTVLIVALGRRLSLRQQALAASAVEAAPHVDYRQLARDVVRFTFLIEAAGALL
FT                   LYLGFLPELGWRGAFWPAVFHAISAFCNAGFSTFSDSLVGFRTNPVVLPVIMVLIVVGG
FT                   LGFLTLEELYLWRRSIRERRRFRLSLHSRLVLTTTVLLLGVGWVFFVFFEWKATLAALP
FT                   LPAKLLNGLFMSVTARTAGFNTIDYGAATEQTNFLTILLMFVGGSPGSMAGGIKTTTIA
FT                   LLVLLAISRLRGQEVPSCWSRSVPHEVVQRAVGLFVVAVAVLMLGSFVLTATEIEHGVT
FT                   APGSFLKYLFEAYSAFGTVGLSMGVTPSLSTTGRWIIILLMFIGRVGPLTFAAALTIRR
FT                   HRTRQFRYAYEDVVVG"
FT   gene            150159..150815
FT                   /locus_tag="Rmar_0139"
FT   CDS_pept        150159..150815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0139"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: pca:Pcar_0085 K+ transport systems, NAD- binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47047"
FT                   /db_xref="GOA:D0MCT7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCT7"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACY47047.1"
FT                   /translation="MKRFVVIGLGNFGASVAEALYAEGNEVLAIDLDERAVDRIAPHVT
FT                   RAVVCDGRDLETLERLGVREVDVGIISTGDDITASVLSTLVLRDLGVGEIYVKVISRDH
FT                   ARVMNRLGVTETIFPERESALNLASRLSGRALLNYFRIGTGFGIQEMAVPDEWEGKTLR
FT                   QLELRQRYGLSVVAVRDVLSDQIHIPPDPDVPLRDTDTLFVAGKEEDLERVARLK"
FT   sig_peptide     150159..150227
FT                   /locus_tag="Rmar_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.799) with cleavage site probability 0.500 at
FT                   residue 23"
FT   gene            150812..153724
FT                   /locus_tag="Rmar_0140"
FT   CDS_pept        150812..153724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0140"
FT                   /product="WD40 domain protein beta Propeller"
FT                   /note="PFAM: WD40 domain protein beta Propeller; KEGG:
FT                   scl:sce7969 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47048"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCT8"
FT                   /inference="protein motif:PFAM:PF07676"
FT                   /protein_id="ACY47048.1"
FT                   /translation="MNTCAMVRRLGVCLLLGLLAGTARAQCFELLGGGPGGRAWRQLES
FT                   AHFRIVYPASLDSVALRVAAIAEASHTALAAWFGFALQGKPRLYLSNADDIANGLAVPL
FT                   GEGYSCIWIYGHDVDAWTGTTPWLERVVPHELAHLFHYQAVRTRPAWLNLLLGRPLPRF
FT                   WTEGLAQYTTETWDAQRGERWLRTAVLDDALSYEDGRSRWNGRLMYAVGHAQTRWLAWQ
FT                   QGDSTLRRILTHRSRRLGLLPVHDFYTAFRDVTGTSYRSFYERWRRHVNVLYNTMAGQM
FT                   ETPDSLRGDTLAVPVAYVDDLALSPDTTHWAVLGLPSMERPGRTLYVGRPGHWRAVVEG
FT                   DIRPPVAWSPDGRWLAFARRERGPKGGVVYDLWLASADGRTHQQLTRGARAFAPTFAPD
FT                   GRRLAFVSVADGAAHLQVLDLEAGAVRWTKAFPASVRIGTVRWRPDGRALVFDRFVEGR
FT                   RRDLVLWYPETDSLVVLTDGRHDDRGPVWSPEGRHLAFTSLRDGVPNVFVLDTASGKVA
FT                   RVTRLVTGARVLDWLPPSPGFPEGRLAVVVTLSKYGEAVRLVDARRRAVERPVEVPEPY
FT                   RAWMAYVAPSRRMLDTLAVRSVPVSSPEPYRSWANLTHVASLALPYYLGPLGAGVGGFT
FT                   LWLEPLGYHAIAAGGMLSATQPRYSFASVSYLSRRGWGTVGGAVYRLPGAAVPYDNGTL
FT                   VEVQTGGELVLGRAFSAPPYGRQWGSLRLRYRDRRPLWPRHPERLRGLLPPPASGRQLD
FT                   VTLKLRLERRRPYRYNTVHPLDGEGVRFRLLGAVPVLGADLQFARLDVAAYRLWPVMGR
FT                   HRLLTYGRVQLQRGRSLPQDYLGLSRTDAVHLLLPGIEPEVFAPAFHERVRGYRRLAAG
FT                   RTVLFGSVEYRVPLLSDLQTRILGLVRLGATALAAFADGAIVREGMNTERLGAGIELKN
FT                   ALHLGPLVLTHALGWAHPLRPDEPGARRELYYRIRAAVPF"
FT   sig_peptide     150812..150889
FT                   /locus_tag="Rmar_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.995 at
FT                   residue 26"
FT   gene            153816..154937
FT                   /locus_tag="Rmar_0141"
FT   CDS_pept        153816..154937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0141"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   tdn:Suden_0108 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47049"
FT                   /db_xref="GOA:D0MCT9"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCT9"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ACY47049.1"
FT                   /translation="MVLGWLLAWLVLGCGQEKPALPVSESVTEVSADTQHSVLVQLDSL
FT                   QVARLEAALDSLSWEVGRLRQMLEQAGVSEATSAALADTVRAITRQQLADTARQVGYLG
FT                   LRVVWATFVLVLTYFLVRWSVWLLDMMAERRAARRLFFKRLIPVVRLLLWMGAIYYVMG
FT                   GIFGVDREGLLAASAVLGVAVGFAAQDVLKNIFGGILIIFDQPFQVGDKVRIGGTYGEV
FT                   VSIGLRSTRIVTPDDNLVSVPNAQVVEGQVANANAGALDCQVVVDLYLPGWVDVMKAKQ
FT                   IAYQAAASSQYVYLKKPIVVNVRDEFHDMFLLHLIVKAYVLDTRYEFAFASEVTEIAKT
FT                   EFLRQGLLTPMTTRIPWALEGDLHNPSRAPHES"
FT   gene            154927..157977
FT                   /locus_tag="Rmar_0142"
FT   CDS_pept        154927..157977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_2714 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47050"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCU0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47050.1"
FT                   /translation="MNPEIATEASVSFDRVVDDIAAEVAAGWRTWQQAEQRRWAQWEAI
FT                   VQEAAQAHGEALALLEKGDRQGYAALVEAQVLRPLQQAWHAQVLPEGIPPTPSFEALGP
FT                   ERWPEQVRVPVTPELFADEAKGWVGRRLRCRIARRILTLWNRRWPQRPCRRTVPLRLLL
FT                   AFHLEVRVPRAWWPVYEACRTHWARAVGLVEKGLATWQETVRTALPLDAEAAPSAEVLE
FT                   GARALQEVLVAAIQERLPDLSIPEASLAKELVRDLERAGTFLLRRRHRRLPRKKRRYHS
FT                   RWERIESAWQQWFRQAADRAALLAALVQVTCQLRAQQDRLADRLEQAVRMPRARVVEQF
FT                   RSYFDRVQERLAQALAEETDDPERLRQHLQEALTARESLRQQLYQQPDLRQLSTVLEAP
FT                   ARDEWAAVTATVQTLPEQCVLHPAGRTLRPEGPALTIPLRALVLEHLEPPWPEHLEAAS
FT                   LRLRQAVLKSWSALEEVLEIVGYNLEAALDEIRAEAPGGDLRTRLEELALGSLQHAGRR
FT                   LEESTRELEEALGAFREALAEEIRSDWRTLEQRLQAEMAQRAQWKRLRLRLQHQAGQWL
FT                   YLAHQQGKRQWKALQAASRRILRRARQLVRWGQAAIGMGADTGAIDQVRAADVLLSIEE
FT                   VRARLPLVYRRLFTFEPLDDPALFVGFELERRQIAGWYGRWCEGRSSSAVVVTAFPGTG
FT                   MTSMLNVLTATVFAEARVCRLTLQERVRDEAHLAVLLAQALQLPETPDTLERVEAAIGQ
FT                   RFAREKPTVVLLDNLEHVLLCTYNGQQWLERLLILFARTDRHVFWVAGIARPAWFFFER
FT                   TARNAVGLVQLCPLREPDRALLEQAIEARHLRSGLLLRFEPPARPSPVLRQRLRRASTP
FT                   EAQQAILREVFFDRLYQEAGPNWRLALLYWLRSVQVEDGGLRVRPIAALTFDFLEQLSL
FT                   EQAFTLKAFLRHRTLTLEEHQQLFRSTPAQSLFVLESLLNQHLIEPEKKEEAPMEGLQP
FT                   GVRYRLVPFFVQPVRRVLQTRHILYEG"
FT   gene            complement(158042..158881)
FT                   /locus_tag="Rmar_0143"
FT   CDS_pept        complement(158042..158881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0143"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 3 domain protein; sigma-70
FT                   region 2 domain protein; sigma-70 region 1.2; sigma-70
FT                   region 4 domain protein; KEGG: bha:BH1376 RNA polymerase
FT                   sigma factor RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47051"
FT                   /db_xref="GOA:D0MCU1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCU1"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACY47051.1"
FT                   /translation="MYVPRQQRMLDQYLQEIGKIPLLTPEEEVELARRIKQGDEEALHK
FT                   LTRANLRFVVSVAKKYQGQGLSLADLINEGNYGLIKAAQRFDETRGFKFISYAVWWIRQ
FT                   AILQALAEQSRVVRLPLNRIGTISKIRKVSARLAQEHERAPSAEELAEELNIDVEKIRE
FT                   ALQHTGRALSMDAPFTDDDDNSLLDVLPNEEDTSPDEGLMEESLKIDIERALSTLHPRE
FT                   AEIIRLYFGIGREHPLTLEEIGQRFGLTRERVRQIKEKALRKLRQKHRREELQIHVG"
FT   gene            complement(159055..160623)
FT                   /locus_tag="Rmar_0144"
FT   CDS_pept        complement(159055..160623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0144"
FT                   /product="GH3 auxin-responsive promoter"
FT                   /note="PFAM: GH3 auxin-responsive promoter; KEGG:
FT                   afr:AFE_0805 auxin-responsive GH3-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47052"
FT                   /db_xref="InterPro:IPR004993"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCU2"
FT                   /inference="protein motif:PFAM:PF03321"
FT                   /protein_id="ACY47052.1"
FT                   /translation="MRAVRLLPHLLLRHHRRFLEDPAGTQARLLRRLLRRAAHTEWGRR
FT                   YGFAELARARDVVRAYQARVPLHTYDDFRDDVARMRRGKADICWPGRIRHFAVSSGTAS
FT                   EGTLIPVSREMLRADRRFSIEVGLNYLLQSGRPDFLKGRHLTLPGRADEDPRHPGTWAG
FT                   EISGLVARYAPWYVRLCYQAVPDQVLILPNWEEKLRAIARHTVQQDIRLVVMAPTWGLV
FT                   LFKLLLEEASRQRGRPVATVREVWPNLQVFISGGVALSSYRTLLEELIGEPAPDFVETY
FT                   GASEGFFAFQSTLDDPAMLLHLDNGIFYEFVPLEARHRPDPPRHTIATVEPGVRYALYV
FT                   TTCSGLWSYAMRDVVRFTQTDPPRLVVAGRTGEMLDLYGEAVFGDEARAALEEACRQTG
FT                   ARVRDYHIAPRPATRDRLPTHQWLIEFEQPPADLSAFAAAIDAYLQRINRHYQIRREAR
FT                   AFDRPEIVALPAGAFLEWMRRHRKRLSGQSKIPRMRPDRRLADALLAQCANFASSAETL
FT                   PDSSA"
FT   gene            160727..161662
FT                   /locus_tag="Rmar_0145"
FT   CDS_pept        160727..161662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0145"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: esa:ESA_03568 dihydropteroate synthase;
FT                   TIGRFAM: dihydropteroate synthase; PFAM: dihydropteroate
FT                   synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47053"
FT                   /db_xref="GOA:D0MCU3"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCU3"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ACY47053.1"
FT                   /translation="MWQPEAFDTDRFVLNCRGRLLDCRPGLPGGAHVMGILNVTPDSFW
FT                   DGGRYQTVDAALKRVETMLEEGAAIIDVGGESTRPRGRAYGRGAEPVSPDEERRRVLPV
FT                   IEAIAQRFPEAIISVDTYKPEVARDALEAGAHLINDQTGLRLYPEMAEVAARYGAPLVL
FT                   MHSVGRPGEMPHESHYDDVVAEVRQSLAESVARAHAAGVRQVVLDPGFGFGKTAAENLQ
FT                   LINNVDALLSLGYPVLVGISRKSTIGQVLGTPEQPVPPEGRLYGTLGVTAVAVLRGATL
FT                   VRAHDVRPTVEMLRLLAATLAQPRTELHAV"
FT   gene            161678..162487
FT                   /locus_tag="Rmar_0146"
FT   CDS_pept        161678..162487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0146"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; KEGG:
FT                   bsu:BSU01750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47054"
FT                   /db_xref="GOA:D0MCU4"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCU4"
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /protein_id="ACY47054.1"
FT                   /translation="MTLVHWIIPIRLVDLLEIALVAYVLYKLYQLMRGTLAVQIFLGVM
FT                   AIYLLQVIVTALDMTMLRRFFSALSEVAVLAVIILFQPEIRRLLVMVAQTPFLRRFVAA
FT                   PVREEVINEVCAAVAEMSRLRIGGLIAFERSTGLRHYIETGTILNARISRELLLTIFYD
FT                   KNPLHDGAVIIRNQVIAAARCILPVSTSMKLSPHLGLRHRAAVGLTEQTDAFVVVVSEE
FT                   TGTISVAQQGELISNLTAAELCTLLIEALEARPAVEVEEETSVNLQS"
FT   gene            162484..163167
FT                   /locus_tag="Rmar_0147"
FT   CDS_pept        162484..163167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0147"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="KEGG: ppf:Pput_4156 protein-L-isoaspartate O-
FT                   methyltransferase; TIGRFAM: protein-L-isoaspartate O-
FT                   methyltransferase; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O- methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47055"
FT                   /db_xref="GOA:D0MCU5"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCU5"
FT                   /inference="protein motif:TFAM:TIGR00080"
FT                   /protein_id="ACY47055.1"
FT                   /translation="MIEDDPLYRRRRLRLVEALREKGIQDERVLEAIARVPRHLFVEPA
FT                   LRARAYDDVALPIGLKQTISQPFTVAYQTQLLEVRPGDRVLEIGTGSGYQAAILCALGA
FT                   RVFTIERHRPLLERALARLEALGYRVVARCGDGSQGWPAFAPFDGIVVTAGATEVPEAL
FT                   CEQLRVPEGDRPGGRLVIPVGSSHQQRMVRVRCTGPGTYETETLHVFRFVPLVRGSDEA
FT                   RRRQS"
FT   gene            complement(163158..164051)
FT                   /locus_tag="Rmar_0148"
FT   CDS_pept        complement(163158..164051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0148"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM: Shikimate
FT                   dehydrogenase substrate binding domain protein;
FT                   Shikimate/quinate 5-dehydrogenase; KEGG: gsu:GSU1490
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47056"
FT                   /db_xref="GOA:D0MCU6"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCU6"
FT                   /inference="protein motif:TFAM:TIGR00507"
FT                   /protein_id="ACY47056.1"
FT                   /translation="MTPGTDVSIRATTRPIALLGDPVAHSFSPLIHNTGFQTQGLDFVY
FT                   LACRVPKDALPEAIAGLRALGFAGANVTIPHKEAVRPLLDRCTPRAEAIGAVNTIVCRA
FT                   DGSGAVELIGDNTDVEGFLEPLQSLADRLAGAEMVVLGAGGAARAVVYALLTEFRPTRL
FT                   TIVARTPARGEALAADFATYDTRRALQVMAPDEAAPAVRSACLIVNATPVGMHPHVAAS
FT                   PWPHAEDFGPEQIVYDLVYNPVRTRLLREAAARGATTIDGLTMLIGQAAAAYRQWTGRE
FT                   LPREAVQAALKPLFQD"
FT   gene            complement(164051..164824)
FT                   /locus_tag="Rmar_0149"
FT   CDS_pept        complement(164051..164824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0149"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xop:PXO_00038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47057"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCU7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47057.1"
FT                   /translation="MPYLRLRAYGLITALLCLAGSVQAQTPPLTADRPGIGIGTGVVLP
FT                   ETFQIEGGFAYDRAPRFNGYSFGQVLLRYGLNPLVELRVGLQSYRIEDYPRNVELKGVQ
FT                   DPTVGFKVALHDRSGLYVPSAAALFEVRLPVGDRVFRAASVQPTATLALDWPLLPGFSI
FT                   SANGTFTSYWVDSRRFDEGLMTATLNVTLSEALPSGAYFGYAQLFVPGRNQHYLEGGLT
FT                   LLLTPDLQFDVNGGVGLHERETYFIGAGLVRRFRF"
FT   sig_peptide     complement(164750..164824)
FT                   /locus_tag="Rmar_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(164860..165060)
FT                   /locus_tag="Rmar_0150"
FT   CDS_pept        complement(164860..165060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47058"
FT                   /db_xref="GOA:D0MCU8"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCU8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47058.1"
FT                   /translation="MAGFGQLLRNWVIYTLIFLVFGGIGAGVTNLLFEWIVGSSFDPVL
FT                   YAVIFGGTGWIACRQMERRVS"
FT   gene            complement(165127..165837)
FT                   /locus_tag="Rmar_0151"
FT   CDS_pept        complement(165127..165837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0151"
FT                   /product="transcriptional activator, TenA family"
FT                   /note="PFAM: TENA/THI-4 domain protein; KEGG: rce:RC1_1613
FT                   TenA"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47059"
FT                   /db_xref="GOA:D0MCU9"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCU9"
FT                   /inference="protein motif:PFAM:PF03070"
FT                   /protein_id="ACY47059.1"
FT                   /translation="MPDEIKLPEFPLAPPSSLFARLRQAVAADWLAYTQHPFVQQLGEG
FT                   TLPEAAFRHYLVQDYRFLVHFARAWALALVKADTLEDMRHAADTISALLHDEMKLHVRY
FT                   CARWGLSEAELEDAPEARANLAYTRYVLERGFSGDVLDLQVALAPCIVGYAEIGRALHA
FT                   QFAETLPQNPYRDWIETYAGEAYQQVARNAILQLDRLAARRLTEARFPELVETFRQATR
FT                   LEVAFWDMGLTQSF"
FT   gene            165928..166707
FT                   /locus_tag="Rmar_0152"
FT   CDS_pept        165928..166707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0152"
FT                   /product="protein of unknown function DUF152"
FT                   /note="PFAM: protein of unknown function DUF152; KEGG:
FT                   gme:Gmet_3434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47060"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCV0"
FT                   /inference="protein motif:PFAM:PF02578"
FT                   /protein_id="ACY47060.1"
FT                   /translation="MGQTRSTVQVAEAVRWLRPTFAEAFPELIAGFSLRHGGVSAPPFA
FT                   TLNLGLSTGDRPEHVQENRRRLAEAAGFDVERLALAGQVHGAKVRVVETPGLYPGYDGL
FT                   VTTAADLVLGITAADCAAVLLYDPQRRVLGACHAGWRGVVGGIVAATIAAMRELGAQPA
FT                   ALHVYVSPCIGPAHFEVGEEVAARFEPEVVRRRPEWPRPHVDLKQAIVRRLLQEGVPET
FT                   QIEVAPHDTAACTADFFSYRAEGGRTGRMLGFIGRRA"
FT   gene            complement(166713..167348)
FT                   /locus_tag="Rmar_0153"
FT   CDS_pept        complement(166713..167348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0153"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG:
FT                   afw:Anae109_2842 OmpA/MotB domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47061"
FT                   /db_xref="GOA:D0MCV1"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCV1"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ACY47061.1"
FT                   /translation="MKPRSYGVLLLCGLLVSGCATQRALVEQQAAHIAQLQDSLAVLRD
FT                   SLAFYDYIDSGRYDQDMRSLRETVDRLRYELAVCRDGGLRVAVELADDLFAPASATLTD
FT                   RGRRRLDALAERLARFPEHRFRIEGYTDNVPIGDRLKERFPSNWELAAARAATVARYFI
FT                   EAHGLDPERFEVVSYGPTRPIGPNDTPEGRRLNRRVVIRALPPLEEAP"
FT   sig_peptide     complement(167268..167348)
FT                   /locus_tag="Rmar_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.561 at
FT                   residue 27"
FT   gene            complement(167335..168120)
FT                   /locus_tag="Rmar_0154"
FT   CDS_pept        complement(167335..168120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0154"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   cbc:CbuK_1741 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47062"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCV2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY47062.1"
FT                   /translation="MDLRDRIVFITGASSGIGAACAEAFARIGARLLLCARRLDRLEQL
FT                   AEHLRRTYNADVHIFALDVRDAAAVQQAIDNLPENWQAIEVLVNNAGLSRALDPVYANK
FT                   IEDIDLMVDTNVKGLLYVTRAVVPGMLARGRGHVINIGSIAGHEVYPGGTVYCATKHAV
FT                   GAITRGLKLDLHGTPIRVSTVDPGMVGETEFSLVRFDGDAERAARVYEGTRPLTPADVA
FT                   EAVVWCATRPPHVNIAEIILMPTDQSSATLIARRTHEAS"
FT   sig_peptide     complement(168052..168120)
FT                   /locus_tag="Rmar_0154"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.905) with cleavage site probability 0.775 at
FT                   residue 23"
FT   gene            168213..169829
FT                   /locus_tag="Rmar_0155"
FT   CDS_pept        168213..169829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0155"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_02477 regulatory P domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47063"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="InterPro:IPR027589"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCV3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47063.1"
FT                   /translation="MCRQAITGLLGLLLPLAALAQTVQSPLLPVTGQAVACVDGRAAGF
FT                   SCNSVTLLSFLPLAAIDGDFSQDDTTAVEANDIWGWVDPETDRRYALVGLSNGVAVVEV
FT                   TDPVRPRLAAFLPEPSHDHAHKTRPARTAHEGASPWRDIKTYGPYALVVSDNNPGHGLQ
FT                   VFDLRQLQTLSQTPVVLEPVAHYHGFGTAHNVVVNEATGFAYAVGVREHPDSLQHCDYG
FT                   YHAVDVSDPLHPRFAGCFKSSLGGLVGPGYTHDAQCVVYQGPDPDYQGREICIGADETG
FT                   VGILDVTDKANVREIAAIRYPDVGYAHQGWLDEAQRYFYLGDELDELRGLVPRTRTLIF
FT                   DLADLDHPRLAAEYLAATSVIDHNLFVRGNLLFQANYTAGLRVLDISDREHPVETGFFD
FT                   TYPWGDPVKFAGAWGVYPYLPDDVVLVSSIGEGLFVLRPAMTTTASDLIPEASRVGLSV
FT                   PTPHPWRTTTRLWLRVDRPQQVRVRLLDLLGRTVQEVYRGVVEPTQPVRLVLQGALAPG
FT                   LYLIRAEGETFTDVRPVVRVR"
FT   sig_peptide     168213..168275
FT                   /locus_tag="Rmar_0155"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 21"
FT   gene            complement(169831..170724)
FT                   /locus_tag="Rmar_0156"
FT   CDS_pept        complement(169831..170724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0156"
FT                   /product="protein of unknown function DUF368"
FT                   /note="PFAM: protein of unknown function DUF368; KEGG:
FT                   dol:Dole_2007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47064"
FT                   /db_xref="GOA:D0MCV4"
FT                   /db_xref="InterPro:IPR007163"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCV4"
FT                   /inference="protein motif:PFAM:PF04018"
FT                   /protein_id="ACY47064.1"
FT                   /translation="MRLPLRTAIRSFLAGLLMGAADVVPGVSGGTMALVVGIYEQLVAA
FT                   VHQVFQALLLAVRGRLADAWQHFRRIPWGFLVPLVLGIGTAILSAARLILHLLAAYPVQ
FT                   MRGLFFGLITGSLLLPWLRLQQRTLREGLLALGGAVVAFLLVGIPPRVVPDPALWQVFG
FT                   AAAVAICAMILPGVSGAFLLLVLGFYEPTLQALTRHHLPYLLVFALGAATGLGLFSRLL
FT                   HYLIRHHHDATMAVLVGLMAGSLRALWPWIDEMRRLRLPDGSDPVGSVLLLALGGLLFV
FT                   GALTWWERRQPHSVAR"
FT   sig_peptide     complement(170653..170724)
FT                   /locus_tag="Rmar_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.810) with cleavage site probability 0.334 at
FT                   residue 24"
FT   gene            complement(170740..172137)
FT                   /locus_tag="Rmar_0157"
FT   CDS_pept        complement(170740..172137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0157"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_3;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; RNA- processing protein
FT                   HAT helix repeating-containing protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47065"
FT                   /db_xref="GOA:D0MCV5"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCV5"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACY47065.1"
FT                   /translation="MSFFEFGFDDADDALDPSHIEQLVAAYEAQGSSAYFDSDTLEEIA
FT                   TYYYERGRFEDALGVIDRLLALHPTASDAWMRRGILLSHLGRHEEALQAYERALSLNPT
FT                   DTETLVNLGITLDNLGRFEEALQAYERALQIDPLNDEIYYNLGITLERMDRLEEAVQAL
FT                   EEAARLNPDHPEVWYELGFCYDRLGDDERSLACYDRHLELDPYSADAWYNRGIVLNRMG
FT                   RYREAVESYDYAIAIQEDFGSAWYNRGNALTNLGDLRGAIESYEKVLEIEGGDPATYYN
FT                   IALAYEELQEYETAIQYFQLALEEDPAYAEAWYGLGCCYDALERFEEAIACMERAVTLQ
FT                   PETSEFWYAKADCEYNARRLQDALQSYRRVIELDPQNRDAWLDYAETLLEAGYVEEALQ
FT                   AYRQALTLNPDARAYIRQARALLALGRSEEGIRSLKMALRLDPSAKDELPEFYRDASIR
FT                   RQLGLDG"
FT   gene            172344..173006
FT                   /locus_tag="Rmar_0158"
FT   CDS_pept        172344..173006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0158"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="KEGG: glo:Glov_1946 dTMP kinase; TIGRFAM:
FT                   thymidylate kinase; PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47066"
FT                   /db_xref="GOA:D0MCV6"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCV6"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ACY47066.1"
FT                   /translation="MLISFEGIDGCGKSTQARLLAQRLETAGYRTLLVREPGGTELSER
FT                   IRGLLLDPALDIDPFAELLLFSAARRQLVVERIRPALQAGYIVLCDRFYDSTTAYQGGG
FT                   RGVVELAWLRDFNRRVTDGLVPDRTYWLDVPLEVALARRDQAGDPDRMERADPAFFERV
FT                   RATYAQLATEEPDRILRLDATASIETLHETIWNDVQRLLPPTGTRPPGVGSSTDRSG"
FT   gene            173025..173555
FT                   /locus_tag="Rmar_0159"
FT   CDS_pept        173025..173555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0159"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: pca:Pcar_1952
FT                   negative regulator of ferric uptake"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47067"
FT                   /db_xref="GOA:D0MCV7"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCV7"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACY47067.1"
FT                   /translation="MSVSPQQLEEVKNIFRAFLKQRGQRQTPERFAVLEEIYSTSDHVD
FT                   ADELYLRLQQKGARVSRATVYNTLELLLECDLVVKHQFGTNQAKYERAYSYWQHDHLIC
FT                   LDCGELFEFCDPRIQSIQEMVAEIYQFDIRHHALNFYGHCRRENCPNRPAAGREALATA
FT                   RKPEAPAGAKESA"
FT   gene            complement(173559..174338)
FT                   /locus_tag="Rmar_0160"
FT   CDS_pept        complement(173559..174338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47068"
FT                   /db_xref="GOA:D0MCV8"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCV8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47068.1"
FT                   /translation="MEVQTQQNVRLSRRVNGAAGSPHILPAGWRGLSRGQRLWRFIKSI
FT                   YYASTPSWQLLKSGALFFFGFFCWAIGNLLHSYLPGVYWPNLLIIYGALLFWFGPLTHL
FT                   VFVPRLIPWLRRQRHNRMLHWLGGHFTMTMLTLFFSTVVLLSLDPPDFVVLDVRGRLHS
FT                   TTVQAAAEPAAQLPELNCQRTGHQITCTLTHLPATVTRIEVTSGVRRLLELDARTTTFT
FT                   LAEQDLAEVLGQREFRVTLYDTQGRQLREFVRNTAFL"
FT   gene            complement(174357..176069)
FT                   /locus_tag="Rmar_0161"
FT   CDS_pept        complement(174357..176069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0161"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /note="PFAM: cytochrome c oxidase subunit I; KEGG:
FT                   mag:amb2222 heme/copper-type cytochrome/quinol oxidase,
FT                   subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47069"
FT                   /db_xref="GOA:D0MCV9"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCV9"
FT                   /inference="protein motif:PFAM:PF00115"
FT                   /protein_id="ACY47069.1"
FT                   /translation="MAGLLLSGTYDAEGFRTCSVTGLRIHRDVERYVKLFALTAVVALL
FT                   IGGISAIFVALTRWEVIGLADPPAFYKWLSIHAWNLLIFWMVFMEVAILYIGGPLVLGR
FT                   PLPAPRLAGIGYFVMLVAALMINHAIATTEAPDSAPLLTSYAPLPSPPLFYLGVILFIL
FT                   GVIVAALPFFITIWQEKQEYPNRSLPLVSFGAFITSIIALEALLGGLITYIPTFLWRIG
FT                   VVEHIDAAWYRQMYWIIGHGSQQINLAAMITVWYFLTHVVGGAEVVSEKLSRTAFILYL
FT                   FFINMGAAHHLLADPGVHMSWKHWNTSYAVYGAVLASMIHAFAIPAGLEAGRRKRGLGS
FT                   QGLFGWLWSAPWGNPVFSATALGIIMFGFIGGISGVVMGQTQLNLTWHNTLGVPGHFHG
FT                   TVVLGTTLTFMALVYFALPVLFNRDLAFKPLARIQPYFYAVAMGLATIMMIYLGVIYGV
FT                   PRRHPSVMSFPGTDFSFAAASPLFAIFGVAAILAIIAGASFLLVAVGSLLFGKRVENPA
FT                   LVMPPLISGGSDDRPIHEYSMQGTFTLTLIFLAVFAIVYAVNWYLLGRLWAIG"
FT   gene            complement(176073..176612)
FT                   /locus_tag="Rmar_0162"
FT   CDS_pept        complement(176073..176612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0162"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /note="PFAM: cytochrome c oxidase subunit II; KEGG:
FT                   mag:amb2221 heme/copper-type cytochrome/quinol oxidase,
FT                   subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47070"
FT                   /db_xref="GOA:D0MCW0"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCW0"
FT                   /inference="protein motif:PFAM:PF00116"
FT                   /protein_id="ACY47070.1"
FT                   /translation="MSSPLKPLEGNWWGIPANRYEKLWVQISVVWGLILFGWMVGWSFF
FT                   GNQNQHGPTYRIEPATYRAKLAAYREASTATEQGLRPAGEDVYIAAMRYGFDGLPVILK
FT                   AGKTYRLHLTSYDVQHGFSIRPEHALSKQVTFQLLPGYEWVIPMRFDEPGVYHVICNEF
FT                   CGIGHRTMHGIFIVEE"
FT   gene            complement(176609..176767)
FT                   /locus_tag="Rmar_0163"
FT   CDS_pept        complement(176609..176767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mag:amb2220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47071"
FT                   /db_xref="GOA:D0MCW1"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCW1"
FT                   /inference="similar to AA sequence:KEGG:amb2220"
FT                   /protein_id="ACY47071.1"
FT                   /translation="METRPHQQTPWLQQIYDNPWLLAGAAIVFFVLSYIVWGVIDLLTI
FT                   PAGGTTP"
FT   gene            complement(176892..177815)
FT                   /locus_tag="Rmar_0164"
FT   CDS_pept        complement(176892..177815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0164"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: AraC-type transcriptional regulator domain
FT                   protein; helix-turn-helix- domain containing protein AraC
FT                   type; SMART: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: pmy:Pmen_2638 AraC family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47072"
FT                   /db_xref="GOA:D0MCW2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCW2"
FT                   /inference="protein motif:PFAM:PF06719"
FT                   /protein_id="ACY47072.1"
FT                   /translation="MLEHEREALQEQAYREELVERIGRIVPEDGGREPIPGVSFFRASA
FT                   PTELFHRVWEPAFCVIAQGAKEVIVGRRTYRYDPYHYLIATMELPAASHVVEASPEAPY
FT                   LSLRLALDPRTISAVMMEAGYVPSPEGPEVSAFDVSPLRPPLLEAVVRLVRLAETPDEA
FT                   PVLLPLITREIIFRLLQDEQGARLRHLVLLNGQYHRIARAIALIRERFDQPLDIQRLAR
FT                   ELGLSTSALYQHFKAATGMSPLQFQKRLRLQEARRLMLMEGLDASTAGYRVGYNDPAHF
FT                   TRDYKKLFGRPPRQDVRLHARSVPAV"
FT   gene            177990..179033
FT                   /locus_tag="Rmar_0165"
FT   CDS_pept        177990..179033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0165"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   rso:RSc0624 zinc-dependent alcohol dehydrogenase
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47073"
FT                   /db_xref="GOA:D0MCW3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCW3"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACY47073.1"
FT                   /translation="MMRATVLYGPKDVRLEQVPDPKILEPTDAIIRVLVACICGSDLWP
FT                   YRGYDPVPEEGRPMGHEAVGVVEAVGKEVRTVKPGDVVLMPFAISDGSCEFCHEGLTTA
FT                   CVHVGFFGYSPGVGGAQAEAVRIPLADGTLYRVPVSEDDRELLPHLLTLTDVMGTGHHA
FT                   AVTARVGPGKIAAVIGDGAVGLCGVLAARRLGAERIILLGHHPDRLELGRAFGATDVVT
FT                   ERGEAAVERVLELTGGFGAHSVLECVGTEEAVETAVQIARPGGAIGRVGVPHHEGIPAG
FT                   VTFFKNVIVAGGPAPTRAYMPELVPDVLEGRIEPGRVFDLTLPLDRVAEGYRAMDERRA
FT                   IKVMLEP"
FT   gene            179046..179897
FT                   /locus_tag="Rmar_0166"
FT   CDS_pept        179046..179897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0166"
FT                   /product="2,5-didehydrogluconate reductase"
FT                   /EC_number="1.1.1.274"
FT                   /note="PFAM: aldo/keto reductase; KEGG: gur:Gura_4373
FT                   2,5-didehydrogluconate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47074"
FT                   /db_xref="GOA:D0MCW4"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCW4"
FT                   /inference="protein motif:PRIAM:1.1.1.274"
FT                   /protein_id="ACY47074.1"
FT                   /translation="MRKVTLNNGVEMPLLGFGTFQITDLEECERAVAHALQVGYRLIDT
FT                   AAAYQNEEAVGRAIRNSGIAREELFVVTKLWIQDASYDRAKAAFYRSLERLGLDYLDLY
FT                   LIHQPYGDVHGAWRAMEELYREGRVRAIGVSNFYPDRLMDLLLHHEVVPAVNQIETHPF
FT                   FQQRETQRFLEEHGVQHMSWGPFAEGRNNIFQNPVLQALAEKHRKTVAQVILRWLLQRN
FT                   IVAIPKSVHLERIEENFQVFDFELTPADMDTIATLDTGASLFLDHRDPATVQRLCQYRL
FT                   PE"
FT   gene            179932..180939
FT                   /locus_tag="Rmar_0167"
FT   CDS_pept        179932..180939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0167"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: afw:Anae109_3206
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47075"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCW5"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACY47075.1"
FT                   /translation="MKKRKLGNLEVSAIGLGCMNLNFGYGRSVPREEAIALIRKAVELG
FT                   VTFFDTAEVYGPFTNEELVGEALAPFRGEVVIATKFGFRCDGEWTAPPFPVDSRPEQIR
FT                   RAVEGSLRRLRVEAIDLLYQHRVDPNVPIEDVAGTVKELIQEGKVRHWGLSEAGPETLR
FT                   RAHAVCPVTAVQYEYSLWWRKPEEAILPICEELGIGFVPYSPLGKGFLTGAIDERTTFA
FT                   SSDLRSRIPRFTPEARRANMALVELLRTIAGRKGATPAQIALAWLLAQKPWIVPIPGTT
FT                   RLHHLQENIGAVNVELTPEDLQALEEAAARIRIVGERYPEELERTTYVEAPPKR"
FT   gene            180961..181401
FT                   /locus_tag="Rmar_0168"
FT   CDS_pept        180961..181401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rle:RL2357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47076"
FT                   /db_xref="InterPro:IPR016888"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCW6"
FT                   /inference="similar to AA sequence:KEGG:RL2357"
FT                   /protein_id="ACY47076.1"
FT                   /translation="MTTREPLKHRAGRWTKEELTRIATADDLHVAPFREDGVTYGTPTW
FT                   VWCVVVGEAVYARAYHGTRSSWYRAAVRQGAGRVHVAGMVREVIFEPVPEDDPLQAKID
FT                   AAYREKYRRSPYLEPMVSPRARAATVRILPRDEDTNPTLSQP"
FT   gene            181398..181724
FT                   /locus_tag="Rmar_0169"
FT   CDS_pept        181398..181724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47077"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCW7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47077.1"
FT                   /translation="MKRNLYAASRLFGWPVVLLMLWTSVAPAQAQQVPDYIERPDDAAG
FT                   VFAIYPGDGVPPSSEDWTWHEQTVRSPRISFAGPNGLVHNVVIPTLTMFRPAPSTANGR
FT                   VAAP"
FT   sig_peptide     181398..181490
FT                   /locus_tag="Rmar_0169"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 31"
FT   gene            complement(181929..182558)
FT                   /locus_tag="Rmar_0170"
FT   CDS_pept        complement(181929..182558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47078"
FT                   /db_xref="GOA:D0MCW8"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCW8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47078.1"
FT                   /translation="MAFSIISLAISIIALLISVATFWFNHLRKAKPLFVCSRWTAIRMD
FT                   HADGRPRAAFCVHVSVMNKGKVPLELQDLMLAAEVGEEYPIFYEPILLWDLQQWMEDGD
FT                   RPDKVGRTQKGQVPLPVLVPPDTICDFGYLILFLPVDKDRLVSPLEHSNVRLKLYALTD
FT                   RERKYRVVGEQVMVEQDLKPLLDKSFSAVISTASKAKRGLLDSSLK"
FT   sig_peptide     complement(182466..182558)
FT                   /locus_tag="Rmar_0170"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.723) with cleavage site probability 0.496 at
FT                   residue 31"
FT   gene            complement(182662..183378)
FT                   /locus_tag="Rmar_0171"
FT   CDS_pept        complement(182662..183378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47079"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCW9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47079.1"
FT                   /translation="MCFIEQYIIRKNIKESYPRDWDEDFITRSLLKSLRTELPQPTSIH
FT                   LHPYTKPDLRHHKVEVKWDAYKMTGGKENKFGDVAILVVTKYPDGDTIKGVAFLEAKKR
FT                   YKNSSHFRAIDFEQLKRITDNAPRASLLLYDFNIINQYWWPTYIVTVPADLVIATHKKD
FT                   ISLYKFSKPFSAALLNYLLGFDLEHTEKALSIAKGYQTEYGTPLYLMVIRVGIGTEPPS
FT                   DNEVDFNRNYFVRLEE"
FT   gene            183410..183529
FT                   /locus_tag="Rmar_0172"
FT   CDS_pept        183410..183529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47080"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCX0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47080.1"
FT                   /translation="MYMVQSHFNSFVELIYSHFVELFRFCNSQKQLEMQILTN"
FT   gene            183649..183828
FT                   /pseudo
FT                   /locus_tag="Rmar_0173"
FT   gene            183830..184012
FT                   /pseudo
FT                   /locus_tag="Rmar_0174"
FT   gene            184142..184885
FT                   /locus_tag="Rmar_0175"
FT   CDS_pept        184142..184885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47081"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCX1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47081.1"
FT                   /translation="MRVSCELLLLAWRLLVLVGLVWLVQPCGVRAQGLPVRGSVGITNK
FT                   GISFVPAFSLGKPAIAFSNAIGRRLRFEPELRFALEDGRPWSFIFWWRYDLRSDEKWYL
FT                   RVGAHPALSFTTRTVEGEELIVARRFLAGEVAVRYRLTPQVLAGVYYLYAHGLEPSVHR
FT                   HGHFLSVQAGLTFSVHPGWVLGLYPQVYYLRLDERQGFYAATSLTLSPPRTPFSLSVLV
FT                   NKILHTRITGEDWLWNVSLIYRYRM"
FT   gene            185015..185425
FT                   /locus_tag="Rmar_0176"
FT   CDS_pept        185015..185425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47082"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCX2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47082.1"
FT                   /translation="MVRFGLVGLLLACLGAWAFPGAVELAFFRVATEGNDLVVTWQANR
FT                   EDGVQRYELRRRTPASKGQYVLIAQVAPQGVGKPYRYVDRHVYKQPADEVAYQLWVIFT
FT                   DGTARQLAEQAVNYTPTAVRRTWGSIKAMFQK"
FT   sig_peptide     185015..185071
FT                   /locus_tag="Rmar_0176"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.958 at
FT                   residue 19"
FT   gene            185422..185943
FT                   /locus_tag="Rmar_0177"
FT   CDS_pept        185422..185943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0177"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: gur:Gura_1855
FT                   pyrimidine regulatory protein PyrR"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47083"
FT                   /db_xref="GOA:D0MCX3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCX3"
FT                   /inference="protein motif:PRIAM:2.4.2.9"
FT                   /protein_id="ACY47083.1"
FT                   /translation="MKRTRILTPEQVARILDRMAYEVLERNRGGKGLVVFGILQKGVAV
FT                   AEALSTRLAQIEGRDFPVNALDVRPFRDDRPPEAEVEDRSRLHIDTITDRHVLLVDDVL
FT                   FTGRTVRAALDALLRWGRPRSVQLAVLIDRGHREFPIRADYVGRTVPTKYQERIVVVPE
FT                   EGLAVYVEEA"
FT   gene            complement(185951..186730)
FT                   /locus_tag="Rmar_0178"
FT   CDS_pept        complement(185951..186730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0178"
FT                   /product="PASTA domain containing protein"
FT                   /note="PFAM: PASTA domain containing protein; SMART: PASTA
FT                   domain containing protein; KEGG: bha:BH2504
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47084"
FT                   /db_xref="GOA:D0MCX4"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCX4"
FT                   /inference="protein motif:PFAM:PF03793"
FT                   /protein_id="ACY47084.1"
FT                   /translation="MKRLTGLIQLLRNPYLWGGLFALLIATLLVYLVVDQWLMPAYTRH
FT                   GVVQYVPDVRQLPYEQAAQILQAQGLRPERIPVRRFRSDLPVETVLDQTPPPQAAVKPG
FT                   RRVYLTVNAGRNPMVTVPSVIGMSLREAVNRLTALGLRADDLRPDTIPSPYARTVTRQH
FT                   PAPGDSVAEGGTVTLWYSTGLGQRFVTVPDVTGRTVAEAQRILLEHRLRSVVVEPREVT
FT                   ETTGDTTRIVIRQSREPGTQVREGFEIRLFVAPPDTL"
FT   gene            187227..188754
FT                   /locus_tag="Rmar_R0006"
FT   rRNA            187227..188754
FT                   /locus_tag="Rmar_R0006"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            188865..188938
FT                   /locus_tag="Rmar_R0007"
FT                   /note="tRNA-Ile1"
FT   tRNA            188865..188938
FT                   /locus_tag="Rmar_R0007"
FT                   /product="tRNA-Ile"
FT   gene            189010..189085
FT                   /locus_tag="Rmar_R0008"
FT                   /note="tRNA-Ala1"
FT   tRNA            189010..189085
FT                   /locus_tag="Rmar_R0008"
FT                   /product="tRNA-Ala"
FT   gene            189201..192161
FT                   /locus_tag="Rmar_R0009"
FT   rRNA            189201..192161
FT                   /locus_tag="Rmar_R0009"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            192277..192389
FT                   /locus_tag="Rmar_R0010"
FT   rRNA            192277..192389
FT                   /locus_tag="Rmar_R0010"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            192535..194811
FT                   /locus_tag="Rmar_0179"
FT   CDS_pept        192535..194811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0179"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: bcy:Bcer98_0273
FT                   phosphoribosylformylglycinamidine synthase II; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase II; PFAM: AIR
FT                   synthase related protein domain protein; AIR synthase
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47085"
FT                   /db_xref="GOA:D0MCX5"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCX5"
FT                   /inference="protein motif:TFAM:TIGR01736"
FT                   /protein_id="ACY47085.1"
FT                   /translation="MAETLLHEPEVTLELARQHGLTDEEYGWIVEKLGRTPTFTELGIY
FT                   SVMWSEHCSYKNSIAVLKTLPREGPALLVGAGEENAGLVDIGDGLAVAFKIESHNHPSA
FT                   VEPYQGAATGVGGIHRDIFTMGARPICALNSLRFGRLDNLRVRYLLDGVVRGIADYGNA
FT                   FGVPTVAGEVYFDPSYEGNPLVNAMSVGIVRVGQTVSAAARGKGNLVYIVGSATGRDGI
FT                   HGATFASEEITEESEAKRPSVQVGDPFTEKLLLEATLEAIRKGLIVGMQDMGAAGLTCS
FT                   SCEMSARGKSGMVLHLERVPVREPDMTPYEIMLSESQERMLVVCEPEKAAELEEVFRKW
FT                   DLHAACIGEVTDDGRVRVYWHGQLVADVEAEHLVLGGGAPVYYREARRPAYLDETLAFD
FT                   PATLPDVTPETAGDVLLQLLGSPNIASKRWVFEQYDTMVRTNTVVGPGPSDAAVIRIKG
FT                   TRKALAVKVDGNGRYVYLNPRRGGQIAVCEAARNVVCAGGRPVAITNCLNFGNPYKPEV
FT                   YWTFKEAVAGIGDACRALETPVTGGNVSFYNENPQGAIFPTPTIGMLGVLEDVTRATTA
FT                   DFKQAGDHIYLLTPAAWLHRNDLGGSEYLAYVHGITAGDAPHLDLEEEKAVQQALLALI
FT                   EAGLVRSAHDVADGGLAVCLAECVIFSPGLGARVELPGAPEVRLDALLFGEAQSRIVFT
FT                   VAPEHEAEVARLLEGRPVQARRIGTVTDAERLELQVDGRPILNLERAQLVAPYETAIPS
FT                   RMPTV"
FT   gene            194886..195233
FT                   /locus_tag="Rmar_0180"
FT   CDS_pept        194886..195233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0180"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: gbm:Gbem_0404 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47086"
FT                   /db_xref="GOA:D0MCX6"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCX6"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ACY47086.1"
FT                   /translation="MGENVKYVTLTDDNFEQEVLQSDVPVLVDFWAVWCGPCRMIAPII
FT                   EELAAEYEGRAKVGKLDVDHNPRTAMQYGIRSIPTLLFFKNGQVVDQLIGAVPKKVLVE
FT                   KLEALVSAEAA"
FT   gene            195263..196267
FT                   /locus_tag="Rmar_0181"
FT   CDS_pept        195263..196267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0181"
FT                   /product="thioredoxin reductase"
FT                   /note="TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   afw:Anae109_0473 thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47087"
FT                   /db_xref="GOA:D0MCX7"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCX7"
FT                   /inference="protein motif:TFAM:TIGR01292"
FT                   /protein_id="ACY47087.1"
FT                   /translation="MTQPDLSAFEGIDFEGAEHHTLVIIGTGPAGLTAALYAARANLAP
FT                   VVFRGPEPGGQLITTTEVENYPGFPEGILGPELMQRFEQQAARFGADLRYGTVTAVDFS
FT                   RRPFRLLVDDQTPVLADAVIIATGASAKYLGLENERRLIGRGVSACATCDGAFFRGMEV
FT                   AVVGGGDTAMEEALFLTRFATRVYVIHRRDQLRASKIMQERAFKNEKITFIWNTVVEDV
FT                   LGENEVEGVRLRNVKTGEVSVLPVKGLFIAIGHKPNTEVFRGWLEMDEQGYIKTKNCST
FT                   HTNIPGVFACGDVQDRVYRQAVTAAGSGCMAAIDAERWLAEQEHAAASTTVAG"
FT   gene            196264..196827
FT                   /locus_tag="Rmar_0182"
FT   CDS_pept        196264..196827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0182"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; transport-
FT                   associated; SMART: Peptidoglycan-binding LysM; Transport-
FT                   associated and nodulation region; KEGG: rpa:RPA2837
FT                   peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47088"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCX8"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ACY47088.1"
FT                   /translation="MTERRGWIVGLGWTLIVAGCAPSPEHPGASAAEQPHPVEAVDPLP
FT                   SQPLPKASFYIPSDTGTVARHVRDRALAAQVLLALSDVPELRAYLPTVNVQEGRVTLRG
FT                   VVPSEALRQRMAQVAARVPGVEAVLNELEVEAADDATARYHTVGPGETLWDIARRYGLS
FT                   VTELRRLNGLRTATIRPGQRLRVR"
FT   gene            complement(196829..197701)
FT                   /locus_tag="Rmar_0183"
FT   CDS_pept        complement(196829..197701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0183"
FT                   /product="Proline dehydrogenase"
FT                   /note="PFAM: Proline dehydrogenase; KEGG: sus:Acid_2007
FT                   L-proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47089"
FT                   /db_xref="GOA:D0MCX9"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCX9"
FT                   /inference="protein motif:PFAM:PF01619"
FT                   /protein_id="ACY47089.1"
FT                   /translation="MPVKLPFVLARRFVAAESLEGTLPVLRQLCAEGLYVTVDRLGEYV
FT                   HDRQQALATRDAYLGLIDVLANERDAGRLRDANVSLKLSSLGQKIDEAFCLDNLHQLLE
FT                   AARPRDVFIRLDMEGSDLTESTLRIFEQVYPDYPDHVGPVLQAYLKRTARDIARMCELK
FT                   ARVRLCKGAYKEPPEIAYQDMPTIRARFIEYMQRLLLEGRYPGIATHDDVLIEATKRFA
FT                   AEHQIGSDRFEFQMLYGIRPETQRELVRQGYRMRVYVPYGTEWLPYFYRRLRERKENVW
FT                   FVVKNLFRR"
FT   gene            complement(197753..198889)
FT                   /locus_tag="Rmar_0184"
FT   CDS_pept        complement(197753..198889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0184"
FT                   /product="Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="PFAM: Cys/Met metabolism pyridoxal-phosphate-
FT                   dependent protein; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; KEGG: sus:Acid_5643 cystathionine
FT                   gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47090"
FT                   /db_xref="GOA:D0MCY0"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCY0"
FT                   /inference="protein motif:PRIAM:2.5.1.48"
FT                   /protein_id="ACY47090.1"
FT                   /translation="MYHDRIHLETLLAKAGCEPDPATGAVVSPPCLSTTFTRAPDGSYP
FT                   HGYIYSRHDNPTRHQLEDTLARLEGGQACAAFASGMAAATALLQALEPGSHVLIPDDVY
FT                   YGVRNLLENVFTSQGLHYSTADFTDLEAVQAALRPNTRLIWAETPSNPLLKITDLAGLA
FT                   HLAREAEARLVVDSTWAPPPIQRPLDLGADLVLHSLTKYLSGHSDVMGGALIAREADDF
FT                   FARIRMIQQTAGAVLDPFSAWLTLRGLRTLAVRLQRQCENARRLAAFLRDHPRVKRVYY
FT                   PGLPEHPGHEIARRQMRDFGAMLSFEVDGDAAQALAVAARTRVFLRATSLGGTESLIEH
FT                   RASIETPPTRTPPNLLRLSIGLEHVDDLLADLSQALED"
FT   gene            198978..201053
FT                   /locus_tag="Rmar_0185"
FT   CDS_pept        198978..201053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0185"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: ppd:Ppro_2061 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold domain protein; PAS
FT                   fold-4 domain protein; PAS fold-3 domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; PAC
FT                   repeat-containing protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47091"
FT                   /db_xref="GOA:D0MCY1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCY1"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACY47091.1"
FT                   /translation="MQRLLPDYIAHRSTHNRQIYSVLLGGVLLSVGVAVLSWLQGWESV
FT                   GLLVALLVATAAWGTGLWLMGRQRAEVLATYQAFFEHALEGIFQADRKGKLLAVNPALA
FT                   RMLGYEQPEQLQGLHLATDVLAEATEFEHLLLQLEAHGAVRNHYLQLRRRNGEVFWARM
FT                   NIWKREELFEGTVEDVSSLQEAEAALRASEARYQALLEHLPVGVYRSTPDGTIRTANPA
FT                   AARMLGYESVEALLRANARSLYVDPAQREAFLKQLREKGEATAELALRRPDGTIIWVQN
FT                   YARCIVEQDGQVYFDGVLIDITERKQARQALQETEERYRQLLEQLPEPVVVHDGETILY
FT                   ANAAAAAFAGLSSSEELIGKSIYQFLRTEKADAIRRYLEMAVQQGRQLPPMEQQMVRAD
FT                   GAVRDVEIVSALVQYQGRPAFQVVLRDITERKQYERHLLEAKERAEEIARLKSTLLSNI
FT                   SHEIRTPLAGVIGFAEVLEEELDEPHRELAALIRDSGRRLLETLNTLLDLARIEAGAFV
FT                   LTPEPFDAADEVRQSVRIFQRMIDDKGLRLELDLPDAPLPVYLDRNGFHRIVVNLVSNA
FT                   VKFTDEGMIRVGLAAEGDWLRLQVQDTGVGIDPAFMPHLFEEFRQENNGLARTHPGSGL
FT                   GLAITHRLVEMMGGRIEVQSEKGKGTTFTVWLPLRLTNGTKTETTSTTANSTKSNA"
FT   gene            201117..201758
FT                   /locus_tag="Rmar_0186"
FT   CDS_pept        201117..201758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0186"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="KEGG: pae:PA1049 pyridoxamine 5'-phosphate oxidase;
FT                   TIGRFAM: pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN- binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47092"
FT                   /db_xref="GOA:D0MCY2"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCY2"
FT                   /inference="protein motif:TFAM:TIGR00558"
FT                   /protein_id="ACY47092.1"
FT                   /translation="MNPEIARLRREYAGQPLDETQAPDDPLVLFRRWFEEALRAELTDP
FT                   NAMVLATADASGRPSARVMLLKDFDEAGFVFYTNYESRKGRELSENPRAALVFWWAELM
FT                   RQVRIEGRVEKVPAEESDAYFHTRPRESQLGAWASPQSQVIPDRATLERRVAELAQQYD
FT                   GREVPRPPYWGGYRVVPDVIEFWQGRPGRLHDRLRYRRTDQGWVRERLAP"
FT   gene            complement(201770..202216)
FT                   /locus_tag="Rmar_0187"
FT   CDS_pept        complement(201770..202216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47093"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCY3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47093.1"
FT                   /translation="MSTLRFVFFVLLLPIGLLRAQPLADTLFTWQGYGQEGRCRVQLFR
FT                   TPPGTDRAYVVVLQELADNPGPSTVADARYLVERVSRHFGFDPVDAYWIFHWGAFSFPG
FT                   ARASSKELFLRATFSRTTTGRLSAPRWQVITRAEVERLTDRQFR"
FT   sig_peptide     complement(202142..202216)
FT                   /locus_tag="Rmar_0187"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.525 at
FT                   residue 25"
FT   gene            202262..203119
FT                   /locus_tag="Rmar_0188"
FT   CDS_pept        202262..203119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0188"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: tbd:Tbd_2489 3-mercaptopyruvate
FT                   sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47094"
FT                   /db_xref="GOA:D0MCY4"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCY4"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACY47094.1"
FT                   /translation="MAFTTLIDPETLQAHLDDPDWVVVDCRFSLSDPAYGRRAYQDAHI
FT                   PGAVYAHLDEDLSGPIVPGRTGRHPLPDPEQLARKLGAWGIDNRTQVVAYDDAGGAFAA
FT                   RLWWLLGWLGHEAVAVLDGGWPRWVREGRPVRSGVETRPARTFVPRLRPERAVSADEVL
FT                   RHLHDPAWRLLDARAPARYRGEQEPIDPVAGHIPGAVNAPFAENLTPEGTFRPPEQLRQ
FT                   RFEALLGNVPPERVICYCGSGVTAAHNLLSMAHAGLPGARLYAGSWSEWIADPRRPVAR
FT                   GAAP"
FT   gene            complement(203152..203778)
FT                   /locus_tag="Rmar_0189"
FT   CDS_pept        complement(203152..203778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0189"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="KEGG: pca:Pcar_0757 dephospho-CoA kinase; TIGRFAM:
FT                   dephospho-CoA kinase; PFAM: Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47095"
FT                   /db_xref="GOA:D0MCY5"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCY5"
FT                   /inference="protein motif:TFAM:TIGR00152"
FT                   /protein_id="ACY47095.1"
FT                   /translation="MNAPHMRTLGVTGGIGSGKSTVCRLLEALGARVFYADEEAKRLMT
FT                   EDPALRRAIVEAFGPESYLPDGRLNRAYLAEWVFNDPEALRRLNALVHPRVLEAFEQAR
FT                   EQAAREQVPLLVLEAALLFESGADRLVDHVLVVDAPEAERIRRVVARDGVTSEQVRARM
FT                   QHQLPPEELRRRADFVLENTGSLETLRKQVEALYRRLTSVRSDNW"
FT   gene            complement(203775..205736)
FT                   /locus_tag="Rmar_0190"
FT   CDS_pept        complement(203775..205736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47096"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCY6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47096.1"
FT                   /translation="MRFGLLGIGWLLLLSQAAMAQSGWTVRTGFVRDVSRYRWTAGLDL
FT                   MPSVGAWTLHWQQQFVSDAFQYGTDRLDFRDESWTTWTLAPAGDATLQPRLFGQWAWFN
FT                   QSRVLMQQALAGLRYRPRNDLWLEPALGVALDQRPGAGGGLVQPPLQTDYGPALSLQLG
FT                   FRPQTPPGYTLRLEGGGLLQYLTPRRGLTAYVDLLFQRRAEAVDVLLQLRGARFRRDTY
FT                   QAVSFLNRTTAAPPQSVEATWSDTLQGLLAVQLPLHSHLHLRGRLGGEWFRRQVRFLRA
FT                   PDDALFFNTRFDHRQLDGALALLYGQGGLNLELELETGAEEEIRALTNRADLPAAQASQ
FT                   KALLLRQADYARSYLTLSGRSQLEAGRLTVGLRAYATILRHDTPEVNPDDRDELQQQAR
FT                   LDLRYRLTRALQLDLGLEGGYYHLVYLNAVRSAENHVQRTLRLQPGLTWTPAPTTRLWL
FT                   QGEVRAAYTVDDFVLPGRQRQDQSARELGYRLQLEQALSPRLRARFDGSYSELRLGRLL
FT                   WDRFAEIPFDTLRTYTGWLRLETQTARLRSSVGFRVFLRRDFMGGLLIAYTTAEGTPAT
FT                   VNRPGQLWIVQLGPTCGLHWQHGSLTFSLEGWLMLQRLHRRLYGPLPEASADRIREAAW
FT                   NGPRTRIPNLTFSLTWQR"
FT   sig_peptide     complement(205674..205736)
FT                   /locus_tag="Rmar_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            complement(205743..206090)
FT                   /locus_tag="Rmar_0191"
FT   CDS_pept        complement(205743..206090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0191"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47097"
FT                   /db_xref="GOA:D0MCY7"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCY7"
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /protein_id="ACY47097.1"
FT                   /translation="MAEKTLFQRIMDGELPGDIVYEDEQCVVLRDINPQAPVHLLIIPR
FT                   KPIPSLNEVTEEDAPLIGHLFVVARQMAEREGIARTGYRTVFNTGPDAQQSVYHLHLHL
FT                   LGGRKFTWPPG"
FT   gene            206250..206666
FT                   /locus_tag="Rmar_0192"
FT   CDS_pept        206250..206666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0192"
FT                   /product="6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein"
FT                   /note="PFAM: 6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein; KEGG: Pts;
FT                   6-pyruvoyl-tetrahydropterin synthase; K01737 6-pyruvoyl
FT                   tetrahydrobiopterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47098"
FT                   /db_xref="GOA:D0MCY8"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCY8"
FT                   /inference="protein motif:PFAM:PF01242"
FT                   /protein_id="ACY47098.1"
FT                   /translation="MPTVYVTRRVHFNAAHRLHNPARSEAWNRETFGPCNHPNWHGHNY
FT                   VLEVTVAGEPDPETGFVLNLSHLKEILETRILQKLDHKNLNLDVDFLQGVIPTTENLAV
FT                   AIWRELEDALPAGRLHRIRLYETEHNYVEYYGEE"
FT   gene            206653..207315
FT                   /locus_tag="Rmar_0193"
FT   CDS_pept        206653..207315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0193"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="KEGG: aba:Acid345_2208 GTP cyclohydrolase; TIGRFAM:
FT                   GTP cyclohydrolase I; PFAM: GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47099"
FT                   /db_xref="GOA:D0MCY9"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCY9"
FT                   /inference="protein motif:TFAM:TIGR00063"
FT                   /protein_id="ACY47099.1"
FT                   /translation="MAKNKSTGVLVRSGAHLELDSHPIDHYERVDRYPAEATEAIQQHV
FT                   REILRWIGEDPDREGLRRTPERVALALQYLTQGYHQDPRAILEAALFEEDYSEMILVRD
FT                   IQIYSLCEHHLLPFFGKAHVAYIPNKKIVGLSKIPRVVDVFARRLQVQERLTIQIRDAL
FT                   EEVLQPLGVAVVIEAQHLCMMMRGVEKQHAITTTSAMSGEFLKEATRAEFMRLINGG"
FT   gene            207320..208021
FT                   /locus_tag="Rmar_0194"
FT   CDS_pept        207320..208021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0194"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: aba:Acid345_2206 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47100"
FT                   /db_xref="GOA:D0MCZ0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCZ0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY47100.1"
FT                   /translation="MLVVVITGASQGIGAAIARAFAEEPQARLALVARQQHKLEAVAAD
FT                   CRARGADVLVLPCDVTDEAAVAAMARQVLDRWGAPDVLVNNAGQFRPAPLRETSVETFR
FT                   AQLEANLTSAFLVTQAFLEAMIARRQGHIFFMGSVASIRAYPGSVAYCAAKHGLLGLAR
FT                   VVREETRTLGLRVTVLLPGATYTPSWEGVDLPEERFMPAEDIARTVRALYHLSPRTVAE
FT                   EIVLRPQEGDI"
FT   sig_peptide     207320..207388
FT                   /locus_tag="Rmar_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.801) with cleavage site probability 0.795 at
FT                   residue 23"
FT   gene            complement(208022..209383)
FT                   /locus_tag="Rmar_0195"
FT   CDS_pept        complement(208022..209383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0195"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /note="TIGRFAM: nicotinate phosphoribosyltransferase; PFAM:
FT                   Nicotinate phosphoribosyltransferase-like; Quinolinate
FT                   phosphoribosyl transferase; KEGG: tgr:Tgr7_0122 nicotinate
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47101"
FT                   /db_xref="GOA:D0MCZ1"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCZ1"
FT                   /inference="protein motif:TFAM:TIGR01513"
FT                   /protein_id="ACY47101.1"
FT                   /translation="MHWVTDENAVLFTDLYELTMLQAYYREGLDTAVATFDLFVRQTPG
FT                   RNYLLACGLDTVLHYLETLHFTQEALDYLASLGRFEPDFLDYLARFRFTGDVYAVPEGT
FT                   PVFAGEPLLQVVAPIGQAQLIETFVLNQITFQTGIASKASRVVQAAQGRLVADFGARRM
FT                   HGADAALKAVRAYYIAGIQATSLVLGGQMFGVPVTGTMAHSYVEAHPTEEDAFRAFAGL
FT                   YPGTTLLVDTYDTLEGVRKVIALCKEQGDRFQVGAIRIDSGDLAALAKEARRMLDEAGL
FT                   THIKIFASGSLDEYRIAELLAQGAPIDGFGVGTRMGTISDRPYLDSAYKLSEFEGEGRM
FT                   KLSLEKANLPGRKQVFRFYGEDGRATHDVIACHDEQLEGGEPLLHCVMRGGRRTEAGRD
FT                   TLEAARERARQDLARLPERLLALEEADPPYPVHISERLQTLGEAVRHRLMQQET"
FT   gene            209583..210680
FT                   /locus_tag="Rmar_0196"
FT   CDS_pept        209583..210680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0196"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: mag:amb2980 hypothetical protein; TIGRFAM: PAS
FT                   sensor protein; PFAM: response regulator receiver; PAS
FT                   fold-4 domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47102"
FT                   /db_xref="GOA:D0MCZ2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCZ2"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACY47102.1"
FT                   /translation="MRRAARLILISGEEGLKAQLSSWLERAGVQVCERFPSLQALITHW
FT                   HALEADPPDLVLVDLNLPDYQGLDAFAEVKVRAINIPVVALIDRSEAMLGPHLLQMGAA
FT                   DYLLRDALSAPLLEHVVQRAWERQQVQNNLSEYLQELYASEARFRAILQHYPDGLLILD
FT                   AEGRILMANDEAQQLLGYAEAHLVGQPLEAFVREEAPGFARLTGTSDPIRLQVIPCEED
FT                   DPCRLVLLRPLTESERQEMAASTAAQTLAEIILEVLDEAVLVADGEGRVVYANQAAAAL
FT                   MGKPHRQLTGRPLNGMLTTLMPGERFDRMMSWLELHGGTWQGIRRLESRSGSVQTFQVQ
FT                   LRLLSEPIFGMVIVLRPVVGEVPIG"
FT   gene            complement(210691..211242)
FT                   /locus_tag="Rmar_0197"
FT   CDS_pept        complement(210691..211242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0197"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   mxa:MXAN_2022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47103"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCZ3"
FT                   /inference="protein motif:PFAM:PF02622"
FT                   /protein_id="ACY47103.1"
FT                   /translation="MESPTLRPGILLIAPPMLEDPNFWRTVVLLCAHGEDGSFGLILNR
FT                   PTTLTLREVLDVPVSYPLFVGGPVQPDTLHILHRLGDEIPEAQPVVNGVYWGGEVEALL
FT                   DRLRTNPPEPDEMRFFLGYSGWAPGQLEAEYEAGGWILAPAHAANVFEDTPEKLWRTVL
FT                   RRMGGEYALLANFPDDPRLN"
FT   gene            complement(211251..211790)
FT                   /locus_tag="Rmar_0198"
FT   CDS_pept        complement(211251..211790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47104"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCZ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47104.1"
FT                   /translation="MKLRLKVANADKRRNGSAEALALRGRFPIFPEKTALRMGRVIRTG
FT                   DTPASRRHQYLRSCAEVLHLLAKRAHFDDEARDMVAFFVFNLRGIAQTIEESAQSWENR
FT                   GYWRKAESLRENWRWTRTAADELERLIRQDRWEAIPSVLLRLMPHFQHITVASITRNAD
FT                   WWCGALKALLRSTTRS"
FT   gene            211811..212785
FT                   /locus_tag="Rmar_0199"
FT   CDS_pept        211811..212785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0199"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: cps:CPS_4920
FT                   aldo/keto reductase family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47105"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCZ5"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACY47105.1"
FT                   /translation="MQTYRIPHTDLEVSRIAYGCMHLGGPWEAETLSDEVRRRAAEAVQ
FT                   TALEVGINLFDHADIYSRGKSEAVFGELLKAGLVRRDEIVLQTKCGIRFKDDPPGTPQR
FT                   YDFSYEHIVRSVEGSLRRLQTDYVDLLLLHRPDPLMEPEEVARAFDELHRSGKVRYFGV
FT                   SNHTAAQMALLARYVDQPLVVNQLELSLLHAYLIEDGIVANHDNAPAYAGVTGLLDYCR
FT                   LHDVLVQAWSPLGGGRLLDPPVEADGRTLRAAEAVARMAEAQQVPREAIALAWLLRHPA
FT                   PIQPIIGTLRPERIRACARADTVALSREAWYALLTAARGERVP"
FT   gene            complement(212789..215080)
FT                   /locus_tag="Rmar_0200"
FT   CDS_pept        complement(212789..215080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47106"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47106.1"
FT                   /translation="MYRILAGLVLLFCVPALAQHLQPLSPRPEPDSYILHVTDRLNRRP
FT                   EARQALEDFHRRKALGLPPATPTIQAPPQVGDRQTFKVYNFETETTESREFELRVIEDR
FT                   FYLWVEVASLDSGWVTDEKLEALRAALADATPAGSINPNQGIIANDEDVFGDPPDVDGD
FT                   GKTDVLLVDVRDGWDPESGGGFVAGFVYSGDLSPLGDGNNKDILYLDTNPSLSTNRPIE
FT                   SLLSTAAHEYQHLIHFNYDLDEISFVNEGLSEWAEVMNGYGRRAMSYLSDVSRYNVPIF
FT                   RWSQDNVNVLDDYERAGLFTTYLEDRIGWEAVGAIARDPSHGYLAYENALVPRGLSFYQ
FT                   VLLDFHTANFLNDRAVQAAYGYSRPDFQNVGAAPSVVYNGRIATQTPNTTVLLWGGGVL
FT                   YLVWQHVKDLQVALSGPSLAIRALQYPEGGGIVVSDLNPSASPFSFTGVHDQVVLIVTR
FT                   TATSGSSQVTYSATWRSDQTFTSQIIQFDNGQVLQPFVLSDGLELLTRFENPQPGYTLL
FT                   GRVFLPLHFYSQFSNGPPRTAPRDFTLTVRTANPDGTPGPVLFEKIFDDPRPYQQVSSL
FT                   IIQFVEIDLFPYAAQIGDLPDTLFIGYRDAGTDTNSVVLATSSYAIENRSFIGPIQGSW
FT                   RALWETTLNDGTSLNGRIIPIRLEFLVGSEPVPAEPVAKLPRELALEPPYPNPFRTTVR
FT                   LRYHLPETGLVRLRVYDLLGRPVATLVDGPQPAGTHTVRLDASGWASGLYLCVLEASGQ
FT                   RRIQRLQVVR"
FT   sig_peptide     complement(215024..215080)
FT                   /locus_tag="Rmar_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.992 at
FT                   residue 19"
FT   gene            215174..215488
FT                   /locus_tag="Rmar_0201"
FT   CDS_pept        215174..215488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47107"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCZ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47107.1"
FT                   /translation="MRCYGLLLLSMLFVIGCATQPPPAQPPIVVEGEVVSRGQAPFAAL
FT                   VLETAAHNYYLLVFENEADRQAVAAEAPVRLRVEGTPYLDRWQGIPYTHLRVHRWERLR
FT                   "
FT   sig_peptide     215174..215233
FT                   /locus_tag="Rmar_0201"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.690) with cleavage site probability 0.504 at
FT                   residue 20"
FT   gene            complement(215480..217096)
FT                   /locus_tag="Rmar_0202"
FT   CDS_pept        complement(215480..217096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0202"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; virulence
FT                   factor MVIN family protein; KEGG: mca:MCA1772
FT                   polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47108"
FT                   /db_xref="GOA:D0MCZ8"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCZ8"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ACY47108.1"
FT                   /translation="MPAGRLRQLASETAIYGLSSILARLLNFLLFPFYSHVFAPNAYGV
FT                   ISIVYTAFLFFNIVYQYGMESAYLRFAVEADEDGRRRVFSTAVGSLLGTSLVLSALIVL
FT                   FPAPVAALIDLEARYRWLLYYMAVILVLDTLAVVPFAELRLRNRAWRFALIRLAGVAVN
FT                   IGLNVLLLVGLHLGVAGVFMANAAASATTLLLLTPEFLRLWRPMFDAGLWRRLLRFGLP
FT                   FLPGGLGYAITDRINLLFLKRMTPEQVRRLYADRFDLEALAREAERAARAVLERAGGAL
FT                   TPEVQQRMAEAAQAVYGNHVVGVYNGVLKLAIFLMLVVQMFRFAWQPFFLQHARDPDAP
FT                   QLFARVFSLLTAVSLLVLLSVSFFAAEIVRLPLPGGYALINPRYWTGLFIVPVALLGYV
FT                   FQGWYYVFSVGAYLRHRTALFIPATLAGAAVALLFNALLVPRLGMLGAAWATTLAYVTM
FT                   ALVLWRLTRPHYAVPYRWGQVLALGAWSALLFGAWHTWPALQRPLFELLLLVGWAAALP
FT                   VLRVVTPAELRTLLQRRSPSA"
FT   gene            complement(217103..217612)
FT                   /locus_tag="Rmar_0203"
FT   CDS_pept        complement(217103..217612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_1443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47109"
FT                   /db_xref="GOA:D0MCZ9"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCZ9"
FT                   /inference="similar to AA sequence:KEGG:Dde_1443"
FT                   /protein_id="ACY47109.1"
FT                   /translation="MANYRGHLAGATAFFAVYLAGLFYVFSIDAAYTRFTLLELVAYPL
FT                   ALFGLCLMFALWPDVDTNSLGQTLFYWIFFLVDVVLIATRHFQEAAYLGLFAILPVLGK
FT                   HRGWTHTWWAMLLIPSPLLLLPYLFFPERPLYGLPFYGAAVVGYLSHLVLDGVLFRFRR
FT                   RRRAYR"
FT   gene            complement(217616..218059)
FT                   /locus_tag="Rmar_0204"
FT   CDS_pept        complement(217616..218059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0204"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: azo:azo0865 3-dehydroquinate dehydratase;
FT                   TIGRFAM: 3-dehydroquinate dehydratase, type II; PFAM:
FT                   dehydroquinase class II"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47110"
FT                   /db_xref="GOA:D0MD00"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:D0MD00"
FT                   /inference="protein motif:TFAM:TIGR01088"
FT                   /protein_id="ACY47110.1"
FT                   /translation="MKILVLNGPNLNLLGKREPAIYGRITLQQLEKMLREAFPEVTLEF
FT                   VQSNHEGELIDQLHRAEAEHFDGVVFNPGGYTHTSVAIRDAVAAISVPVVEVHLSNLHA
FT                   REPFRQHSLTAAVCEGQIVGLGATGYRLAIQYLIERARQKPKR"
FT   gene            complement(218133..218945)
FT                   /locus_tag="Rmar_0205"
FT   CDS_pept        complement(218133..218945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0205"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   pca:Pcar_0199 phosphonate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47111"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D0MD01"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACY47111.1"
FT                   /translation="MSRSTDTLRVTLLGTGTSTGVPVIGCTCRVCRSSDPRDKRTRCAC
FT                   YIEANGLGILIDTGPDFRQQALREGIRRLDAVLYTHHHFDHVAGIDDLRPFFFENDRAI
FT                   PCYAPPNTARVLYRMYAYIFADGTYPGVPRLRLHAVEGPFEVTSRYGDGGRVRVEPIEV
FT                   LHGELPMYGYRIGRFAYLTDASRIPETSYERLRDLDVLVLDALRERPHPTHFSIEEAVR
FT                   VARRIGARQTYFIHMTHDVLHAEVDARLPEGINLAYDGLQFTCRLTTS"
FT   gene            complement(218929..219252)
FT                   /locus_tag="Rmar_0206"
FT   CDS_pept        complement(218929..219252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47112"
FT                   /db_xref="UniProtKB/TrEMBL:D0MD02"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47112.1"
FT                   /translation="MARSRDNRHAATRRLVDELIAVARQLGLEVRVESGPFRGGYCVKQ
FT                   GDELVVLNRRHPPEVHLALLAEALRTRPLDTLYLKPAVRRALEEAWDRSSPSTDAVLDV
FT                   ALD"
FT   gene            complement(219258..221072)
FT                   /locus_tag="Rmar_0207"
FT   CDS_pept        complement(219258..221072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0207"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; KEGG:
FT                   dol:Dole_0098 ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47113"
FT                   /db_xref="GOA:D0MD03"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="UniProtKB/TrEMBL:D0MD03"
FT                   /inference="protein motif:TFAM:TIGR00757"
FT                   /protein_id="ACY47113.1"
FT                   /translation="MAKEIIINAEKDQTRIAIVEDGTLAEFYIEDPEHERTIGNIYLAR
FT                   VCRVMPSIQAAFVDIGQQQDAFLHFSDIAPSLPLQLKFLADPQPSVRKLAAEIEQHHQS
FT                   LARRRHPRPHRADKSEASDEDETTEAAASSRRRRLDARLRGRRRSAQRRLQRKTAAETT
FT                   TTEAEAAPHADVSPETLLKRDQPLLVKIIKEPISSKGSRVSTDISLAGRFLVLVPFANY
FT                   VAVSKKITSYKERRRLRALARSLLPEGFGVIVRTVAEGQTAKALDTDLRLLLEKWERIE
FT                   KKLAEHPKPPVLLHEDVNMVSSVIRDLFSEDCTRILVDNPRLHRNIRSYVQAVAPHKVE
FT                   VVQLYRGKEHIFKATGIAEQVAQAFESRVDLPSGGYLYIEHTEAMHVIDVNSGRAGRGL
FT                   SQEENSLRVNLEAARVIAQQVRVRDLGGIIVIDFIDLKDEKNKKKVYDELKKEFRKDRA
FT                   VTKILPMSDFGLVQITRQRLRPSLTTTFDKMAERLAREKILPPAPSQPTPEALLEAMER
FT                   WLQAYRHAGGRRNVTLRVHPFTAAYLTRRVPTYPTRWLLKHLVRVRLESDPNQPPLSFR
FT                   FEDPATGEDLTERFTIFQNGQHPEKISA"
FT   gene            221619..222029
FT                   /locus_tag="Rmar_0208"
FT   CDS_pept        221619..222029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0208"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="TIGRFAM: succinate dehydrogenase, cytochrome b556
FT                   subunit; PFAM: succinate dehydrogenase cytochrome b
FT                   subunit; KEGG: bpt:Bpet0401 succinate dehydrogenase
FT                   cytochrome b-556 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47114"
FT                   /db_xref="GOA:D0MD04"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="InterPro:IPR039023"
FT                   /db_xref="UniProtKB/TrEMBL:D0MD04"
FT                   /inference="protein motif:TFAM:TIGR02970"
FT                   /protein_id="ACY47114.1"
FT                   /translation="MAVETVEPEVRHVRRLQRYRIRTGMLAWLLHRLTGIGLVVYLILH
FT                   VWGLRALTDREAFNELIATYHAPIFKIGEFLLLAAVAYHALNGLRIVLIDFLGWHPHSK
FT                   KLFWTLAVVCLLIIGVGGYPSLYAVITYLTGS"
FT   gene            222051..222554
FT                   /locus_tag="Rmar_0209"
FT   CDS_pept        222051..222554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47115"
FT                   /db_xref="GOA:D0MD05"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:D0MD05"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47115.1"
FT                   /translation="MAIQYGKTSRSYATNWFLHRITGTFLVFLLITHFWVQHYDAQTAS
FT                   VAAQVLSSEQIEAGALPDYPEAAKEAVRARYGPDAEVTPYDVVMLRLADPVYAVLWKGF
FT                   NILFLIFALHHGFYGLNNILTDYIRNPIGRVLAQTLSWTLALALLIVGLYSIIVAGWGY
FT                   VPAS"
FT   gene            222592..224331
FT                   /locus_tag="Rmar_0210"
FT   CDS_pept        222592..224331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0210"
FT                   /product="succinate dehydrogenase or fumarate reductase,
FT                   flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="KEGG: sfu:Sfum_2104 succinate dehydrogenase,
FT                   flavoprotein subunit; TIGRFAM: succinate dehydrogenase or
FT                   fumarate reductase, flavoprotein subunit; succinate
FT                   dehydrogenase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47116"
FT                   /db_xref="GOA:D0MD06"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D0MD06"
FT                   /inference="protein motif:TFAM:TIGR01812"
FT                   /protein_id="ACY47116.1"
FT                   /translation="MIFSHDVVIVGAGGSGLMAALYAKEGGADVAVISKLHPLRSHTGA
FT                   AQGGIGAALGNEEEDHWLWHAFDTVKGSDYLGDQDAIEIMCQDAPRTIIELEHYGVPFS
FT                   RNKEGKIAQRRFGGHTRNFGEAPVRRTCHAADRTGHAILHTLYDQCVKNQVRFYDEFQA
FT                   LDLIMTPDGVCCGVVAYELLTGEIHIFHAKMVCLATGGYGRVYKTTSNAHASTGDGMAI
FT                   VLRSGLPLEDMEFVQFHPTGLYRLGILVTEGARGEGGILLNDKGERFMERYAPTVKDLA
FT                   PRDLVSRAIYREIREGRGINGKDYVYLDLRHVGREVIETKLPEIATFSRTYLGIDPVKE
FT                   PIPVAPTCHYAMGGIPTSYDGQVERAGRGSIVPGLYAVGECACVSVHGANRLGSNSLVD
FT                   LVVFGRRAGIHMAETLRKEGRKKEPLPENPDRRVREMLEDILSRTQGEPVAVVRADLQQ
FT                   TMMDNVSVFRTEETLNTALEDLKQIRERAQRVVIRDKSKRFNTELMDAVELGFLVDLAE
FT                   VITRSALNRTESRGAHSREDYPKRDDENWLKHTLIYREGEGEYRFDYKPVTITRFQPQE
FT                   RKY"
FT   sig_peptide     222592..222663
FT                   /locus_tag="Rmar_0210"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.826) with cleavage site probability 0.802 at
FT                   residue 24"
FT   gene            224381..225097
FT                   /locus_tag="Rmar_0211"
FT   CDS_pept        224381..225097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0211"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; KEGG: sfu:Sfum_2103
FT                   succinate dehydrogenase and fumarate reductase iron-sulfur
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47117"
FT                   /db_xref="GOA:D0MD07"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D0MD07"
FT                   /inference="protein motif:TFAM:TIGR00384"
FT                   /protein_id="ACY47117.1"
FT                   /translation="MKVKVKIKRFNPETDAEPHWETYEVDADPMDSALSLLLHIKWHID
FT                   GSLTFRKSCGHGVCGSDAMKINGENRLACSVLVRDLVKGEGDTITFEPLPTAPVVKDLV
FT                   IDQSRFFEKYRAVKPWLITRTPPPERERLQSPEEFALIDDATKCIMCGACTHACPSTWA
FT                   DPDYLGPAALLKAYRYTFDSRDEGAEERLPVVDSREGLWKCYTIFNCNEACPKEIDISR
FT                   WLSALKRRAVMEVAAR"
FT   gene            complement(225098..225541)
FT                   /locus_tag="Rmar_0212"
FT   CDS_pept        complement(225098..225541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0212"
FT                   /product="AIG2 family protein"
FT                   /note="PFAM: AIG2 family protein; KEGG: pca:Pcar_0180
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47118"
FT                   /db_xref="GOA:D0MD08"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:D0MD08"
FT                   /inference="protein motif:PFAM:PF06094"
FT                   /protein_id="ACY47118.1"
FT                   /translation="MSRTWHPPACTPVTLLFVYGTLRGQIRRFLPATLHHAVHLLGPAR
FT                   YRGRLYDLGAYPGAVPDPDHFVHGELYALRCDDAPRIFTYLDAYEDCDPQRPEAGEYRR
FT                   VQDTVLLPDGRALSAWIYLYNGDLSRARPIPSGDWLCHRGQPR"
FT   gene            complement(225538..226440)
FT                   /locus_tag="Rmar_0213"
FT   CDS_pept        complement(225538..226440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0213"
FT                   /product="Gas vesicle synthesis GvpLGvpF"
FT                   /note="PFAM: Gas vesicle synthesis GvpLGvpF; KEGG:
FT                   mxa:MXAN_2772 gas vesicle protein, GvpL/GvpF family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47119"
FT                   /db_xref="GOA:D0MD09"
FT                   /db_xref="InterPro:IPR009430"
FT                   /db_xref="UniProtKB/TrEMBL:D0MD09"
FT                   /inference="protein motif:PFAM:PF06386"
FT                   /protein_id="ACY47119.1"
FT                   /translation="MRMNPEKPALRWHFPEEEILQLTEASRQEALAQARAWLKQWWLEA
FT                   ILQQIGRYLEPIPAPEEQVYYVYGVTWAGLSVQGPEPLEAIPFRNLQALVRRVPAHEYG
FT                   LDVIRQRLQDTEWVREQLRAHHRLLAALQLEGPLLPLRFGTICPEKAHVEALLEANYED
FT                   FCATLALLHGRQEWTLRLGADRARLKEAIALVHGTRPDDPSLEAEADRLLQMAAEHCHQ
FT                   TLSALADRSEIHQLDVRQRPVLRAAYLVATDQADAFRNRVASLQRAYQTLGIRLQLEGP
FT                   SPPFNFARLHLEETPAAAI"
FT   gene            complement(226424..226942)
FT                   /locus_tag="Rmar_0214"
FT   CDS_pept        complement(226424..226942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0214"
FT                   /product="translation initiation factor IF-2"
FT                   /note="KEGG: gbe:GbCGDNIH1_2392 translation initiation
FT                   factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47120"
FT                   /db_xref="GOA:D0MD10"
FT                   /db_xref="UniProtKB/TrEMBL:D0MD10"
FT                   /inference="similar to AA sequence:KEGG:GbCGDNIH1_2392"
FT                   /protein_id="ACY47120.1"
FT                   /translation="MHDEQIRRLIEQFRARFLELSSEEIQRLIEEAKAEALAEARAIIK
FT                   EQMLEAILEQSARLQTRSAAAQPASSAAAPTSSPRQPEPAQRSPFETPRVTLVSRPETP
FT                   PAPEKKTSRPSPEPATVEAAEQNGAEIDGARKILREIENLRQQLSANEEWLKRAGGSGP
FT                   GASDYADES"
FT   gene            complement(227087..229288)
FT                   /locus_tag="Rmar_0215"
FT   CDS_pept        complement(227087..229288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0215"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic;
FT                   Peptidoglycan-binding LysM; SMART: Peptidoglycan-binding
FT                   LysM; KEGG: mxa:MXAN_5690 transglycosylase, Slt family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47121"
FT                   /db_xref="GOA:D0MD11"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D0MD11"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ACY47121.1"
FT                   /translation="MRAAVLRGLFLLLLAWSLVGTGRAQDTRRIAPPLPLERLQAYPSE
FT                   EIPFARRVRLLGAGLAGLLPPADSLSEAELLEYLARLYDQQARILKAEADGDLDQAAQL
FT                   LDEALEALAALSRQPGIEADVRFRELYRSLLVEYEQLYGTPPDTLTLSYGDIFAFREAM
FT                   FAAMETVREPLLEDVFTPNLTVPASSVPLTMNRLVKASMDYLLREPEKHLLRWLSRAET
FT                   YFPMIEQIFEEEGVPDELKYLAMIESGLNPYARSRAGAVGMWQFMAGTARLYNLNITPW
FT                   VDERRDPEKSTRAAARHLKDLYAMFGDWHLALAAYNAGAGRVQRALNQARMRHGTGQLT
FT                   FWDIYPYLPRETRNYVPMFIAAALVASNPAALNLTVEPGPRYEYDYVPVQGMLSLEEIA
FT                   HLAGTDVATLRALNPELRQNTLPPSRGPYFIRLPLGSYARFAEAYARLPEDRKRPVTTY
FT                   TVRRGDALSIIARRFGVSVSALMRANGLHSTVIRPGQRLIVPVPHYESTNALQLAEAKP
FT                   VSVQYGSRAVRPLYSTQPIPPTAPATTAQPTALETSSEERNEPSRETTSATTESRTPEA
FT                   PTRVVYTVRRGDALSEIAQKYGVSVADIKRWNNLSGNTIRVGQELVLYLSEPVTPERVV
FT                   YTVRRGDTLSEIAQRFGVSVTAIKRWNNLDDNTIQIGQRLTIYPEAGTTQGYTIYHVRP
FT                   GDTLSEIAQRFGVSVRDIQRWNGLRSSRIYPGQRLKIFS"
FT   sig_peptide     complement(229214..229288)
FT                   /locus_tag="Rmar_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.971 at
FT                   residue 25"
FT   gene            complement(229346..230530)
FT                   /locus_tag="Rmar_0216"
FT   CDS_pept        complement(229346..230530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47122"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDC9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47122.1"
FT                   /translation="MTEFVRLLYRQLQATLPPTRAYSIQELRRLGLPDALVHHLQHQAI
FT                   ARAETMLPVLDDTWFDTEAPDIQEAYQQLRNRLRSHVRIPASVWPELLGESLQALAGYL
FT                   VQPIRTLTAHVFAEADSVPADEALRRMHWFQPYAYFREAVALYVEEKQVAHLERERFES
FT                   LLVRVDRELTADFDAEAWVRLLRPLYELAALLPERPVVLPASLLIAFFTEKQQPDLVQR
FT                   LQAEGTALLTAEALERLLAGKELSAPGTAPVAEEEAEALPLWRRFQLQQAGAGEARSAN
FT                   EAAALPRWMQFYQQPPAEQMPAPPTAELEREVLGETGLRNRELFITHLFNGDRSAYLRV
FT                   LRLLRDTPTWAEASQLIAREVFRRYQVNIYSEPAVAFTDAVERRYRKNQASPLQ"
FT   gene            complement(230578..231492)
FT                   /locus_tag="Rmar_0217"
FT   CDS_pept        complement(230578..231492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0217"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: hypothetical protein; K00767 nicotinate-
FT                   nucleotide pyrophosphorylase (carboxylating); TIGRFAM:
FT                   nicotinate-nucleotide pyrophosphorylase; PFAM: Quinolinate
FT                   phosphoribosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47123"
FT                   /db_xref="GOA:D0MDD0"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDD0"
FT                   /inference="protein motif:TFAM:TIGR00078"
FT                   /protein_id="ACY47123.1"
FT                   /translation="MSAAPITSTDWPPYLDEATLDRLIRQWLAEDIGPGDVTTEATVPP
FT                   ERQARGLFLAKANGVVAGLQVAARVFQLVDPDVHVRWHQADGSRVTAGTIFGTVEGRAR
FT                   SLLMAERLALNLLQRMSGIATATRRLVERVRPYGTKVLDTRKTAPGLRLLDKWAVRLGG
FT                   GTNHRLGLYDMILIKDNHIVAAGGIREAIEAARRYREQHRLDIPIEIEAQSLEDVDAIL
FT                   ATGGVDWILLDNFARHLPDGTLDVEPLREAVRRIGGRFHTEASGNITLETAEAIAATGV
FT                   EAISCGALTHSVQALDLSLELTL"
FT   gene            complement(231499..231936)
FT                   /locus_tag="Rmar_0218"
FT   CDS_pept        complement(231499..231936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0218"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   lip:LI0724 thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47124"
FT                   /db_xref="GOA:D0MDD1"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDD1"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACY47124.1"
FT                   /translation="MIRHVYQHRVRYRECDPMGMVYHAHYVDYLEAARTEALRDLGLPY
FT                   RELEASGIIMPVVDLSLRFHRPAYYDELLDVITMIRELPRARLHLDYEVRRHETQELLA
FT                   TGRVTLCFVDRARNRPVRAPQALLDVLQKALEPSLSPDGQR"
FT   gene            complement(231933..232964)
FT                   /locus_tag="Rmar_0219"
FT   CDS_pept        complement(231933..232964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0219"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="KEGG: gme:Gmet_1216 acetyl-coenzyme A carboxylase
FT                   carboxyl transferase subunit alpha; TIGRFAM: acetyl-CoA
FT                   carboxylase, carboxyl transferase, alpha subunit; PFAM:
FT                   acetyl-CoA carboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47125"
FT                   /db_xref="GOA:D0MDD2"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDD2"
FT                   /inference="protein motif:TFAM:TIGR00513"
FT                   /protein_id="ACY47125.1"
FT                   /translation="MARNSSQYLLDFEKPIAELEEKLDEMRALMAENPEVDLSAEISAL
FT                   EARVAALRESVYRNLTRWQRVQIARHPDRPYTLDYIGALSEGFVELHGDRCAGDDPAIV
FT                   GGFATFQGSRFGYRDRTVLFVGHQKGRDTKSRKYRRFGMPNPEGYRKALRLMKLAAKFG
FT                   KPVVTMLDTPGAYPGIEAEEHGQAEAIARNLFEMARLPVPIVVVVIGEGASGGALGIGV
FT                   GDRILMLENAWYSVIAPESCSQILWRSWDYKEEAARALKLTAADLLKLGVIDEIIPEPI
FT                   GGAHRDPEATFQAVGAAIARALQELEGLEPRALIDARIEKFARMGVYREEPEATPSTET
FT                   GAS"
FT   gene            complement(232973..235090)
FT                   /locus_tag="Rmar_0220"
FT   CDS_pept        complement(232973..235090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0220"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   noc:Noc_2168 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47126"
FT                   /db_xref="GOA:D0MDD3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDD3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACY47126.1"
FT                   /translation="MSCASSISAPADPVTPESCDLSVIIVNYNVRDLLEQALRSVFRAA
FT                   DGLELEVFVVDNNSVDGSVEMVRAHFPEVHLIANTENVGFSRANNQAIRRARGRYLLLL
FT                   NPDTIVQEDTLRAMVDFLDAHPEVGAAGCKILNPDGSFAPESRRSFPTPAVAFYRMVGL
FT                   SRLFPHSRRFGRYNLTYLSPEVETEVDALSGSCMFVRHAALYFSRMAYERLCREGLGPT
FT                   AHLLPNGLQPDGGAGLLDEDFFMYGEDLDWCYRIQQAGWKIVYTPRTQIIHYKGESTKK
FT                   GELRYVRLFYGAMLRFVEKHFRDRYSPTFLTLLRLGIALRAGLSALHRGARRLAPLVID
FT                   GLLTALIVTLGGWLRSLAAGRPLAALFLLSVVPAYALSTVAGIALMGGYRRGRIWQLRP
FT                   VFYGTLIGLLFMGTLSFLVPDIAFSRMVVLLSAPFALAALLGWRLVWRRRHAARLQRAL
FT                   LVGPTDEARRLHRLLEAAPWPSFQLIGYVSPEPDGTDQETPPRLGALHHLRDLVRLRQV
FT                   DAVIFATAGLSHTTVLQLIQQLRDLPVQFKILPEGRPHVIGKAHIETLEPPSLVDAEAA
FT                   LPTLRSLPLGRALECGLALVGLILRPLLKGMARLSARPGLRQLVRRLDGLPDVLRGRRT
FT                   LVGCHPDECALLPEGWGIRPGLFAVSEARPTPPRTPEDIRQLYAYYMQQRTAWLELRLL
FT                   LQAIRRLLQTT"
FT   gene            235440..236075
FT                   /locus_tag="Rmar_0221"
FT   CDS_pept        235440..236075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0221"
FT                   /product="cytochrome c family protein"
FT                   /note="KEGG: scl:sce7584 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47127"
FT                   /db_xref="GOA:D0MDD4"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR029467"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR039118"
FT                   /db_xref="PDB:6F0K"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDD4"
FT                   /inference="similar to AA sequence:KEGG:sce7584"
FT                   /protein_id="ACY47127.1"
FT                   /translation="MPQIFSRKTNRLPALSLAGSVFGGVLAVFLVWYYFSPEFYEVGYA
FT                   PPYSHRIHVGKLGLDCRYCHNWVEVSDKANIPPTQTCINCHSQILTDSPRLQAVRDSWA
FT                   TDRSIEWVKVHHLPDYAHFSHASHVNNGVGCETCHGRIDQMDVVRLVEPLSMGWCLECH
FT                   RQPELYLRPQSEITTMGYQPPADYIERNLERIRKEGIRPPTNCSACHY"
FT   sig_peptide     235440..235523
FT                   /locus_tag="Rmar_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.741 at
FT                   residue 28"
FT   gene            236133..239252
FT                   /locus_tag="Rmar_0222"
FT   CDS_pept        236133..239252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0222"
FT                   /product="Fe-S-cluster-containing hydrogenase"
FT                   /note="KEGG: aba:Acid345_3003 Fe-S-cluster-containing
FT                   hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47128"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR030948"
FT                   /db_xref="PDB:6F0K"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDD5"
FT                   /inference="similar to AA sequence:KEGG:Acid345_3003"
FT                   /protein_id="ACY47128.1"
FT                   /translation="MIELPVVNPDGAETPGSGKRLWRSTADLRRDPEWVKLAHDEFMPG
FT                   VAEPPSGTSRRQFLQIMGASMALAGLTACRRPVEKILPYVRQPEEIIPGIPLYYATAMP
FT                   FRGSVRPLLVESHEGRPTKIEGNPDHPLSRGATGVFEQASLLNLYDPDRSQQVLRKGEP
FT                   ASWGDFVQFARSLAAEAGTKRLAVLCEPSSSPTLAALRRELERRYAQVRWVTYRPEGDD
FT                   HEALGLQQAFGRPVRARYRFSEARVIVSLDADFLGPTDRNFVENTREFAASRRMERPED
FT                   EISRLYVIESTYTVTGGMADHRLRLRAGDIPAFAAALAAELGVGELREAGARFAGHPYV
FT                   VEIARDLRAAGARGVVLAGETQPPAVHALCAVINDLLGSLGRTVILHALDEPATAQHAA
FT                   LAELVQAMQAGAVDALLLLNVNPVYDAPAALGFAEALAQVPEVIHLGLHVDETARRSTW
FT                   HLPSTHYLEAWGDGRAYDGTLSVIQPLIAPLYEAAHSPLEVLALLATGEEQSAYDLVRN
FT                   TWRRLLAGRGAFEQAWQRVLHDGFLPDSGYPTVSLRPNRQALADWPQAAEGGLEVVFRL
FT                   DPTVLDGSFANNAWAQELPDPITKIVWDNVAILSPKTAAALGVKAEYHKGVYIADVIEL
FT                   SLDGRAVELPVWVLPGHPDDSITVYLGYGREITSTRPERKTPFFDLDDYTDIYGHGAIA
FT                   TGVGVNVAPLRRPDNTWVAYGAQVRKTGRTYKIVTTQDHGSMVGRPLVRLATVEEFRKN
FT                   PDFAKEAEPPLEGLEPWDQYPTLWEENHPSKQPAFQDSDYYRNQWAMVIDLNACTGCNA
FT                   CIVACDSENNIPMVGKNEVGRGREMHWLRIDRYFVSDEAHADDPQIVVQPVPCMHCENA
FT                   PCESVCPVAATVHSPDGLNEMVYNRCIGTRYCSNNCPYKVRRFNWFNWVKTLPIQVQMA
FT                   QNPDVTVRFRGVMEKCTYCVQRIREAQRQANIEKRPLRDGEVKTACQQACPAEAITFGD
FT                   LNDPNNAVVKQRQNARRYEMLAALNVKPRTSYLARITNPNPRLLEQEPVA"
FT   gene            239281..240735
FT                   /locus_tag="Rmar_0223"
FT   CDS_pept        239281..240735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0223"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG: scl:sce7586
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47129"
FT                   /db_xref="GOA:D0MDD6"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="PDB:6F0K"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDD6"
FT                   /inference="protein motif:PFAM:PF03916"
FT                   /protein_id="ACY47129.1"
FT                   /translation="MAHATKDLSALARTDEEVLVQGGLTFHDITELVAQHTEKKTPKAW
FT                   WAAFSVAFLGMLTLVAMLAYQVWNGVGVWGNNIPVGWGWPIVNFVFWVGIGHAGTLISA
FT                   ILFLFRQRWRTSINRAAEAMTIFAVICALIFPTFHVGRVWAIYWTLPIPNQMEMWPQFK
FT                   SPLLWDVFAVSSYFIVSLVFWYVGLIPDLATLRDRAALMGRRLRAKILGFFALGWCGAN
FT                   RHWRNYEKVYMLLAGLATPLVLSVHSVVSFDFAVSIIPGWHTTIFPPYFVAGAIFSGFA
FT                   MVVTLMVIARKAYGLENVITIDHLEKMNIIMLVTGTMVGFAYITEFFIAWYSGVPYEQY
FT                   AFINRATGPYAWAYWTMMSCNLIFPQFFWIKKLRRNIPFMFIASIVVNIGMWFERFVIT
FT                   ITSLHRDYLPSSWDYFVPTWVDVLTLIGSFGLFFTLFLLFLRFVPMVAIAEVKGVLPEA
FT                   DPHFYETHGDGHSRPAEVQVNRGRSS"
FT   gene            240752..241405
FT                   /locus_tag="Rmar_0224"
FT   CDS_pept        240752..241405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce7587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47130"
FT                   /db_xref="GOA:D0MDD7"
FT                   /db_xref="InterPro:IPR021776"
FT                   /db_xref="PDB:6F0K"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDD7"
FT                   /inference="similar to AA sequence:KEGG:sce7587"
FT                   /protein_id="ACY47130.1"
FT                   /translation="MLKELLRSLKASMGIYEARDGSIYGLLAEFSDPAALLHAARQVRK
FT                   AGYRHFDAHSPFPIHGMDEAMGLGNSKVAFITFFTGTIAGFALAWWMQWWMGAVDYPLN
FT                   ISGKPFFALPPSVPIIFELTILFSALAGVATMLALNGLPRPYNPLFYSKNFMRVTDDGF
FT                   FLFVAASDPKFDPTATRQLLEQLGGYNIEVIEDRGEEDVTPATAPAAEAAVTTS"
FT   gene            241412..242041
FT                   /locus_tag="Rmar_0225"
FT   CDS_pept        241412..242041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0225"
FT                   /product="quinol:cytochrome c oxidoreductase monoheme
FT                   cytochrome subunit"
FT                   /note="KEGG: scl:sce7588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47131"
FT                   /db_xref="GOA:D0MDD8"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="PDB:6F0K"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDD8"
FT                   /inference="similar to AA sequence:KEGG:sce7588"
FT                   /protein_id="ACY47131.1"
FT                   /translation="MQNITAMPRTIWTGLLLGLLLAGCRGMISSKPPVHPNLNMDFQEK
FT                   FEAQELNPFFADRRAMRPPVPGTVPRGLLKEDTPFYFGKTADGAYVERIPVAVTPELVA
FT                   RGRERYNIYCAVCHGQAGDGQGIIMRGNYGYTPAPSFHDDRLRNVEDGYIFDVISHGVR
FT                   NMPAYGHQIPVADRWAIVAYVRALQRSQHATAADVPEEVRARLQGE"
FT   sig_peptide     241412..241504
FT                   /locus_tag="Rmar_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.629) with cleavage site probability 0.615 at
FT                   residue 31"
FT   gene            242073..243326
FT                   /locus_tag="Rmar_0226"
FT   CDS_pept        242073..243326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce7589 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47132"
FT                   /db_xref="GOA:D0MDD9"
FT                   /db_xref="PDB:6F0K"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDD9"
FT                   /inference="similar to AA sequence:KEGG:sce7589"
FT                   /protein_id="ACY47132.1"
FT                   /translation="MAEVKANGFPGWLLDPLRPTREKAEPRYRLPEDVRIWAVPLAIGV
FT                   GLLIVSLVGWAIDARQFYFSYLVGWTFCLTLALGSLFFVMIQHLTRAQWVVAVRRLPEA
FT                   LVWTFPVLIVLFIPILFGLHDLYHWTHHELYDPSSPEYDPILAGKHAYLNVPFFLVRIA
FT                   FYFFIWTLLAYKLYTLSVRQDVDPDPSIPAQQRKVSAWGMPLYGVTVAFASYDFLMSLD
FT                   PHWYSTIFGVYFFAGSFFVALGFITTCYAILVRRGTLQGIVRAPHFQDLGKLMFGFTAF
FT                   WAYIAFSQYMLIWYGNLPEETLWYRHRLEHGWEVLSQVLIWGHFVLPFLILLPWAAKRT
FT                   PVLVGTMGIWFAIIHWIDLFWVAMPVLHTEHMTFHWLDVTCWLGLFGVVVGLFFYRISR
FT                   HSLVPQNDPYLARSLALH"
FT   gene            243406..243798
FT                   /locus_tag="Rmar_0227"
FT   CDS_pept        243406..243798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47133"
FT                   /db_xref="GOA:D0MDE0"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDE0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47133.1"
FT                   /translation="MAEQEKKQPAVAEAELPAVQPDEANFEAPRLYRMIWITVVLLAVI
FT                   SVGLVVLTQWQMQQNAEVAAATARYPLREETEAHARQLLEGYGVVDAEQGVYRVPIDRA
FT                   MEEIVEAYGGDSVWTLPQPSAVSRRM"
FT   gene            243817..244650
FT                   /locus_tag="Rmar_0228"
FT   CDS_pept        243817..244650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0228"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="KEGG: sus:Acid_0496 electron transport protein
FT                   SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47134"
FT                   /db_xref="GOA:D0MDE1"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDE1"
FT                   /inference="similar to AA sequence:KEGG:Acid_0496"
FT                   /protein_id="ACY47134.1"
FT                   /translation="MRWWGKGWWLLSLVCLLAFPAQAQRSGQQLAVFEGVGIEEQLGER
FT                   IPLDLTFRDEAGQPVTLRTFFDGRRPVLLTLVYHDCPMLCNLVLDGLAKSLRQMAWTPG
FT                   EQFEVLAVSFNHRETPELARRKKAHYVDMLGRPDAAAGLHFLTGDSTTIRALTDAVGFS
FT                   FRWVPEKQQFAHPAVLIFLSGEGKISRYLYGLEHDPGDVRKALVEASEGKVGTVVDQVL
FT                   LYCFQYDPSENSYVANAYNIMRLGGAVTVVLLGITLFLFWRRERRRQQETLQTAG"
FT   sig_peptide     243817..243888
FT                   /locus_tag="Rmar_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            244676..245626
FT                   /locus_tag="Rmar_0229"
FT   CDS_pept        244676..245626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0229"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="TIGRFAM: cytochrome c oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; cytochrome C oxidase
FT                   subunit II transmembrane region; cytochrome c class I;
FT                   KEGG: scl:sce7592 putative cytochrome-c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47135"
FT                   /db_xref="GOA:D0MDE2"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDE2"
FT                   /inference="protein motif:TFAM:TIGR02866"
FT                   /protein_id="ACY47135.1"
FT                   /translation="MSGMILLQNTAWLPEAASSIAPEVDSLFHFWTLVSAIIFIGVVGA
FT                   MTFFVVRYRRRRRDEVPEPVQEKKVVELAWIVVPTILVLIVFAWGFRVYIKMYTAPPDA
FT                   YEILVHGYQWYWEFEYPNGVKTTNELHVPAGQPVKLRMTSADVIHSFYVPAFRVKQDVL
FT                   PDRYSALWFEATKPGEYTVFCTEYCGTQHAGMLAKVIVHPREEFEQWLESAGIPEDMPL
FT                   AELGARLYREKACFSCHSIDGSRLVGPSFKGLYGSTRTFEDGTTAVADENYLRESILQP
FT                   GAKIVQGYPNVMPASYASLSEREVAALIEFIKQQQ"
FT   gene            245643..247340
FT                   /locus_tag="Rmar_0230"
FT   CDS_pept        245643..247340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0230"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: scl:sce7593 putative cytochrome-c oxidase;
FT                   TIGRFAM: cytochrome c oxidase, subunit I; PFAM: cytochrome
FT                   c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47136"
FT                   /db_xref="GOA:D0MDE3"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDE3"
FT                   /inference="protein motif:TFAM:TIGR02891"
FT                   /protein_id="ACY47136.1"
FT                   /translation="MATQTVATATTGQPEIHYLNHAKGLKSWLLTLDHKRIGLLYLISV
FT                   VFFFIVGGILALLIRAELFEPGQTLMTAETYNHIFTLHGAVMIFLFLIPAVPAVLGNFA
FT                   LPIMIGAKDVAFPRLNLASWYIFWLGALTMLVGIVTSGLDTGWTFYTPYSTMTSSGVTW
FT                   VALGVFILGFSSILTGLNFIVTVHKMRAPGLTWSRLPLFVWGLYATSIVQILATPVLGI
FT                   TVLLLALERIMKIGIFDPALGGDPILFQHFFWFYSHPAVYIMILPAFGVISELIGTFSR
FT                   KGIFGYKFVALSSVAIAFLGFLVWGHHMFVSGQSATAATVFSLLTFLIGVPTGVKVLNW
FT                   VASLYRGSIWLRTPLLYALAFLFVFPIGGFTGIALGTLGLDVPLHDTYFVVAHFHYVMV
FT                   SGGLLAFLGGLHYWWPKMFGRLYNEKLAQIAALLIFVGFNVTFFPQFILGTQGMPRRYF
FT                   DYVPEFTTLHQLSTVGSWILGLGLLLVAVCLLHSLFKGQPAPANPWGAATLEWTHTGRL
FT                   PSPHNFERTPVVTRGPYDYHLAEEIFGNGHGDGSGTPAVIPAQRQAQS"
FT   gene            247381..248061
FT                   /locus_tag="Rmar_0231"
FT   CDS_pept        247381..248061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0231"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   scl:sce7594 putative cytochrome-c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47137"
FT                   /db_xref="GOA:D0MDE4"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDE4"
FT                   /inference="protein motif:PFAM:PF00510"
FT                   /protein_id="ACY47137.1"
FT                   /translation="MAGVPEAATGHAEAHAHHPPYLQHHFVSAEQQFDAAKLGMWLFLV
FT                   TEILLFSGMFVAYAVYRVWHPEVFQAASKLLDWRLGGLNTLVLLASSYTVALAVHYAQL
FT                   GDKKRLVQNLWLTVALAGVFMVVKYFEYSEKFHHHIFPGGNYAYEGLQLPYVGQFFSIY
FT                   FVMTGIHGLHVLVGMGVLTWIALRAQRGDFSSEYYTPVEISALYWHLVDIIWIFLFPLL
FT                   YLIH"
FT   gene            248080..248448
FT                   /locus_tag="Rmar_0232"
FT   CDS_pept        248080..248448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0232"
FT                   /product="caa(3)-type oxidase, subunit IV"
FT                   /note="TIGRFAM: caa(3)-type oxidase, subunit IV; KEGG:
FT                   sus:Acid_0500 caa(3)-type oxidase, subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47138"
FT                   /db_xref="GOA:D0MDE5"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR011743"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDE5"
FT                   /inference="protein motif:TFAM:TIGR02229"
FT                   /protein_id="ACY47138.1"
FT                   /translation="MAHATHHIIPRPLLLKVFLTLVALTIITALTGQADLGAFSFLHVP
FT                   LAIGIAVIKAALVVLFFMGLKYDRPINALAFVIGLLMVGVFLAFTLLDVFYRGDIGNLS
FT                   PEPIRGPQVEQVEAPAGH"
FT   sig_peptide     248080..248184
FT                   /locus_tag="Rmar_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.905) with cleavage site probability 0.844 at
FT                   residue 35"
FT   gene            248489..248848
FT                   /locus_tag="Rmar_0233"
FT   CDS_pept        248489..248848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47139"
FT                   /db_xref="GOA:D0MDE6"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDE6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47139.1"
FT                   /translation="MADAFFVDPDRRPGVSMENQGEAMYLLPALVFVPILFFMLVWAVV
FT                   TAGRILFPERPLPFDREFSLRGWTMRPRYRAPVHVAAPRATTMPHVAQAVYHFEEGHSD
FT                   GLPEVWVDDLWLRRN"
FT   gene            248919..249875
FT                   /locus_tag="Rmar_0234"
FT   CDS_pept        248919..249875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0234"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="KEGG: hypothetical protein; TIGRFAM:
FT                   5,10-methylenetetrahydrofolate reductase; PFAM:
FT                   methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47140"
FT                   /db_xref="GOA:D0MDE7"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDE7"
FT                   /inference="protein motif:TFAM:TIGR00676"
FT                   /protein_id="ACY47140.1"
FT                   /translation="MKVVEILEQATGPLISYEIIPPRRGGSLDEVLAVVEELMPFDPPF
FT                   IDVTSHAAEVEYEQLPDGTLRPRVKRKRPGTIGICAAIKSRFGVETVPHLLCRGFTREE
FT                   TEDALIELHYLGIQNVMALRGDSPNYQKPIPPDRTVNEYAVDLVRQIANMNRGIYLEPL
FT                   EDAVPTDFCIGVAGYPEKHFEAPNLTWDIMNLKRKIEAGAHYVTTQMFFDNRHYFRFVE
FT                   RCREVGINVPIIPGLKILTSKRHLQLLPSRFHIEIPEELVAEVEAAKLEHVPEIGIAWA
FT                   RRQAEELLEAGVPCIHFYIMLRADYVREVVAYLRKIA"
FT   gene            250117..250404
FT                   /locus_tag="Rmar_0235"
FT   CDS_pept        250117..250404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0235"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: tgr:Tgr7_0507 cold-shock DNA-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47141"
FT                   /db_xref="GOA:D0MDE8"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDE8"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACY47141.1"
FT                   /translation="MAARRGVVKWFDAKKGYGFIIHPEGGADIFVHYSQIISERRFKTL
FT                   RTGQIVEFELHEGPKGLHARNVVPLDEVQRKAASGERTPRQQQSHSLSRS"
FT   gene            250483..250950
FT                   /locus_tag="Rmar_0236"
FT   CDS_pept        250483..250950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47142"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDE9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47142.1"
FT                   /translation="MAFTFSDEDIQRIAAALGVAPQIEGSSVRFSLFDPESGRRLTLEI
FT                   QRALQLPPALQEVMPPNLVSVYTPSSFLQLQGCTGYLASQELGEVIFFGRQQGFVSGLV
FT                   VEREVGCSLYANVHERLLSADFMQLPPEMVMSSVALSMSETLFNDLDESSS"
FT   gene            250947..251387
FT                   /locus_tag="Rmar_0237"
FT   CDS_pept        250947..251387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0237"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   afw:Anae109_2711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47143"
FT                   /db_xref="GOA:D0MDF0"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDF0"
FT                   /inference="protein motif:PFAM:PF02130"
FT                   /protein_id="ACY47143.1"
FT                   /translation="MKAPETEALEIVQAHPSRRLPNALLRRLVQAVLAGEKARLRYLSL
FT                   VLTDHATVRELNRTYLGHDYDTDVLSFPLSEEPGVVEGEIYVDLDTAAERHAEFGATFT
FT                   QEACRYVVHGLLHLLGYDDATPEARAHMHRLEDRYLQAAGLL"
FT   gene            complement(251391..254234)
FT                   /locus_tag="Rmar_0238"
FT   CDS_pept        complement(251391..254234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0238"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_2515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47144"
FT                   /db_xref="GOA:D0MDF1"
FT                   /db_xref="InterPro:IPR021280"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDF1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47144.1"
FT                   /translation="MRRTLIERFVAAAVFLYALVLYGLTIAPTVSFWDSGEFIASVFGL
FT                   EVMHPPGAPFYMLVARLFSMLAPSRELVALAVNWVSALSSAVTVLLTFLIIVRLIRHWQ
FT                   PPADQRTWTDDFIALAGGVVGACTFAVTDSFWFNAVEAEVYAMSMLFTALVVWLGLRWS
FT                   EQAAAEVAMLRRGGTLSALSANRYLVLIAYLFGLAIGVHLLSLLALFFVALLVFFTEFE
FT                   RPEWTPAQRWLRIFGALVVSSIIFLIIYPGIIQELPDWAGKSGDPLLFGLVVLALVVGG
FT                   VYYTHRQRKPAANLAMLCLAMILLGYSSYALIIIRSSVDPPIDLNDPETPHAFVSYLKR
FT                   EQYGETPLLRGATYNNQTGQIDQSRQVLFPRRWSPDPSHLRVYAQYDSDLDFFLRYQLG
FT                   HMYIRYFLWNFVGKASDVQDAPAITGFLPGEKDLYFFQTPSERASRNVYYALPLLLGLL
FT                   GMAFHFNHDWRRAFSVLVLFLVTGVGIILYLNQTPLQPRERDYSYVGSFFAFSLWVGIG
FT                   AAGLLEILRDRLKETLRRPLLWGAAVVIFAAVPLHMLLQNYDDHDRSGRYVARDYAWNL
FT                   LMSLDDNAIVFTNGDNDTYPLWYLQEVEAVRQDVRVANLSLLNTSWYIKQLKHQWARKS
FT                   APLPISLSDAQIDRLSVVAWEPREIELPVRLNPATDYERLGIAPEDSSRVMRPMRWRLE
FT                   GRPYTRDLHLLYAADIAVLDMLRTNAERDWERPIYFAVTVSPDGQLNLQNFFQLEGQAY
FT                   RVVPIRHNVTLGRVVPSITLERLRRFRFTNLDNPDVYFDENIRRMVDNYRSIYAHIATQ
FT                   LAQQGLPDEGEALLDTIMVRVPLETIPADLRSYYFLAQAYQQVGAPEKAVAIWKKAEPL
FT                   VLFTLRTAHSQREADMAAQFVQIIRFTYMMAGDYEAAAAFSNRLAEVLGDDSFRKTPDQ
FT                   LRQEMEQFLRGDTSEEQ"
FT   gene            complement(254301..255386)
FT                   /locus_tag="Rmar_0239"
FT   CDS_pept        complement(254301..255386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0239"
FT                   /product="RNA 3'-phosphate cyclase"
FT                   /EC_number="6.5.1.4"
FT                   /note="KEGG: sat:SYN_00093 RNA 3'-terminal phosphate
FT                   cyclase; TIGRFAM: RNA 3'-phosphate cyclase; PFAM: RNA
FT                   3'-terminal phosphate cyclase; RNA 3'- terminal phosphate
FT                   cyclase insert region"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47145"
FT                   /db_xref="GOA:D0MDF2"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013791"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR017770"
FT                   /db_xref="InterPro:IPR023797"
FT                   /db_xref="InterPro:IPR036553"
FT                   /db_xref="InterPro:IPR037136"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDF2"
FT                   /inference="protein motif:TFAM:TIGR03399"
FT                   /protein_id="ACY47145.1"
FT                   /translation="MSTPAPLSLDGSRHSGSGTLVRQAVALAALVGRPLRLYNVRARRQ
FT                   PPGLRPQHLKAVEAVAELVDARLEGAEVGSQRLTFVPRRRPRGGTYRWDIGTAGSATLL
FT                   VQTVLPVLAFADGPSRALIRGGLFQDFAPTYFHLRHALLPLLHRMGLVARLEMLRPGYV
FT                   PRGGGELLLDVTPLQAPLRPLRLEQQGRPVRVFGVALASHLKQRRVARRMADRCRQRLL
FT                   EAGLPEPHIETIDDTSAYQPGAALAVFVETDTGALLGADQAGAPGRPSEAIADNVARML
FT                   LEDLRSGATVDRHLADQLIPYVALADGTSAYHVPEVTDHVASSCWLVEAFFNVTVELQG
FT                   RRLSVEGTALQPIPDRTATAP"
FT   gene            complement(255383..256123)
FT                   /locus_tag="Rmar_0240"
FT   CDS_pept        complement(255383..256123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0240"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG:
FT                   aba:Acid345_0035 protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47146"
FT                   /db_xref="GOA:D0MDF3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDF3"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ACY47146.1"
FT                   /translation="MLYLVPTPIGNLEDLTLRALRILREVDLIACEDTRTSAKLLRHYG
FT                   ITTPTMSYHAHNEARKAAELVARMEAGARVALITDAGTPGISDPGFYLVRECLRRRIPV
FT                   VALPGPTAFVPALAASGLPTDRFVFEGFLPTKKGRQKRLTELASEPRTIVLYESPHRLL
FT                   RTLDDLARALGDERPAVVARELTKAFEEFARGTLRTLHAYYAAQPRVRGELVLVVAGTG
FT                   YRPDPDWPRDRAVVVSSYTSETTS"
FT   gene            complement(256092..257537)
FT                   /locus_tag="Rmar_0241"
FT   CDS_pept        complement(256092..257537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0241"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   gbm:Gbem_3407 permease YjgP/YjgQ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47147"
FT                   /db_xref="GOA:D0MDF4"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDF4"
FT                   /inference="protein motif:PFAM:PF03739"
FT                   /protein_id="ACY47147.1"
FT                   /translation="MKRLHRMTLGMLPGPFLGWFGTLMFLLIMQFLIKYLPDLVGKGLP
FT                   LGVILELISYNLAYMVVLAVPMATLIAMIMTFGRLAESNAYQVIKSAGISLPQLTWPLL
FT                   IVGLVLTGAMMYFNNLILPEANHRARNLWIDIQRKKPGFQLQPGVFYDGIEGYSILVQH
FT                   RDPETDSLRDVTIYDYRNSGEHAVLKAQRGLLQPIAGGRFIDLILEDGEFHRLRRLEGQ
FT                   ERYERLAFARYRLRLDLSDFVFTRSQEEGYRTDRTTPTPQMLALVDSMAAEVQRNRARI
FT                   RQLLLRVLGDTVSAAPAPEPPPLQRAAADSARQATRPALRGLSESQRATLYELALQQTR
FT                   RLQTEIEDLQRSIQWTERRADRYRVEIHKKFSIAVACLIFVLIGMPLGLSVRRGGLGLA
FT                   GGLALAIFLFYWITLVQGEKLADRGYLTPWIGMWLPNLVMGLLGVALFVYVSFDLRVTR
FT                   PLTWLTCKLKALRHALSRSYAHR"
FT   gene            complement(257548..258804)
FT                   /locus_tag="Rmar_0242"
FT   CDS_pept        complement(257548..258804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0242"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: sus:Acid_0954
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47148"
FT                   /db_xref="GOA:D0MDF5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDF5"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACY47148.1"
FT                   /translation="MGRFALFSVGLVLLTLAIDGYVYVNWRRFARPRPALRWTLAIYRV
FT                   LLWTMPLALPGYFLLFRWWEVEPKLARALFFGFWAFYYVPKVPIALVLLLKDGLRLISR
FT                   LMARLRPASPTPSAPSTNPARRMSRAEFLQKLGWSAAALPFLAVGHGVLRTLYDFTVHR
FT                   VTLPVPDLPRALDGLTIGQISDLHAGSFFDERPAHEAVELLLALKPDLIVITGDYVNHD
FT                   ADELPIILPALRKLKAELGVWGCLGNHDHYAHTPDVVRRLHEQTPLRLLINAHHTFQID
FT                   GARLHLIGTDNTGFHQRFADLPRALQGLEPDPNGEEFRLLLAHDPTFWDLEVRPGYPDI
FT                   DLMLCGHTHGGQIGVELGPLRWGLARLVYQRWAGLYVEPAPSRRGRQYLYVNRGVGTVG
FT                   PPLRLGIRPEITLVTLRRA"
FT   gene            258966..259613
FT                   /locus_tag="Rmar_0243"
FT   CDS_pept        258966..259613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0243"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   dal:Dalk_3960 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47149"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDF6"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACY47149.1"
FT                   /translation="MKIHRFTFNPFQTNCYICHDGDEAVLIDPSCHTRAEQQAVVDYLE
FT                   RNGLRLRHLLLTHGHIDHIFGCRFFSEYAGKGFWMHRADVPFLEQAEAQGQFFGVSVEP
FT                   PPPPEGFLDEGDTITFGQTTWTVLHTPGHSPGSISFYDEKHKLVIVGDVLFQGSIGRTD
FT                   LPGGSLPVLMQSIFQKLVPLGDDTRVYPGHGPETTIGRERRHNPFLTGAFPL"
FT   gene            complement(259640..260716)
FT                   /locus_tag="Rmar_0244"
FT   CDS_pept        complement(259640..260716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47150"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDF7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47150.1"
FT                   /translation="MAHLISRKKPAYPISDYLRSYLERYGRIYDGGIRYDDLLRYNNAI
FT                   PFYDEQGRDTLWSTVFYPELEQKEIHDRLRLTYALLKADGDFSIADHLYIDRIDLCLYG
FT                   NTSPFRVRIVNALNDNFDYFYVKRVDANRIYGLELEHILSPNRINYFVWGDTIIEEHII
FT                   GIPGDDFLKDHMPTNRFDQVRLAKEFVKFNERCFVRLLGDMHAGNFVIDGTPDLEKWHY
FT                   RIRPIDFDQQSHHWRKEVYLPECFPQNAPFVELVAEYLPEETIVQYQKEERALIANRMR
FT                   VSHGRFQALMEVMQEDLIAPEENVRRLGAQLAEHYGDARFERCLTMGELVWCSTQIVLE
FT                   RSRPASVAFYLRAVMGHP"
FT   gene            complement(260723..261871)
FT                   /locus_tag="Rmar_0245"
FT   CDS_pept        complement(260723..261871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0245"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   sus:Acid_7283 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47151"
FT                   /db_xref="GOA:D0MDF8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR023881"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDF8"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACY47151.1"
FT                   /translation="MRIGISCYPVYGGSGVVATELGKALAARGHEIHFIAYSMPFRLSH
FT                   ITERIYFHEVNVNTYPLFEYPPYDLALTSKMVDVVKYEKLDLLHVHYAIPHATSAVLAR
FT                   QILEKQGIYVPVITTLHGTDITIVGQDPSFNPVVTYSINESDGVTAVSDYLRRETLTHF
FT                   EITRPIEVIPNFVNTRRFRRLNKLHFKQALCPQGEKVIVHVSNFRPVKRVPEVVRVFHR
FT                   LRQEGLAVKLLLVGDGPDRVPTEHLARELGVYDDVRFLGKQDPVEEILSIADVFLMPSG
FT                   SETFGLAALEAMACGVPVVASNIGGLPELIVDGETGFLCPLGDLDAFTERTRRILTDDE
FT                   LWARMSRAARRRAVEHFDTERIVPRYEAYYEQVLAQAAPRMV"
FT   gene            261982..262617
FT                   /locus_tag="Rmar_0246"
FT   CDS_pept        261982..262617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47152"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR025665"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDF9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47152.1"
FT                   /translation="MVRQTVVSRLFSYGLLLLLLALPTAAQAQLGVSLGLNFNQLSDIK
FT                   TGDTRATFDNSQGWHVAVWFDLPLGPVAIRPGLRYMDAGSLYRGFREDLSDPSVQEGFD
FT                   VTLLEIPIDVRYRMPLPFLTPYVMAGPVLRFPSGDEAIKDNLKEFSLAGSLGVGVEVSL
FT                   LGLRLYPELQYTFGVTEFTKGFEVGGVEINPDARQHLNVVMLRVGVAL"
FT   sig_peptide     261982..262068
FT                   /locus_tag="Rmar_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 29"
FT   gene            complement(262667..263683)
FT                   /locus_tag="Rmar_0247"
FT   CDS_pept        complement(262667..263683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0247"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47153"
FT                   /db_xref="GOA:D0MDG0"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDG0"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ACY47153.1"
FT                   /translation="MLRRLTPLLLTIFLLVPACRQTEPEPEVVEYPREGLFVPEPPPEY
FT                   RAEGIRIATLNTFFLFDGYGDEGQTDFPHKGNPEAARRHRARIAQVLRMINADLVVLQE
FT                   VENEEVLRRMVTEDLPDLNYEVHFVQGHDTFTGQDVAVLSRLPVEKIGRTEERVPVEGT
FT                   DDTYGVSKNIWVRLYLGDLPATIIGVHFLAQPDDSRRKPRREAQAEVIRRLVERELAAG
FT                   RAVAVLGDFNDYDESVLDLNGHRPITRTLALVKAAGPGPDDDLYNVMAEVPQHDRFTVF
FT                   YDADEDWQVEWPELAAIDHVLLSPRLRARLREVHYVQAYDPRTVTDHFPIVVTLAPR"
FT   sig_peptide     complement(263615..263683)
FT                   /locus_tag="Rmar_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.878 at
FT                   residue 23"
FT   gene            complement(263772..264377)
FT                   /locus_tag="Rmar_0248"
FT   CDS_pept        complement(263772..264377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0248"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_1369 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47154"
FT                   /db_xref="GOA:D0MDG1"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDG1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47154.1"
FT                   /translation="MTGVLAFHTNLLMGDTAPLTDEDPSFVYSELDSLQTVRAQLVQLG
FT                   ARRLPPVPPEAIDSETLWLARVIYSETKRPEEMELVAWVVRNRVETRFRGKATYRDVVL
FT                   DPFQFSAFIPYNPRRQYYMRLTPHSRAPGWQQALSIAYYVRFADTTHRPFSIRTRHFYS
FT                   EQSMTGRLLPVWAEGVHPVQPMRYRVDAQRFRFYEDIS"
FT   gene            264709..266202
FT                   /locus_tag="Rmar_0249"
FT   CDS_pept        264709..266202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0249"
FT                   /product="periplasmic component of the Tol biopolymer
FT                   transport system-like protein"
FT                   /note="KEGG: sus:Acid_7543 periplasmic component of the Tol
FT                   biopolymer transport system-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47155"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDG2"
FT                   /inference="similar to AA sequence:KEGG:Acid_7543"
FT                   /protein_id="ACY47155.1"
FT                   /translation="MWALLLGGWLLIVVNAQAQPLGPFEAHGNVGEVKRPGTVAYDPEE
FT                   QVFVVAGSGANMWGDRDAFHFLWRRMTGRFMLQARGHFLGEGVDPHRKMGWIIRAGLGP
FT                   DDPYVDIAIHGDGLAAVQFRRVRGGPTEEIRFAVKGPDVFQLERDEDRYVASVARFGEP
FT                   FVQQELSGLALGDTVYAGLFVCAHNDTVLERALFDNVRLIVPAPEDFVPYQDYIGSLLE
FT                   VLDVETGRRKVLYTSEASIQAPNWTPDGRALIYNQDGLLYRFDLATRRPSVIPTGFATQ
FT                   NNNDHVLSPDGRWLGLSHHAPEYGGRSIIYVVPIEGGTPRQVTPTGPSYLHGWSPDGRY
FT                   LVYTAERDGDYDIYRIPVEGGEEVRLTDTPGLDDGPEYSPDGRYIYFNSVRSGTMQIWR
FT                   MRPDGTEPEQLTDDAFNNWFPHVSPDGRWVLFLSYLPDVDPSDHPFYRLVYLRMMPAAG
FT                   GSPRVVAYLYGGQGTLNVNSWAPDSRHAAFVSNSDKLRP"
FT   sig_peptide     264709..264765
FT                   /locus_tag="Rmar_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.981 at
FT                   residue 19"
FT   gene            266261..267484
FT                   /locus_tag="Rmar_0250"
FT   CDS_pept        266261..267484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0250"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: shn:Shewana3_1476 D-isomer specific
FT                   2- hydroxyacid dehydrogenase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47156"
FT                   /db_xref="GOA:D0MDG3"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR020921"
FT                   /db_xref="InterPro:IPR024531"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038251"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDG3"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACY47156.1"
FT                   /translation="MAGPMLLHPGLQRPLRIVADENIPFAREAFRGFGVVRPLPADQIT
FT                   PATVRNCDVLLVRSVTRVDAALLEGSRVQFVGSATSGIDHVDLAYLQKRGIAFAHAPGA
FT                   NADAVVEYVLAALLELAVRRNVPLRGRVAGIVGCGHIGGRLARRLPALGLEVLCCDPPL
FT                   AEQTGRSDFVSLETILAEADIVTLHVPLTRTGPHATYHLIDAAALARLRPSAWLLNTSR
FT                   GAVVDGRSLLEARRQGRPEAVVLDVWEGEPAPDPELVAHVDLATPHIAGHSYDGKVRAT
FT                   LMLAEALARHLNLPLRADDSELLQPQPGDRLDLIPPDYRLPEAQWLAELVRQMYDIAAD
FT                   DARFRIVMQNGTPERRAERFLELRRTYPRRRSFSVHRIDRAFVPEPLQEAVAVGLGVQL
FT                   VAAETMAQ"
FT   gene            complement(267478..268413)
FT                   /locus_tag="Rmar_0251"
FT   CDS_pept        complement(267478..268413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0251"
FT                   /product="GTP-binding protein Era"
FT                   /note="TIGRFAM: GTP-binding protein Era; small GTP-binding
FT                   protein; PFAM: GTP-binding protein HSR1-related; KH type 2
FT                   domain protein; KEGG: GTP binding / RNA binding; K03595
FT                   GTP- binding protein Era"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47157"
FT                   /db_xref="GOA:D0MDG4"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDG4"
FT                   /inference="protein motif:TFAM:TIGR00436"
FT                   /protein_id="ACY47157.1"
FT                   /translation="MEPEKTPSQPSLLIDPSQLPPEHRSGYVAIVGKPNVGKSTLMNAL
FT                   LGHKLSIVTPKPQTTRHRVLGILSGDTYQIVFLDTPGVLKKARYKLHEHMLRTVDRAVA
FT                   DADLVLFMAEATQKAPDTISLGHLGNRPAILALNKMDLVRNQEQVLPLVDAYMKQYPFE
FT                   AVVPISALTGYNLDVLLKEIIHRLPPGPPFYPKDQLSEHPERFFVAEIIREKIFEQFRE
FT                   EIPYAAQVNIVDYKERPEGKDFIDAEIIVERPTQKAILIGKGGQALKRLGTAARQEIEA
FT                   FLGRPVYLQLHVKVREDWRNRDRLLRSYGY"
FT   gene            complement(268424..269161)
FT                   /locus_tag="Rmar_0252"
FT   CDS_pept        complement(268424..269161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0252"
FT                   /product="pyridoxal phosphate biosynthetic protein PdxJ"
FT                   /note="TIGRFAM: pyridoxal phosphate biosynthetic protein
FT                   PdxJ; PFAM: Pyridoxal phosphate biosynthetic protein PdxJ;
FT                   KEGG: ecv:APECO1_3967 pyridoxal phosphate biosynthetic
FT                   protein PdxJ"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47158"
FT                   /db_xref="GOA:D0MDG5"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDG5"
FT                   /inference="protein motif:TFAM:TIGR00559"
FT                   /protein_id="ACY47158.1"
FT                   /translation="MRLAVTRLLVNIDHVATLRNARRETFPDPVQAAVLCELAGADGIV
FT                   FHLREDRRHITDRDVFRLKEVVQGKLDFELSTNEEIVSICCQVRPHLATLVPERREEIT
FT                   TEGGLDVLANRARLQQVIPRLFDAGIEEVALFVDPDPRQIEAAREVGANAIELHTGDFA
FT                   NAPTEAARRAEAEKLAAAARVAHELGLQVHAGHGLDYHNYPLFRETVPHVHEVSIGFAI
FT                   IARAVLVGLETAVREMRRLVKGY"
FT   gene            269357..269815
FT                   /locus_tag="Rmar_0253"
FT   CDS_pept        269357..269815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47159"
FT                   /db_xref="GOA:D0MDG6"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDG6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47159.1"
FT                   /translation="MATGRQITRIVLQIVLGVVIVILAYYLYLSITEPYKAVKREQELT
FT                   RLTRDRMSDIRTALIRYELLYDHYPPTLDSLVAWIRQDSFMMAKADSIFGPGFILDSLI
FT                   YSPRDGKFEYAVNDTGRVEIYYLKDPASDDHIGSLEPDVTKLNAASWE"
FT   gene            269848..270753
FT                   /locus_tag="Rmar_0254"
FT   CDS_pept        269848..270753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47160"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDG7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47160.1"
FT                   /translation="MEARARAGIELHDAVLRYAELERRGDRYQLLRLGSCDFDFGVLDE
FT                   LQAEAPRYLDIVGEALRDVLAGLVADELDVALHPSRGVTAFASLQPEALEPDALRGRLL
FT                   AEASWITGQSADSLHLHAEPGMHQPLSEDERARWYQVLVLPRHVQAHLERVLQQAPCRR
FT                   YRVRLSTAGAAETLRRLPGPEPEVPPEVALAIGCYETHTEFTLCRRGHWYLSHFAPGTE
FT                   DVAYFCMALLHRLGLSAVMVEQVALYGTHVPEALSEQLRLLFPVEPMLLNPLVLTTLDP
FT                   KALNPAEAVAYVPCIGVALS"
FT   gene            270770..271318
FT                   /locus_tag="Rmar_0255"
FT   CDS_pept        270770..271318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0255"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; PFAM: Protein of unknown
FT                   function methylase putative; putative RNA methylase; KEGG:
FT                   bcs:BCAN_B0206 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47161"
FT                   /db_xref="GOA:D0MDG8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDG8"
FT                   /inference="protein motif:TFAM:TIGR00095"
FT                   /protein_id="ACY47161.1"
FT                   /translation="MRIIAGRFRRKTLRAPKGHLTRPTTDRTRESLFHLVESRMDLEGA
FT                   DVLDLFAGTGALGLEAISRGAVAVTFVELQGPVLACVRENARALGVEEACEFIRGDAVE
FT                   YLRRYSGPPFDLILADPPYDLPELPQLPELAFPHLKPHGLFVLEHDKRHNFEGHPHLDT
FT                   SRRYGRTIVSVFRPQPVER"
FT   gene            271324..271812
FT                   /locus_tag="Rmar_0256"
FT   CDS_pept        271324..271812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0256"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="KEGG: mxa:MXAN_3385 pantetheine-phosphate
FT                   adenylyltransferase; TIGRFAM: pantetheine-phosphate
FT                   adenylyltransferase; cytidyltransferase-related domain
FT                   protein; PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47162"
FT                   /db_xref="GOA:D0MDG9"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDG9"
FT                   /inference="protein motif:TFAM:TIGR01510"
FT                   /protein_id="ACY47162.1"
FT                   /translation="MRERLALYPGSFDPFTYGHLDIVERALRIFDRVEVTVAVNIGKEP
FT                   LFSIEERCELIRQCTAHLDRVEVVAFEGLLVDHARARGATALVRGLRQVSDFEYEFRMA
FT                   FANRRLYPELETVFLMTSEEYAMISSSIVREIHRWGGDVSLFVPPPVVEALRKKRAAR"
FT   gene            271886..273094
FT                   /locus_tag="Rmar_0257"
FT   CDS_pept        271886..273094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0257"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase; KEGG:
FT                   Os01g0871300; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47163"
FT                   /db_xref="GOA:D0MDH0"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDH0"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACY47163.1"
FT                   /translation="MSLQLDTFNPRVMAVQPSATLAMTARAKQLRREGKPVIGLSAGEP
FT                   DFDTPAPIAEAAIQAIREGFTHYTENAGMLELREAICRKLAEENGLTYEPDQILCTNGA
FT                   KQAVAMAIEVLCRPEDEVLIPAPYWVSYPEMVRLAGATPVILPTSVETGYRLTPEQLEA
FT                   AITERTRLLILCSPSNPTGTVYTPEELEALADVLRRHEHVYVLSDEIYEYILFDAKHVS
FT                   FASLPGMKERTITVNGFSKGFAMTGWRLGYLAAERPIVKAAAKVQSQFTSAPCSISQKA
FT                   GLAALQMDKGPIREMVAAFRQRRDFVLERLQAIDGITCPKPEGAFYLFPQVSAFYGRRT
FT                   PDGRTITDSESLCLYLLEQCHVALVPGQAFGDPNGVRISYAASMENLAEAMRRIEAGLA
FT                   ALQ"
FT   gene            273163..274356
FT                   /locus_tag="Rmar_0258"
FT   CDS_pept        273163..274356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0258"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: sus:Acid_5169 peptidase
FT                   M50"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47164"
FT                   /db_xref="GOA:D0MDH1"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDH1"
FT                   /inference="protein motif:PFAM:PF02163"
FT                   /protein_id="ACY47164.1"
FT                   /translation="MEPIPGIRWRETVAAPPRRPQRVWLHLLLFVLTLVTTTLTWPDWA
FT                   GRWLLYERVGYGALLADGLRFSLPLLLILTVHEFGHYLAARFHRIDATLPYYIPFPFNG
FT                   IGTFGAVIRIREPIPDTRSLFDIGVAGPLAGFVVALIVLFYALLTLPPPTYLLDVPGHE
FT                   ALKAYILAHGRFPSAPLPSEDPTSVTLVLGHTLLFDTLARFFPNVPPMYELYHYPTLFA
FT                   AWLGLFFTALNLLPVGQLDGGHVLYALFGRRWHRRLARAFVLLLLVSATIGFALETLPP
FT                   LLQEGIWWLEPAAWFGLALVLYLYLHRLFDGDHRIVAPVLLGLMVLAALAPRMAGLVGW
FT                   MGHSGWFLWSLIILYLIRVDHPPVWYRVPLSRTRRALGWAAIAIFVLCFSIRPLYLI"
FT   gene            274464..275273
FT                   /locus_tag="Rmar_0259"
FT   CDS_pept        274464..275273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47165"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDH2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47165.1"
FT                   /translation="MRHVFWLLALAGGLLWGCDTLPGAPSLEGRPPVVSNLSFAPDSVD
FT                   FNTLPSEQIRGDTALIPLSLAVTARDPDGRIARVAFVVRAPLNTTEPVAMGTLEASGTD
FT                   RYTGETTLRLHRAQVGPYTVLVYAVDDEERLSNQVRGTLWFWATGGPPVIEEVQVPDTL
FT                   RRPAPGEPPVVFQVVARVSDPDGLENILRVELRVNNGAPILLCDDGGEGLCGGIPNSGD
FT                   AVAGDGLFTMTLSLASDNVPGTYTFVFQAIDRTGLTSEEVRRHVVVE"
FT   gene            275257..276840
FT                   /locus_tag="Rmar_0260"
FT   CDS_pept        275257..276840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0260"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_5189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47166"
FT                   /db_xref="InterPro:IPR002860"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDH3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47166.1"
FT                   /translation="MWSWSKRLVWVGLLLGLTAGDGRAQSKADWSRRVAELIPVPGIAE
FT                   NFVSNLAARGDSLWVGPRLDLTFDGGQTWYRADVDSITQGRGRVYALLVVGDTIWASLG
FT                   TRYQADLNGDGVDDDVFEAVGLVYSTDGGNTWGFRFPPLDAPTDTVITYGVSRLLAEPV
FT                   VSPQLTTTFDLAYDRRRGRLWAASWYGGLRYSDDFGRTWHRAVLPPDSLDALRPDQPYF
FT                   FRVAPPVSALDRYDNYFAFAVHVDDEGTVWAGTAGGINRSVDGGLSWDRFFNDGRPNAP
FT                   TGNWIVAIAEQRRPNGQRVLWFATRPAGATPGETFGITRTADGGRTFQQVLLGERINDF
FT                   AFRGDTVYAAGDNGLFVSTDQGRTWRTIRDFYDPASNRIVRPDVRVLAVAVTRSHLWIG
FT                   TSDGLLRSDDGGRTWRLFRADVPLRPDNPSPAVPRVDTYAYPNPFSPALDAFVRIRYEL
FT                   DREATVRVHVFDFGLQRVRTLFEGTQPAGPHEVIWDGLDARGVRVANGVYFYAVETGSA
FT                   TYWGKILVIE"
FT   sig_peptide     275257..275331
FT                   /locus_tag="Rmar_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.906) with cleavage site probability 0.684 at
FT                   residue 25"
FT   gene            276837..277853
FT                   /locus_tag="Rmar_0261"
FT   CDS_pept        276837..277853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47167"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDH4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47167.1"
FT                   /translation="MKRIALLIVLSWAVAARAQEVGVFARMGLDARALALGQALVADVE
FT                   GAAAYYNPALAVFTERPELALSTAFMALDRELQSAQLSTRMPPRAGIAVVLRHAGVRNI
FT                   DGRDASGYHTQSYSTDEYALLVAFGTRVSDRVTLGLGLQFFRADLFEGLRPVQSIGLDL
FT                   GLLYRATETLHLGLAVDDLLARYTWNTSDLYGPQQGSTTSDRFPMRVRLGASWTAPAGR
FT                   LRLLGEYEASFTSVEVRQRRVQLVGDTPREALVSERRWARGGQLRLGATYRLSEAFALL
FT                   GGLDRIGRLPEAGGWQPALGFSLATRLGNLPFRAGYTVRLEHTALPPMHMLSVGLFL"
FT   sig_peptide     276837..276893
FT                   /locus_tag="Rmar_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 19"
FT   gene            complement(278029..278466)
FT                   /locus_tag="Rmar_0262"
FT   CDS_pept        complement(278029..278466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0262"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: saz:Sama_2184 phage shock protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47168"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDH5"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACY47168.1"
FT                   /translation="MAAMKTRILLLLALLSGPAACTTERTEAPQTTTTAVADTTAIVRL
FT                   TAEEFLARYTPDAVVIDVRTPEEFAQGHLKGALNINVQAPDFREQIQARGLDPNRPVYL
FT                   YCRSGRRSQRAAEILREMGFRQLYNIGGFEDLARAGAEVAR"
FT   sig_peptide     complement(278398..278466)
FT                   /locus_tag="Rmar_0262"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.678 at
FT                   residue 23"
FT   gene            complement(278473..278823)
FT                   /locus_tag="Rmar_0263"
FT   CDS_pept        complement(278473..278823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0263"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: dvm:DvMF_2623 rhodanese domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47169"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDH6"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACY47169.1"
FT                   /translation="MWTHLLRLLTRPAETHDVLRPEVFLHRRRPEDVVIDVRTPEEFAQ
FT                   GHLEGAINLDLMASDFHEKVARLDPNRTYYLYCRSGNRSGQAARLLRKRGLEAYNIGGL
FT                   EDLARAGATIVR"
FT   gene            complement(278900..279451)
FT                   /locus_tag="Rmar_0264"
FT   CDS_pept        complement(278900..279451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gsu:GSU0303 sensory box protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47170"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDH7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47170.1"
FT                   /translation="MAVLLLAACGREPASDAPPAAVRQQVEEAIRALDALRAGLARTIT
FT                   AGETIDAATFNRVCRPVGQQARQLAETNGWIVQQLAVKYRNPAHRPDSQAAALFARFEA
FT                   DPSLDSLWVRATWNGTPGWRYLRRITVRPQCLACHGPRDRRPAFIVQNYPEDRAYDFRP
FT                   GDLRGLYSVFVPDSLLQTSF"
FT   gene            complement(279487..279819)
FT                   /locus_tag="Rmar_0265"
FT   CDS_pept        complement(279487..279819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0265"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: reu:Reut_A0822 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47171"
FT                   /db_xref="GOA:D0MDH8"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDH8"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ACY47171.1"
FT                   /translation="MTLPEFFQKEVIEKSHEKPVVVDFWAPWCGPCRILGPVLEKLARE
FT                   SKGAWRLVKVNTDQHPELAMHYGVRGIPTVKLFRNGEVVDEFVGALPEPAVRRWLQQHV
FT                   PEPSAS"
FT   gene            complement(279870..280667)
FT                   /locus_tag="Rmar_0266"
FT   CDS_pept        complement(279870..280667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0266"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   tcx:Tcr_0174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47172"
FT                   /db_xref="GOA:D0MDH9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDH9"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACY47172.1"
FT                   /translation="MWIALIGALLVGLSLGLLGSGGSILTVPVLVYLVGEPDKVAIAES
FT                   LGIVAAIAAAGALPYARQRTIDWRSVLFFGIPGIVGTYGGAWLSRFVSGPVQLVLFAGV
FT                   MLLAAVLMYRRSTPRPVPTPPSAGGVTVTARKHAAWKIMLEGVSVGVLTGLVGVGGGFL
FT                   IVPALVLLGGLDMRRAVGTSLIIIALKSVAGYLKYLDVLADLGLAVNWEVVGLFAIVGI
FT                   AGSFAGNWIGGRIPQHRLQRGFAVFLVVMGLWILYQNLGMLTG"
FT   sig_peptide     complement(280608..280667)
FT                   /locus_tag="Rmar_0266"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.379 at
FT                   residue 20"
FT   gene            complement(280780..282234)
FT                   /locus_tag="Rmar_0267"
FT   CDS_pept        complement(280780..282234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0267"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; Rhodanese
FT                   domain protein; SMART: Rhodanese domain protein; KEGG:
FT                   bcb:BCB4264_A3523 hydroxyacylglutathione hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47173"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDI0"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACY47173.1"
FT                   /translation="MLFRQIFDPKLAQYAYLIGCQQTKEAIVIDPERDVDQYLRLAEEE
FT                   GLRIVAVAETHIHADFLSGARELAERVGARLYLSAEGEADGWASNWAKNGRYDVTFLRD
FT                   GDTFRIGNIEFKAVHTPGHTPEHLCYLVTDRGGGATEPMGLVTGDFVFVGDLGRPDLLE
FT                   SAARISGMKEPSARRLYQSVLRFLELPDYLQVWPGHGAGSACGKALGAVPESTVGYEKR
FT                   FNASLAPAREGEDAFVQAILSGQPEPPLYYARMKAYNRDGVPLLGRLPAPRRLSVAELD
FT                   RLVKQGEVTFVDTRLDRMAFMLAHLPGALYAPFNRSFNTTVGSLVADDQTPLVLIIDDE
FT                   DVEQAVRDLVRIGYDRIEAYATPETLVRYFNEGGARASIPTITFEDVVRLREQPDVAVL
FT                   DVRYASEYEAGHIPGAINASYTRLPEYLDRIPKDRTLLVHCVTGGRSAAAASFLAAQGY
FT                   RVQYVADDFATYQQIGPVESGQPVTA"
FT   gene            complement(282332..282850)
FT                   /locus_tag="Rmar_0268"
FT   CDS_pept        complement(282332..282850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0268"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: tcx:Tcr_0170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47174"
FT                   /db_xref="GOA:D0MDI1"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDI1"
FT                   /inference="protein motif:PFAM:PF04143"
FT                   /protein_id="ACY47174.1"
FT                   /translation="MAELVRDTRPEACIDIEQVAPDYEAQAQEAGNRPGSLLAYLLLGI
FT                   FFGIVLIKSEVASWFRIQEMFRFQSFHMYGVIGSAVVVAGLSVQLIKRLRLKTIHGEPI
FT                   EIQPKIWGKGVRYWLGGILFGLGWGLLGACPGPMFALLGSGVTVMVVAIASAMLGTWAY
FT                   AVLRPRLPH"
FT   gene            complement(282872..283435)
FT                   /locus_tag="Rmar_0269"
FT   CDS_pept        complement(282872..283435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0269"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: tcx:Tcr_0171 YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47175"
FT                   /db_xref="GOA:D0MDI2"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDI2"
FT                   /inference="protein motif:PFAM:PF04143"
FT                   /protein_id="ACY47175.1"
FT                   /translation="MLEWLSQPWPWYVAGPLIGLIVPLLLLIGGKSFGVSANLRHLCAA
FT                   VLPTRVDFLRYDWKRQGLWNLTFALGIVLGGFIAATLLASPDPYVHISEATRADLAALG
FT                   ITDFRGLVPSEFISWKGLTTLPGLIMVVLGGFLIGFGARYAGGCTSGHAIMGLADLQLP
FT                   SLVATIGFFIGGLIATYLILPLIL"
FT   gene            283614..283922
FT                   /locus_tag="Rmar_0270"
FT   CDS_pept        283614..283922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0270"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: regulatory protein ArsR; transcriptional
FT                   regulator TrmB; SMART: regulatory protein ArsR; KEGG:
FT                   pna:Pnap_2826 regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47176"
FT                   /db_xref="GOA:D0MDI3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDI3"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACY47176.1"
FT                   /translation="MKTLIPREQLEQVARRFRLLGDPVRLEILNLLHVRGEMTVQDLVA
FT                   ATGQSQANVSKHLRLLREAGLVARRQEGPYAYYRINDPMLAALCVLVCSQVPEATAL"
FT   gene            complement(284346..286883)
FT                   /locus_tag="Rmar_0271"
FT   CDS_pept        complement(284346..286883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAa0464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47177"
FT                   /db_xref="GOA:D0MDI4"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR032534"
FT                   /db_xref="InterPro:IPR033413"
FT                   /db_xref="InterPro:IPR034032"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDI4"
FT                   /inference="similar to AA sequence:KEGG:PSHAa0464"
FT                   /protein_id="ACY47177.1"
FT                   /translation="MLRRLLLATLSLLWVHLSVAQLPDIDTFTRDMVRRDGLIPVYLDT
FT                   LKGKLYLEVIPSGADLLLVPALPAGLGSNDVGLDRGLFGEERVVQFRRTGNQILLYAPN
FT                   LTYRALEGDAPARRAVEEAFAASVLWRFPIVARQGDRFLIDATDFALHDAMDVVGRLRQ
FT                   TDQGTFRLDRDRSTILFEAVKAFPRNTVIEALLTFSSEQPGRFVRQVAAVPEHVTLRQR
FT                   LMFVALPPPGYRPRAHDPRSGLFSITFYDYTSPVGEPLARRWIVRHRLQKKDPNAPVSE
FT                   PVKPIVYYVDPGAPEPIRQALIDGASWWAEAFEAAGFRNAFRVEVLPDTADPLDVRYNV
FT                   IQWVHRATRGWSYGRTIVDPRTGEIIKGHVTLGSLRIRQDYLIFEGLLAPYDSAHAHGY
FT                   PPESDPMLQLALARIRQLAAHEVGHTLGLQHNFAASVNDRASVMDYPAPYVRVRPDGLL
FT                   DVSEAYDTGIGAWDKVAIRYAYSEFPPGTDETAALEAILEEAARQGLHFITDADARPPG
FT                   GAHPLAHLWDNGTDAVAALHRELQVRKVALERFGLRNLRAGRPLATLEEVLVPIYLWHR
FT                   YQTEATVKLLGGAFYTYAVRTPDMPEAPVVRPVPGATQRAALEALLTIVQPATLRLPET
FT                   LRGLIPPRPPGYPAHRELFARQTAPLFDPVAPAKAAARQVFDLLLQPERLSRLHDQALQ
FT                   DPSLPSLSEVLEQVSRNVWAAPVPDDPYDAHLQRVVQTAWTAGLLERARDARTPVDVRV
FT                   ELEAHLRRLADWLTQNPGTDAATRAHRRFHRDWIRRFLERPYTPDEPGAPELALPPGAP
FT                   IGLLEQVLERPRRLLEATYDPGCALIDQKSSEK"
FT   sig_peptide     complement(286821..286883)
FT                   /locus_tag="Rmar_0271"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            286997..289057
FT                   /locus_tag="Rmar_0272"
FT   CDS_pept        286997..289057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0272"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; peptidase S9B dipeptidylpeptidase IV domain
FT                   protein; WD40 domain protein beta Propeller; Acetyl xylan
FT                   esterase; KEGG: swi:Swit_2952 peptidase S9 prolyl
FT                   oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47178"
FT                   /db_xref="GOA:D0MDI5"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDI5"
FT                   /inference="protein motif:PFAM:PF00326"
FT                   /protein_id="ACY47178.1"
FT                   /translation="MRRALLFLLFLVVIAPASHAQSDRLTLERYLEWEDVNDPQISPDG
FT                   RRIVFTRRWVDQQKDRWQSALWIMNADGSQQRFLVEGRSPRWSPDGTRIAFIANDAEGR
FT                   PQIFVKWVDLPEPPTQLTHLTEAPGSITWSPDGRMIAFTMNVPVEVRWNVDLPKPPEGA
FT                   TWTKPPRLVRRLHYRADRRGFMEEAYTHLFVIPAEGGTPRQLTEGTWHVGPRFDGLPAG
FT                   ATLSWTPDGRTIVFDGFKASADSVDRNYRNAHLYAVDVATRQLRQLTREPGRWTQPAVS
FT                   PDGRWVAFTGYAETRQTYHAADLWLMPLDGSAAPRNLTRALDRDVSNLHWAPDGSGVYF
FT                   TIDDRGTRNVYFASVRGEVRQVTRGVHMLTLSSISRNGVAVGVRTSYHEPDDVVRFALN
FT                   RPDQIERLTAVNDDVLQDVKLGEVEEIWYASRDGTRIQGWIVKPPDFDPAQKYPLILHI
FT                   HGGPHAMYNVGFNYSFQNFAANGYVVLYTNPRGSTGYGTEFGAAISQAYPGVDHEDLMA
FT                   GVDAVLARGYIDPDRLFVTGCSGGGVLSSWAIGQTDRFAAAAVRCPVTDWISMAGTTDV
FT                   PLFTFNWFDRPFWEDPSEWLARSPLMLAGKVKTPTLLMTGELDLRTPMSQTEEYYVALK
FT                   MRGVPVVLLRFNEEYHGTGSRPSNFMRTQAYIMDWFEKKGRIPGVTVEAEE"
FT   sig_peptide     286997..287059
FT                   /locus_tag="Rmar_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 21"
FT   gene            complement(289304..290542)
FT                   /locus_tag="Rmar_0273"
FT   CDS_pept        complement(289304..290542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0273"
FT                   /product="nuclease SbcCD, D subunit"
FT                   /note="TIGRFAM: nuclease SbcCD, D subunit; PFAM:
FT                   metallophosphoesterase; KEGG: slo:Shew_2457 nuclease SbcCD,
FT                   D subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47179"
FT                   /db_xref="GOA:D0MDI6"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDI6"
FT                   /inference="protein motif:TFAM:TIGR00619"
FT                   /protein_id="ACY47179.1"
FT                   /translation="MKILHTADIHLGITTYGRVDPSTGLNTRLQDFRRAFEFMVEQALA
FT                   EDVDLFLFCGDAFRNPDPSPTEQTIFAECLQPLTERGIPIVLLVGNHDHPVTFGRASSI
FT                   DIFRYLEGQARVFRRPEVATIQTKSGPLQLIALPWPVRSLLLSREEFRQKSASEVREVI
FT                   EQLYVEYVQKAVERLDPSLPTVLAGHFSVQGAELSGSERTSLIAHEPKFTVGQLALPPI
FT                   DYVALGHIHRHQNLNPDGIPVVYSSSIERVTFRETDDPKGFVLVEIQSDGPRKQTRYRF
FT                   VETPARRFVDLHIDARDSDDPTERILNAIARAPVADAIVRVRYQVDEDQVARVDVRRIR
FT                   EALRTAAHIAGVERTVTPVVRERRTIVERDSSLREALSRYIDQHEKLHPLREQLIEAAL
FT                   ALEARLEAGRLPE"
FT   gene            complement(290608..292959)
FT                   /locus_tag="Rmar_0274"
FT   CDS_pept        complement(290608..292959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0274"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: cti:RALTA_B1852 peptidoglycan
FT                   glycosyltransferase; TIGRFAM: penicillin-binding protein,
FT                   1A family; PFAM: glycosyl transferase family 51;
FT                   penicillin- binding protein transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47180"
FT                   /db_xref="GOA:D0MDI7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDI7"
FT                   /inference="protein motif:TFAM:TIGR02074"
FT                   /protein_id="ACY47180.1"
FT                   /translation="MPDRWTHTEEELRRYFSDPNFRHARLQGDGHAPRKRRGLVGFFYR
FT                   RFRDPRKAQAALVLSVLVGLILLGVLALGLYVWSLSDELPSFQQLDNPTFELATIAYTA
FT                   DGKELARYARQNRTWVSYDEISPYVIQALLATEDHRFYDHWGVDLFRTASAVTQTILSL
FT                   GREVQGGSTITQQLARNLYNEQIGRAQTIERKLKEMVTAVELERRYTKREIIEMYLNTV
FT                   EFVYNAFGIESAARTFFNKPARDLNVLEAATLVGMLRNPALYNPIRFPERARQRRNVVL
FT                   WQMVRHGYLDRDFFEAHKDDPIVTDFRTSAITASIAPYFAEYVRRWLVNWAKAHGYNIY
FT                   TDGLRVYTTLDSRLQELARQAVDEQMRGLQAVVDYEWSRRSGFFLGQDVNLYLQQKNYE
FT                   PFAYYWSSKRDTVDQFIRETEHYRRLVAGGVAPDEALRRLRADRAFMDSLKAVKTRLEA
FT                   GFVAIDPRNGYVRAWVGGRDLTRDWYDHVAIARRQPGSTFKPFLYTAAIDNGWSPYDVL
FT                   PDSSVTYVDPAGNVWQPRNAEGESTGQLLTLREALARSVNTVSARLVLQVGARNVAFYA
FT                   RRMGIKSPLKEVPSLALGTSNVTLLELVSAYATLASGGLYYEPTVVTRIEDASGNVLYE
FT                   ARPVPREAISEETAYTVVDMLRDVIRYGTGTRIRWQFGLTRYDFAGKTGTTQNSADGWF
FT                   ILMHPELVTGAWVGFNDPRVTFRTHWWGQGAHNALFIVGDFWRRMEQAPDIEISNATFP
FT                   LPIGLHQPGTDSLRQERRITPELNQRRVGW"
FT   gene            complement(292985..293734)
FT                   /locus_tag="Rmar_0275"
FT   CDS_pept        complement(292985..293734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0275"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: pca:Pcar_1978
FT                   UDP-2,3-diacylglucosamine hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47181"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDI8"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACY47181.1"
FT                   /translation="MVLFFADLHLGRADPATERAVEQSLLACLTALADRVRHLVLVGDV
FT                   FHHYIEYRYLIPRGFVRFQALLADWTARGIPVTYVVGNHDPWHRDYFEQELGVQVLHEA
FT                   AVVSLLGCRVYLDHGDLAIARPFSRALRRLLRHPVPVWLYRTLLPGDLGLALARRVTQW
FT                   RPERLNPVTVERLRRYARQVLRERQAEVVVLGHGHQAELLRWPEGLYLNPGCWYQEQTF
FT                   GVLETDMLALCRWTPDGPQTLIRYALS"
FT   gene            294058..294720
FT                   /locus_tag="Rmar_0276"
FT   CDS_pept        294058..294720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0276"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: aeh:Mlg_2078
FT                   rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47182"
FT                   /db_xref="GOA:D0MDI9"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDI9"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACY47182.1"
FT                   /translation="MYRDYDYYQPPTQFAVFPPVVKNLLILNGLVFLAQLVPTTDRLLI
FT                   EWFALWPLGLPDFYPGFWPWQLITYSFLHGGFAHLFFNMFALWMFGVPIERAWGSRRFG
FT                   VYYFVCVVGAGLTQLLVVTLSGAVYPTVGASGGVFGILLAFGMMFPNTPIYLYFLFPIK
FT                   AKWLVIGYGLLELWAGVTGTQSGVAHFAHLGGMLFGFLLIQYWRGRLPWRPSRRLYW"
FT   gene            294818..295699
FT                   /locus_tag="Rmar_0277"
FT   CDS_pept        294818..295699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0277"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: sus:Acid_2217
FT                   rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47183"
FT                   /db_xref="GOA:D0MDJ0"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDJ0"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACY47183.1"
FT                   /translation="MQPPALRALLTINVGVYLLWILALMHIDAVRGFVWMQLALNPDWP
FT                   AILTHPWQLVTYNFLHLQPGFWGLLHILFNMLWLVWIGREYEELHGSHQLLALYLIAGV
FT                   GGGLLTVLLHALFPGVGAFGGLVHGASASVLGVLMAVAILYPFKSVALFLFGPIRLLYL
FT                   VLIFLALDVLFMAGGGTAVGAHLGGALFGFLYAKAEQRGLDLAGWARIFFQPRRARRGR
FT                   QPVTAETGRMLRRVGAWMEQRRGAAAEGRSSSAEERSLEEEVDRILDKISAHGYDSLTE
FT                   EEKRILYEASRR"
FT   gene            295739..296854
FT                   /locus_tag="Rmar_0278"
FT   CDS_pept        295739..296854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0278"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="KEGG: bcy:Bcer98_3006 4-hydroxy-3-methylbut-2-en-1-
FT                   yl diphosphate synthase; TIGRFAM:
FT                   1-hydroxy-2-methyl-2-(E)-butenyl 4- diphosphate synthase;
FT                   PFAM: IspG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47184"
FT                   /db_xref="GOA:D0MDJ1"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDJ1"
FT                   /inference="protein motif:TFAM:TIGR00612"
FT                   /protein_id="ACY47184.1"
FT                   /translation="MERPRRWSRPVMVGNVQIGGGAPISVQSMTTTKTHDVEATLAQIR
FT                   QLAEAGADIVRVAVPRPEDAEALRDIVQGSPVPIVADIHFNYQYALKAIEAGVAKVRIN
FT                   PGNIGKEEWEREVLLAAKEKGIPIRIGVNSGSLERDLLDKYGYPKPEALFESAMRHVEI
FT                   CRKHGFEDIVISVKHSDVYYMIQAYRLIAERTDFPLHLGVTEAGSFVSGSIKSAIGIGA
FT                   LLAEGIGDTIRVSLATDPVKEVEVAHQILKALRLGPPGVNIIACPTCGRLTGDLFSIVE
FT                   AVEEAVKARKFKKNLNVALMGCAVNGPGEAAGADLGISLGRGRAHLFIRGKVVRVVPED
FT                   QIVDAVLEAIEQWEEMPDETPAQANGQADAS"
FT   gene            297091..298146
FT                   /locus_tag="Rmar_0279"
FT   CDS_pept        297091..298146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0279"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: bcb:BCB4264_A4790 catabolite
FT                   control protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47185"
FT                   /db_xref="GOA:D0MDJ2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDJ2"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACY47185.1"
FT                   /translation="MGLTIYDIAREAGVSIATVSRVFNNSPRVAPHTRKRVLEVARRLG
FT                   YQPHVSAQSLARRQAQTVAAIVPMLTNYFFVEVLRGLQDRLAETNFDLLVYAAPTLSDV
FT                   DAHLERALQRGRSAGVMIFSTPMSPERVERLQRSRQPVVLVDSFHPDFDSVSIDNEQGG
FT                   YLAARHLLEHGYRRIGLLMAHPDSVPARERRHGYERALREAGLEPDPDLIVASTDPHNH
FT                   GYTEEGGYEAMKQLLERTPRPEAVFVVSDIMALGALRAVEEAGLRVPDDLGLIGFDDLR
FT                   VSRFLGLSTLRQPMYEMGKLAAEKLLRRIAELELPVTSTVFAPRLICRRTCAPGARDGQ
FT                   PETAALSQNQT"
FT   gene            298170..299828
FT                   /locus_tag="Rmar_0280"
FT   CDS_pept        298170..299828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0280"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: ppd:Ppro_3588 PpiC-type peptidyl-prolyl cis- trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47186"
FT                   /db_xref="GOA:D0MDJ3"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDJ3"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ACY47186.1"
FT                   /translation="MGLLLLAGCHAGSAQQTLLAEGPGVHITADAFREAYLDYLLRTGQ
FT                   TDSPRLRRLFLEQMIREALVAYEARRQGLDRTPAYEEEARAVETKLLVEAYARRVLYDT
FT                   VRVREAELAEAFVRINTEVRARHLWAPTRAAAESLYARLQAGASFEELAAGVFRDTALA
FT                   RSGGDLGWFSFDEMDPAFEDVAFRLRPGEISSPVRTAYGYSIIQVTDRFTKPILTETEF
FT                   AQKRPLLERYLRYRKQQAAREACARSLADSLQIRFHEATLRRLYDRIAGRVTQEEMEGT
FT                   TEDWLQEPLLTFGPAAERVTWTVADFREQARRTSRAQREAAARSPEALEEFARGLVVRH
FT                   VLAERARAAGLHRSPAFAQARQEALDRWLYRYVRQQVESGAAVPEDTLRAFYKAHREDF
FT                   RMPARRAVWEILVPTEAEAQRIRTLLTATPFEELARHYSRRPGAAATGGYLGFVAEAQL
FT                   GAAGKAVFAAREGEVLGPLRIADGYVLLKVGAEQPERPMTFEEARPLIERQLRPFFVRR
FT                   RWQEHLAELAARHADRITRHLSRLDTLRLTSPTDA"
FT   gene            299859..302717
FT                   /locus_tag="Rmar_0281"
FT   CDS_pept        299859..302717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0281"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: ank:AnaeK_0281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47187"
FT                   /db_xref="GOA:D0MDJ4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDJ4"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ACY47187.1"
FT                   /translation="MKTQAIISKALIFFAGLLLVGGPIGSALAQTTGKITGRVIDAATG
FT                   APLPGVSVYIEGTTLGAATDVDGEYVIIGVRPGTYTVVASFVGYATERREGVQVGSGLT
FT                   TRVDFALREEVIQGEEIVVVAPPITVRKDLTSSEARVTAETIDRLPVQEVSQVLTLQAG
FT                   VTERGGLHIRGGRASEVVVMVDGVPVTDNFDGSTAVQLENEGIQELQVISGTFNAEYGN
FT                   AMSGVINVVTKEGRSDRWAGSIKTYSGSYLVFGEGGEAYLRGVEVERYTRQGIQYRDVD
FT                   PYGYLPINPTHYYNFEAALEGPIFTPRLTLFGLVRYFHNDGWLYGARMFNMDGTYGDSS
FT                   LVPMNTYSKLSWQGNLRFQVTPNLFLNLIGLGSVTRSRPYDLYWRWNPDGRTRNYDLGY
FT                   NLKLQLKHLLSSRTFYTVHLATFRRHAWSRRFDDPLDPRYNGLAILTPDSIEVAPGVWV
FT                   PYVTGGGRFARGGMDMNHFERTSQAYFAKADLTSQVARNHLVKLGAEVRIDRLDFTAFS
FT                   LIPATDAEGNVIQPFQPAIPPETSPQYQHYEDVSPITASAYVQDKIEFEDFVVNVGLRF
FT                   DYFDARTPVPADPEDPNIYFPFKKIHIYRDLNGDGVITVDEEREDNRYTLEERETFWWK
FT                   EPKPKFQLSPRLGISYPITEAGVLHFSYGHFLQIPTLNLLFAGYGYKIQNQSGQYGPYG
FT                   NPDLDAQRTVMYEIGFRQGLGPFLFDVTAYYRDVRDWVSTSTPIETEIPGVVYVIYTNR
FT                   DYASTRGVTATFSRRFEDGWGFDVSYTYQVAEGSNSNPDEEFFARLNNQQPTLTLLPLD
FT                   WDQRHKVAAAFYLGGKNWGASMVSVWGSGFPYTPSFPEAAIAGPDVPPTFPRNARRMPS
FT                   TWQVDLYAYRDFEIAGVRPRLFVQVYNLLDRRNPVAVFSDTGRPDVTLPQQQAASFDPG
FT                   YFVRPEHYSEPRRLHVGLELRF"
FT   sig_peptide     299859..299948
FT                   /locus_tag="Rmar_0281"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 30"
FT   gene            302731..306519
FT                   /locus_tag="Rmar_0282"
FT   CDS_pept        302731..306519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47188"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDJ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47188.1"
FT                   /translation="MRKRLFLIHGLVLILLAGAADRSAVRAQTIERGHVPSKERVDPLE
FT                   RRRDDIDGNNVRATITNWLQTAQSGNPGDFWYEWPKNTRRIYVSLTQLWVGAQVKANVG
FT                   SNPGQTLYIVDVADFRQNRFGGTNSWTFEPIKGYVNPAGSEYGIAQSDDPESWPPFWPD
FT                   KLADKNDPGWRGSWNGFFGKNIFNADQEFFFKAGDDQYDRYLNAYRPDSTDPSRGGLGL
FT                   IVEARYMAWTQILIDDVVFLLYEVKNDGTEDLERVGFTVWLADCVGGDCGDDIPFFDIL
FT                   EDVAFMTDRDGVGDQNFGPDPVGVAAITFLETPGNGIDRIDNDADGSTGKPDCSVAECN
FT                   SPVVPEAFLEGENPLNGIDDNNNGLIDENASHVPFQAEQGSSPGVGYADYIDNDDDGEA
FT                   DSPVVTEAMVAAAASDAWNRWPPNPESDPLQQRADGRPIVHLVGVGQEDVGHGFKDGID
FT                   NNNTCDAQGHILAEPGSPRVTQEMIDAAASDPYRRYRLPGTDIILYDVGPEDLGKCYAD
FT                   GVDNDGDGAVDEGIDEGIDEMIDERRDDGLDNDGDWNPLRDDTGLDGVAFSGDPGEADG
FT                   LPTSGAGTPFPGERNIDKTDVSESDQIGITNVQVFGANTLDLSNTADQTLFNTFMLPGD
FT                   LELERPPAGDNDLAVSSGLFPLRAGQIERISLAIVLAANRTEALKGRDYALSAYSEDYQ
FT                   FAQAPLTPTVVAVPGDGRVTLYWDSKAEESVDSYLESIGLNGRDFEGYRIYRATDPAFL
FT                   DALVITDGFGNLTFRKPIAQFDLKDGIRGFHPVDINGIKFYLGDDTGIRHVFVDTTVTN
FT                   GITYYYAVTAYDFGAAEANIAPTETPIRIRRLPDGTIETGPNVVRVTPTAPVAGYRNAE
FT                   LENVDGFLPRVQGFTTSRIGYQIIDPRAVRDGARYRVVFEDTLIPGTRTAPDTLTTKNF
FT                   SLIDITDPDNPDTLIRRSTAFKPGREVPIVDGFQLIFFPDPYVVQDRTKSGWNNPDVYD
FT                   PVMEPFVQPPFVKGLRNPADYRVEIVGDGEVMSEPLRIGAQVIPARPTNVRVVNISTGQ
FT                   EVKFAFLDRDGSDVDRDTARFTANPEAKPPASDYLVLIEPLPGGGEGVTWRISLDITQT
FT                   GRRNPQQGDVATLITRKPFLSSDVFEFTARGPTADREAARSLLDQIRVVPNPYIATNRF
FT                   EQQNPYSTGRGPRAIHFIHLPPQATVRIFTISGRLVRTLRLNEGSNDGLDAASLMNGTL
FT                   VWDLLTEDGLEVSYGVYLYHVEAPGIGEKTGTFAIIK"
FT   sig_peptide     302731..302814
FT                   /locus_tag="Rmar_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.727 at
FT                   residue 28"
FT   gene            306525..307565
FT                   /locus_tag="Rmar_0283"
FT   CDS_pept        306525..307565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0283"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dal:Dalk_0288 membrane protein involved in
FT                   aromatic hydrocarbon degradation"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47189"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDJ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47189.1"
FT                   /translation="MRGHRSIAATLWLLVLTAGVAQAQFASETRTVTRAGTAAAEFLSI
FT                   PIGARATAMGSAVSATIDDPTAIYWNPAGLTGLTRGTFTAEYAQWLADISVNYVAVATP
FT                   LGAGTVGIGVTAVRTPEMEETTVEQQEGTGRTFTAASYAVALSYARALTDRFSIGGSVK
FT                   FITERISFSTASGLALDIGTLFVTPFRGIRLGAAITNFGTKMRMRGDDLLTIVDIDPNN
FT                   RGNNTSNRAELRTDPFDLPLTMRIGLAGEVWQRDGYRLTLAVDALSPSNSSQYVNVGAE
FT                   LGLLGDLLLLRGGYSELFLTDSAHTFSLGGGLRYRFGAFHVTFDYAYEGWRYFNGVNRF
FT                   TLMVGF"
FT   sig_peptide     306525..306596
FT                   /locus_tag="Rmar_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.920 at
FT                   residue 24"
FT   gene            307611..309650
FT                   /locus_tag="Rmar_0284"
FT   CDS_pept        307611..309650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47190"
FT                   /db_xref="GOA:D0MDJ7"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDJ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47190.1"
FT                   /translation="MVSATTKIGGRLALLLLAAVLMAGQALAQRTVTLRLNTATLPDTT
FT                   GTADGLIQVRGQITNQDWPFTLPDGNVISWDDQTTLKPMNVGGDYWEISFQIPDNEELQ
FT                   FKFFSSQAEATGIGGWEDGGNHVLAAGTGDTTLVLHFFEKGFDTTYAWRPWEQKPDTVA
FT                   VWFRVYVSTEEGILNGYDPNAENIVVGVRGDPLNGAGPLDWGTTRVILQRESSDPNRPG
FT                   YHLFSGVAYYPASLAGTTQEYKFFIEPNGWELNGKPNRSFVIPDKDTTLHWVYYGNTKP
FT                   VQQLVSAEVIFTVDIDPLVNAGLFDKQRGDTIIVLGGFNGWTNCLSTNPDACALFESID
FT                   PTQYTSSITLRAAPNSEVEYKFYVDFEAEGWPDGWEEPLDYGGSNRRFVFTGEDPLDLG
FT                   VQFFNDVREGNVIPEGTQIDVTFQVDMSPALNFQVKRAFDPEKDSVYVVFEDPLWRLTQ
FT                   AMPLGLSDLEPLLLSDEDGDLIYTGTLTVTGPTYNGIGFRYRYGNVLDGYENEGPVGDF
FT                   YGPGRRRYQYILPSAAKNWPTEYTMPLVQFQESGPLPFECNPTADVASLPQDVQDLCYP
FT                   AGTSPTAVEPIDGTRPERFALSRNYPNPFADRTTFEYTLPETQPVRVRVYDLLGRVVAT
FT                   LVDEVQPAGTYRVTFRAEGLSSGIYVYRLETPSGIFARKMMIVR"
FT   sig_peptide     307611..307697
FT                   /locus_tag="Rmar_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            309925..312897
FT                   /locus_tag="Rmar_0285"
FT   CDS_pept        309925..312897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0285"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; glycoside
FT                   hydrolase family 13 domain protein; SMART: alpha amylase
FT                   catalytic sub domain; KEGG: mes:Meso_2421 glycoside
FT                   hydrolase, family 13- like"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47191"
FT                   /db_xref="GOA:D0MDJ8"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDJ8"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACY47191.1"
FT                   /translation="MRRFWLFALLFWYGATVASGQVVWTDPAVVRVDRPVTIYFNAKEG
FT                   TGGLAGYTGDVYAHTGVITNESRTDTDWRYVKADWGENRADIRMERIGEDLYRLHIPDI
FT                   RAYYQDYSGTPPPGAPPWDNIYDEQILKLAFVFRNADGSREGKDVGGRDIFVDVAPPGL
FT                   AVTFAAPSVTPLRPLIAPRDTSVEVVAVADPGAGATLTAFRLLVEGVEVAQTTDDTLRY
FT                   TLTLNVPGRFDVLAIAENSLGEADTAAFYAVRNPAVEDRPRPPGIEDGINYDPNDPTRV
FT                   TLSLYAPGKSFVYVIGDFTNWEVDPAYFMYRDAPRPDSVHWWITIEGLTPGQEYAFQYF
FT                   IDGELRLADLFAHKVLDPWHDPFIPSSTYPNLKPYPTGKTEGIVAVLQPGAPQYQWQVT
FT                   DFERPPAHELVIYELLLRDFVAKHDYATLIDTLDYLERLGVNAIELMPVAEFDGNISWG
FT                   YNPAFHLAPDKYYGPADDLKRFVDECHRRGIAVILDVVYNHATGNSPLVQLYGPTADNP
FT                   FINIPARHPFNVFYDLNHEHPYIQYWLDRANRYWLEEFRVDGFRFDLSKGFTQKYTDND
FT                   VGAWSAYDASRIRLLKRMADAIWAVDSTAYIILEHFADNQEEKELAAYGQDRGRAGMLL
FT                   WHNLNRAFSQSVMGYLNDPNFSSDLTTIYYKNRGFPTPNLIAYMESHDEQWLMYRMRAY
FT                   GARQGSYDVRSLPVALDRMKLAGAFFFTVPGPKMIWQFGELGYGYGERGEQCLEGAGDS
FT                   CPSIAPGRIDPKPIRWDYRNDPLRMKLYKTWAELLRLRREHAVFRSPETQVRMRLQHGV
FT                   PGRWLSLTHPELSVVVVGNFGLEPLVVTPTFPQTGTWYDYFNGDSLVVDDPNTGIELLP
FT                   GEFRLYTNRYVGQAEPGLITVGVASGDASTRPERVRLETPFPNPFRTQVTLRYALPEPM
FT                   RVKLAVYDLLGRRIATLADGLQAAGRHTITWMPEKLAAGLYLVRLEAGGHTETRPVLFA
FT                   P"
FT   sig_peptide     309925..309987
FT                   /locus_tag="Rmar_0285"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.810 at
FT                   residue 21"
FT   gene            312933..314768
FT                   /locus_tag="Rmar_0286"
FT   CDS_pept        312933..314768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0286"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: bha:BH2927 maltogenic
FT                   amylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47192"
FT                   /db_xref="GOA:D0MDJ9"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDJ9"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACY47192.1"
FT                   /translation="MRRLLLLTLLLIGCAPERPSGPRVPDWAADAVWYQIFPERFWNGD
FT                   PTNDPTRESLEYPPALPEAPPSWRISPWTGDWYARDDWEREMGDDFYESYAVFHRRYGG
FT                   DLQGVIDRLDYLQELGITAIYFNPVFYARSLHKYDGNTYHHIDPYFGPDPEGDLALMAQ
FT                   ETEDPNTWHWTAADSLFLRLIREAHARGIRVIIDGVFNHTGRDFFAFADLRRRQQDSPY
FT                   RDWYIVYSFDDPATPDTNEFDYEGWWGVKTLPVFADNEDGTDLHPGPKRYIFHATARWM
FT                   DPDGDGDPSDGIDGWRLDVTNEVPVGFWADWNAYVRELNPNAYTVTELWQDASEMIVQG
FT                   GFSATMNYYAFAFPVKAFLIDFGLEAPEFARLLDERRNRYPVAVQYAMQNLIDSHDTDR
FT                   LASMIVNRDPADVHREQFGYDRDNSPRHNPDYDVQAPDATDRAIQRLVALFQMTYVGAP
FT                   MIYYGTEAGMWGADDPDDRKPMVWPELTYADEASDPLGRPRRPDPVRFDSTLFRFYRQA
FT                   IALRKQSAALRRGTFEVLMADGGLFVFRRALADEQVLVALNREENAREVALSLPEADRF
FT                   RVRLATVSEGYAVTATADTLRLTLPSLSGLVLVGQ"
FT   gene            complement(314826..315278)
FT                   /locus_tag="Rmar_0287"
FT   CDS_pept        complement(314826..315278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plu:plu2152 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47193"
FT                   /db_xref="GOA:D0MDK0"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDK0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47193.1"
FT                   /translation="MAILTVPKVLREKLGDDGVEALIALLNEAAHHERNNLLGILEERF
FT                   ERRVTEEGKRLEVQMAETEKRLDYRITEEVAKLDNRITEEIAKLDSRLTEEVACLDRRL
FT                   TEEVARLETRLSTQMAATRADLIRWMFIFWVGQIGTLVALLFAFLR"
FT   gene            complement(315340..317058)
FT                   /locus_tag="Rmar_0288"
FT   CDS_pept        complement(315340..317058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0288"
FT                   /product="protein serine phosphatase with GAF(s) sensor(s)"
FT                   /note="PFAM: Stage II sporulation E family protein; GAF
FT                   domain protein; SMART: protein phosphatase 2C domain
FT                   protein; GAF domain protein; KEGG: sus:Acid_3432 serine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47194"
FT                   /db_xref="GOA:D0MDK1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDK1"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ACY47194.1"
FT                   /translation="MSDAPTVRPTDRFDLRALYEASRLLSTSDDRAAVVRNLLLSTLSK
FT                   LLVTRGAVLLFDPLMQRFRVADARGPIDLAPGTELALPLPDTDRLLHDAEVPEALRARG
FT                   LCLLVPLMFRHRLLGLLVLGRKATGQPFSKRELEFVQALATLSAAALHNALLIEELQQA
FT                   NRDLDLRLQQLDTLFELAQEFNATIDRNRLAHLLSLALMGQLLINRYLLLVRIEAADGN
FT                   ATFEVLASRGLPSTLPPERIEQLGRLEQPLLLEEAPPAWDWLRAFQLYLVLPIRQQGVT
FT                   QAVLGLGRRINGAPYGPGELEFLYALGTLAASAIRNTFLIEAQIERQHLERELQQARQI
FT                   QQRLLPRRLPEVPGVELAACALPSQEVGGDYYDVLREPDGSLRLAIADVAGKGMAAALL
FT                   MANLQACLHVLVPLESTLERSTSQINRVVCENTEADRFITFFQARYTPSTRQLAYVNAG
FT                   HNPPMLLRASGRAERLSRGGLLLGVLPDARYEAERLSLAPGDLLVLFTDGVTEAMGPGD
FT                   EPFGEDRLLACLQAHRHASARAIVEAVRQAVEQFTGRPANSDDDFTLVVLKVLPS"
FT   gene            complement(317055..317567)
FT                   /locus_tag="Rmar_0289"
FT   CDS_pept        complement(317055..317567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0289"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: afw:Anae109_2317
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47195"
FT                   /db_xref="GOA:D0MDK2"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDK2"
FT                   /inference="protein motif:TFAM:TIGR00040"
FT                   /protein_id="ACY47195.1"
FT                   /translation="MILGILSDTHGFFHPALPEAFAGVDLILHAGDVGSPEVLERLEAL
FT                   APVHAVYGNIDGPELRRRLPVDLWLTLEGLRIWMTHIGGRPGRWAPGIAARLRQERPDV
FT                   FICGHSHILRIERVPSLGGMLYLNPGAAGREGFHRVKTCVRLHLADGRARQAEVVHLDE
FT                   IPEASAP"
FT   gene            complement(317651..318592)
FT                   /locus_tag="Rmar_0290"
FT   CDS_pept        complement(317651..318592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47196"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDK3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47196.1"
FT                   /translation="MLLLLGTGLSDPAAAQAPAQLNDGLYQSETARRSFFDGYAVGTEL
FT                   FCCARTLNQESGPASSGLFGLPLGLRFHLNYALGDRLDLGAVLNASGSTTGRTLAVDWI
FT                   LLKFYQASENDSYAFRLAVDPSVDGMLGFPQIDVALLTSSLLSPFVVANYAIGLRRVRT
FT                   GYERWTPLEEAEAQPNAALIAADPPPRFEITYQQAFGWELHLLMSYALLLNPARSNVFV
FT                   GLTGTARYYNLMESARETRTVTEGAGKRGAEEATVWERTYNGGIVWAQGGLEYNRPSYQ
FT                   LSPFVGLPLLFWSSETEEAAPRVQAGLRLTLR"
FT   gene            complement(318735..319418)
FT                   /locus_tag="Rmar_0291"
FT   CDS_pept        complement(318735..319418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0291"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bat:BAS4507 metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47197"
FT                   /db_xref="GOA:D0MDK4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022877"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDK4"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACY47197.1"
FT                   /translation="MKLTYFGHSAFQIETNGTTLLFDPFITGNPHTQGVVTADQLRPDV
FT                   ILLTHAHGDHWGDTLAIARRTNALLIANFEITQYAQKHGHSNVHPMNTGGSWQFPWGRV
FT                   TQTYARHSSSFPDGTYGGNPNGYILEIEGKVIYDLGDTCPFAEMAWYGEDYNIDVALMP
FT                   VGDLFTMGVEGAVRAAKMLKPGLIIPIHYNTFPPIQIDIEQCRKRLEQEGFKVQVMKPG
FT                   ESLTL"
FT   gene            complement(319537..319891)
FT                   /pseudo
FT                   /locus_tag="Rmar_0292"
FT   gene            complement(319901..320137)
FT                   /locus_tag="Rmar_0293"
FT   CDS_pept        complement(319901..320137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0293"
FT                   /product="protein of unknown function DUF433"
FT                   /note="PFAM: protein of unknown function DUF433; KEGG:
FT                   rpc:RPC_2761 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47198"
FT                   /db_xref="GOA:D0MDK5"
FT                   /db_xref="InterPro:IPR007367"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDK5"
FT                   /inference="protein motif:PFAM:PF04255"
FT                   /protein_id="ACY47198.1"
FT                   /translation="MEKPEVLWTRIEVNPRIMLGKPVIRGTRIPVELILRKLSEGATEE
FT                   MLLEAYPHLTREDIRAALAFAAALLANEESLTL"
FT   gene            complement(320225..322216)
FT                   /locus_tag="Rmar_0294"
FT   CDS_pept        complement(320225..322216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0294"
FT                   /product="oligopeptide transporter, OPT family"
FT                   /note="TIGRFAM: oligopeptide transporter, OPT family;
FT                   oligopeptide transporters, OPT superfamily; PFAM:
FT                   Oligopeptide transporter OPT superfamily protein; KEGG:
FT                   xfn:XfasM23_1386 OPT family oligopeptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47199"
FT                   /db_xref="GOA:D0MDK6"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDK6"
FT                   /inference="protein motif:TFAM:TIGR00733"
FT                   /protein_id="ACY47199.1"
FT                   /translation="MERPASVSTGPYIPPDRSLPEITVKALILGVILAAVLAAANAYLG
FT                   LKVGMTVSASIPAAVISMGVLRLFRRANILENNIVQTAASAGESLAAGVIFTLPALILL
FT                   GYWQGFPYLDTLAVAAAGGVLGVLFTIPLRRALIIEGGLRFPEGIATAEVLIAGDEGGR
FT                   GVRDIAVAAVAGGLVKLAQTGFRVLAGTVDGAVQVGRALFGFGSELGVALLGVGYIVGL
FT                   RIATLVFAGGLISWLFGIPIYTALHGLPEGVEGYEAALQIWSTKIRYLGVGAMAVGGLW
FT                   ALLSLIRPIRDGVRASWQAVREARQGHQVAIPRTERDTPIHFVLAGTLAMALPLVFVFL
FT                   HVIDQPHLGASDGTYAATIAFGVLFALVAGFLFSSVAGYMAGLVGSSNNPISGVTIATI
FT                   LTASLLLLVLLGSQIDLQVNAERATAAAATAILIGAVVCCAAAIAGDNMQDLKTGHLVG
FT                   ATPYKQQIMQMVGVLTGALVLAPVLELLFNAYGLGGVFPREGMDPSQMLAAPQASLMQS
FT                   VAQGVFARSLDWTIIGIGALIAVAIIVADQVLKARGSSFRMPVLAVAVGIYLPLELSVP
FT                   IFLGGLVSYAAGRALGGRQESSRGLLFASGLITGEALVGILLAIPFALAQSTDVLRLVP
FT                   DSFASVAHALGVLVFLGFVYWLYRVART"
FT   gene            complement(322221..323858)
FT                   /locus_tag="Rmar_0295"
FT   CDS_pept        complement(322221..323858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0295"
FT                   /product="Laminin G sub domain 2"
FT                   /note="PFAM: Laminin G sub domain 2; SMART: Laminin G;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47200"
FT                   /db_xref="InterPro:IPR001791"
FT                   /db_xref="InterPro:IPR006558"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDK7"
FT                   /inference="protein motif:PFAM:PF02210"
FT                   /protein_id="ACY47200.1"
FT                   /translation="MKTRARVLLLAAVLASCLRAGTARAQLQALWSGERLQAGQAANLF
FT                   ARWEGEVPFYGTLLDVPPDWSVRRAWVVRPGRGPMPLRLDTLTSGRFRLRPDRPIDGPL
FT                   VLCIETTPGGPGLALWQLASLEPSESSAKKLEPRTAEVQRQALFVQPADTENPRNYVLA
FT                   VRRGARPLLVTDTLLRRLDLRHPFTVALWLKSTDRDAVVLSTWRGDEQQPYPIELVLDA
FT                   AGFLRAYRGRPGRHQALITPRPVADGSWHHVALSYDPASGWTRLYLDGRPADSLYVPDV
FT                   TSIDPPEALALGGRPGQMETDFGGLLDAIVLDRHAWSAAQVRRLFRRADPPADGLRLDF
FT                   EAATLRLPPGMRRRRADLFFFEPLQHLQALSTDDGQVLLSWTCTDRQTRAFVVERSTDG
FT                   RDFAMIARVPADCSGLPFTFRDPSPPDAPVLYYRIQQELEGGVLYPSAVLKLGRAPVQS
FT                   GRALLVGNFPNPFQGRTTIQYELHEPMPVRLSIWDLSGHEVRVLIDAVQSPGRYTLTFD
FT                   AADLPSGTYFLRLETPEGVQTHKMILVR"
FT   sig_peptide     complement(323781..323858)
FT                   /locus_tag="Rmar_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 26"
FT   gene            323989..325116
FT                   /locus_tag="Rmar_0296"
FT   CDS_pept        323989..325116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0296"
FT                   /product="phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="KEGG: lch:Lcho_3976 6-phosphofructokinase; TIGRFAM:
FT                   phosphofructokinase; PFAM: phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47201"
FT                   /db_xref="GOA:D0MDK8"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012829"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDK8"
FT                   /inference="protein motif:TFAM:TIGR02483"
FT                   /protein_id="ACY47201.1"
FT                   /translation="MPRRLRIGLLTGGGDCPGMNAVIRAVTKSLILQANAEVIGFEDGY
FT                   EGLIEGRFRTLEFQDVSGILTRGGTILGTSNRANPFRYYRRGEADVSAEVIALYRELEL
FT                   DGIVAIGGDGTMTIAHGLSERGLRFIGVPKTIDNDIWGTERTFGFDTAVHIATEAIDRL
FT                   HTTAQSHHRVMICETMGRYAGWIALYAGVAAGADVILIPELPFDVEVVAEVCRERESDG
FT                   HRFTIIVVAEGARPEGGTFHVRERVPESPDPIRLGGIGYELERQLRDRLRSEVRTTVLG
FT                   HVQRGGTPTAYDRSLASAFGAYAAALVQAEQYGCMVALRDGRLTTVPLAEVAGRTRTVP
FT                   LDHPMLGAALAVGTSLGVRALTSPLVGAEPTTPLA"
FT   gene            325150..326070
FT                   /locus_tag="Rmar_0297"
FT   CDS_pept        325150..326070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0297"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; dTDP-4-dehydrorhamnose reductase; NmrA family
FT                   protein; KEGG: gsu:GSU0385 NADH dehydrogenase subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47202"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDK9"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACY47202.1"
FT                   /translation="MKVYMTGATGFVGRYVLQALRAAGHEVRCLVRRPDRPLPFEDEGV
FT                   EKVGGDLLRPETFAGTLDGCEAVVHLVGIIAERPRQGITFDAVHRRGTLHMVEAAQQAG
FT                   ISRFIHMSANGARPDGTTAYQTSKWEAEEIVRHAGFAHWTIFRPSIIFGDPKGAPMEFV
FT                   MELARRLVRPFPVLPVFGDGQYRLQPVAVEVVAAAFAQALTRPEAHGQTYCVAGPQPLT
FT                   YDEILDVIARALRGRPKPKLHLPLGPVRLLVGTLGRIGLLPVTPEQLAMLIEGNTCDPS
FT                   AFYRDFDVPQVPFTPETIAYVRQAA"
FT   gene            326161..327081
FT                   /locus_tag="Rmar_0298"
FT   CDS_pept        326161..327081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0298"
FT                   /product="NADP oxidoreductase coenzyme F420-dependent"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   KEGG: sat:SYN_02774 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47203"
FT                   /db_xref="GOA:D0MDL0"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDL0"
FT                   /inference="protein motif:PFAM:PF03807"
FT                   /protein_id="ACY47203.1"
FT                   /translation="MSVQQPVVAIVGAGAVGRVLGRSLRAVGYPIAAVISRNPASSREL
FT                   AAQVEAPVASAALEDLPGEVRLVFCCVPDDALPGLAEQLALVPHDWPRTVVAHTSGALP
FT                   ARVLEPVGRRGALLLSFHPVQSFPRQGPPPSLAGVAIGLEGDSEAVALGREVARALGAR
FT                   PIELSPETKPRYHLAAVLASNGLGALMAMAGEVLASIGLSRPEAHAMLLPLVQGTLHNL
FT                   EQLLPEEALTGPAVRGDLGPITQHLETLQQHLPHLLPVYAALTTEMIRVGVRSGRLAPE
FT                   RATALLDRLQEALDTRSDIPPERLP"
FT   gene            327159..327713
FT                   /locus_tag="Rmar_0299"
FT   CDS_pept        327159..327713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cti:RALTA_B0204 exonuclease SbcC"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47204"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDL1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47204.1"
FT                   /translation="MRIRRRRAAALRKSWTQSFETPTVELATIEHPTLERLETLLRGEE
FT                   AATLAFQSVLAALLPMLERVLQREQQAADASLSLAQRETLQEMTETLATAIQMLRGALN
FT                   ERGQQVLRYERPVESGPPERSWWFALSEALEAVEDALQRIPPLVRAQPRSSLSRRVGAL
FT                   LLRLLRQHQRHLLHEAREWIE"
FT   gene            327688..328083
FT                   /locus_tag="Rmar_0300"
FT   CDS_pept        327688..328083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47205"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDL2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47205.1"
FT                   /translation="MKHVSGSNNTEPIARWLAEADQELEARWARLLAYLERLVGRTPTG
FT                   IEQVLFLIGIQERGRGFEPGMSREQKQEVIMEGARHAFAAIGLYRRVANDPTAWEPAFS
FT                   PWPELSRDDQEKLLRIAILEYFKPLLS"
FT   gene            328080..328862
FT                   /locus_tag="Rmar_0301"
FT   CDS_pept        328080..328862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0301"
FT                   /product="peptidyl-prolyl cis-trans isomerase cyclophilin
FT                   type"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47206"
FT                   /db_xref="GOA:D0MDL3"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDL3"
FT                   /inference="protein motif:PFAM:PF00160"
FT                   /protein_id="ACY47206.1"
FT                   /translation="MNIRWLAGVALAFFVAACQSAPSTPSVEADSLAQATDTLALPATN
FT                   YYEIRTPLGRMVVRLYDETPLHRDNFKRLVAAGFYDSTTFHRVIDGFVIQGGDPNSKDA
FT                   DPSNDGTGGPGYTLPAEIRPGLFHKRGALAAARQGDEVNPERRSSGSQFYLVVGRTFDE
FT                   ATLDEIEVYLREQIPDPDFAFPDSVRQLYQTVGGAPFLDGLYTVFGELVEGFEVMDAIA
FT                   RVPTPRSTGRQAPPTMLDRPLQPVPMTIRPLENYSPGS"
FT   sig_peptide     328080..328142
FT                   /locus_tag="Rmar_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.709 at
FT                   residue 21"
FT   gene            328984..330555
FT                   /locus_tag="Rmar_0302"
FT   CDS_pept        328984..330555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0302"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: bha:BH0098 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47207"
FT                   /db_xref="GOA:D0MDL4"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDL4"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ACY47207.1"
FT                   /translation="MKRVLTEQELERRRARQQLEAMGINPYPYRWEVTAHAAEILQNFD
FT                   DERHQPREDGPAPEPYEVSIAGRIMTRRIMGKAAFFDLQDETGRIQVYVRRQDLPEGFY
FT                   DQVFKKLLDIGDIVGVEGFVFRTRMGEITVHARRLELLAKALRPLPVVKEQDGKVYNEV
FT                   TDKEFRYRQRYADLIINPEVREVFRKRARMITTIRRFLDERGYLEVETPILQPMYGGAS
FT                   ARPFITYHNALDMQLYLRIADELYLKRLIVGGYEGVYEIGKDFRNEGLSRFHNPEFTML
FT                   ELYVAYKDYYWMMDFVEELLEHVATEVTGSPEVQWGEHTISFRRPWPRIPMFEAIKERT
FT                   GYDLYGKSRDELAEIARKLGLEIDDTMGSGKIIDEIFGEFVEPHLIQPTFIIDYPIELS
FT                   PLAKRHREKPGLVERFEVIVGGKELCNAFSELNDPDDQRARFEEQARLRAAGDEEAMQI
FT                   DEDFLRALEYGMPPTAGLGIGIDRLAMILTNQPSIRDVILFPLLRPEQPAVPAGSDGAE
FT                   KEASES"
FT   gene            330563..331843
FT                   /locus_tag="Rmar_0303"
FT   CDS_pept        330563..331843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0303"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sus:Acid_5839 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47208"
FT                   /db_xref="GOA:D0MDL5"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR022324"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDL5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACY47208.1"
FT                   /translation="MEAAPSRPVTRAASATGYVALVRRNVHFRRLWLGNLISLLGDWFN
FT                   TIALYTLVSELTGSPFALGGVFLTKLLPWALASPLAGLLVDRFDRRRLMIGADLVRAVI
FT                   VLGFLLIDEPGEVYLVYVLTTLQVVVTAVFQPAKSASIPNIVRTDELLTANALMSATWS
FT                   VMLALGAASGGLVTAWLGTAPVFVIDSLTYLVSAFFIYRTVIPQQTAPAAGGLLRTARR
FT                   ELLDGWRYLTTHPGVGRIALAKSAWALAGGGLVYMLALIGEAIEPTAQAAGIGWLFAAR
FT                   GLGTGIGPVLARAIFRDARRWPAVLGWSIVLSGLCYGVVGLQDWTYAVAPAVLLAHAAS
FT                   GANWVLASVLLQQRTEDAFRGRVFATEWLGVLFSESCSILAASMLLEWQVLSLREAVLA
FT                   FALVQGLIGLAWLAVIVPRERRAYSGV"
FT   gene            complement(331828..332808)
FT                   /locus_tag="Rmar_0304"
FT   CDS_pept        complement(331828..332808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0304"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /note="TIGRFAM: iron-sulfur cluster binding protein; PFAM:
FT                   domain of unknown function DUF1730; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: hha:Hhal_0672
FT                   putative iron-sulfur cluster binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47209"
FT                   /db_xref="GOA:D0MDL6"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDL6"
FT                   /inference="protein motif:TFAM:TIGR00276"
FT                   /protein_id="ACY47209.1"
FT                   /translation="MPGFDEHAQQRLAQALKAEARRLGFDACGISKAEPLDEEARRLEA
FT                   WLKAGYHGTMYWMERHFDKRIDPTRLVEGARSVISVLHNYYQPVAHDPSPETGKISRYA
FT                   WGDDYHEVLKEKLYQLFAWLEAQVGEVHGRAFVDSAPVMDKAWARRSGLGWIGKNTNLI
FT                   NRRMGSFFFIGELIVDVPLPPDGPIPDYCGTCTRCIDACPTGALVQPYVLDARRCISYL
FT                   TIEHRGDDIPPELQEKMGNWIFGCDICQDVCPWNKFKYATSEPRFMPRPGLPDTPLERW
FT                   EELDLEAFRQKFRKNAVKRTKFEGFKRNVRIALQNVRRDTLQTPE"
FT   gene            complement(332933..333886)
FT                   /locus_tag="Rmar_0305"
FT   CDS_pept        complement(332933..333886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0305"
FT                   /product="PKD domain containing protein"
FT                   /note="PFAM: PKD domain containing protein; OmpA/MotB
FT                   domain protein; SMART: PKD domain containing protein; KEGG:
FT                   hch:HCH_00086 cellobiohydrolase A (1,4-beta- cellobiosidase
FT                   A)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47210"
FT                   /db_xref="GOA:D0MDL7"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDL7"
FT                   /inference="protein motif:PFAM:PF00801"
FT                   /protein_id="ACY47210.1"
FT                   /translation="MHTMKPQRYLLLTALTALTILGLTGCRSTPVEVLGVEGPDSLQVN
FT                   QSGTFTATINEDAKPPVEFSWDFGDGSSAAGNPVTHAYTEPGTYTVTVTASNRGGKSTS
FT                   TGSTSVVVYRPPVPAEIISITANPMQPDTRTAVRFSANVRGDQPITYQWNFGDGSTGSG
FT                   ANPTHTYSRPGTYTVTLNVSNNAGSDSRTLSITVRPYEAEYCADVTEMNPVFFDRNSSV
FT                   LNDAARSALQENLQILQDCPNLSVRVEGWAAPGERNPQQLSTDRARAVEQFYTSNGIPA
FT                   SRITTVSRGRVTGVTSKKEGLAQYRRADTIPVRGGM"
FT   sig_peptide     complement(333800..333886)
FT                   /locus_tag="Rmar_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.848) with cleavage site probability 0.540 at
FT                   residue 29"
FT   gene            complement(334174..334428)
FT                   /locus_tag="Rmar_0306"
FT   CDS_pept        complement(334174..334428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0306"
FT                   /product="ribosomal protein S20"
FT                   /note="TIGRFAM: ribosomal protein S20; PFAM: ribosomal
FT                   protein S20; KEGG: glo:Glov_2108 ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47211"
FT                   /db_xref="GOA:D0MDL8"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDL8"
FT                   /inference="protein motif:TFAM:TIGR00029"
FT                   /protein_id="ACY47211.1"
FT                   /translation="MAHHKSAIKRIRQNAKRRARNRYYRSWMRTLIKKVRAAQSREEAL
FT                   PLLNQAKSLLDRLVVKGIIHKNKAANYKRKLEKYVNQLA"
FT   gene            334554..335450
FT                   /locus_tag="Rmar_0307"
FT   CDS_pept        334554..335450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0307"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: gbm:Gbem_3080 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47212"
FT                   /db_xref="GOA:D0MDL9"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDL9"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ACY47212.1"
FT                   /translation="MWPFFKKLLARWDEEVVVLVVEDAYAGAPVPFTLRPLRLLALIGG
FT                   SAVLLAAMLVALVLLTPLRELFPGVATEEMRQRARLSSLRVAALEDSLAVQQEYIARLR
FT                   QLILGEVTPAGEGEARSESPGETGVMLPEAAPTSENWQEHQPPALPVLELAAPTTPNVQ
FT                   PAVLRSDPLLQLQFPVLPPVAGFLTRGFDARSGHYGVDLAVEEGTVVRAIGSGYVIFAD
FT                   WTQAGGFVIIVQHADGYVSVYKHNQRLLKQVGDRVRDREAIALSGNTGEITTGPHLHFE
FT                   LWRHGLAQDPLNYFVIQ"
FT   gene            335492..335950
FT                   /locus_tag="Rmar_0308"
FT   CDS_pept        335492..335950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0308"
FT                   /product="protein of unknown function DUF583"
FT                   /note="PFAM: protein of unknown function DUF583; KEGG:
FT                   rce:RC1_3014 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47213"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDM0"
FT                   /inference="protein motif:PFAM:PF04519"
FT                   /protein_id="ACY47213.1"
FT                   /translation="MSRASGTPAPGQLNLVGEGTVFEGTLRTPHDIRISGKVIGTLYVQ
FT                   GKAIIAAEGVLEGQLHARSADVAGQVQGDLIIEETLLLKDSARVEGRIQTGRLVVEAGA
FT                   IFDGECRMGKIDRVIETKATPSADKEAATPARDAARARKADVEPGAGA"
FT   gene            335986..336228
FT                   /locus_tag="Rmar_0309"
FT   CDS_pept        335986..336228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0309"
FT                   /product="ATP synthase protein I"
FT                   /note="KEGG: dde:Dde_2698 ATP synthase protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47214"
FT                   /db_xref="GOA:D0MDM1"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDM1"
FT                   /inference="similar to AA sequence:KEGG:Dde_2698"
FT                   /protein_id="ACY47214.1"
FT                   /translation="MQEALRALGPYMGLGLQLALGMAFFAVGGYLLDRWLGTLPWLTLV
FT                   GVVLGLVAIVAKLWQVNALLQRRSRRSGRDAAHEK"
FT   gene            336347..336646
FT                   /locus_tag="Rmar_0310"
FT   CDS_pept        336347..336646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47215"
FT                   /db_xref="GOA:D0MDM2"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDM2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47215.1"
FT                   /translation="MEDLWISLMAGAGLAGGYAGVGLWGVRRAWRWPLARFTRWVLGGM
FT                   LVRMIGALLLLAVCIRVFNLHTTALLGGFGGVFILGLILEIWSWHRTALQRTHG"
FT   gene            336639..337841
FT                   /locus_tag="Rmar_0311"
FT   CDS_pept        336639..337841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0311"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+transporting two-sector ATPase A subunit; KEGG:
FT                   afw:Anae109_4487 F0F1 ATP synthase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47216"
FT                   /db_xref="GOA:D0MDM3"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDM3"
FT                   /inference="protein motif:TFAM:TIGR01131"
FT                   /protein_id="ACY47216.1"
FT                   /translation="MGDRTHIQQGWRRTGLWLAVVALFGLIPRPLLAAEEGEGNENISE
FT                   VLIHHTADGYYVALEPFVTIELPRIFLVRTSEGSWRLDAFGSTASALHSGRYVADYEGH
FT                   RYESSAELEELIAAHHHLYAELHPREGELVLDLSITRHYVFGLIAALLVLALFIPVAQR
FT                   YRKGIGRTTAPRGVLQNLAEVFIVFVRDEIARPNIGEKADRFLPYLLTAFFFILFCNLL
FT                   GLVPNLGAATSNLAVTGVLALFTFIIGTIYASKDHWKHIFWPPGVPVFVKPILIPVEIM
FT                   GLFTRHAALAIRLFANMTAGTLVILSLIGLIFMINALFGALVAWMSTLPSVLLTLFISA
FT                   IKLLVAFIQAYVFTLLSALFIGMSVAEHDHEHHEHEEEAGNEPVVHAVPTSDGARVVVH
FT                   G"
FT   sig_peptide     336639..336740
FT                   /locus_tag="Rmar_0311"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.987 at
FT                   residue 34"
FT   gene            337901..338128
FT                   /locus_tag="Rmar_0312"
FT   CDS_pept        337901..338128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0312"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+transporting two-sector ATPase C subunit; KEGG:
FT                   afw:Anae109_4486 ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47217"
FT                   /db_xref="GOA:D0MDM4"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDM4"
FT                   /inference="protein motif:TFAM:TIGR01260"
FT                   /protein_id="ACY47217.1"
FT                   /translation="MEPTALAFLAAGIGAGIVAIGASVGIGRLAASAMEGSARQPEAAG
FT                   DIRTSMIIAAALIEGVALFGLVICFLLAIK"
FT   sig_peptide     337901..338002
FT                   /locus_tag="Rmar_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.611 at
FT                   residue 34"
FT   gene            338238..338753
FT                   /locus_tag="Rmar_0313"
FT   CDS_pept        338238..338753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0313"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+transporting two-sector ATPase B/B' subunit; KEGG:
FT                   afw:Anae109_4485 ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47218"
FT                   /db_xref="GOA:D0MDM5"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDM5"
FT                   /inference="protein motif:TFAM:TIGR01144"
FT                   /protein_id="ACY47218.1"
FT                   /translation="MNLILAANLVSVEPGLIFWKSLTFLLLLFLLYKFAWKPILQALKE
FT                   REESIDTSLRRAERALAEARQIQAENERIRREAEQEAQRILREAREEAERLRQEELQKT
FT                   RVQIQQMQAQARAEIEREKQGALDELRAVVADLAIQAAEKILRESLDADRQRRLVERFL
FT                   ESLPASKN"
FT   gene            338760..339338
FT                   /locus_tag="Rmar_0314"
FT   CDS_pept        338760..339338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0314"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+transporting two-sector ATPase delta (OSCP) subunit;
FT                   KEGG: afw:Anae109_4498 F0F1 ATP synthase subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47219"
FT                   /db_xref="GOA:D0MDM6"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDM6"
FT                   /inference="protein motif:TFAM:TIGR01145"
FT                   /protein_id="ACY47219.1"
FT                   /translation="MQEISHPVARRYARALFEEARARGQAEAIDADVAALHEAFAASRE
FT                   LARVFESPVIPREKKKKIIETLFAGRLQPLTIRFLELLVEKERENLLPAIVAAYRALQD
FT                   EAQGIVEAHVRTAFPLDEAGARPLVEKLERLTGKKIRLQLKQDPSLIGGVVVRVGDTVY
FT                   DGSVRQQLTALRERLRRRATFVNGSNESR"
FT   gene            339343..340947
FT                   /locus_tag="Rmar_0315"
FT   CDS_pept        339343..340947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0315"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: acr:Acry_1679 F0F1 ATP synthase subunit alpha;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47220"
FT                   /db_xref="GOA:D0MDM7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDM7"
FT                   /inference="protein motif:TFAM:TIGR00962"
FT                   /protein_id="ACY47220.1"
FT                   /translation="MATIRPDEITEVLRRELGGFEAEADVYEVGTVLQVGDGIARIYGL
FT                   RGVGAGELIEFPRSGVTGMALNLEEDNVGVVLFGEVDKVKEGDEARRTRRVASILVSEE
FT                   MLGRVIDPLGNPLDGKGPIGGEKYEMPLERKAPGVIYREPVREPLQTGIKAIDSMIPIG
FT                   RGQRELIIGDRQTGKTAILVDTIINQKYTHQTDKPVYCIYVAVGQKASTVAQVVRALEE
FT                   HGAMEYTVVVNAPASAPAPMQFIAPFAGACIGEFFRDTGRHALVVYDDLSKQAVAYREV
FT                   SLLLRRPPGREAYPGDIFYLHSRLLERAAKIISDDAVARQMNNLPPSIKHLVKGGGSLT
FT                   ALPVIETQAGDVSAYIPTNVISITDGQIYLESNLFNAGIRPAINVGISVSRVGGSAQIK
FT                   AMKKVAGTLRIELAQYRELEAFAKFGSDLDPATQRQLRRGERLVEVLKQGQYQPMPVEE
FT                   QIAIIYVATQGLLDRLPVEKVRPFEREFLERLRLRHADKLKALAETGDLTDELTEIFRK
FT                   EAEALIEVYLSGETQPA"
FT   gene            340962..341891
FT                   /locus_tag="Rmar_0316"
FT   CDS_pept        340962..341891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0316"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: afw:Anae109_4496 ATP synthase F1, gamma
FT                   subunit; TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47221"
FT                   /db_xref="GOA:D0MDM8"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDM8"
FT                   /inference="protein motif:TFAM:TIGR01146"
FT                   /protein_id="ACY47221.1"
FT                   /translation="MASLRDIRNRINSVKSTQQVTRAMKMVAAAKLRRAQERIFQTRPY
FT                   AFQLAEVISHLQGHVDPGTHPLFQPRAERQAALLVVVTADRGLAGAFNANIIKLTEQTI
FT                   ARDYAELEQAGRLYLYCVGRKGYDYFRRRNYQIVANRQGFFDRLTFDIAREISEDIVNG
FT                   YLEGRWDEVRIVYNEFRNTIAQNRIVEPFLPIPPERFLTPIMERELGRRPQLRPGYRVD
FT                   YIFEPSPQAILEALVPRYLNYQIWRILLESYASEQGARMVAMDNATTNAEELLHQLRLK
FT                   YNRARQDAITKEILEITSGAEALAKGGG"
FT   gene            341954..342046
FT                   /locus_tag="Rmar_R0011"
FT                   /note="tRNA-Ser3"
FT   tRNA            341954..342046
FT                   /locus_tag="Rmar_R0011"
FT                   /product="tRNA-Ser"
FT   gene            342161..345259
FT                   /locus_tag="Rmar_0317"
FT   CDS_pept        342161..345259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0317"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: scl:sce3530
FT                   ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47222"
FT                   /db_xref="GOA:D0MDM9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDM9"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACY47222.1"
FT                   /translation="MAFLADLHVHSKYSRATSRDLDLEHLALWAYRKGIAVVATGDFTH
FT                   PAWMAEIREKLVPAEPGLFRLRDDLDREARRLAGVPVMTPVRFLLEVEISTIYKKGDRV
FT                   RKVHHLIYAPDLEKAERIREALGRIGNLNADGRPILGLDSRDLLEITLEAGDGCYLVPA
FT                   HIWTPWFSVLGSKSGFDSIEECYGDLAGHIFAVETGLSSDPPMNWRLSALDRYTLVSNS
FT                   DAHSPARLGREACLFDTELDYFAIKRALETGQGYGGTVEFFPEEGKYHLDGHRACGVRL
FT                   EPSETRALGGRCPVCGRPLTVGVLHRVEELADRPEGTPPARPMSFESLIPLEEVLAEIE
FT                   NKGARTKAVQQRYERLLRTFGPELTILREVPLEELQQRAGSLLAEAIRRMRTGEVIREA
FT                   GYDGTYGVIRLFTDAERKQGNAVGLLFDLPEPTPARKKRPAASEPSLPRPSRMAEPTPP
FT                   PLHTPPRNGSGGLLVGLDPEQQAAATYTDGPVLVVAGPGTGKTRTLTYRLAYLIKERGV
FT                   DPAQCLAVTFTRRAADEMRTRLQALLGEAAADVTVTTFHGLGLELLQTYGDRLGLPQPL
FT                   RVATEAEQRAVLEAQGLSPTQAQRLLPRISYRKRTGQPGDERLETTLQAYDRALRESGR
FT                   VDYDDLIRLSVQLLEDHPDVADACRERFRWIAVDEFQDVDANQYRLLRLLAPEADARLF
FT                   VIGDPDQAIYGFRGGDVRCFLQFTSDYPKTRQVLLRQNYRSTQAILEAAARMMARASLV
FT                   PDRELVAVRSGGVPVEVVACPSERSEAIFVAETIEKLIGGTSYYALDSGRADGEERSYT
FT                   FGDVAVLYRTEAQAAELQEVLAQAGIPYQKRSHRLLAELPEVEALLAYLQENPKGPLAE
FT                   RLERWAATTSEREALLGVLRALAAQCGDDLEAFRNELALRSEADLWDARAEGVSLLTLH
FT                   AAKGLEFRVVFIVGCEEGLLPLTYDGRVDPEQEAEERRLLFVGMTRAQERLFLTHAQRR
FT                   RWMGRVRTPEPSRFLADLPARFVRRRTHTVRRSPTGGRQLELF"
FT   gene            complement(345265..345966)
FT                   /locus_tag="Rmar_0318"
FT   CDS_pept        complement(345265..345966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0318"
FT                   /product="queuosine biosynthesis protein QueE"
FT                   /note="KEGG: gbe:GbCGDNIH1_2305 queuosine biosynthesis
FT                   protein QueE"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47223"
FT                   /db_xref="GOA:D0MDN0"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDN0"
FT                   /inference="similar to AA sequence:KEGG:GbCGDNIH1_2305"
FT                   /protein_id="ACY47223.1"
FT                   /translation="MRSYRVKEIWKTLQGEGFFAGRPAVFVRFVGCNLWSGRDEDRARD
FT                   ARRTGADCPRWCDTDFRKEGSRAYTADELVAAMQEVGGPIQFCVLTGGEPLLQLDAALM
FT                   RALKAAGYFVAIETNGTISLREACTDPETGQVVAPDWIVCSPKLPEDRLALEYFDELKL
FT                   VVPDYRPEQYARFARRARPHRVGGRRIPLLWLQPEDGPRLAEAQRCAVELALAHPDWRV
FT                   SVQTHKILGVP"
FT   gene            complement(345969..346685)
FT                   /locus_tag="Rmar_0319"
FT   CDS_pept        complement(345969..346685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0319"
FT                   /product="exsB protein"
FT                   /note="TIGRFAM: exsB protein; PFAM: ExsB family protein;
FT                   KEGG: wsu:WS1657 PP family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47224"
FT                   /db_xref="GOA:D0MDN1"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDN1"
FT                   /inference="protein motif:TFAM:TIGR00364"
FT                   /protein_id="ACY47224.1"
FT                   /translation="MSALNLLPTLKPAEHGETALVLLSGGQDSTTCLYWALHYFPKVEA
FT                   LGFHYGQKHAVELEQARKIADRAGVPFTVLDLRGLLRGSALTEHEQDVSAAHPLAPHLP
FT                   AAFVPGRNALFLTLAASYGFTRGIHDLVGGMCQTDYSGYPDCRREFIDAMERALSLALD
FT                   TPIRIHTPLMHLTKAETWRLARELGILDVIVELTHTDYNGDRSERHPWGYGRLDNPASI
FT                   LRARGYEEAKARGWLD"
FT   gene            complement(346645..347115)
FT                   /locus_tag="Rmar_0320"
FT   CDS_pept        complement(346645..347115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0320"
FT                   /product="6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein"
FT                   /note="PFAM: 6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein; KEGG: neu:NE1517 6-pyruvoyl
FT                   tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47225"
FT                   /db_xref="GOA:D0MDN2"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDN2"
FT                   /inference="protein motif:PFAM:PF01242"
FT                   /protein_id="ACY47225.1"
FT                   /translation="MKVAKRFRFEAAHRLPWHPGACRHLHGHSYRLVVGLEGNPDARGI
FT                   LVDFQDLKRLVQPLIDTWDHATLVASDDTALQDALDALGSRYVVLPFDSTAENLCAYVA
FT                   DYLIREAGDWLRARGVRRLWVRLAETETSFAETERALIRDVRPEPAAHAEAR"
FT   gene            347253..347759
FT                   /locus_tag="Rmar_0321"
FT   CDS_pept        347253..347759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0321"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /note="TIGRFAM: 7-cyano-7-deazaguanine reductase; PFAM: GTP
FT                   cyclohydrolase I; KEGG: mrd:Mrad2831_0983
FT                   7-cyano-7-deazaguanine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47226"
FT                   /db_xref="GOA:D0MDN3"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDN3"
FT                   /inference="protein motif:TFAM:TIGR03139"
FT                   /protein_id="ACY47226.1"
FT                   /translation="MTEQERQALAEKLAALREEALAHTEQALAYMARFGVRPEGRIQPF
FT                   LPPEARQQHIDRLPYEHAVRQVVVYETEPGEFSAVCPFSGLPDYGVLRIEYVPGSWILE
FT                   LKSLKYYIVSWRNIGAAQEDLTAIIYQDLMRHLEDPEYLRVITVYNVRGGIRTTCTIDS
FT                   REQGR"
FT   gene            complement(347756..349513)
FT                   /locus_tag="Rmar_0322"
FT   CDS_pept        complement(347756..349513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0322"
FT                   /product="Dynamin family protein"
FT                   /note="PFAM: Dynamin family protein; GTP-binding protein
FT                   HSR1-related; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47227"
FT                   /db_xref="GOA:D0MDN4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDN4"
FT                   /inference="protein motif:PFAM:PF00350"
FT                   /protein_id="ACY47227.1"
FT                   /translation="MEALLTAEHEALLEAERNLLARLHGVLARTGADESLRERLSEVIE
FT                   TLDALFVVVVVGEFNAGKSTVLNALFGEKLLEEGPIPTTAKITLLRYGETPMERPRSEY
FT                   LVERYHPSERLRHLVLVDTPGTNSIIRRHQELTEHFIPRADLVLFVTSFDRPLAESERQ
FT                   FLSYIRDTWGKRLVFVLNKADLARSEADLEQVLAHIRTGCRELMGFEPEIFPISAARAF
FT                   EARTSDDPERRARLWESSGFEDFERLLLDRLAGPERLRIKLTAPLDVAEKLIERLQTHL
FT                   AERRQLLAQDRANLERLEARLEEVRAELIATVRPYLSEIDNQLLQVERRGLQFLQDTIR
FT                   IGRLGLLRDRDRFKEEFARQVVRDLDHRLETTLAEAVDRLLQQGLQLWNQTLSEFTERV
FT                   EQVVRRRPPQVRADLLYDRRQLFDAVVRQATRQLETYDLREEARRILENTRDAVALFLG
FT                   TEALAGLGALVTMLITAAGLDVTGGFVAAGALAVVGLVVLPIQKRRALREFRNRIEQLR
FT                   TELLTALGQQLEREVDGLLERLAATLAPYREFVHREQRLVDETEEALRALERETRRLRA
FT                   AIEKAVPVG"
FT   gene            complement(349570..350946)
FT                   /locus_tag="Rmar_0323"
FT   CDS_pept        complement(349570..350946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0323"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; KEGG: pca:Pcar_1103 fused recombination factor
FT                   protein RarA/unknown domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47228"
FT                   /db_xref="GOA:D0MDN5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDN5"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ACY47228.1"
FT                   /translation="MADLFQQAAERLLAAQAPLAERMRPRTLDEFVGQEHILGPGKLLR
FT                   RAIEADRLSSLIFYGPPGTGKTTLARIIARTSRAHFTALNAVLAGVKDIRDAIEAAQER
FT                   LRLHQQRTILFIDEVHRFNKAQQDALLPHVENGTVIFIGATTENPYFEVIKPLVSRSRV
FT                   FELKPLTPEHLRRIAEQALADPERGYGRRNVVVDPEALDHLIDVANGDARSLLNALELA
FT                   VETTPPDASGRIHITLPVAEESIQRRAVLYDKEGDAHFDTISAFIKSLRGSDPDAALYW
FT                   LARMIYAGEDPRFILRRMLIFAAEDVGLADPRALQVAAAAAQAFDYVGMPEGQFILAEC
FT                   CLYLATAPKSNSTMAYFNALAYVEREQSGDVPTHLKDASRDRQGLGHGQGYKYPHAYRE
FT                   HYVPQQYLPEHMQGTYFYEPSDQGYERVIAERLAAWRQRDLAEGLKKRLQRYLPDDANR
FT                   "
FT   gene            complement(351297..353012)
FT                   /locus_tag="Rmar_0324"
FT   CDS_pept        complement(351297..353012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0324"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: hypothetical protein; K01687 dihydroxy-acid
FT                   dehydratase; TIGRFAM: dihydroxy-acid dehydratase; PFAM:
FT                   dihydroxy-acid and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47229"
FT                   /db_xref="GOA:D0MDN6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDN6"
FT                   /inference="protein motif:TFAM:TIGR00110"
FT                   /protein_id="ACY47229.1"
FT                   /translation="MPPLNRYSRRITQPKSQGASQAMLLATGLKEEDLDKPQIGIASVW
FT                   YEGNPCNMHLLDLAAEVKAGVQEAGMVGFRFNTIGVSDGISMGTEGMSYSLPSRDLIAD
FT                   SIETVMAAQWYDGLIALPGCDKNMPGCVIAMGRLNRPALMIYGGTIRPGCLNGQKLDVV
FT                   SAFQSYGEYLAGKITDEQRRAIIRHACPGPGACGGMYTANTMAAAIEAMGLSLPFSSSL
FT                   PAEDPRKREECRRAGHVMRRLLEQDLKPRDIVTRASLENAIAVVMALGGSTNAVLHLLA
FT                   IAHAFDLPLSLDDFQRIARRVPLLADMKPSGRYVMEDLCRIGGVPAVMKLLLKHGVLHG
FT                   DALTVTGKTLAENLADVPDLPENQDIIRPWDNPIKSSAHIYILYGNLAPGGCVAKITGK
FT                   EGLRFSGPARVFDSEEDMLAGLEAGRIQRGDVIVIRYEGPKGGPGMPEMLTPTSALMGA
FT                   GLGKDVALITDGRFSGGSHGFIIGHVVPEAQEGGPIALVRDGDRITIDAEAGLIHVDVS
FT                   DEELARRRAAWTPPPLKVTRGALFRYVQTVQDASRGCITDAPIGEPQPVGSPTS"
FT   gene            353102..353755
FT                   /locus_tag="Rmar_0325"
FT   CDS_pept        353102..353755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0325"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: efe:EFER_3835 conserved hypothetical protein;
FT                   putative outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47230"
FT                   /db_xref="InterPro:IPR011727"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDN7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47230.1"
FT                   /translation="MNRKRFFLLGLMLLLAGLAAAQERRFRIYLIHHGWHAGIAFYQAD
FT                   LEGTDWPAEAFFPERRFVEVGWGEAGYYPDPDPGAGDALRAALWPTDAVLHVAAFDHPP
FT                   ALIFKGPVRQIDLDSTAFRRLVAYVADYFKRDAQGRLEPVAPGLYGVESQFYAAKGRYH
FT                   LFNNCNHWVARALRAAGLSVHPARALTLGDLWRQLEPLSQAASPEAAGCLSNIR"
FT   sig_peptide     353102..353167
FT                   /locus_tag="Rmar_0325"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 22"
FT   gene            353977..357531
FT                   /locus_tag="Rmar_0326"
FT   CDS_pept        353977..357531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0326"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hhe:HH0798 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47231"
FT                   /db_xref="GOA:D0MDN8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR011639"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDN8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47231.1"
FT                   /translation="MSREPGTHLVAHGYERATLLALLKKTGRFREDLTGNASAAPPRAQ
FT                   VLGVWELEDIAVPVLEVPVEDAERKRWSDWEAVCAWLRAQQGEAALCVFYDARRAFRLA
FT                   LIGPRSGKARPPVSGNFRRWSLLVQPGYPNRTFSERVPLLMRADSREALLEVFDAEAVG
FT                   HAFYAAYVKIFQESVVSGIYGEGSRQEYQDCFLAFTVRVLFLSFVAKKGWLGDQGARFL
FT                   PWLLERYQTVAQQEEATGFYNRWLRPLFFEAFRAAPSAKTARFRTLPEDIAIIYRDAPF
FT                   LNGELFRRQPFDARLALTDEAIARFFSLLYGYNFILEESTHEDVDLELTPELLGLILEQ
FT                   LINGVGITGAKEQVGAHYTPRVEVDLMVRLALMEALVQRAVLDRAAAARFVFEGKLESD
FT                   QALAVRKTLEDLKVLDPAVGSGAFLVGMLQVLEELLDRTHESLGDRCADRVQRRRRLIA
FT                   EVLHGVDVLRWAVWMTELRLWLALLVDLDDRVRHTSGPILPSLGLRVVQGDALIQRIGK
FT                   RLLPMRPDGPLWNRPEIRAPLQQLNEYRRAYFENKASLEQVRAAETALFQAMVQQERRR
FT                   LQQQASSTGELFQKARCRSDDAATQQQLTALQELLDAAAAGHRPFVWWVDFSDVMVERG
FT                   GFDVVIGNPPYVRQEQISDVLGDLTPSAYKAMLAAAYRMDWEAIAGSRLPAVQRRADLY
FT                   VYFYVRSLRLLNDRGVHVFIASNSWLDVDFGSWLQELFLRYAPLRLVLENRSYRSFAAG
FT                   INTAITVALAPRPIVHREPVRFCALYRAFEEVHPADILQIVEATQDLRQEAFRVLVRAP
FT                   NVLLQEAGRTGKYSGSKWGGKYLRAPDIFYTLFEQGQRRWVRLGEIAEVRRGITTGVNE
FT                   FFYLEPVGQTVEEVATLAKQDPAARVPVRNSLGWEGRLEAAWLRPIIKSSREIRTLKVG
FT                   LENLRYLVLMPPEEVRAHLEANLDPPLARYPGILDYIRWGETRGYPKRPTCSSRRWWWD
FT                   LGERPIGQVLCMMTYNDRHPFWVNTVALSDNRLYDLYVKTTDPLLLAALMNTTLVPLQM
FT                   ELLGRINLGEGALDFKVYEAAELLCPAPDVLSSDEQARLLTAFQAMVDRPVRSLFEELG
FT                   FPRCRRSRCAHPDHPYEHVVPEMLTLDQVRQASPERFQMDTVVCRALGLNDREQLEVYR
FT                   AVTQLVLERLRRARTAHP"
FT   gene            complement(357609..357693)
FT                   /locus_tag="Rmar_R0012"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(357609..357693)
FT                   /locus_tag="Rmar_R0012"
FT                   /product="tRNA-Leu"
FT   gene            complement(357701..357773)
FT                   /locus_tag="Rmar_R0013"
FT                   /note="tRNA-Lys2"
FT   tRNA            complement(357701..357773)
FT                   /locus_tag="Rmar_R0013"
FT                   /product="tRNA-Lys"
FT   gene            complement(357903..358739)
FT                   /locus_tag="Rmar_0327"
FT   CDS_pept        complement(357903..358739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppu:PP_1922 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47232"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDN9"
FT                   /inference="similar to AA sequence:KEGG:PP_1922"
FT                   /protein_id="ACY47232.1"
FT                   /translation="METSSTPADVEQLYRHVQAQAWTPALELVYRHRTLLAVDPLWRHA
FT                   ADVLVRELHPRLAEVGEAVLERLFLLHTGRLYALPEKVFADLVAELVRRHADRPELARR
FT                   YARWCPTHPECARLLATPTTETPWEELHDFAVRRHQPIQQVRPPSLFRSQQEFVFFQAV
FT                   REVFPTYLVYPNVALSCLIDYERLADVLSEAERRYALQALVDCAVFDPDDGYRPRYCFE
FT                   LDSPLHGAPERRQRDALKARILQRAGLPLFCIRPPTGTVDRNAFVALLRRLFQQNL"
FT   gene            358802..361204
FT                   /locus_tag="Rmar_0328"
FT   CDS_pept        358802..361204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0328"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; peptidase S9B dipeptidylpeptidase IV domain
FT                   protein; WD40 domain protein beta Propeller; PGAP1 family
FT                   protein; KEGG: sus:Acid_5975 peptidase S9 prolyl
FT                   oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47233"
FT                   /db_xref="GOA:D0MDP0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDP0"
FT                   /inference="protein motif:PFAM:PF00326"
FT                   /protein_id="ACY47233.1"
FT                   /translation="MKRLTSGWILLLMLGGVAWAQPQLTVEKIMQDPKTWIGDWPDNPF
FT                   WSEDGQYLYFWWNPKGQFPSDSLYRVSRSGGAPEKVAPEERRNLPPAFDGWHHGEWVYD
FT                   ADFRRKVFARDGDLYLYDRTTRRLTRLTRTAERESNPRFTPDGQAVVFVKENNLFQLDL
FT                   RTGALTQLTDLRRGQEPRERRPDAQDAFLEAQQRALFEVIRKRVEMREAREKAQERDRK
FT                   AENPPPTFYYGDKNVEQLQLDPTGRFVTFALTTDEPREKATAVMDYVTESGYARELRAR
FT                   PKVGVPPGSFELYVQDLMRDTTYRVNLHQVPGAYDVPEYLREQGVEPDSQKTKRFLYAY
FT                   GPYWSGDGRYAVLEVRARDNKDRWIVRLNPETGRLTVLDRQHDEAWIAGPGISWFGGRS
FT                   TMGWLPDNRHFYFQSERTGYSHLYVVDVETGRIRQLTDGAFEVFDPFISRDGRYWYFTS
FT                   SEGSPFERHFYRMPIDGGPRERLTTLTGRNDVVLSPDEQVMGILYSYSNRPPEIYLQPL
FT                   RRGRPGEPQRITHSPTDEWLAYSWRDPEIRFIPASDGAQVPARVYEPDSLNGAAVFFVH
FT                   GAGYLQNVHRWWSSYFREYMFHNLLADRGYLVLDLDYRGSAGYGRDWRTAIYRHMGGRD
FT                   LQDYVDAARYVQERYGIPPERVFIYGGSYGGFLTLMALFTEGEHFGGGAALRAVTDWAH
FT                   YNHPYTSNILNTPETDSIAYVRSSPIYHAEGLEDPLLMCHGLVDTNVQPQDIFRLVQRL
FT                   IELGKENWELAVYPVEGHGFQEPSSWTDEYRRILKLIEATVGPDRRR"
FT   sig_peptide     358802..358864
FT                   /locus_tag="Rmar_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(361246..362652)
FT                   /locus_tag="Rmar_0329"
FT   CDS_pept        complement(361246..362652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0329"
FT                   /product="extracellular repeat protein, HAF family"
FT                   /note="TIGRFAM: extracellular repeat protein, HAF family;
FT                   KEGG: bvi:Bcep1808_6998 autotransporter beta-domain-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47234"
FT                   /db_xref="InterPro:IPR014262"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDP1"
FT                   /inference="protein motif:TFAM:TIGR02913"
FT                   /protein_id="ACY47234.1"
FT                   /translation="MSARFLTSIWHVCVLVLAGIIGLASFASAQTLTWLGAPEAWENST
FT                   AEGVSSDGQTVVGYFTPAGTYLSRAFRWTSRFGSFLLDPRYEGSTATAVSGDGNTVVGR
FT                   AYLNNDATNRNFPFVWFAFSIDLNGDGYNDLIRLNPPDTDDGVATDLSEDGQIIVGYYK
FT                   DENGNNQAFWRTDQGFIVLGTLGGSTSAALAISPDGSVVVGSSENSFGNTHAFRWTSNE
FT                   GIQPLSTLFYLSYTHMVASDVSSQGKYIVGWADRPTSERVAYLYKTINGVSTVELLGSL
FT                   GGLSTAATAVSDNGVVVGYGENALGQVRAFRWTEQTGIQDLTALYGHLLDSGSYFLSAL
FT                   DISKNGEFIVGKAYHAANDKTEAFLLHAPITTATETALLPEAPALLTPAPNPFAAATTI
FT                   RYDLPAPTTVRLEVVDLYGRTVAVLVDGPRPAGSHYLYYQPDHLAGGLYFLQLTVGARR
FT                   FHQKMVYLGK"
FT   sig_peptide     complement(362563..362652)
FT                   /locus_tag="Rmar_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 30"
FT   gene            complement(362795..365920)
FT                   /locus_tag="Rmar_0330"
FT   CDS_pept        complement(362795..365920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0330"
FT                   /product="TonB-dependent outer membrane receptor precursor"
FT                   /note="KEGG: xca:xccb100_1664 TonB-dependent outer membrane
FT                   receptor precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47235"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDP2"
FT                   /inference="similar to AA sequence:KEGG:xccb100_1664"
FT                   /protein_id="ACY47235.1"
FT                   /translation="MLLCLLGLPLAGYAQGVTTAALTGTVTDERGDPLPGANVVAVHEP
FT                   TGTQYGTTTQIDGRYALLNLLPGGPYTVTVSFVGYQTRRETDLMLPLGQTRVLDFTLAE
FT                   ATVELQALEVVGVRSSVLNSDRTGARTNIDEATIERVPTITRSLADFTRLTPQATGGFS
FT                   LAGRNNRYNNIQIDGATLNDVFGLSGTGMPGGQADAQPISLDAIQEFNIDIAPFDVRYN
FT                   GFTGGSINAVTKSGTNRLSGSVRYLGRNQNFVGDLKTPDGETVPFGDFSEYTLVGNLGG
FT                   PIQPNRAFFFVNAEYQRRKTPLDVGVQGSRAATIFPVALDSLNRIIEIARTRYGYDPGG
FT                   FDPLSNGTDNFKLLAKIDWNLAPNHRLTLRHNYVNADKDEGISRGTFSFDLSNRRWIFE
FT                   SVQNSTVLELKSTFGTNLFNEARLVYTRIRDKRTVKAQPFPQVSILVNNRYTVNLGIDR
FT                   FSQANALDQDLWEFTDNLTYFRGKHTITVGTSNQIYRFSNLFIQDYYGAYEFNSIADFE
FT                   AGRPSRYFFSYSLLDDPKPRAEFTAYQLGFYVQDQYQATPHLSVTVGLRVDVPLYPDKP
FT                   LYNPAVPEAFPGYSTATTASGNLLWSPRLGFNWDLSKGARTTQLRGGTGIFSGRTPFVW
FT                   ISNQYSNTGVDFGRVDARNLPEGCFVPEPDPAAQPRPGTALGTTCGLAPITTTEVNLID
FT                   EDFKFPQVWRTDLALDQQLPYGLIGTIEFLYSKTINDVVFENLNIVRTGTAQGGRVLYG
FT                   TPSFNGSTARKDPRFTNAILLKNTDKGYSTSLTVGVQREAQAEGLSGALFYTWNRAENV
FT                   NNATSSRAISNWQYNEARDVNNPELGTADFEVRHRILAHLSYRVRYQQRFATTVTLIYE
FT                   GRSGSPFTWIYNGNANADTRRDNDPIYVPASPDEIVFTSDSPGGWDELNAFIESEPSLR
FT                   KYRGQIVPRNSARAPWRNLLDLQVLQEVQTLGTQRLEITATLLNVLNLLNSDWGKVRYT
FT                   LFDTVRLMDFQGYDDQGRAIVRFTPVQDRDDLFITDDLASRWQLQLGVRYVF"
FT   sig_peptide     complement(365870..365920)
FT                   /locus_tag="Rmar_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.811) with cleavage site probability 0.343 at
FT                   residue 17"
FT   gene            complement(366085..367419)
FT                   /locus_tag="Rmar_0331"
FT   CDS_pept        complement(366085..367419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0331"
FT                   /product="Membrane dipeptidase"
FT                   /EC_number="3.4.13.19"
FT                   /note="PFAM: peptidase M19 renal dipeptidase; KEGG:
FT                   sus:Acid_4390 membrane dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47236"
FT                   /db_xref="GOA:D0MDP3"
FT                   /db_xref="InterPro:IPR000180"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDP3"
FT                   /inference="protein motif:PRIAM:3.4.13.19"
FT                   /protein_id="ACY47236.1"
FT                   /translation="MAGAGRTGRTVVDRMLMRLAFLLLLLAPACRAQTPAPTPPRPADT
FT                   LRAEDGGPVALPPPRYHALLRLDTLWARVLALHYRTLVFDGHIDTPTRMLEGFDFGRRH
FT                   RRADGHVDLPRMFEGGLDAAFFSIYVPARYGEGAAAVRYARRLLAEVRRQVTAHADSAA
FT                   LAYSAADVLRITRSGRKAILLGIEGGHALAGSVDTLRALYEAGIRYVTLTHVNTNRLAD
FT                   ASQDRPRWNGLSEEGRRIVRAMNRLGMLIDLSHASDATFFDVLAISEAPVILSHSSMRA
FT                   LVPAVRNASDEMLRALARNGGVVLINFFDALVNPHLTADVYAEAERRTGGNLRQLWNAV
FT                   YAVRRERGLPGATLEDVLDHIDHAVQVAGIDHVGLGSDFDGVFDLPAGLEDVTRLPWIT
FT                   YGLYRRGYSETDIQKILGGNLLRVLREAERVAARLQATEAGSTSD"
FT   sig_peptide     complement(367321..367419)
FT                   /locus_tag="Rmar_0331"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.949 at
FT                   residue 33"
FT   gene            complement(367567..368166)
FT                   /locus_tag="Rmar_0332"
FT   CDS_pept        complement(367567..368166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0332"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="TIGRFAM: intracellular protease, PfpI family; PFAM:
FT                   ThiJ/PfpI domain protein; KEGG: ppd:Ppro_1389 PfpI family
FT                   intracellular peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47237"
FT                   /db_xref="GOA:D0MDP4"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDP4"
FT                   /inference="protein motif:TFAM:TIGR01382"
FT                   /protein_id="ACY47237.1"
FT                   /translation="MAAKRILMIVGDFGEDYEIMVPFQALQAVGFQVDAVCPGKKKGQK
FT                   VRTAVHDFEGDQTYSEKPGHNFQLNATFDEIRPEDYDALVIPGGRAPEYLRLNDRVLEI
FT                   VRHFAQNNKPIAAICHGLQILTAADVLKGRRCTAYPAVGPEVKAAGGEYVEVPADEVVV
FT                   DGNLVTAPAWPAHPRWLAEFFKVLGLRIEHEEAAMA"
FT   gene            complement(368268..368687)
FT                   /locus_tag="Rmar_0333"
FT   CDS_pept        complement(368268..368687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0333"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: scl:sce2760
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47238"
FT                   /db_xref="GOA:D0MDP5"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDP5"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACY47238.1"
FT                   /translation="MWRDPEKRRDLGLLVVRIGLGLTFLFIHGGPKLLGGPERWARVGG
FT                   AMQVFGIDFAPTFWGLVAALSEAVGGGLLLLLGLFFPWALIFPTLTLLVAALGHLTGLI
FT                   PGGPWYPLELAIVFIALMLTGPGRYSLDARRAGNR"
FT   gene            complement(368897..369970)
FT                   /locus_tag="Rmar_0334"
FT   CDS_pept        complement(368897..369970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0334"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: gdi:GDI1736 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47239"
FT                   /db_xref="GOA:D0MDP6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:D0MDP6"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACY47239.1"
FT                   /translation="MTQPPAPKGRGAAFNPPSRFEPRHLEPDPEALAREEMPHRVPTTI
FT                   LEDHTRSALARNDSPDIPFNFGLNPYRGCEHGCAYCYARTYHEYLGFSAGLDFETKIVV
FT                   KRDIARLLEQTLRRPSWEPQPISLSGVTDPYQPLERRLRLTRACLDVLLRYRNPVVIVT
FT                   KNALIRRDLDLLAEMARQELVLVWISVTSLKPDITARLEPRTARPALRLKTIEALSRAG
FT                   VPVGVLAAPIIPGLTDEELPAILEAAARAGARWAGYTLLRLPGAVREIFLDALRRHFPE
FT                   RYDRVVRRLEAMRGPSLNDTRAGRRLHGSGKEADLLAQLFHLTCRRLGLNRTRPVLRTD
FT                   RFRRDGAQLSLFEQKMP"
FT   gene            complement(370025..370576)
FT                   /locus_tag="Rmar_0335"
FT   CDS_pept        complement(370025..370576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0335"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccs:CCNA_00861 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47240"
FT                   /db_xref="GOA:D0ME16"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME16"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47240.1"
FT                   /translation="MTPFAYLSVLISIVLGLGLTELLSGVQRLVHQRDRIRFHWLPLTW
FT                   AGLVFVALVQWWWAAFGLRHQVAWNFFSFLLILLVPVLLYLAAALVLPNRIPDGPCDLL
FT                   NHYRKMQRPFFAALATVNVLEGLRALSVHDQQATLLNLAGVVLLGSLAVVRNLRYHAVI
FT                   TILTAILLLLFIVLETLRIA"
FT   gene            complement(370681..371739)
FT                   /locus_tag="Rmar_0336"
FT   CDS_pept        complement(370681..371739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0336"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: eba:ebA3150 2-oxoglutarate ferredoxin
FT                   oxidoreductase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47241"
FT                   /db_xref="GOA:D0ME17"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME17"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ACY47241.1"
FT                   /translation="MPPGAKPAGDGKPRLTRKDFASDQDVRWCPGCGDYAILATVQRLL
FT                   PELDVPRENIVFISGIGCSSRFPYYMNTYGMHSIHGRAPAIATGLKASRPELDVWIITG
FT                   DGDALSIGGNHLIHILRRNLNVQILLFNNQIYGLTKGQYSPTSEEGKITKSSPYGSIDH
FT                   PFNPVALALGADATFVARSMDRDTKHLQDMLRRAHDHRGAAFVEIYQNCNIFNDGAFFQ
FT                   FTERDTKPHRALFLEHGKPLVFDEGRKGIRLDGFRPEVIDLTDGRWSIDDCLVYDETNR
FT                   ELAHIMARIFFRPDLPQPFGVFYREERPTYEDLLHRQIAEVTARKGKGDLQALLRSGDT
FT                   WVIEPELAEASE"
FT   gene            complement(371890..373752)
FT                   /locus_tag="Rmar_0337"
FT   CDS_pept        complement(371890..373752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0337"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase; KEGG: eba:ebA3149 2-oxoglutarate ferredoxin
FT                   oxidoreductase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47242"
FT                   /db_xref="GOA:D0ME18"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME18"
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /protein_id="ACY47242.1"
FT                   /translation="MAVFEKPVEVLPEATVLFAGDSGDGMQLTGLQFARATALARNDLA
FT                   TLPDFPAEIRAPAGTTYGVSGYQLHFGSVPVRTPGDAVDMLVAMNPAALKVHLPRVRRG
FT                   GTLLINVNAFDRRGLELARYETNPLEDGSLEGYQVIPVELTRLTHEALADSGLDKKEID
FT                   RCKNMFALGLVLWLYSRPLKPVEEWLAQKFANRPEIRDANLKVLHKGYHYGETHELFAV
FT                   RYEVRPARLEPGLYRAIRGVEALALGLIAASHQSGLPLFYGSYPITPASDLLHELSRHK
FT                   NFGVMTFQAEDEIAAVGAALGASFGGALGVTATSGPGLALKAETIGLAVMTELPLVVID
FT                   LQRGGPSTGLPTKTEQSDLLFALYGRHGEAPLPVLAASSPGDCFYAAYEASRIAVRYMT
FT                   PVILLADGYLANGAEPWRVPDVASLPPFEVKFATEPNFRQNGDVRFLPYRRDPETLARP
FT                   WARPGTPGLEHRIGGLEKEHETGNVSYDPANHQRMVKLRAEKVARVAREIPPTKVFGDP
FT                   EGDVLLIGWGSTRGAIEAAVERLQARGLRVGSVHLRYLNPLPPDLPTIFERYHHLVVPE
FT                   LNNGQLVRVLRDAYLRPFVPLNKIQGLPFQAREIEEFVADLVQS"
FT   gene            373909..374292
FT                   /locus_tag="Rmar_0338"
FT   CDS_pept        373909..374292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0338"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; KEGG: bcs:BCAN_A0310
FT                   ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47243"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME19"
FT                   /inference="protein motif:PFAM:PF04379"
FT                   /protein_id="ACY47243.1"
FT                   /translation="MVPYAATTRGVTVTVRPVYLDDPSDFFEKRFVFAYFISIENHTDE
FT                   PVQLLRRYWRIEEADGSVREVEGAGVIGQQPVIRPGHAHIYSSYCILSSLSGTMEGYYL
FT                   MRSADGRRFRVTIPRFDLRVAAN"
FT   gene            complement(374296..374556)
FT                   /locus_tag="Rmar_0339"
FT   CDS_pept        complement(374296..374556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47244"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME20"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47244.1"
FT                   /translation="MDPTLHQKQGINHLKRVLSYAPMVAENGRAEVFLTQEDWFVVADT
FT                   LFRMHTPRELLPPEIQEYRLTDENRVIELVTPELTIEVKMF"
FT   gene            374638..375489
FT                   /locus_tag="Rmar_0340"
FT   CDS_pept        374638..375489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0340"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="KEGG: fph:Fphi_1432 thymidylate synthase; TIGRFAM:
FT                   thymidylate synthase; PFAM: thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47245"
FT                   /db_xref="GOA:D0ME21"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME21"
FT                   /inference="protein motif:TFAM:TIGR03284"
FT                   /protein_id="ACY47245.1"
FT                   /translation="MRQYHEFLRYILERGTRREDRTGTGTISVFGYQMRFDLQEGFPLV
FT                   TTKKIHIKSVVHELLWFLRGDTNLRYLHEHGVTIWDEWATEEGELGPIYGKQWRRWLAP
FT                   DGREIDQIAEVVRSIRERPWSRRHVVSAWNVADLPDERLSPQENVRRGRMALAPCHVLF
FT                   QFYVAERPEWERPRLSCQLYQRSADAFLGVPFNIASYSLLTHMIAQQTDLDVGEFIWTG
FT                   GDCHIYLNHLEQVEELLSREPYPLPKLVIKRRPPSIFDYRYEDFEFVNYRHHPPIKAPI
FT                   AV"
FT   gene            375501..376034
FT                   /locus_tag="Rmar_0341"
FT   CDS_pept        375501..376034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0341"
FT                   /product="Dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="PFAM: dihydrofolate reductase region; KEGG:
FT                   eba:ebA4414 dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47246"
FT                   /db_xref="GOA:D0ME22"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME22"
FT                   /inference="protein motif:PRIAM:1.5.1.3"
FT                   /protein_id="ACY47246.1"
FT                   /translation="MNQIASRRPEIVLIAALAEKNRVIGRDGRLPWHLPEDLRRFKRLT
FT                   MGHPLLMGRKTFESLLEEFGGPLPGRRHLVLSRSRTYPGMANVEVYPDVEAALKAVGDV
FT                   PVLFIAGGAEVYAQFLPRADRLELTLVEGDYEGDTFFPPYEHLIGSVFEEVAVERHPGF
FT                   RFVTYRRRPDAPKP"
FT   gene            376144..378006
FT                   /locus_tag="Rmar_0342"
FT   CDS_pept        376144..378006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0342"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ribonucleotide reductase
FT                   large subunit; Ribonucleotide reductase large subunit
FT                   domain protein; KEGG: tbd:Tbd_0058
FT                   ribonucleoside-diphosphate reductase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47247"
FT                   /db_xref="GOA:D0ME23"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME23"
FT                   /inference="protein motif:TFAM:TIGR02504"
FT                   /protein_id="ACY47247.1"
FT                   /translation="MATEVLPDLGTHFHEPVSWHVWDAKYRYREGNVVRDQTIEDTWRR
FT                   VARALAAAEPESERARWAERFYQVLYGFKFLPGGRILAGAGTRHRVTLFNCFVMGIIED
FT                   SLDGIFDSLKEGALTMQQGGGVGYDFSTLRPAGTRARTTGTIASGPVSFMHIWDAMCAT
FT                   LLSTGARRGAMMATLRCDHPDIETFVTAKHRPGVLTHFNLSVQVFDEFMEAVRRDADWP
FT                   LVFPAAALEDEGMGDGPIVYRRWTGTDGPVPCRVLRVVKARALWEQILRATYDYAEPGV
FT                   LFIDTINRMNNLAYREHITATNPCGEQPLPPYGACDLGSINLTRFVRAPFTPEADLDWE
FT                   GIRETVAVAVRMLDNVIDVSGFPLPAQAEQARGTRRIGLGITGLADALIMLGLHYASEE
FT                   ARQLAARVMQTICHTAYRTSIALAREKGVFPFFERERYLESPFIQALPEDIRKGIATYG
FT                   IRNSHLLSIAPTGTISLLANNVSSGIEPVFAYRYTRYILGLDGERRAYTLTDYALRLWQ
FT                   RLHGDSEMLPEAFVDAQHLDPYDHLKMQAALQPYVDGAISKTVNVPADTPFNAFRQLYD
FT                   WAYDHGLKGCTTYRPSPVRGAVLEAITAGVAESTHCCSIEREAD"
FT   gene            complement(378276..381515)
FT                   /locus_tag="Rmar_0343"
FT   CDS_pept        complement(378276..381515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0343"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; Two component
FT                   regulator propeller; Two component regulator three Y domain
FT                   protein; SMART: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; KEGG: sus:Acid_4777
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47248"
FT                   /db_xref="GOA:D0ME24"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR011110"
FT                   /db_xref="InterPro:IPR011123"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME24"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACY47248.1"
FT                   /translation="MASTNGLYRFDPKREAFVHYAADPDSPTGLSHSDVRALLIDSRGN
FT                   FWVATAGGLDRFDPATGVFEHFRHDPRDPRSLPHNVLFDLVEDAHGHLWVSTDGGGLGR
FT                   LDLDHIAQGFRRYRHDPHNPRSLAIDRVRVLYVDREGRLWVGTENGGLDLFDYRTETFR
FT                   HHRHSRTDPSSLNNESLWAIYQDRTGNLWFGTFAGGLNVLKRNSQAIEHYRSVPGDPYS
FT                   LNANAVSRFYEDAQGNLWVATDGGGFHRFDRRTGRLYGYSMANTNARTDAVFAMASDAD
FT                   GYLWVGGWAGGIGRFSPRQGRFLEFFNDQNGMLLTPHVFDALVDAQNRLWVANFLGGLV
FT                   RIDLNTRQRKVYTPENSALGSNQILRMGHDPEGRLVLATQDAGVIVFDPRTETFTDYRH
FT                   DPSSSNSLSNNSVLSILVADAHTLWVGTQYGLNRIDRQTGTVTRFFREDGLPSNTIVGL
FT                   ARDRQGFLWVATNRGLCRYDVQERTCTLYTKADGLQGNEFNRFADYTARDGALFFGGFN
FT                   GFNVIYPDRFEPNTTPPPVVLTDFRLFNQPVRVGAKDSPLKAHISVTRTLTLAHWQNVL
FT                   TFEFAALDFTAPSKNRYAYKLEGFDLDWNEVGTQRTATYSNLDPGEYVLLVRGTNNDGV
FT                   WSTRPATLHIVITPPFWATWWFRLLAGLTLVGAVVGVVHRERRRRKRQEAINAELEAIN
FT                   RRLEAEMRHAAEAEREKRRALEEAAEHDRRAREQLQQQQQEYLEQSVLRILEAMERFSR
FT                   GDLTVALTATQDDAIGRLFDGFNRAVANMQAILREVASVIRATADTSKEIYRNSGELAS
FT                   GVQQLTRQTGEVAEAIEEMARTISEATRNLSHVAELAEQSLRQAEEGGQVARDAVGRMN
FT                   DVAEAVARSSAIIQALDESSQKIGEMARIIDEIADQTNLLALNAAIEAARAGEQGRGFA
FT                   VVADEVRKLAERTAAATKEIEQMTARIRHDTSRAVTAMARVNQEVDTGRTRVDQVGALL
FT                   EEIIARSRQVQERIAQVATSGEEQAATIQHISESVEAIAQVTEQAAAGNTSIAAAMAQL
FT                   TERMESLRQLVTRFTFTRTDSEPKPAGFPES"
FT   gene            complement(381651..381941)
FT                   /locus_tag="Rmar_0344"
FT   CDS_pept        complement(381651..381941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0344"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: pat:Patl_1665 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47249"
FT                   /db_xref="InterPro:IPR011110"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME25"
FT                   /inference="similar to AA sequence:KEGG:Patl_1665"
FT                   /protein_id="ACY47249.1"
FT                   /translation="MDRGFIAIVLLVGILSTPAQAQRLRFTHLTSDDGLSRSWVTAITQ
FT                   DSLGFLWIGTAGGLNRYDGYRFTLYEHDPRDSTSIANSYIRCLYVDRHGTL"
FT   sig_peptide     complement(381876..381941)
FT                   /locus_tag="Rmar_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            382182..383633
FT                   /locus_tag="Rmar_0345"
FT   CDS_pept        382182..383633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0345"
FT                   /product="amidohydrolase"
FT                   /note="TIGRFAM: amidohydrolase; PFAM: peptidase
FT                   dimerisation domain protein; peptidase M20; KEGG:
FT                   eli:ELI_13895 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47250"
FT                   /db_xref="GOA:D0ME26"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017145"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME26"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACY47250.1"
FT                   /translation="MRRYGIIWGLLLALSASAAAGQDLAAYKQEALQETEQLRETLRHL
FT                   AQELWRYAETALQEERSAALLAEALEAEGFRVQRGVAGMPTAFIAEWGSGRPIIGILAE
FT                   YDALPGVGNAPVPERHSREDGVSSGHGCGHNLFGAASTVGAIVLKRMMERHRIPGTVRL
FT                   YGTPAEETVVGKVYMARAGVFDDLDAAIEWHPGTETAVRNQPGRAMNNFIVRFHGQAAH
FT                   ASADPWNGRSALDAVELMNHAANMMREHVHPTARIHYVITDGGEAPNVVPERAEVWYYV
FT                   RDINRERVEFMYEWLKKMAEGAALMTRTEYEIEFITGVHEVLLNRPLQEAVQANLELVG
FT                   PPRFDAQEQQFARRLQEFLKIEPVGLDTTIKPLPEGPEPPRGGSTDVAEVSWITPTVGF
FT                   TVATAARNVPWHSWATTACHGTSIGYKGAEVAAKVIAATGLDMLLRPELLQAAREEFLR
FT                   LTGGRPYQSPLPPDQPPPLPSRTDR"
FT   sig_peptide     382182..382244
FT                   /locus_tag="Rmar_0345"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.500 at
FT                   residue 21"
FT   gene            complement(383630..383770)
FT                   /pseudo
FT                   /locus_tag="Rmar_0346"
FT   gene            complement(383891..385195)
FT                   /locus_tag="Rmar_0347"
FT   CDS_pept        complement(383891..385195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0347"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="PFAM: Fmu (Sun) domain protein; KEGG: dar:Daro_3159
FT                   Fmu (Sun)/nucleolar NOL1/Nop2p"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47251"
FT                   /db_xref="GOA:D0ME27"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME27"
FT                   /inference="protein motif:PFAM:PF01189"
FT                   /protein_id="ACY47251.1"
FT                   /translation="MATETTTLRVYPVWIEAVVTVLREILRSPLPADTVLQQFFRKHRK
FT                   MGKRDRAFVAETVYGMLRHYRRLAHAARRRADDLRFLTLLYLEVFGFGDAILDLPVRPA
FT                   ERGALEAAARRFREPDLPDDPAAALGILYSLPDWLVAAWLEVLPRETVEARCAALKAPA
FT                   PLTVRVNTLKADRGTVQQRLLEEGFPSRPTPYSPVGLILEEKAFIFRTRAFQEGLFEVQ
FT                   DEGSQLISLLTEARPGQVVVDGCAGGGGKTLHLAALMEGKGRLYAFDIHEARLRELRPR
FT                   TRRADVHNVRLHVLPHNRASIVRRLYGKADAVLVDAPCSGTGVLRRNPDAAWKITPERV
FT                   AALVEQQRQILEAYAPLVRPGGRLVYATCSLLPAENEQQIHTFLNAHPEFTLIPAAEVL
FT                   ARQGIAFPHQTDAFLRVEPATHGTDGFFAAVLVQS"
FT   gene            complement(385215..386393)
FT                   /locus_tag="Rmar_0348"
FT   CDS_pept        complement(385215..386393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0348"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bba:Bd0503
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47252"
FT                   /db_xref="GOA:D0ME28"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME28"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACY47252.1"
FT                   /translation="MLRRLARGVVLWTTAHVGVLALFLAGYGWPGLVGAAVLWLLGIGP
FT                   AFVLLRAFQGRFYPSAAVRRWVFRPFWYVQLALPLLSTAAVLGWLAGLPFSAGLVGARY
FT                   ALVVMAGLYLLVALTGYAGTYRLVVRHRTFRFPTLPPALEGLRIVQLSDLHIGPHTSRR
FT                   LLRRIVQAVETAAPDLIVFTGDQVDDYAADARLFVDAFGSLRAPLGVWAIAGNHDIFAG
FT                   WHEVRHTLESAGFIVPVNEARAVSYRGARFWVVGLGDPAGSFWPYGGGAEVVPDVARAL
FT                   QHVPDGAFVVALAHHPALWPELARRGVALTLSGHTHHGQVSIPALRWCLASPFVRFAMG
FT                   CYRYRDAVLYVHPGSNYWGLPLRLGAWPEVTVITLRRGPLANHCTNVASLED"
FT   sig_peptide     complement(386286..386393)
FT                   /locus_tag="Rmar_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.789) with cleavage site probability 0.770 at
FT                   residue 36"
FT   gene            386576..387460
FT                   /locus_tag="Rmar_0349"
FT   CDS_pept        386576..387460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0349"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: aha:AHA_3991 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47253"
FT                   /db_xref="GOA:D0ME29"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME29"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACY47253.1"
FT                   /translation="MKTRTLRSDLLILLATAIWGFAFVAQRVGMEHMGPFWFNALRFAM
FT                   GSLVLVPLLGRRDPADVPPAVQLRVGLLAGLILFLGASAQQIGLVYTTAGKAGFITGLY
FT                   VIFVPLLGVFWRQHTYLDAWLGAVLAAAGMYLLSVAETLTINPGDVLVLVSAVCWAFHI
FT                   HLIDRYAHRMPPFRLAFTQFVACAVLSGLTAALVETPVLPTAREAWGALLYAGFLSVGI
FT                   GYTLQVVAQREAHPTHAAILFSLEAVFAALGGWWLLDETLSTRQLLGCGLMMGGMLLSQ
FT                   LRPFTRRAPVSLS"
FT   sig_peptide     386576..386650
FT                   /locus_tag="Rmar_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.949 at
FT                   residue 25"
FT   gene            387528..387713
FT                   /locus_tag="Rmar_0350"
FT   CDS_pept        387528..387713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47254"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME30"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47254.1"
FT                   /translation="MRPGDIGWMPRVAEVAADREQYREKEEPTHRRRRKKTREETPDAS
FT                   GAPSVGDTGRHIDLRA"
FT   gene            complement(387692..388087)
FT                   /locus_tag="Rmar_0351"
FT   CDS_pept        complement(387692..388087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47255"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME31"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47255.1"
FT                   /translation="MRSVCSVLLLGLLSMVDALAQDAPRIFRFEGLLDRACPCPPGQVL
FT                   ATPPVDRAMILPPGPRFRPKMRTFRPAPGIRPHFRNLACRPLRPPAWLDSLQTKGLSLR
FT                   SGERKRLLRFRFPDPWQSHADYARRSM"
FT   sig_peptide     complement(388025..388087)
FT                   /locus_tag="Rmar_0351"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            388410..389453
FT                   /locus_tag="Rmar_0352"
FT   CDS_pept        388410..389453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0352"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: bcn:Bcen_2358 LacI family transcription
FT                   regulator; PFAM: regulatory protein LacI; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47256"
FT                   /db_xref="GOA:D0ME32"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME32"
FT                   /inference="protein motif:PRIAM:5.1.1.1"
FT                   /protein_id="ACY47256.1"
FT                   /translation="MGSARSTIRDVARAAGVSISTVSLVLNNKGNVSEATRRRVLKVAR
FT                   ELGYVPSRAARDLSLQRTGNVGFVLREDHFTRSEPFYTYIFLGTEFEARLHNLYVLLTT
FT                   IPRDYRRGEHTPRFLRERSVDGLLIAGKVSDVFLEEVRAMKLPTVLIDYEAEGFPAVVI
FT                   DNQGGARVAVEHLIQQGHRRIAFVGADIRHPSIANRLEGYRIALVRAGLPMDPALVLVE
FT                   DEAEPTRATGQRLGARLLALTERPTAAFCANDALALGVMETLLQAGLRVPDDVALVGFD
FT                   DVQGAAQAPVPLTSVRVFKEQMGELAMRHLAERIGPEQTRRPYARGQHTIVAPTELVVR
FT                   ASSVKNA"
FT   gene            389575..390246
FT                   /locus_tag="Rmar_0353"
FT   CDS_pept        389575..390246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47257"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME33"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47257.1"
FT                   /translation="MKTMLQHTGRIGQALWFALILAIGGWSMTAQAQQTLLDLLTADSP
FT                   MNLLSDGGFESGLPSYWEPVGDGAEWTRERSRTPEWSLKLSGTGASSWVQSEAIRNWTP
FT                   RIPGNLELVVGGWVWTEGVNTNPQTDEEKFQLVFTFYNSAGQDLLGGPLVIDVPQDQPS
FT                   TGGWVQIDNTSLGSLILPEDATSVRIEFRKGSQATGTVYLDDVFVRKADPNAEGWEGGL
FT                   V"
FT   sig_peptide     389575..389673
FT                   /locus_tag="Rmar_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 33"
FT   gene            390260..391123
FT                   /locus_tag="Rmar_0354"
FT   CDS_pept        390260..391123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47258"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME34"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47258.1"
FT                   /translation="MSGGWYYWWPDFPRGLAGWPADQEFAVTVTESDAHRGRRSLRIED
FT                   LQGTAQYEAVAISERVPVVAGEPVLVSFWVRYEGVLSPETIGEGNNNIGLTALWYNQME
FT                   SGAAGWGEIGGVDIRLNGEYNEQVIPLAAREDSTGWRQYAFVVYPKEGAVGMELRLRYW
FT                   HEFTGTTYWDDVSIVRIGGSALLPTGVSEESAVERPQRFLLHANYPNPFRRSTTLSFSL
FT                   PEPTRVTLAVYNLLGQEVVTLIRDEVLPAGTHRVVFDARDLPAGLYLYQLRAGRYVETR
FT                   KMLLVK"
FT   gene            391215..393881
FT                   /locus_tag="Rmar_0355"
FT   CDS_pept        391215..393881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0355"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: ade:Adeh_0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47259"
FT                   /db_xref="GOA:D0ME35"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME35"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ACY47259.1"
FT                   /translation="MTGLVKRGTGWIGLLLLLSALPLRAQTTGKIVGRVTDAQTGEPLP
FT                   GVNVVILETQQGASTDADGYYVILNVRPGTYTLRASMVGFTPQVVQEVRVQINLTTEVN
FT                   FTLQEETITGQEVVITATRPLVQRDLTATAAAVSREELAVLPVENFTDVVNLQAGVVEG
FT                   HFRGGRIGEVAYLVDGVQINDVYDRSFAFQVENNAIQEIEVITGTFNAEYGSAQSGVVN
FT                   IVTREGSERYQGSLGGYVGDYLTTATDLFMGLERISPLHARSIQGDLSGPLIPGYSNVT
FT                   FFVAGRYVHNDGHLYGRRIVLPVDQDDPRAQYVTVDGRQVFVPALGDSALVPMNWSEQH
FT                   TLQAKLTARLFGQHKLTLSGLWQGDRGKNYNHLFRYNPDGTPTVYGRSRSLLATYTHIF
FT                   SSRTFAELKGAYFTNEVREYVYENPLDPRYPRDDALRLLGGNFSFYRGGAIMRHFRRRT
FT                   ETFTARFDITSQVTLRHQVKAGVEFKQHTLTVRDFEVKRNPSTGFQPAIPPVHTPDHVY
FT                   YHKRPIELSAYVQDKMEFDYLVVNVGLRFDFFDPRAEVLEDFSRPRTSPRRPAPVRWQL
FT                   SPRLGLSFPISQNGAVRLAYGHFFQMPAFDYLYTNADYIYDPERGLSRAFGYAGLEPEQ
FT                   TVAYEIGLQQAFSELIGLNLVLYYKDIRNLLGTRIEVIAPGFDEPFQLEKYGRYVNRDY
FT                   GQVKGFLVSLERRMAGGFGLGIDYTFQIARGNASDPRAVLIDEMSGIEPEKQLVPLDWD
FT                   RRHQLNTSLTVGEAGRWTVTLVGRLGSGLPYTPSIADERIGVENSARRPGFVQFDLYAS
FT                   RLWKLGSVGVQLFARVYNVFDHRNEIQVYTDTGRAFPNLRYYSGEPQGLNSKEEFLRRP
FT                   DFYSAPRLVNIGMNVTF"
FT   sig_peptide     391215..391292
FT                   /locus_tag="Rmar_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.993 at
FT                   residue 26"
FT   gene            393889..397182
FT                   /locus_tag="Rmar_0356"
FT   CDS_pept        393889..397182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47260"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME36"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47260.1"
FT                   /translation="MMRVSAGRFRGIVLLAGWLLAVPSLAQRTPDPNKGDPRLTQWGIM
FT                   DGNRVRTLYANHGEVARWPDQPSGEWPKGSGHSYVDGVALIVSARTQDSQGRTIYPMST
FT                   NYREFIDRDPVTKLPWGWAPLPGYSNPRQSSPARSDDPSTWPTEWPDRPIEWAGYWNGY
FT                   FGRGIMNADLETYFVFDDAHDFEWTQPPHRFFPCRNDTTRGGLGMEVAARGFQWTHVLA
FT                   QDVIFWHYEITNECDVFYPDIFYAQYIDWGVGGTDDSGDDEGAYNTRLDLAFAWDFDGI
FT                   GTPGQWGPVGVAGYAFLESPGNHTDGIDNDQDGITDERRDSGPGQLIEGQENIRAYLEQ
FT                   HYNLQDFERFYGPLELRPAYRAGRWWTGDENLTWVGFTDLNGNGIWDPGEPTNDDCGED
FT                   GVCPGDPGYNGADRGETDGRPTPGERNFDATDKDESDQIGLTGFEIFDVHRYELIDDEE
FT                   DYRVFSRALPPLEDILLEGGRNLGMFFSSGPFPLQPGQTERFSMALLFAGHDFTDPRNM
FT                   ENTSLARKKETVQQIYNANYQFARPPDKPTLIAIPGDRQVTLIWDDVAERSFDPFLREN
FT                   DFEGYLIYRSSEPNFNENFLITDAYGTLTYRKPIAQFDLKNGIRGLHPVAVNGVHFNLG
FT                   NDTGLRHVYVDRDVQNGQTYYYAVVAYDRGYVARDENGDIVVDPEGFIRGIAPSLTTAT
FT                   IKTDLAGQVVSLDINTAVVTPRAPAAGYVPPEVTAFERQTIGTGSVDLQLAAPEAVQEG
FT                   ATYEVVFENPSLWQNAPEVHYRVQRETGEVLREGTLRAGLNELAVLEGGWVLTLDEPAG
FT                   VSIDGSSLTFTDEQTTYAGIVQPASTSSVVGTARYVPLPADFEVHFTETFADTSLRLAL
FT                   GMRQIPTPFYIENLTTGERQPFIIVEDRPELQNGQYDHGDLIILVMGETPDSEPQMQGG
FT                   RWRASWAIRFLPPDPVAEPDKPDRPPRPGTSFRFRTIKPFQTGDRIRFTIRPPAFDASK
FT                   ARHDLRNIYVVPNPYVATSTFEPSSVYRIGRGERRIYFMNLPPECTIRIYTLSGQHVQT
FT                   LEHRGGIDNGQLAWDLTTKDGMQLAYGVYIFHVEAPGVGEYVGRFAVIK"
FT   sig_peptide     393889..393969
FT                   /locus_tag="Rmar_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.993 at
FT                   residue 27"
FT   gene            397192..398232
FT                   /locus_tag="Rmar_0357"
FT   CDS_pept        397192..398232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0357"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gbm:Gbem_0891 membrane protein involved in
FT                   aromatic hydrocarbon degradation"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47261"
FT                   /db_xref="InterPro:IPR005362"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME37"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47261.1"
FT                   /translation="MQTGIRQGQWLAAIGLALVLAVPTRAQTVSKAGTVAGDFLQIGVG
FT                   ARAMAMGGSFVAAADDASALYWNPAGLAHLEGGEAMAVHSRWLADVSFDYLGAALRLGT
FT                   LGTLGVSVTMLSVPDMLVRTEDRPEGTGEWFDAADLAIGLSYGRFITDRFAIGATAKFI
FT                   QQRIWHSSAVGFAVDLGVQFRTDFFGGLTLGAAVYNFGTDMRMSGRDLRTFVDPDPTRE
FT                   GNNNRIPANYETDSWSLPLNFQFGVALRPVQTRMHQLLLTADALHPSANYESVNVGIEY
FT                   GFQQRIFLRGGYHALFLPGAEGGLSAGLAVHQVLPYAGGLAKLEYAYRDSGRLGGVHIV
FT                   GIGITF"
FT   sig_peptide     397192..397272
FT                   /locus_tag="Rmar_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.947 at
FT                   residue 27"
FT   gene            398236..399561
FT                   /locus_tag="Rmar_0358"
FT   CDS_pept        398236..399561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0358"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ypm:YP_2296 putative solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47262"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME38"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACY47262.1"
FT                   /translation="MRRLFRHRCWIGLLAGVLLLAGCHRPAPTPVPENGRVRLVYWTAP
FT                   NPDELALARELVAEWTAANPDVEVIVQPIPAGQSSEEVLLAAVAAGTTPDLCSNIWPGI
FT                   VEDFVEAGALVPLDRFPDFDSLLEARIPETVREPFRSRDGHFYQLPWKTNPVMMFYNVQ
FT                   LLREAGFERPPRTYGEYLEAARRVTADTDGDGLIDRWMGYRDIRPIWWQRYFDYYAFYI
FT                   AASGGRTLFDREGRLAVDTAASNRVFDFFARLYAMGAFPKAVWTSAGSRFLKGQLATDF
FT                   TGPWHLIWLEKHAPPTLTYDVAPIPVPDDHEGPVYTYGDYKNIVIFSTTRHPDVAWRLA
FT                   RFLVSREADRRLLERTRQIPVRRGLLDDPYFAPVFERYPILRRFAEQAAYTRSVDSAPD
FT                   LKEILDAFAQEFEAAAVFGVRSPAEATRRALRRIQMILDWNA"
FT   gene            399554..400456
FT                   /locus_tag="Rmar_0359"
FT   CDS_pept        399554..400456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0359"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: xfa:XF2447 ABC transporter
FT                   sugar permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47263"
FT                   /db_xref="GOA:D0ME39"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME39"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACY47263.1"
FT                   /translation="MPELRATLRRLQIRLRGERSGYVLVAPYLLHMAVFFGYPLLFAFV
FT                   LMFHRWDIVTPMEFVGLKNFVRLVRDDLFFRALLNTGIFLTIHIPLQIIVALFFAELLN
FT                   RPLRGRGFFRAAYFMPVVVSGVVITILFQQLFAFDTGLINRMIRALGGEPVPWLVSPAL
FT                   AMPSIALMATWKNVGLYIVLFLAGLQHIPKHLYEAAELDGANAWQRWWHVTLPMLNPTM
FT                   VTVVVLSTIGGFSLFIEPYILTGGGPLNATLSAVLYIYNQAFYFNHMGYAAALGFCFAI
FT                   VIFVVVLLQRRFVETDTWS"
FT   gene            400460..401269
FT                   /locus_tag="Rmar_0360"
FT   CDS_pept        400460..401269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0360"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mca:MCA1924 sugar ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47264"
FT                   /db_xref="GOA:D0ME40"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME40"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACY47264.1"
FT                   /translation="MRRLGLYLLLGIGLVVFAYPFVWMGIATFTPEAEIPELTLLPSRW
FT                   TLDHYRLVFERIPVWRGLLNSLVVALAVTASVLVFTSMAAYALAKLHWRGRETVFSIIL
FT                   FTMMVPFLLLLIPLYTLVVRLGWTDSLLGLIVPFMMNATGVLILRQSFLTIPRDLIDAA
FT                   RIDGCGELRILFTIIWPLSVPALVTVGLLTFIGSWNEVLWPIIVVREVQWMTLPQLVAL
FT                   FAVGGGAEGQLGPQLAAAFLLALPIVLAYLFFQRYFIQSFATGGLKG"
FT   sig_peptide     400460..400516
FT                   /locus_tag="Rmar_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.944 at
FT                   residue 19"
FT   gene            401280..402722
FT                   /locus_tag="Rmar_0361"
FT   CDS_pept        401280..402722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ypm:YP_2290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47265"
FT                   /db_xref="GOA:D0ME41"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME41"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47265.1"
FT                   /translation="MRRLLWIIPGFFVLAAAGCLTAPESRPVPDTLPINLAHLEHLSED
FT                   VVRGDSVLRIVHIYAEAPDYHWVDDPDEGTACVDDVARAAVLYLRLYELTGDEAVRRTA
FT                   EKLLRFVLYMQRADGLFYNFVYSNRLDINTTHQNSRAEPFGWWAGRAVWALGTAADVLR
FT                   RANPRMAAQAAAAARRALVHLDRTWLVHYPRTRRVNGRTVPEWLVYRYGSDASSELLLG
FT                   LVRLQKAAPDTSLARMIRQLAEGMARMQYGSMARHPYGAHASWIDTWHGWGNAQTQALA
FT                   EAGYLESAIYEAEHFYPRLLVYGWMYAMSLDDSTQVQRYEQIAYAVRCVAVGLIRLYEQ
FT                   TGDVRYATMAGLAASWLTGNNEAGVPMYDPATGRGYDGITGPGTVNRNAGAESTIEALY
FT                   TMLEVSRHEPARRWLYARGAPPVEVTHEGTRYAYRVFSVQEKDATRSVAVVLNLSAERM
FT                   ELLEGEALARFLREVTSEPVHH"
FT   sig_peptide     401280..401345
FT                   /locus_tag="Rmar_0361"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.880) with cleavage site probability 0.826 at
FT                   residue 22"
FT   gene            402737..403768
FT                   /locus_tag="Rmar_0362"
FT   CDS_pept        402737..403768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0362"
FT                   /product="glycosidase PH1107-related protein"
FT                   /note="PFAM: glycosidase PH1107-related; KEGG:
FT                   sat:SYN_01903 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47266"
FT                   /db_xref="GOA:D0ME42"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME42"
FT                   /inference="protein motif:PFAM:PF04041"
FT                   /protein_id="ACY47266.1"
FT                   /translation="MPQDSEAVTLFRRHPEPILTPMPELSWASGAVFNPGAWYDGTRVH
FT                   LLVRGVPAGYRRIRLTDTRPGEPEWGFEPYVSYIGYAESTDGVHFSVRPEPLIRPDAPY
FT                   DHFGVEDPRISRIDDLYLITYTALGAPAFARPGCVRIGLASTRDFQSVTKHGIVGPDTT
FT                   DKDAVIFPRRIRGRIAMLHRIVPSIQLIYFDDLEQLFHPPKALWERHLARLDEHVVLRP
FT                   EFPWEAKKIGAGPTPIETPEGWLLIYHGVDAQHVYRMGMALLDLDDPRRVIARTPEPVL
FT                   EPELPFECEGDVPNVVFPEGAVVIGDELLVYYGAADRTIGLARAPLSDVLAHLRACSVR
FT                   VSS"
FT   gene            403790..404902
FT                   /locus_tag="Rmar_0363"
FT   CDS_pept        403790..404902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0363"
FT                   /product="glycosidase PH1107-related protein"
FT                   /note="PFAM: glycosidase PH1107-related; KEGG:
FT                   sat:SYN_01903 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47267"
FT                   /db_xref="GOA:D0ME43"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME43"
FT                   /inference="protein motif:PFAM:PF04041"
FT                   /protein_id="ACY47267.1"
FT                   /translation="MVDPLSVRTITAVPPVQPARLHDGRPVLEPNPQNAWESRVVLNPA
FT                   AVLITEPEEWAWLADRWALAPEKRRRIEAAGGVVVLLYRAQGAFDPERNHAPSRLGLAL
FT                   MTPTLELIHRFPYPVIDAAADFHNLGVEDPRCTRVGDTFYLFYTGYYTEAPGDPEAERA
FT                   VQICLASTQDFLEWTLHGPLEGNLNRVDNKNAALFPEPVDGRWLLLHRPMAGPDAMTIH
FT                   LAEAEAVTGPWHTRGMLMPSYPYREFARSWIGAGGPPIAIGNERFLMIYHQGHYTREGM
FT                   REYDLAAALLDFSRREAPVVGRIEPLMRPVADGERHGDPELGVDNVLFTCAGYVWEGQV
FT                   IIPYAGADSRIFGASVPLEPLVQALEQRSA"
FT   gene            404899..406665
FT                   /locus_tag="Rmar_0364"
FT   CDS_pept        404899..406665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47268"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME44"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47268.1"
FT                   /translation="MKRLMLIALGLTVLVPAIAWAQPKRVPLARVGETVIDRATFLQRY
FT                   ENAVWIGKERSGVSIVPKHAFLLALIAEELLAQEGERRGLDQERPVRPILEEIERMLVL
FT                   DALYRTEVQEPIRLTEAEIDSVARLRLAPVTFAYLTIGDSARAWHLQRRVRQAPDPIAA
FT                   FDSLQQVLGQAGQLRTARWGELYEPLETFLYAGATPGQVGPPVSVDSLYYLVQLRDRAT
FT                   PALITPETWQQARYEAGRILQERRERARFTDFMRRFGAGKTAQVNDTLFYRLADAIRTR
FT                   LTLRQAQQERQNRPRYPVALLESDWEALRLELTDALDAPLIEAPTFTRALGYVLDRLAF
FT                   RGFELRSERQAVPHRLRALLWEIIAEEFLLEEGYARGLDRRLDVQQDLTMWRKAYLARG
FT                   MRKVLVDSLRQVWRGQLWLVNLCRATLSTREAATRLQQHWAQTSGSCEADGTPVDTTGY
FT                   RLAPTLGPVGALAVSAVPGAVLGPLAESCLPESVPCWRVYRLLDRRRPDDPEAAFQEAA
FT                   REEVNAYIARLAEQRGVTIDLEALEATRVTPLNMVLVRLLGFGHRLLAVPTVYPLIEWF
FT                   DRMDKRRLYAPL"
FT   sig_peptide     404899..404964
FT                   /locus_tag="Rmar_0364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 22"
FT   gene            406857..407981
FT                   /locus_tag="Rmar_0365"
FT   CDS_pept        406857..407981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0365"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: reu:Reut_A2049 glycerol-3-phosphate transporter
FT                   ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47269"
FT                   /db_xref="GOA:D0ME45"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME45"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY47269.1"
FT                   /translation="MHETMPSSGVSLEQVWKIYDNGYVAVADVTFEAAEGEFLVLLGPS
FT                   GCGKTTLLRLVAGLETVSRGTIRIGDQVVNDVPPRDRDIAMVFQNYALYPHMTVYENMA
FT                   FGLKLRRVPKAEIDRRVRAAARVLELEHLLDRRPHQLSGGQRQRVAVGRAIVREPRVFL
FT                   FDEPLSNLDARLRVEMRAELARLHRELGRTMLYVTHDQVEAMTLGQRIVVLNQGRVQQI
FT                   GTPLEVYHRPANRFVAGFIGSPPMNFIEGRLEHLDGLRFVGEGGRVQIPLVEAEWPNAR
FT                   PGQRVTLGVRPEHVTLAASEEATMQGQVETVEVLGAVAHLYVRVGQTTVVAQVDAAMRP
FT                   EPDQTVALRIDPARIHLFDAETGRALSRIEAASV"
FT   gene            complement(407921..408640)
FT                   /locus_tag="Rmar_0366"
FT   CDS_pept        complement(407921..408640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0366"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: mmw:Mmwyl1_1237 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47270"
FT                   /db_xref="GOA:D0ME46"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME46"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ACY47270.1"
FT                   /translation="MTDLLIGTRSLAAWEPIFEELLQRAWADASDPAHDLEHVRRVVRW
FT                   ARRLALAEGADLAVVLPAAWLHDCVLVPKDHPERPLASRKAADRAVVLLREAGYPESLL
FT                   PAIHHAIEAHSFSAGIPPRTLEARVVQDADRLDALGAIGLARMFMLGGATGRPLYDPAE
FT                   PVPHNRPPDDRRFVLDHLFTKLLHLADRMQTDAGRREAQRRTAFLQAFLEALQRELAQT
FT                   EAASIRDSARPVSASNR"
FT   gene            408780..410813
FT                   /locus_tag="Rmar_0367"
FT   CDS_pept        408780..410813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0367"
FT                   /product="putative alpha-glucosidase"
FT                   /note="KEGG: xcv:XCV2800 putative alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47271"
FT                   /db_xref="GOA:D0ME47"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019563"
FT                   /db_xref="InterPro:IPR029483"
FT                   /db_xref="InterPro:IPR029486"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME47"
FT                   /inference="similar to AA sequence:KEGG:XCV2800"
FT                   /protein_id="ACY47271.1"
FT                   /translation="MRRFLPVLLLIVSLAAGARAQTASVASLDGSLVVSFTLEDGRPTY
FT                   RIDRFGLPLILPSRMGFELQEQPPLVGPFRLIGVARDTVDTIWTQPWGEKKDIRSHYHE
FT                   LRLQLEETSERPRRMDIVFRVFDEGVGFRYEWPAQPNLDRFVIMDELTEFRLAGDHMAW
FT                   WIPAYHPNRYEYLYRHTPVSQLDTVHTPVTMETADGWFLSFHEADVEDYATMTLAPKDS
FT                   LTLEVDLVPWSDGTRVRAQTPFRSPWRVLLVGDDAGELITNYTILNLNPPNRLGDVSWV
FT                   RPAKYVGIWWEMHIGRSTWGSGPRHGATTENAKRYIDFAARHGFDAVLIEGWNVGWDGD
FT                   WTQNGDKFRFTEPYPDFDIEEVARYAREKGVQLIGHHETACHITNYERQMEDAFAFYRR
FT                   LGIHMVKTGYVAHGRNCVWIDEQGREHREWHHGQFMVRHHRRVLETAARYQIAINAHEP
FT                   VKDTGERRTYPNMVSREGARGQEYNAWSEDGGNPPEHTTILPFTRLLAGPMDFTPGIFD
FT                   ILIEDRPNNRVNTTLAKQLALYVVIYSPLQMAADLPEHYEARPDAFQFIKDVPVDWEDT
FT                   RVLHARIGDYVTIVRKDRHSDDWYLGSITDEYGRTLQAPLSFLEPGRKYVAEIYRDAPD
FT                   ADWRTNPLAIEITRQIVDASTVLTLRLAPGGGTAIRFHPVEE"
FT   sig_peptide     408780..408842
FT                   /locus_tag="Rmar_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.883 at
FT                   residue 21"
FT   gene            410895..411269
FT                   /locus_tag="Rmar_0368"
FT   CDS_pept        410895..411269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47272"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME48"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47272.1"
FT                   /translation="MRWVIVGLALLLGGCVGSRKAQESENGLHVWKSDTPWGEVTVRQM
FT                   RSDKGLCTFREVTLHRQVGLYIDGRPTFVRATDYLCDDVFDDWRFRSAIEQQRANYWDL
FT                   SGLLLHLMYSTMPIEEHPRW"
FT   sig_peptide     410895..410960
FT                   /locus_tag="Rmar_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.685 at
FT                   residue 22"
FT   gene            411429..414839
FT                   /locus_tag="Rmar_0369"
FT   CDS_pept        411429..414839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0369"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   SecA DEAD domain protein; SecA Wing and Scaffold; SecA
FT                   preprotein cross-linking region; SEC-C motif domain
FT                   protein; helicase domain protein; KEGG: glo:Glov_2490
FT                   preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47273"
FT                   /db_xref="GOA:D0ME49"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME49"
FT                   /inference="protein motif:TFAM:TIGR00963"
FT                   /protein_id="ACY47273.1"
FT                   /translation="MFDFLKKLFGDRNERELRKLWPIVHKVNEYAEQFKALSDEELRAK
FT                   TDEFKRRIKEAVADIEARKAEIEARLRGEVPDISGDGHAEVEELSPEERERLYEELDDL
FT                   EKEWLERVERQLDELLPEAFAVVKEACRRMLGKEWMAGGQKIVWDMVPYDVQILGGIVL
FT                   HQGKIAEMKTGEGKTLVAVMPVYLNALAGRGVHVVTVNPYLAQRDAEWMGPIYEFLGLT
FT                   VDVIDKYEPHSEGRRRAYQADITYGTNNEFGFDYLRDHSFVIDPDQLVQRGHHYAIVDE
FT                   VDSVLIDEARTPLIISGPVPQSGDERFTELKPVIEKLVYLQQRLVAQLVAEAEQKLKER
FT                   DKALEAGDRKRASELEEEAGLALLRAARGFPRNKRFMKLKTEPGVETLLQRTEAFYLQD
FT                   NAKNMPFVDEVLYFALDEKNHTIELTEKGLDEIARIAGQDRDMFVLPDLGEETARLEQE
FT                   YREKLRRLEEELAQRTDLSEEKRQNKLENDRRLLHKELEEQKRELYNRYAERAERLHAV
FT                   EQLLRAYTLYERDVEYIVQDGKVLIVDEHTGRVLPGRRYSDGLHQAIEAKEGVKVQAAT
FT                   QTYATITLQNYFRMYHKLAGMTGTAVTEAEEFYKIYGLDVIVIPTHKPVIRVDHEDLVF
FT                   RTKREKYNAVIQKIKEYHRKGQPVLVGTTSVEVSEMLSRMLKREGIPHNVLNARRDRAK
FT                   QEALIVAQAGQKGAVTIATNMAGRGTDIKLGPGVKELGGLAIIGTERHESRRIDLQLRG
FT                   RAGRQGDPGESQFYVSLEDDLMRLFGSERIARVMDRLKMEEGEVITHPWVTKSIERAQK
FT                   KVEQNNFAIRKRQLEFDDVLDAQRRVVYSRRRHALTGERISHDVLEMLRDVLGQIVERH
FT                   YREGDLEGLRDEVLRTFAFDFEMTPEEFARLGDDGVFDRLYQAALDFYRRKRQMLAEPF
FT                   YERLQAFLNQDGLEQKPDRVVVDFTDGRRVLRAVARVDEALRTRGQEINNALERAALLH
FT                   FIDEHWTEHLRELDELKEGINLRAFGQRDPLVEYKVEGFKLFQQTLDKINRDAISFIFR
FT                   AGPLVETRPAAPVSAPRRRLDPSRARTQHESVDSYGVRVRAQSPADSAARRDPTVKEQP
FT                   VVVGEKIGRNDPCPCGSGKKYKHCCGRNR"
FT   gene            414866..416602
FT                   /locus_tag="Rmar_0370"
FT   CDS_pept        414866..416602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0370"
FT                   /product="DNA repair protein RecN"
FT                   /note="TIGRFAM: DNA repair protein RecN; PFAM: SMC domain
FT                   protein; KEGG: sat:SYN_02862 DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47274"
FT                   /db_xref="GOA:D0ME50"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME50"
FT                   /inference="protein motif:TFAM:TIGR00634"
FT                   /protein_id="ACY47274.1"
FT                   /translation="MLRTLYIRDYALIEELEVEFGSGLNILTGETGAGKSILIGALKMI
FT                   LGERADTEMIRSGARKAVVEGVFDEADTPRIRALLEANAIDPMPQLIVRREILSGQSRA
FT                   FINDTPATVQLLREVAAQLIDLHGQHEHQSLLRTETHLELLDNFGSLGGLRDTYRRHYE
FT                   EVTRLIREREALMARRRELQEQKERYAFEIEEIDRVNPQQGEEEALEAELRILENAEQL
FT                   YEATARLYELLYESENAVHDQLVLARNELQDLARIDRSFEEALQEIRSAQISVAEIAKF
FT                   LQDYNARIEFNPERLEEIRARLVELELLKRKYGGTLEAVLAHRAEIGRRYELAVDFEGA
FT                   LERLDRQLAKAMQALSTAAQRLSAKRREVAERIEQAIVSELAVLGMPDSRFEVRFTHRP
FT                   DPEGWIVIPVPGREPERYAAFTTGMDQVEFYITTNPGEPLRPLARVASGGEVSRIMLAL
FT                   KTILAKSDRLPILVFDEIDTGISGAIAHRVGERLHDLASYHQIIAITHLPQIAAFGDVH
FT                   FLVEKVVEDGRAKTRIRRLSDEERARQVAALMSGAEVTEAALESARELIRQVAAREKAP
FT                   EA"
FT   gene            416646..417179
FT                   /locus_tag="Rmar_0371"
FT   CDS_pept        416646..417179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0371"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; SMART: GAF domain protein;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47275"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME51"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ACY47275.1"
FT                   /translation="MMAETTTLWTPLPVTAGAEERARHYEAVRRHIDALLEGETDWIAA
FT                   MATVACELHHAFDYYHWTGFYRAVSDDLLIVGPYQGTHGCLRIPFSRGVCGAAARTRQT
FT                   QLVPDVHRFPDHIACSATTQSEIVVPVLTPDGRLLAVLDVDSDIPAAFTEVDQRYLEQL
FT                   CAELGRRFADTPQR"
FT   gene            complement(417238..418662)
FT                   /locus_tag="Rmar_0372"
FT   CDS_pept        complement(417238..418662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0372"
FT                   /product="Phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; KEGG: gbm:Gbem_3964
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47276"
FT                   /db_xref="GOA:D0ME52"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME52"
FT                   /inference="protein motif:PRIAM:5.4.2.10"
FT                   /protein_id="ACY47276.1"
FT                   /translation="MAQIKFGTDGWRAVIADDFTFANLGRVAQATVRWLKKRYGDHPKV
FT                   VIGHDTRFLGREFAEHVARIFAAQGISVRMADTFTTTPAVSWATKHFGCNAGIVITASH
FT                   NPPKYNGFKIKADFGGPASPEMIAEVERELSDAEPPAELPAFDDLVSDGRVELFDLNTA
FT                   YLNLLREKLDIDGIARNLKIAHDAMFGASQGLVSRLLGADRVVELHCDWNPGFHGQPPE
FT                   PIERNLKELAEVVVRERCGLGMANDGDADRIGLFDENGRFVTSHEILALLVKYLHKEQG
FT                   LKGDIIKTFSTTHLLDKMGQAYGLRVETTPIGFKHIAKQMVERDVLVGGEESGGIAVKG
FT                   HLPERDGIYIGLLVAELLVRRGKKLSELVQELYDEFGPHHFYRIDLHTTEEKKQAALDH
FT                   LRQTGGLKEVAGDAVREVQTLDGFKHITDRGWVLIRPSGTEPLLRVYAEAPTPELAEAY
FT                   VHNAIEQLGFAEVPAH"
FT   gene            complement(418782..419345)
FT                   /locus_tag="Rmar_0373"
FT   CDS_pept        complement(418782..419345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aba:Acid345_1594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47277"
FT                   /db_xref="InterPro:IPR021314"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME53"
FT                   /inference="similar to AA sequence:KEGG:Acid345_1594"
FT                   /protein_id="ACY47277.1"
FT                   /translation="MRRFCLLALLVYLMGPALARAQDSVEVVPPPRSGSLERSPLALAA
FT                   TWIDSTYMKIVYGSPRKRGREIFGALVPYGEVWRTGANEATEITTTGDLIFGGHHLPAG
FT                   TYSLYTIPYPDRWTIIVNRALGQWGAFNYNPELDLFRFDVPTRRTDKLYEGFTITFEEE
FT                   DGQTYLYLRWDRTEVRIPVAAASE"
FT   sig_peptide     complement(419280..419345)
FT                   /locus_tag="Rmar_0373"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.506 at
FT                   residue 22"
FT   gene            complement(419363..419662)
FT                   /locus_tag="Rmar_0374"
FT   CDS_pept        complement(419363..419662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47278"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME54"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47278.1"
FT                   /translation="MTTQEQQAPAMTITLEQLCQDLARQVASALLRRFHQMGWTSATLR
FT                   DAEAFVTKVVTEAWRTPKEQYERTIAACVNQALEPVLKLHKRSRTSISLEVLPR"
FT   gene            419793..420215
FT                   /locus_tag="Rmar_0375"
FT   CDS_pept        419793..420215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0375"
FT                   /product="Protein-tyrosine phosphatase, low molecular
FT                   weight"
FT                   /note="PFAM: Protein-tyrosine phosphatase, low molecular
FT                   weight; SMART: Protein-tyrosine phosphatase, low molecular
FT                   weight; KEGG: sat:SYN_00054 phosphotyrosine protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47279"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME55"
FT                   /inference="protein motif:PFAM:PF01451"
FT                   /protein_id="ACY47279.1"
FT                   /translation="MEKLRVLFVCTHNSARSQMAEGLLRAMAGDRYEVYSAGTEPRGVH
FT                   PLAVRVMQELGIDLSGHHSKHVDTYRDVPMDYVVTVCDSAREHCPYVPARRRNLHQSFP
FT                   DPSAVEGDEPTRLEAFRHVRDQIRAWLEETFVRQVP"
FT   gene            420940..421341
FT                   /locus_tag="Rmar_0376"
FT   CDS_pept        420940..421341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0376"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   wsu:WS0033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47280"
FT                   /db_xref="GOA:D0ME56"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME56"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACY47280.1"
FT                   /translation="MAAYRDFPEYGEPDEAHALRYLQWLQRHHTLFLIAEVEGRPVGFI
FT                   VVDTNWRDWKGRRIGEIHELAVQPEYWGRSIAHRLLEAALDHIRAQGLQQAGLWVGVRN
FT                   ERAQSFYRHIGFRRSGMRKDEWIKMVKSL"
FT   gene            complement(421275..422378)
FT                   /locus_tag="Rmar_0377"
FT   CDS_pept        complement(421275..422378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0377"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: rde:RD1_0090 succinyl-diaminopimelate
FT                   desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47281"
FT                   /db_xref="GOA:D0ME57"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME57"
FT                   /inference="protein motif:PFAM:PF01546"
FT                   /protein_id="ACY47281.1"
FT                   /translation="MQPSTLIQELEQLIAIPSHEDCTPILHYLEKRLDFLRWERQDAGK
FT                   QVGGQPQYNLIHLDPAKPFIVNTHVDTVPPLGMVDPFRPRREEDRIYGRGAVDTKGLLA
FT                   ALTIALEACHRTYGQIPVSVAFTVDEENTSAAGSAALARLLGPDHCVLVLEPSNGHICT
FT                   RQAGALEFEVRSYGTPRHAALFHRGPHPIRTLMAYLQAAENALQRPLNVLSFQGGWDHY
FT                   ATPPEARALVEVIIPADQQWEPAEEVLQQLARTMFRGEVMYRRVDAENPLDFGHHAGVT
FT                   LLEEAYTEALGRRPQYDTMPSWTDAANFSKVGASCVIFGFGDLARAHGPEEHITVAELV
FT                   DTARVLYRLFTILIHSSFRIPERRNPM"
FT   gene            complement(422550..422919)
FT                   /gene="ssrA"
FT                   /locus_tag="Rmar_R0014"
FT   tmRNA           complement(422550..422919)
FT                   /gene="ssrA"
FT                   /locus_tag="Rmar_R0014"
FT                   /note="tmRNA as predicted by Rfam (RF00023), score 171.88"
FT   gene            complement(422965..423417)
FT                   /locus_tag="Rmar_0378"
FT   CDS_pept        complement(422965..423417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47282"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME58"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47282.1"
FT                   /translation="MRGFLFFLPVLLLSLAGTGCSPRLVPLYYDYRLPDTTGPSLQPVA
FT                   RALASEGWEVSQSDSLHLETMSRSLQHWGLYRVVVRLEAVPVDGRFVRVFIHPYRHYIT
FT                   GRRSKIPYLPAGLRATLLPRLHAALEAEGLEPAGTAFQRDHVRPRW"
FT   sig_peptide     complement(423358..423417)
FT                   /locus_tag="Rmar_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.701) with cleavage site probability 0.528 at
FT                   residue 20"
FT   gene            complement(423615..424472)
FT                   /locus_tag="Rmar_0379"
FT   CDS_pept        complement(423615..424472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0379"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: alpha/beta
FT                   hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47283"
FT                   /db_xref="GOA:D0ME59"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME59"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACY47283.1"
FT                   /translation="MPSPFRSHTEPYAYLEAGPASASPPVVLLYGMLGEPSNWEATAEA
FT                   LTANGYRVWIPLLPIYELPVRESNLQGLVAFLEQFLDAMRCERVVLAGNSLGGHLALLY
FT                   ALRHPERVAALVLTGASGIYEVELGTSTLRRYDRAYIRERAALTFYDPRHATDELVDRV
FT                   QATIHDRQKAIRLIRMARSAQRETVTDRLCELTMPVLLIWGRNDRITPPEVAETFRKHL
FT                   PAATLHFIDRCGHAPMMERPEQFNALLLAFLQQHCPTVVSNGRPRSAKADTSAPAPSAP
FT                   TPDS"
FT   gene            424793..425122
FT                   /locus_tag="Rmar_0380"
FT   CDS_pept        424793..425122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47284"
FT                   /db_xref="GOA:D0ME60"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME60"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47284.1"
FT                   /translation="MKKTYTTGEVVRAGLLGALLGGVAGFVVGLLVAPETGGQMRRRLT
FT                   YQLEHLGERLQRLSEQLLHPPRPGEARRSGEALVASARAEAETIRQDIDALLGDLRRKR
FT                   TSANS"
FT   sig_peptide     424793..424891
FT                   /locus_tag="Rmar_0380"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.634) with cleavage site probability 0.489 at
FT                   residue 33"
FT   gene            425152..425964
FT                   /locus_tag="Rmar_0381"
FT   CDS_pept        425152..425964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0381"
FT                   /product="protein of unknown function DUF328"
FT                   /note="PFAM: protein of unknown function DUF328; KEGG:
FT                   sun:SUN_0122 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47285"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME61"
FT                   /inference="protein motif:PFAM:PF03883"
FT                   /protein_id="ACY47285.1"
FT                   /translation="MPEFAILLPPAEGKKPGGNPLAPDMFDYRASNTFNYFSELNPERR
FT                   RLIDAVQQAIQAGDDLEKIFGVKGPALEEAIQVNLEIYKAPRMAALDRYSPGVMYQALD
FT                   FPGLPTGAQRRFLENTIIFSGMFGLLRPDDLIPNYRLRMDAVVPGIGKVSRYWRPYISP
FT                   ILNELLKDRFVWNLLPAAHQEAWEDAHTYRQMVEIKFFQEEGGQRRPVSHGVKPLRGRL
FT                   VNFIVREGLEDIEGLKAWRDSEGFVLDEEASEFDEATRRAVLVMVKRG"
FT   gene            425969..426607
FT                   /locus_tag="Rmar_0382"
FT   CDS_pept        425969..426607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0382"
FT                   /product="uridine kinase"
FT                   /note="TIGRFAM: uridine kinase; PFAM:
FT                   phosphoribulokinase/uridine kinase; KEGG: bsu:BSU27330
FT                   uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47286"
FT                   /db_xref="GOA:D0ME62"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026008"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME62"
FT                   /inference="protein motif:TFAM:TIGR00235"
FT                   /protein_id="ACY47286.1"
FT                   /translation="MMGRPVVIGIAGGSGSGKTTVLRRIVEAFGPDRIAVLEHDAYYRD
FT                   LSHLPFEARTQVNFDHPDALETSLLRAHLEALLAGRPVEKPVYNFTTHTREPYTVRVEP
FT                   RPVIIVEGILVLAEPELRELMDIKLYVDAPDDVRLIRRIRRDLQERGRSIESILEQYER
FT                   TVRPMHLEFVEPSKRLADVIIPGGGYNQVAIDMVLARIAALLEQHATSG"
FT   gene            complement(426599..427372)
FT                   /locus_tag="Rmar_0383"
FT   CDS_pept        complement(426599..427372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0383"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: ade:Adeh_2387
FT                   pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47287"
FT                   /db_xref="GOA:D0ME63"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME63"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ACY47287.1"
FT                   /translation="MTWLALDLGNSALKGGLFEADRLVHTFRVAGPDAAGLQQQLAAAL
FT                   RDYRPTRAAMASVVPARTPVVQETVQQLSGVRPALIGPDWRLPFTLAYETPHTLGTDRL
FT                   AAAVAAWELYGRPRRRPVLALLAGTAFTIEVIDEHGCYQGGVIAPGPSLMRQALAEGTA
FT                   QLPEVPLEWPPSPVGRSTRTAIQAGLLYGFVESARGLLRRVAETLATAPLVILSGGWAS
FT                   LLQTHLGQQIDVHDPHLVLRGVYLLLERNPDRGLP"
FT   gene            complement(427369..428166)
FT                   /locus_tag="Rmar_0384"
FT   CDS_pept        complement(427369..428166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47288"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME64"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47288.1"
FT                   /translation="MRSLYWVGFLCVLSLACRPPASGPPTTRTPVAELEATTIPRAFER
FT                   LARDTFRLTRTLVVLDSSGRLLGRAVRTGLYRPDSALRWLRIDQNGTFPEGPFDHAISR
FT                   ADHAPLAATQALWPEPLPFLQPRQRDAYRFRSLPDTVLFGRTVARLHVRPADPERTGPE
FT                   AFQGMLYLDARRLIGAVLQETHATLFGTERRFLSVGLHPDDGRLLREQLLLELDPPGRP
FT                   PYRFCLETRYIYGTQAPADSLPRLPAFCQHPFEDLMALKPDDR"
FT   sig_peptide     complement(428098..428166)
FT                   /locus_tag="Rmar_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.914) with cleavage site probability 0.905 at
FT                   residue 23"
FT   gene            428230..429048
FT                   /locus_tag="Rmar_0385"
FT   CDS_pept        428230..429048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0385"
FT                   /product="Inositol-phosphate phosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /note="PFAM: inositol monophosphatase; KEGG: rme:Rmet_1078
FT                   inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47289"
FT                   /db_xref="GOA:D0ME65"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME65"
FT                   /inference="protein motif:PRIAM:3.1.3.25"
FT                   /protein_id="ACY47289.1"
FT                   /translation="MMDAYTLYEEAREVAARLARDAGQIARYYAGRVTVREKGYNELVT
FT                   QADEEVQRFLIEQIHRHFPEHAILAEENLSDMQDGREGASFRWIIDPIDGTTNFTHGVP
FT                   PYGISLALQHEGRTVVGVVYDVPHDELFTAVRGGGLYVNGVRARVSQTETLREALITTG
FT                   FPYREVVHLEEYLEALGRVIRATRGVRRPGAASVDLAWVACGRFDGFFETGLSPWDVAA
FT                   GILLVEEGGGRVTDFHGRPDPIFARQMLATNGRIHEALCELVAPLHHVYA"
FT   gene            429125..429976
FT                   /locus_tag="Rmar_0386"
FT   CDS_pept        429125..429976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0386"
FT                   /product="enoyl-(acyl-carrier-protein) reductase"
FT                   /note="KEGG: gsu:GSU1008 enoyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47290"
FT                   /db_xref="GOA:D0ME66"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME66"
FT                   /inference="similar to AA sequence:KEGG:GSU1008"
FT                   /protein_id="ACY47290.1"
FT                   /translation="MAEKSYGLLEGKKGVIFGALNEQSIAWAIAEAVHREGGRFILSNA
FT                   PVAKRLGTLEKLAEKTGSPIIWADATNNDDLMALFQQARETFGPLDFIVHSIGMGLNIR
FT                   KNRPYEDLNYDWYIKTLDISAISLHRIIHCALKQEALADGASIVTLSYIGAQRTFSKYS
FT                   EMGDAKALLESIVRSWGYRLGKRRIRINAISQSPTPTTAGSGIEGFDAMYEFAQRVAPL
FT                   GNADAKSCADYTVTLLSDLTRMVTMQTLYHDGGFSSMGISDELIETLAEALGVKQPNEA
FT                   GS"
FT   gene            429973..431523
FT                   /locus_tag="Rmar_0387"
FT   CDS_pept        429973..431523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0387"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="PFAM: Peptidase M1 membrane alanine aminopeptidase;
FT                   KEGG: sus:Acid_2560 peptidase M1, membrane alanine
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47291"
FT                   /db_xref="GOA:D0ME67"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME67"
FT                   /inference="protein motif:PFAM:PF01433"
FT                   /protein_id="ACY47291.1"
FT                   /translation="MTHHAHRGRTRWGAWLVVLLWVGCSAPKHPTYLPPVGIDVRHYDV
FT                   ALRLDPETRHLEGQVTLEVRRTQAATELPLCFGMLVVDSVRVDGRAVAPVRRGQRLIIP
FT                   LNGELQTRVTLAYHGTPSEGLYEATYLGQRVVFTDSWPYRGCEWLPAVHHPSDPATLAL
FT                   TLTVPRGYQAAGSGRLVRIDTLDAAVRFRWQLDATAPTYSFAFAVADYVRTDTVADDTI
FT                   PIHYYLLPSDRDRVYRLRRTPDALHWLSRWLGPYPYRSYAVVQVPIDYAGMENASAPFL
FT                   RADLFDMGDVEGVQVHELVHQWFGNRVSIAGWRDLWLSEGTATYLTTMFYEAYDGFEVA
FT                   RQQWVDMARLTPEALRLHGALVPGRYVDPEAHLTWVPYRKGACVLHLLRLKLGDATFQR
FT                   ALQTVYRRFAGKPLSTEGFQAVLEEVGGRDLDALFDYWVYGDRLPELRVYWEAAQRRLT
FT                   WRVVGDGGTLQGVPFQLAVQQGAQVRYVDARASALQLPEATERPEVHPVGILMKVVYP"
FT   gene            431540..432313
FT                   /locus_tag="Rmar_0388"
FT   CDS_pept        431540..432313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0388"
FT                   /product="Haloacid dehalogenase domain protein hydrolase
FT                   type 3"
FT                   /note="PFAM: Haloacid dehalogenase domain protein hydrolase
FT                   type 3; Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: rpa:RPA3639 Cof-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47292"
FT                   /db_xref="GOA:D0ME68"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME68"
FT                   /inference="protein motif:PFAM:PF08282"
FT                   /protein_id="ACY47292.1"
FT                   /translation="MIRLFVSDIDGCLAEPYRPFALDRFQELARQAHLAGRPGDHPVLP
FT                   AFTICSGRPYPYVEAVTQALGLQVPVLFEAGAGMFDPREVVVHWHPAFTDELAEQVEAL
FT                   RRWMVERCIPGTSLMLDIGKRTQAGMVSPDTEEILRFVPIVEEYVAAHFPAFHVFHTHI
FT                   SIDVVPRGFTKREGLQWLMETLGLEADEVAYIGDSNGDLGALALVGYAFAPANAAESVR
FT                   QQVSYVMDAPDIEGVLAAYRWCIAHNEACRKAVAP"
FT   gene            432367..433092
FT                   /locus_tag="Rmar_0389"
FT   CDS_pept        432367..433092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0389"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   sfu:Sfum_3514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47293"
FT                   /db_xref="GOA:D0ME69"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME69"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACY47293.1"
FT                   /translation="MMGIWLGMLLVLNLRAIAPDSALTLYYVAAEQTLLHAQPGEGAYL
FT                   MLHRREPVHVLDRVGLWWRVRTQDGAEGYVVAHDLSNVWLRVSKRQRRLFVYRGTRLVR
FT                   SFPVDLGTNPFSDKTRRGSVASPDDWRTPEGVFYVAAKNARSQYYRALVLNYPTADDAL
FT                   RGLREGLISEAEYRAIVEAEANFRMPPMNTALGGWIEIHGDGTGQQVTWTQGCVALRNE
FT                   DLDAIWPLVVVGTPVLIEP"
FT   gene            433098..433682
FT                   /locus_tag="Rmar_0390"
FT   CDS_pept        433098..433682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0390"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; methyltransferase
FT                   small; Methyltransferase type 12; KEGG: sus:Acid_3827
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47294"
FT                   /db_xref="GOA:D0ME70"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME70"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACY47294.1"
FT                   /translation="MQVSGNARRYTVDNRLYRWHIQQFLNELGRLVEATKPRTILDVGC
FT                   GEGFVAAFLKRRLPEVEMTGVDLSEEALAYARQHFGELATFRQADIYRLPFPDRSFDTV
FT                   VCSEVLEHLDDPDRAVHELKRVARRYVVITVPLEPYFKWLNILGQWLGVSEDPGHVQFW
FT                   NRDGFETFIRRHFPEAEISRKHIYQLARGRV"
FT   gene            433739..435097
FT                   /locus_tag="Rmar_0391"
FT   CDS_pept        433739..435097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0391"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   bsu:BSU25390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47295"
FT                   /db_xref="GOA:D0ME71"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR002825"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME71"
FT                   /inference="protein motif:PFAM:PF01957"
FT                   /protein_id="ACY47295.1"
FT                   /translation="MRRVFRRAFGLLALLSTTAIGRASEGPVYVVAVEGMVDNVLVQYI
FT                   ERAIHEAEAADAAAIVFRIDTFGGLVAAADQIRQLILDTPLPTVAFIDRNAASAGALIA
FT                   YACDRIVMAPGASMGAATVVEGTTGEAAPDKYQSYMRGLMRATAEANGRDPRIAEAMVD
FT                   PDVAIEGLVPAGKVLTLSAREALELGVADALAASVDEALQVLGYGPHPVVAFAQTGTER
FT                   VLRVLASPVLQTLFLLMMLGGLYFELQTPGVGVPGLIALAGALLFFAPNYLSGLVEFWE
FT                   VVLFLVGVGLLLVELLVIPGFGIAGIAGILFMLAGLLAALIGNVGLSFPSAREIGRAIA
FT                   TLTSTLILLGVGIAVLGRYLPRTRRFQELVLGTGLSRTQGYTAAATEAQLTGKRGRAVT
FT                   PLRPAGVVEIEGRRYDVVASGQFVPAGTPVEVVRVQGSRIEVRPLSEAENQTS"
FT   sig_peptide     433739..433810
FT                   /locus_tag="Rmar_0391"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.870 at
FT                   residue 24"
FT   gene            435122..435634
FT                   /locus_tag="Rmar_0392"
FT   CDS_pept        435122..435634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0392"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   scl:sce5334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47296"
FT                   /db_xref="GOA:D0ME72"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME72"
FT                   /inference="protein motif:PFAM:PF01957"
FT                   /protein_id="ACY47296.1"
FT                   /translation="MELLLAITLILIGLALIVAEVYLIPGMNIAGILGVVLVLFGLAYA
FT                   FTASGLLAGLAVLFGTLVAGGVLFLVLWRSGAWRQFVLATSLKSESAERPGEYRARYLG
FT                   KEGIAVTPLRPVGIVEIDGERIEAATEGQYIAAGSRVRVVAMDRRRYFVRLATRSEASS
FT                   SPDSTES"
FT   gene            435720..436418
FT                   /locus_tag="Rmar_0393"
FT   CDS_pept        435720..436418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0393"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; KEGG: mxa:MXAN_6997
FT                   TonB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47297"
FT                   /db_xref="GOA:D0ME73"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME73"
FT                   /inference="protein motif:TFAM:TIGR01352"
FT                   /protein_id="ACY47297.1"
FT                   /translation="MRFRLFLPLVLLGLLGCQSAPSLEPPEGWLSTDGRWWRAGVDTTL
FT                   AFRDLSSLAAMGLEGAPMASVSRTYATGEVLVQAVRRSLTPLFRVHPEIVDSLFNRHIA
FT                   PELAQASISGDLEAEVDRLRQESYRKLQRYFREPRPITRLGEDVPIVYPDSLIEKGVAG
FT                   TVEMQVYLDAEGQPQAIMLLESVHPVLDRLAMQATAQMRWQPAYVRRGDEWVAVPSWVR
FT                   FNIRYRIPEG"
FT   sig_peptide     435720..435779
FT                   /locus_tag="Rmar_0393"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.905 at
FT                   residue 20"
FT   gene            complement(436419..437741)
FT                   /locus_tag="Rmar_0394"
FT   CDS_pept        complement(436419..437741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0394"
FT                   /product="Na+ dependent nucleoside transporter domain
FT                   protein"
FT                   /note="PFAM: Na+ dependent nucleoside transporter domain
FT                   protein; nucleoside recognition domain protein; Na+
FT                   dependent nucleoside transporter; KEGG: xca:xccb100_3588
FT                   broadly selective sodium/nucleoside cotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47298"
FT                   /db_xref="GOA:D0ME74"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME74"
FT                   /inference="protein motif:PFAM:PF07662"
FT                   /protein_id="ACY47298.1"
FT                   /translation="MSLIALLRGILGLTVILGLAYLLSSDRRHINWRTVGGGLLLQIVL
FT                   AIFILKGREMGAWFAPLGWPKEFFAWVSSFFVLVLNFTTEGARFVFGNLALSPGTDDSL
FT                   GFFFAFQVLPTIIFFSSLMAVLYHLGVMQRIVQAVAWVVSRTLGTSGAESLSVSANIFV
FT                   GQTEAPLVVRPYLEKMTRSELMAVMTGGMATIAGGVMAAYIQLLGDPYAQARGLALEVA
FT                   RLQFAEHLLGASVMAAPAALLLAKMLIPETGQPLTAGTVRVSIERTTRNVIDAAAAGAS
FT                   DGLKLALNVGAMLIAFIALIAMLNYFLGWAGGLVGVELSMERLFGWTLAPVAWLIGVPW
FT                   SDAAQFGALVGTKLVVNEFVAYLNLSTLIGQNALSDKAVAMATFALCGFANFSSIAIQI
FT                   GGIGPLAPSRISELAELGLRAVLAGTLANMMTATIAGVLIG"
FT   gene            complement(437810..439726)
FT                   /locus_tag="Rmar_0395"
FT   CDS_pept        complement(437810..439726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0395"
FT                   /product="peptidase"
FT                   /note="KEGG: xop:PXO_02197 peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47299"
FT                   /db_xref="GOA:D0ME75"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME75"
FT                   /inference="similar to AA sequence:KEGG:PXO_02197"
FT                   /protein_id="ACY47299.1"
FT                   /translation="MRTRWILLLCGVLLVGNLQAQPSAFAPLDLPAPNSYRTASGEPGP
FT                   DYWQQRVDYRIHAVLDTTTHRITGSETITYTNNAPVALQELWLQLDQNLFAAGSLGDAL
FT                   IEPGSRWRGAFEGGGFKITRVEVVQDGRRYAPHYLIDDTRMRIDLDTPLPARGGQLQLE
FT                   IDFSFIVPEYGADRMGRLRVEQGTVYEIAQWYPRLYVFDDVNGWNVAPYLGQGEFYLEY
FT                   GNFDVEITVPRNFIVVATGELLNPDEVLTEAQQARLAQARQSAETVHIIRPEEVGRPET
FT                   RPAGEGPLTWRFHAENVRDFAWAASQAFIWDAASWQDVLLMSVYPKEGLGTPEQPGWEE
FT                   STRYVRHTIAHYSEMWYPYPYPVAINVAGIVGGMEYPMIVFCSVRARGQGLFGVTDHEF
FT                   GHTWFPMIVGSDERRYAWQDEGFNTFINYYSNLAFYGEEAARTQRLQPDYIVRRMQDSL
FT                   VHQPIMTYPDQIRPQALGFVAYRKPGFGLRLLREYVLGPERFDRAFRTYIRRWAFKHPQ
FT                   PADFFRTIENVAGEDLDWFWRGWFYSTDLLDQAIDSVRVAEGQTRLYLHNRQGLVFPVV
FT                   VEATYADGRKARYRFPVELWATGARQTVEIPGEAAQVELDPDHLLPDVDRTNNLWPAST
FT                   STE"
FT   sig_peptide     complement(439664..439726)
FT                   /locus_tag="Rmar_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(439868..440506)
FT                   /locus_tag="Rmar_0396"
FT   CDS_pept        complement(439868..440506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0396"
FT                   /product="flavoprotein WrbA"
FT                   /note="TIGRFAM: flavoprotein WrbA; PFAM: flavodoxin/nitric
FT                   oxide synthase; NADPH- dependent FMN reductase; KEGG:
FT                   tcx:Tcr_1010 flavoprotein WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47300"
FT                   /db_xref="GOA:D0ME76"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR037513"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME76"
FT                   /inference="protein motif:TFAM:TIGR01755"
FT                   /protein_id="ACY47300.1"
FT                   /translation="MEKTRVLVLYYSMYGHIEALAREVAAGAAEVEGVEVVVKRVPELI
FT                   PEERARQIGVKLDQEAPIATVDELPEYDAIIVGTPTRFGNMAAQMRNFWDQTGPLWAKG
FT                   ALIGKVGSVFTATATQHGGQESTILSVHTTLLHHGMIVVGVPFSCAELTQIDEVAGGSP
FT                   YGAGTITGGDGSRMPSEVERRIARFQGRYVAEVAHRLKVGRLQAQEARN"
FT   gene            440707..441510
FT                   /locus_tag="Rmar_0397"
FT   CDS_pept        440707..441510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr2777 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47301"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME77"
FT                   /inference="similar to AA sequence:KEGG:blr2777"
FT                   /protein_id="ACY47301.1"
FT                   /translation="MEERSVARQVNRERVVVLGWGRALLWQLAHPLVAVAVARHSDFSR
FT                   SLRAAWRRFTRTVQAMRRLSFGTEAEADEVARWIRQAHRRVQGRLDEPLGPFPAGTTYR
FT                   ADDPALLTWVHVTTVEATLHAYETFVRPLTPEERDRYCQEARAMEAWLGLPPGTFPDSW
FT                   AALTAHLQTVLASGVLQVTPPARQMAEHVLAPTPWVAPLAKPWRLLTLGLLPPALRAAY
FT                   GFAWSERDERAFRRLVALVRRGVARAPHRVRHWPEARRLHLAPGR"
FT   gene            441587..443893
FT                   /locus_tag="Rmar_0398"
FT   CDS_pept        441587..443893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0398"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: bcy:Bcer98_0285
FT                   ATP-dependent DNA helicase PcrA"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47302"
FT                   /db_xref="GOA:D0ME78"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME78"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACY47302.1"
FT                   /translation="MRTFLLQPDPNAENETPEPLPEAAARILEGLNPVQRQAVQVTEGP
FT                   VLIIAGPGSGKTRTLTHRIAYLIATGRARPHQILALTFTNKAAREMMERIERLVGAEAA
FT                   RHIWMGTFHAIFARILRREGHRIGYTPDFSIYDTDDSERLLRELMARYHIDPRQYSPRT
FT                   IRHLISGAKNQMIGPEEYARLVASPVQEKAAKLYGPYQEALRKANALDFDDLLLKPIEL
FT                   FEQHPDVLQRYQERWRYLHIDEYQDTNRAQYVLARKLAAAHRNLCVVGDDAQSIYAFRG
FT                   ADIGNILSFQRDYPDATVIRLEQNYRSTRRILKLAEAIIQHNRDQLEKRLWTENPEGDP
FT                   IVLIEALSERDEAQKVEQRIRDLHVRYGYAFRDFAVLYRTNAQSRSLEEALRRGGIPYR
FT                   VVGGLSFYQRKEIKDVLAYLRLLVNPHDAASLQRVINYPARGIGQRTIEVLADYARQHG
FT                   LSLWQAIERVEEVGLPTRAQKAVQEFHFLIARHAAKMDAMPVDELARSLLQESGLLEEL
FT                   RREGTPEALARWENVQELLNAIAEYVATAGEQATLSGFLQEVALLTDLDEMPEDNRVTL
FT                   MTLHASKGLEFPVVFITGLEEGLFPLAQATQDRKDLEEERRLFYVGVTRAQRHLFLCYA
FT                   RSRYRYGEQQPSVRSRFLEELDTDVIVTEAGLPFRRGEVLDRRPRSERYVEMDPHYYRR
FT                   PLQQRRSSGATRRVVYDEGAGEIVPGARVEHAIFGEGKVLALEGQGDQARAIVFFPEVG
FT                   QKKLVLKFARLRRID"
FT   gene            complement(444155..444595)
FT                   /locus_tag="Rmar_0399"
FT   CDS_pept        complement(444155..444595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47303"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME79"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47303.1"
FT                   /translation="MRGSAGLYALVGAALLLAGCALIEPEASLERPSESECDETPPRID
FT                   MDRFPRDTSLLWGEWRWVKSVISTSFSLLVQTPCSAGYTETLIIRPEGVVEVYRNDTLA
FT                   YRETLQEFLDTPLEWGVNQDSLVTNSLPVDGSLEIFVRKRAD"
FT   gene            complement(444636..445904)
FT                   /locus_tag="Rmar_0400"
FT   CDS_pept        complement(444636..445904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0400"
FT                   /product="Phosphodiesterase I"
FT                   /EC_number="3.1.4.1"
FT                   /note="PFAM: type I phosphodiesterase/nucleotide
FT                   pyrophosphatase; KEGG: pzu:PHZ_c1256 type I
FT                   phosphodiesterase/nucleotide pyrophosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47304"
FT                   /db_xref="GOA:D0ME80"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME80"
FT                   /inference="protein motif:PRIAM:3.1.4.1"
FT                   /protein_id="ACY47304.1"
FT                   /translation="MNRHAAVLRLVLLATLLVGWLTGCRTTRTTPVDDGPPPLLLISID
FT                   GFRADYLDRYEPPTLTALAREGVRAEALIPVFPSLTFPNHYTIVTGLYPDHHGIVANTM
FT                   FDSTLGWFRLSDRDAVSDGRWWRDGEPIWVTAERQGLRTATYFWPGSEAEIRGVRPTYW
FT                   VPYDGSIPGETRVRQVLEWLDLPDSLRPRFLTLYFSEVDHAGHEHGPDAPEVAEAVQRV
FT                   DGYLRLLVDGLRARGLLDRVNLLIVSDHGMTATSRERVIFLDDYIALDDVQVVNWSPVL
FT                   MLTPRPGRLETVLQALREAHPHLHVYRKAELPAHLHFGTHPRIPPIVGLADEGWTITTR
FT                   ARFEQQPDRFPMGMHGYDPTLPSMHGILIAHGPAFARGRVVPPVENIHLYALMCRLLGI
FT                   TPAPNDGSPEATELLLALETSAP"
FT   gene            complement(445901..446278)
FT                   /locus_tag="Rmar_0401"
FT   CDS_pept        complement(445901..446278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0401"
FT                   /product="protein of unknown function DUF307"
FT                   /note="PFAM: protein of unknown function DUF307; KEGG:
FT                   sdn:Sden_2147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47305"
FT                   /db_xref="GOA:D0ME81"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="InterPro:IPR031308"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME81"
FT                   /inference="protein motif:PFAM:PF03733"
FT                   /protein_id="ACY47305.1"
FT                   /translation="MRLLGNLLWLVLGGLLVALEYALAGLLLCLTLIGIPFGLQCFKLA
FT                   LLALFPFGHTVREKPPATGCLALAMNVLWLLLGGVWIALTHLAAALVCAITIIGIPFAL
FT                   QHLKLARLALTPFGYEIVRLP"
FT   sig_peptide     complement(446204..446278)
FT                   /locus_tag="Rmar_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.921 at
FT                   residue 25"
FT   gene            complement(446285..446542)
FT                   /locus_tag="Rmar_0402"
FT   CDS_pept        complement(446285..446542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0402"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47306"
FT                   /db_xref="GOA:D0ME82"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME82"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47306.1"
FT                   /translation="MRRLPALLLLGASALLLAGCGPNLIDRLQNFWALGFCGTVIVVLD
FT                   ILALIELANSQREFSSKALWALLIIFFPVGGLILYYFFGR"
FT   sig_peptide     complement(446486..446542)
FT                   /locus_tag="Rmar_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.579 at
FT                   residue 19"
FT   gene            446721..447797
FT                   /locus_tag="Rmar_0403"
FT   CDS_pept        446721..447797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0403"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; KEGG: bha:BH0097 nitrogen
FT                   regulation transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47307"
FT                   /db_xref="GOA:D0ME83"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME83"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ACY47307.1"
FT                   /translation="MRIGTIELGERPLFLAPMEDVSDPPFRLLCKRYGADMVFTEFISS
FT                   GGLVHESEDAVKKLDIYDEERPVGIQIFGGELEQVREAARIVDQIGPDVIDINFGCPVR
FT                   KVVCKDAGAGVLRDLNKMRALTEAVIEVATRPVTVKTRLGWDDRSIRILEVARMLEDCG
FT                   VQALTVHARTRAQMYKGSARWEWLRRLKELGLSIPIIGNGDALTPEKVKQMFDETGVDG
FT                   VMIGRGAIGNPWIFRDAKIYMETGELPPPPSWEERVRVVAEHLELKCQWLGERKGVLEM
FT                   RRMYGGYFKGFPGASRLRQLLMDKETKAEVLEILLNFRPDDPEIQVAVPRAVRAVPVAL
FT                   TARLPAPTRQKAQTAEAA"
FT   gene            447868..448830
FT                   /locus_tag="Rmar_0404"
FT   CDS_pept        447868..448830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0404"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: pca:Pcar_0623
FT                   site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47308"
FT                   /db_xref="GOA:D0ME84"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME84"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACY47308.1"
FT                   /translation="MAEREAKDGRVEVGLKLTLNELQRRLRDFQQEYLKNKSPETVGTY
FT                   RRALHEFERWFATQRGQFRFRVADVQRYKQYLMREKKLHQVSVSTYLTALRRFCQYLVD
FT                   IGLLPENPARTVKGNRRPSSHSRSVLTRVEIEQLLAVLDQDTSQIGLRDRAIVHMMLFA
FT                   GLSEVEIVRADVRDLDQTLLGWYLRVQGKGHTAKDQQVPLDPPVVEALQAYLNTRVPLH
FT                   PGEPLFVSHGHRSEGQRLNTRSVRSRIKQHLEAAGITRRGVTPHSLTHTAALIWLNQGM
FT                   SIEEVQRRMRHGTLETTMIYYRKQGLLNRDPEELKRLLG"
FT   gene            complement(448827..449468)
FT                   /locus_tag="Rmar_0405"
FT   CDS_pept        complement(448827..449468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0405"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; KEGG: ade:Adeh_2979 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47309"
FT                   /db_xref="GOA:D0ME85"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME85"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACY47309.1"
FT                   /translation="MTHLPSWRKNLQRHSGFWRDGYWYDLHLERRMPLALEMIDEMVLA
FT                   LPPLREGTRVCDLACGTGNAAAAVVSAYPLVHLTLIDRDSDLLAIAYDKVADYCPDAVT
FT                   IQATIVPDGEPLPGGPYDVVLASLALHVLVGHDSERSDPAEVETRYELLLQGIRDTLTP
FT                   GGHLIIGDHVGVLPLYRHLKALERTGFVDVDCAWRVDDFFVIGGRVPDTP"
FT   gene            complement(449527..450291)
FT                   /locus_tag="Rmar_0406"
FT   CDS_pept        complement(449527..450291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0406"
FT                   /product="DNA repair protein RecO"
FT                   /note="TIGRFAM: DNA repair protein RecO; PFAM:
FT                   Recombination protein O RecO; KEGG: glo:Glov_2799 DNA
FT                   repair protein RecO"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47310"
FT                   /db_xref="GOA:D0ME86"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME86"
FT                   /inference="protein motif:TFAM:TIGR00613"
FT                   /protein_id="ACY47310.1"
FT                   /translation="MIVRTEAIVLRTLPYGETSLIASLFTRAKGRLSMMAKGARLPGSR
FT                   FGGTLQPPSCLQVVFYYRPTRELQTLSESSFAQYLPELGRDLEKLTLSLRMVELAHALL
FT                   PPEEPMPEFFETFWQVLARLDATPTRAWNLLPWFQLRLAAALGFAPRIERALVEQIGPE
FT                   GGELALASGQVRPRSADPEPTQPASRAALRAFAFLARTDPDTALRLHLNPSHRHELLQL
FT                   TEAYLHHHVPEGFPTRSGRVAERLFETLRPGS"
FT   gene            450416..450811
FT                   /locus_tag="Rmar_0407"
FT   CDS_pept        450416..450811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0407"
FT                   /product="competence protein ComEA helix-hairpin-helix
FT                   repeat protein"
FT                   /note="TIGRFAM: competence protein ComEA helix-hairpin-
FT                   helix repeat protein; SMART: Helix-hairpin-helix
FT                   DNA-binding class 1; KEGG: afr:AFE_3100 competence protein
FT                   ComEA helix- hairpin-helix repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47311"
FT                   /db_xref="GOA:D0ME87"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME87"
FT                   /inference="protein motif:TFAM:TIGR00426"
FT                   /protein_id="ACY47311.1"
FT                   /translation="MKLLRRWLSNLSLTRTEAGVLLGLLALLLAGLAYRWWQRQQPVPP
FT                   PTAEEAARFREGAARMRQVLEPEPLNVNTATAEELERLPRIGPVLARRIIEYREAHGPF
FT                   RRIEELEAVPGIGPKTLAELAPLIRVE"
FT   sig_peptide     450416..450517
FT                   /locus_tag="Rmar_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.825 at
FT                   residue 34"
FT   gene            complement(450798..451007)
FT                   /locus_tag="Rmar_0408"
FT   CDS_pept        complement(450798..451007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47312"
FT                   /db_xref="GOA:D0ME88"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME88"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47312.1"
FT                   /translation="MDYYTLVILGALIGFLALAALLLVPVYRFLQREDEAARRFTAEYL
FT                   RRQQAARPNGADHDEETPEPPTRP"
FT   sig_peptide     complement(450948..451007)
FT                   /locus_tag="Rmar_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.956 at
FT                   residue 20"
FT   gene            451100..451933
FT                   /locus_tag="Rmar_0409"
FT   CDS_pept        451100..451933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0409"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; putative
FT                   esterase; KEGG: aba:Acid345_2269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47313"
FT                   /db_xref="GOA:D0ME89"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME89"
FT                   /inference="protein motif:PFAM:PF02230"
FT                   /protein_id="ACY47313.1"
FT                   /translation="MHGSSTTLWGLSLLLLIALVVPPARAQDCDGTTQTGFLLRTLEYN
FT                   GQTHHYQVFVPPDYTPERTWPVILFLHGAGERGTDGFKQTAVGIGQAIRMNVERFPAIV
FT                   VFPQVPPGRAWFGEQAEVAMAALDEVMATYSVDPERVYLTGLSMGGHGTWYVAYHWPDR
FT                   FAAIVPICGFIVFPEAARGFFGELPPEQLEIQSAEDPYRKVAERIKHLPIWVFHGADDP
FT                   VVPVEASRRMVEALRELGADVQYTEYEGVGHEAWEPAYAEFALMPWLLSHRRPKE"
FT   sig_peptide     451100..451180
FT                   /locus_tag="Rmar_0409"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            451942..452136
FT                   /locus_tag="Rmar_0410"
FT   CDS_pept        451942..452136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afr:AFE_2792 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47314"
FT                   /db_xref="InterPro:IPR032568"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME90"
FT                   /inference="similar to AA sequence:KEGG:AFE_2792"
FT                   /protein_id="ACY47314.1"
FT                   /translation="MMCELDRVVLVRDLPEHGLEAGDVGTVVHVYGEGEGYEVEFVGGE
FT                   GETVAVITLGPEDIRPMRF"
FT   gene            complement(452181..453023)
FT                   /locus_tag="Rmar_0411"
FT   CDS_pept        complement(452181..453023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: zgc:111944"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47315"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME91"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47315.1"
FT                   /translation="MNKIRAMVLGLLVWAAPTALAQSQPDLNAVAQRMAERLQLSEATA
FT                   QALREAFARHADRYEQGGFFWYVAAELQRRLNDEQRAEFWEEPLRAERERPARRRWRER
FT                   QDRPDRRMRRERLHRRDDRPPAHRAAWMAARGARLADYLNLTEAQRDSLAVLRRRQGDA
FT                   MRELLRQRREGALSAEAFREQVRQLREQYRARFRQLLTPEQQERLDRLEAIPENSRKAM
FT                   LEVLRLTDTQQQQLAARALQPGPDRGALAEILTPEQQEIVRLHRRLVRAWQDVQRNDG"
FT   sig_peptide     complement(452958..453023)
FT                   /locus_tag="Rmar_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 22"
FT   gene            453072..453596
FT                   /locus_tag="Rmar_0412"
FT   CDS_pept        453072..453596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0412"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rru:Rru_A0455 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47316"
FT                   /db_xref="GOA:D0ME92"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME92"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACY47316.1"
FT                   /translation="MARELSRFCGEFLEKPDGRMVETVVRVVDVYAYRLEEGRPRFLLL
FT                   RRAPGVSYAGQWRMIGGKIRRGEAAWQTALREIEEETGQQPRRLWVVPSLNAFYEWQHD
FT                   RVNLIPAFAAELTDDPVLNDEHDAFAWLDEEEAVARLPWPEQQRLLRLTARLLRQGLPP
FT                   EIFVFECENAQ"
FT   gene            453671..455959
FT                   /locus_tag="Rmar_0413"
FT   CDS_pept        453671..455959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0413"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molybdopterin
FT                   oxidoreductase Fe4S4 region; molydopterin dinucleotide-
FT                   binding region; KEGG: ade:Adeh_0908 periplasmic nitrate
FT                   reductase subunit NapA apoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47317"
FT                   /db_xref="GOA:D0ME93"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010051"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME93"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /protein_id="ACY47317.1"
FT                   /translation="MNLSFSMESGKLTRRELLQRLSALAGGLILTGPISGCEGFWRREP
FT                   AIPVDSWHKGVCRFCGTGCGIMIGVRDGKVVDVKGDEYAHNRGRICIKGILNREILYVR
FT                   DRALYPMIRRNGRLERATWDEAMSLVAERFREAIDRYGPDSVAFYGSGQLFTEESYTAN
FT                   KLFKAGIGTNNVDGNPRLCMASAAAGYISVFGKDEPMGCYEDIDHATCFFITGSNTADC
FT                   HPIVWERIMDRKRSRPETVIIVVDPRRTRTARHADYHLAIRPGTDVALYNAMIYEFIRN
FT                   GFIDQDMVENYLTFREGDAERTFEDLKRHVAQYTPERVAPVCGVDARQIEEVAYLFAAS
FT                   EATMSIWTMGLNQQAQGTAANRLVNAMHLLTGHIGRPGATPFSLTGQPNAGGGVRDTGA
FT                   LAHALPNGRVVANPQHRAEMEDLWGVPRGRISPKPGYHAVAMFEAMARGDLKCVLIMGT
FT                   NPAQSLPHAERYREAMQRTFLVVADAIYPTETAQFADVFLPSAMWVEKGGVFSQSERRY
FT                   HLVPKLVEPPGEARSDLEILVELADRLGYGDLIKARTPEEVWDEWRQISAHSPYNFAGI
FT                   TYERLKKERGILWPAPTEDHPGTCRRYVPGEDPMAKGTGRFDFYGRPDGRAVVYLEHQQ
FT                   PSSDPRSDEYPLTLVTGRVYEHWHTLTITGKLEELEDITTDFLVVHPRDAHRYGIRDGA
FT                   PVLVESRRGRAVLKARVSTDITPGVVFAPFHSPEALVNRVVNNTVDPISKEPAFKESAV
FT                   RIRPASSAA"
FT   gene            455976..456704
FT                   /locus_tag="Rmar_0414"
FT   CDS_pept        455976..456704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0414"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_2746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47318"
FT                   /db_xref="GOA:D0ME94"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME94"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47318.1"
FT                   /translation="MNRLQRILLRVLVVGWPGLAWAAEGETPGITSAELFRIIGIVAAL
FT                   LGIGWLVVSHWLLRDRLPRTFYHWAMLLGLFALPALALMGAVEFVFEETKTVASCNSCH
FT                   VMEPFVRDLQDPHSATLAARHYRNKWIPENQCYACHTTYGLHGSFEAKRDGFRHWLLYV
FT                   TRSWDEPIQYSGSYPNINCLNCHGETDAFQRVPSHGALMTELQADRVACTSCHGPPHPT
FT                   PPERTRLLSAAPVHSSREMP"
FT   sig_peptide     455976..456044
FT                   /locus_tag="Rmar_0414"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            456701..456913
FT                   /locus_tag="Rmar_0415"
FT   CDS_pept        456701..456913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47319"
FT                   /db_xref="GOA:D0ME95"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME95"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47319.1"
FT                   /translation="MNAAASVDRLLRTAVVLAIVGLSCLLIFLLSGFAAWSVGLGIFLG
FT                   VPLLMVALVLYVLVVIRDLRRRGAL"
FT   sig_peptide     456701..456805
FT                   /locus_tag="Rmar_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.769 at
FT                   residue 35"
FT   gene            456980..458782
FT                   /locus_tag="Rmar_0416"
FT   CDS_pept        456980..458782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0416"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   aba:Acid345_1514 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47320"
FT                   /db_xref="GOA:D0ME96"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME96"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY47320.1"
FT                   /translation="MGTLARLNPYFWKYRRLFGPGLLCAIASALFAMLAPGVVRQAVDS
FT                   VPRFVAYYRAVEGTSAQPFFYAYALTGLLFYGGVILGLSLLSGLFTFLMRRTIVVASRH
FT                   IEFDLRNALYEHLQRLPPSFYRKFPTGDVLTRATSDIEQVRRYVGPAIMYATRAVVLMV
FT                   AAITAMLLISPELTLYTLLPMPLLAVGVFWVAHLVHQRSDALQAQYARLTSRVQEALNG
FT                   IRVLKAYTREEAEARAFDAESEAYRRRMLDLARVDAFWSPIFLLLTGLSTILVVWKGGQ
FT                   LAMAGAITIGNIAEFIIYVALMTWPVASVGFVLSMIQRASASMNRLAEIFDTEPEIRDD
FT                   PAWTDYSIQQIEGRITFKNVYFRYEEDGPWVLEDISFDLPAGGVLGIVGRTGAGKTTLV
FT                   ELIPRLIEPVRGVVEIDGHDVRRIPLAVLRRAIGYAPQDVFLFSDTVAANIAFGELEAD
FT                   LARIEEAAYEADLLENVRHFPHGFETFVGERGITLSGGQKQRTAIARALIRRPRILILD
FT                   DALSAVDTETERRILRQLRRHYGKRTVVIVSHRISAVQEADLILVLDEGRIVERGTHAE
FT                   LLKQDGLYARLYRQQLLEEELKQL"
FT   sig_peptide     456980..457078
FT                   /locus_tag="Rmar_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.415 at
FT                   residue 33"
FT   gene            458790..459770
FT                   /locus_tag="Rmar_0417"
FT   CDS_pept        458790..459770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0417"
FT                   /product="ribonuclease Z"
FT                   /note="TIGRFAM: ribonuclease Z; PFAM: beta-lactamase domain
FT                   protein; KEGG: ect:ECIAI39_2416 binuclear zinc
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47321"
FT                   /db_xref="GOA:D0ME97"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME97"
FT                   /inference="protein motif:TFAM:TIGR02651"
FT                   /protein_id="ACY47321.1"
FT                   /translation="MELFVIPLGTASAVPTRTRHLSSLALWRAGRLLLFDCGEGTQYRL
FT                   LAAELKAPRLEAIFITHFHGDHFFGLFGLLATLAMLNRTEPLVVVGPEGIERLIESMPG
FT                   LSGAERGFPIRYVELAEGFEHAVVFETPDYVVTARPVEHRVFTVGYRFEERTRPGRLHV
FT                   ERARALGVTEPEQYRALKEGRPVQVGDRWVRPEEVLGPPIPGRTFAYLTDTRPCENGRL
FT                   LAEGVDLLYHEATFGEVHHALAVERGHATAREAAELAREAGARRLLLGHFSARYEDPAP
FT                   LVAEARAVFPNTEAAEELKRYVLPPHAPRRAALQETANVADDRGR"
FT   gene            459760..461562
FT                   /locus_tag="Rmar_0418"
FT   CDS_pept        459760..461562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0418"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   aba:Acid345_2371 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47322"
FT                   /db_xref="GOA:D0ME98"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME98"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY47322.1"
FT                   /translation="MDDKPTRDETRGLDRRLLWRLAGYLWPYRGWVALAFCTVMAEAFL
FT                   GPLRPKLVQVAIDRHIVEGDWSGLQQIILLLVGVLVVEAGLSFVNDYLTQWIGQRAIYD
FT                   IRTKVYRHIQRQSLRFFDRTPVGRLITRVTNDVESLSDMLSAGVVRILGDLFRIVFIAS
FT                   FMFMLEWRLALVTLAVMPLMMAAVAWFRRKVREQYRETRRQIARLNAFLQEHIGGMKIV
FT                   QLFNREAEELRRFREINDAHRQAQIKTVFYFALFWPAVQLVSDTALGLVLWVGGLRALE
FT                   GTLTLGVLIAFIQYVRQFFEPIRNLSDQYNMLQSAMAGAERIFGLLDQDTALPEPAHPV
FT                   RVERLRGHIEFRNVWFTYDELPTDGQEPNWVLRDVSFTVEPGQHLAIVGATGAGKTTII
FT                   NLLLCFYDVQRGQILVDGHDVRDYALRDLRRHIGLVLQDVFLFSGTVLDNITLGDPSIP
FT                   FEKVQEAARLIGADRFIERLPNGYFQDVRERGLTLSHGQRQLLSFVRALVYDPEVLVLD
FT                   EATSSVDTETEQLIQRAMETLLRGRTAIIIAHRLSTIQHADQILVMHRGEIRERGTHQE
FT                   LLARDGLYRKLYELQFMEQARSAA"
FT   gene            461634..461987
FT                   /locus_tag="Rmar_0419"
FT   CDS_pept        461634..461987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0419"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: afw:Anae109_3644 regulatory protein
FT                   ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47323"
FT                   /db_xref="GOA:D0ME99"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0ME99"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACY47323.1"
FT                   /translation="MARSETKRFLPPEERMAALMRALGHPARIAILKLLAERGAMPCFE
FT                   LVEELPLAQATISQHLRTLREVGLITFQTDGPRSYYRIRPEALQELDRAFRFLMMQLRP
FT                   ALSPEPGFPPNVA"
FT   gene            461993..462577
FT                   /locus_tag="Rmar_0420"
FT   CDS_pept        461993..462577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0420"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_1898 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47324"
FT                   /db_xref="GOA:D0MEA0"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEA0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47324.1"
FT                   /translation="MKDRLKKGIQELGSWIMRGVLLWIVVFSILTTVIIILFGIKKAVY
FT                   FLQTLSIFVSLFGLYRIYKYFDLSIFEYIAKYFKEFPFRKKEVITVSATITLPAGFGFK
FT                   AEAKVIPSDLKKRIELLEQEVDQVKNEMRNLENELKQRVKEIEGKLSSDILEIKKENRR
FT                   RAIEGLIMEGLGVLYLSISLFLQMIYDFMTA"
FT   gene            462707..463471
FT                   /locus_tag="Rmar_0421"
FT   CDS_pept        462707..463471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0421"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47325"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR029461"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEA1"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACY47325.1"
FT                   /translation="MKLLAISDLREAFDYIDRLPEIVQEARIDAVLFAGEILQAEARKA
FT                   EWERAVREQRLPDRARPEVVEERKNDAESLMTFFRRLNTIGVPVYVIPGRNDAPERFFM
FT                   QAAFNSEIVTPHVHMVHRSFAPLGGRYMVAGFGGEVTVEARDHEFFLRYPGWEAIFSLD
FT                   FLRHLDPPKILLFYTAPADRFEEPADQSGPAAVAHLIKTYDPHFVVCAGVGGRKEKKQL
FT                   GNTLVVFPGSLAEGDYAIIDTREKEVAFGNLR"
FT   gene            complement(463578..464144)
FT                   /locus_tag="Rmar_0422"
FT   CDS_pept        complement(463578..464144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0422"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   aba:Acid345_1412 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47326"
FT                   /db_xref="GOA:D0MEA2"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEA2"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ACY47326.1"
FT                   /translation="MPTYEDALKLFHEWTQSENLRRHGYAVEAAMAHYARHFGEDETLW
FT                   RMTGLLHDLDYERHPTPEEHPYVGVRVLRELGYPEEMLEAILGHADYTGTPRRTLLARA
FT                   LFAVDELAGFITAVAYVRPTRLEGLTVKSVRKKLKDKAFAAGVSREDIYRGAEELGLPL
FT                   EEHIAHVIAGMQAEAERLGLAAPTS"
FT   gene            complement(464148..465011)
FT                   /locus_tag="Rmar_0423"
FT   CDS_pept        complement(464148..465011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0423"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sus:Acid_7533 xylose isomerase domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47327"
FT                   /db_xref="GOA:D0MEA3"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEA3"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACY47327.1"
FT                   /translation="MALTRRQALRTLAGAAALGSMGAPLVLTSRNRPQFKGRIKHSVCK
FT                   WCYPNLSVEELAAAGVKMGLQSIELLDPPDWPIVKKYGLTCAMGNGPSRIPDGFNRREN
FT                   HEWLIPQFKKRIEEAAEAGIPNIICFSGNRNGMDDEEGLENCVIGLKEILPTAEKYGVT
FT                   ICMELLNSKIDHPDYMCDHTEWGVRLVKRLGSERFKLLYDIYHMQIMEGDIIRTIRENI
FT                   EYIAHFHTAGVPGRHEIDDSQELYYPAIMRAIADAGFDGFVAQEFIPTADDPLESLRRA
FT                   IAICDV"
FT   sig_peptide     complement(464943..465011)
FT                   /locus_tag="Rmar_0423"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.737 at
FT                   residue 23"
FT   gene            465237..467795
FT                   /locus_tag="Rmar_0424"
FT   CDS_pept        465237..467795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0424"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; TrkA-C domain
FT                   protein; TrkA-N domain protein; KEGG: hch:HCH_05288
FT                   NhaP-type Na+/H+ and K+/H+ antiporters"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47328"
FT                   /db_xref="GOA:D0MEA4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEA4"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ACY47328.1"
FT                   /translation="MESIVLGIVAVLVLGVGAQWLAWRFRLPSILLLLIFGFLAGPVTG
FT                   LLPPEALQGDWVFAFVSLSIGIILFEGGLNLRLSELREVGKAVRNLITVGVLVTWVLAG
FT                   LAAYHIVGLNPSLSVLVGAILTVTGPTVVIPLLRHVRPSGRVGAVAKWEGITIDPVGAI
FT                   LAVLVLETILLLEAAPGAGESLSEAIWHAVEGLLLTITISVGISVLGAALLILLLYRRL
FT                   IPDYLQSPIALMIVVATFALSNVLQEESGLLEVTLLGIILANQRYVPVRRITEFKEDLQ
FT                   VLLISSLFIVLSARLDIESLRFIEEEALLFLAALVLVVRPVAVWISTLGTNLNWREKVF
FT                   LSWLAPRGIVAAAVASLFAFRMETVYPGQAQTIVPLVFLVIVGTVALYGLTIAPLARFL
FT                   KLADPNPQGVLILGAHLWARRLATILRDLGFKVLLIDSNADNIARARRARLPAARVNAL
FT                   SEEVLDELDLSGIGYFLALTPNDEVNALAALHFAEVFDSTSVFQLAMRSEDGEQDLPAH
FT                   LRGRPLFGGKVTYATLTERFNQGGEIRMVELSEKMTYEALLEEYEGDLILLFVVRGNEL
FT                   LVHAEEGQLTPQPGDKVVVFLPPRAREKEEVEAVSFEQLVTRAFVRDLDRCAPFEELVE
FT                   DVSALLAQRLPVTAARLSRGFLDGARYGLMPITHGVALAHLRVPEIEEPELLLVRCREG
FT                   VQITVDGEAVEAPASGQPETVYAILFLVSPEENPGKHLRTLAYLASRIDEPDFLERWRN
FT                   AADELELKATLLDPEHFLMLTLRADDETAAWIGHDVDELELPPSCQVALVQRQQKRFVP
FT                   GPYTQLQEGDRLILIGEASAIRSLRQRFPSARPTSASVER"
FT   gene            467963..468199
FT                   /pseudo
FT                   /locus_tag="Rmar_0425"
FT   gene            468297..468521
FT                   /pseudo
FT                   /locus_tag="Rmar_0426"
FT   gene            complement(468901..471225)
FT                   /locus_tag="Rmar_0427"
FT   CDS_pept        complement(468901..471225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0427"
FT                   /product="5-methyltetrahydropteroyltriglutamate/homocystei
FT                   neS-methyltransferase"
FT                   /note="TIGRFAM:5-
FT                   methyltetrahydropteroyltriglutamate/homocy
FT                   steineS-methyltransferase; PFAM: Methionine synthase
FT                   vitamin-B12 independent; Cobalamin-independent synthase
FT                   MetE domain protein; KEGG: ccs:CCNA_00515 5-
FT                   methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47329"
FT                   /db_xref="GOA:D0MEA5"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEA5"
FT                   /inference="protein motif:TFAM:TIGR01371"
FT                   /protein_id="ACY47329.1"
FT                   /translation="MIQATNLGFPRIGLARELKWAVEGYWAGRVSENELLETARRLRAR
FT                   HWQWQQEAGLDQIPSNDFSLYDHVLDTIALVGAVPERFGWRGDSVDLATYFAMARGVQE
FT                   KELEARGLEGTGVPPLEMTKWFDTNYHYLVPEFHPEQRFRLASTKPIDEYLEAKALGIE
FT                   TRPVLLGPVSFLLLGRATVTHFDPLTLLDRLLPVYAEVLRRLKAAGARYVQMDEPCLVR
FT                   DLPPGARQAYQQAYAALSRPEHPALVLTTYFGGLEENLPLARSLPVAAVHLDLVRAPEQ
FT                   LEPALAHLPEDRILSLGLVDGRNVWRTDLDVAASMLRRAVDALGRERVWIGPSCSLLHV
FT                   PIDLDAEAELDPEIRPWLAFARQKLDELVTLKRLINEGEAAAGDRLETARRARQERLTS
FT                   PRRIDPEVQRRLAALSSEMTRRGRPFAERYALQRARLKLPLLPTTTIGSFPQTDELRRK
FT                   RAAFRRGELSREVYEQFLEATIAETIARQEAIGLDVLVHGEPERSDMVEYFAEQLQGFL
FT                   VTRNGWVQSYGTRCVRPPILYGDVARRGPMTVRWTTFAQRCTARPVKGILTGPVTILQW
FT                   SFVRDDQPRADTCRQIALALRDEVADLEAAGISVIQIDEPALREGLPLRRRDWPAYLEW
FT                   AVECFRLASCVVRDETQIHTHMCYADFEDILEAIAALDADVISIEAARSRMALLDAFRR
FT                   FRYPNAIGPGVYDIHSPRVPSVEEIEALLKRALEVIPAERLWVNPDCGLKTRRWAEVEP
FT                   ALRHMVEAARRLRARVTAEAT"
FT   gene            complement(471242..471619)
FT                   /locus_tag="Rmar_0428"
FT   CDS_pept        complement(471242..471619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF2029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47330"
FT                   /db_xref="InterPro:IPR041049"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEA6"
FT                   /inference="similar to AA sequence:KEGG:XF2029"
FT                   /protein_id="ACY47330.1"
FT                   /translation="MTETVHLLADMNISPLTVALMQQQGWDVIRVSDRLPANAPDWEVL
FT                   RLAREENRVLITHDLDFSSLLAISGWSKPSLITLRLHNVDPDTVARYVDRVLRRFGQRL
FT                   LEGCAVSVDEQSIRLRPLPIS"
FT   gene            complement(471616..471852)
FT                   /locus_tag="Rmar_0429"
FT   CDS_pept        complement(471616..471852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0429"
FT                   /product="protein of unknown function DUF433"
FT                   /note="PFAM: protein of unknown function DUF433; KEGG:
FT                   sus:Acid_6200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47331"
FT                   /db_xref="GOA:D0MEA7"
FT                   /db_xref="InterPro:IPR007367"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEA7"
FT                   /inference="protein motif:PFAM:PF04255"
FT                   /protein_id="ACY47331.1"
FT                   /translation="MKPLDRITINPEICLGQPTIRGTRITVSTILKLLASGKTVQEVLE
FT                   AYPELEAEDIYQALAYAAWHVSEQVHPDLPEQA"
FT   gene            complement(471907..472950)
FT                   /locus_tag="Rmar_0430"
FT   CDS_pept        complement(471907..472950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0430"
FT                   /product="Ribonucleoside-diphosphate reductase"
FT                   /EC_number="1.17.4.1"
FT                   /note="PFAM: ribonucleotide reductase; KEGG: mca:MCA1637
FT                   ribonucleotide-diphosphate reductase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47332"
FT                   /db_xref="GOA:D0MEA8"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEA8"
FT                   /inference="protein motif:PRIAM:1.17.4.1"
FT                   /protein_id="ACY47332.1"
FT                   /translation="MMELPAFGSRRIRVEDKRLINCHEVDVNQLMPIKYAWAWEHYLNG
FT                   CKNHWMPSEIPMARDIELWRSDKLTDDERLVILRNLGFFATAESLVGNNIVLAIFRHVT
FT                   NPECRQYLLRQAFEEAIHTHAFLYIVESLGLDEGEVFNMYREIPAVARKDEFEMELTRE
FT                   VLRPDFTTATVEGAQAFLKNLIGYYVIMEGIFFYSGFAMILSFHRQNKMTGIGEQFQYI
FT                   LRDETIHLNFGIDLINGIKAENPELWTPEFQREVQQLIEEAVELEVAYAYDCLPRGVLG
FT                   LTAPMFREYVQYIADRRLERIGLKARYGSKNPFPWMSETIDLLKEKNFFETRVTEYQQA
FT                   AALSWDE"
FT   gene            complement(472995..475775)
FT                   /locus_tag="Rmar_0431"
FT   CDS_pept        complement(472995..475775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0431"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="KEGG: csa:Csal_0668 ribonucleotide-diphosphate
FT                   reductase subunit alpha; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase, alpha subunit; PFAM:
FT                   ribonucleotide reductase large subunit; ATP- cone domain
FT                   protein; Ribonucleotide reductase large subunit domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47333"
FT                   /db_xref="GOA:D0MEA9"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEA9"
FT                   /inference="protein motif:TFAM:TIGR02506"
FT                   /protein_id="ACY47333.1"
FT                   /translation="MATLHTLVTDTLPTVVKRDGRRVSFDAERIRRALEKAFRATLELP
FT                   ADAPLSAELSEEIEALTGAVVRWCRDRAEVSVEEIQDEVERTLMRAGRYAVARRYILYR
FT                   EARAEARRRQQLTYRRADGTEAPFPHEALRARIEAACDGLDDVDPELVREELLRTVYPG
FT                   IPEDELDRALILAARTHIEREPDYTYVAARLLLDALYREVFGRPIPPSEQAEACRAGFR
FT                   AYLEHGVRLGRLDERLLRTFDIDRLAAALHPERDRRFTFLGLQTLYDRYLLHEPEGRRF
FT                   ELPQYLWMRVAMGLALAEDDPTARAIQFYELLSSFRFMNSTPTLFNAGTPHPQLSSCYL
FT                   TTVQDDLGAIFKAIRDNALLSKWAGGLGNDWTPVRALGAHIRGTNGRSQGVIPFLKIVN
FT                   DTAVAVNQGGKRKGAVCAYLEVWHLDIEEFLELRRNTGDERRRTHDMNTACWIPDLFMQ
FT                   RVRERKHWTLFSPDEVPDLHDLYGRAFRERYEHYEREAEAGRIRNWRRIEAVALWRKML
FT                   SMLFETGHPWLTFKDPCNIRSPQDHVGVVHSSNLCTEITLNTSPEEVAVCNLGSINLVA
FT                   HVDEQGELDREKLRDTIRTAVRMLDNVIDLNFYPIPEARTSNLRHRPIGLGLMGFQDVL
FT                   YRRGLSYASEAAVELADEFMEFIAYCAYEASSDLAAERGAYPTFKGSKWDRGLLPLDTL
FT                   DLLEAERGEPVPVPRTARLDWDALREKIRRQGMRNSNVLAIAPTATIANICGVSPSIEP
FT                   TYKNLYVKSNLSGEFTQLNPYLVRDLKARGLWDKEMLDDLKYYDGSVQEIDRIPPELKA
FT                   RYRTAFEIEPRWLIECAARRQKWIDQSQSLNLYLAEPSGRKLSEMYQLAWQLGLKTTYY
FT                   LRALAATQIEKSTLDINRRGIQPRWMKSRSPSSDIVVRRDGPACSPDDESCEACQ"
FT   misc_binding    complement(475991..476045)
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam(RF00174),
FT                   score 39.69"
FT   gene            476473..477069
FT                   /locus_tag="Rmar_0432"
FT   CDS_pept        476473..477069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0432"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: sus:Acid_7166 YceI
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47334"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEB0"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ACY47334.1"
FT                   /translation="MNRILRTTWILALGLLLPLGGRAQPVVLTFETEGSTFRVTGTSTL
FT                   HDWECAVTDWRGRIELGQAGELASLQATEVVVPVAAISCKNGTMDRKMREALKAEDHPE
FT                   IRFVLTRVDSVAAVAEGYRLQVQGRLTIAGAEQPVQMQVLARPEDGGWRFQGEQPLSMK
FT                   VFGIKPPTAMLGTLRTGDEVVVHFDVVARPTSGNP"
FT   sig_peptide     476473..476544
FT                   /locus_tag="Rmar_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.992 at
FT                   residue 24"
FT   gene            477083..477691
FT                   /locus_tag="Rmar_0433"
FT   CDS_pept        477083..477691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0433"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: afw:Anae109_0583
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47335"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEB1"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ACY47335.1"
FT                   /translation="MRVIGLLSAVLFLLGFRGTPCYVPDPVASRVWIEGRSTVNRFTCT
FT                   AAQVEGVGEVEAGRAVQARLVVPVRAFDCGKQAMNRDLQEALQADRFPEIRFKLSEVAV
FT                   LEAPAADSARLEVVGALTIAGTTRTVRFEAAGQLLASGRARLVGSLPLKLTDFNVKPPT
FT                   ALLGLIRVHDQITVHFDLVVQPVAWRPCAVAAADSLNQP"
FT   gene            477716..478996
FT                   /locus_tag="Rmar_0434"
FT   CDS_pept        477716..478996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47336"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47336.1"
FT                   /translation="MRTRLTGGILALIALLLWTLPAAGQDKDQPKNEGPVVHGFIRPDW
FT                   VIQNVDDPFRDDLRIYHFLSRTRVFLKGTYEGVRYRVELGLSGPEAEIPVSRSGFWGMP
FT                   QILQDFYADVPFPGVENVYVRLGQFKVPAGAEGLTYSADMPFVERSIAQKFVGLLRDYG
FT                   AALHAYPSENVSLALAVQTGLGRSIPNRYLPEVFGFPFVTARVQFGPNQGHDLFRLKPM
FT                   PSGDELEVRLGANITYYKDVLAGHSTALRVWNKEKPILLQSGWNTYIDQREAGHLKAGE
FT                   LLIGGGDIALGYPTAQGALWLEGQVTYGQYKNDFGDVAVTAVRAQATYSLEAVAFGLRY
FT                   ALVQLDDLGGAAVGDDPIHEVTPMLTYRLQKNVKIILDGSILLDVPVAVEDGVGVYVLT
FT                   DHPEEIGMETIERQNVINLRAAVQINF"
FT   sig_peptide     477716..477790
FT                   /locus_tag="Rmar_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            complement(479256..480221)
FT                   /locus_tag="Rmar_0435"
FT   CDS_pept        complement(479256..480221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47337"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEB3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47337.1"
FT                   /translation="MKTWRFLPVLWLCLVPLVRAQEAPLGGFAFLRLSPSARVTALGET
FT                   PATVADDDVTLFLLNPALLQPAQHRQLQVSYLNHVGDIRAGTIAYGWHRRGLGTLGLAL
FT                   RFLDWGAIDEADLEGNRNGTFRPIDLALTAGLGRAAGPSLHYGASLHLIHTTLADRRAT
FT                   ALALDAGVRYELPEHLLTIGASLHHLGVTLQTLGTTPDRLPFDVRLGLRKRLRYLPLQL
FT                   TLTAYDLPHFWQSPENQTWLGRLFYHLNFGAELGAGRSFQLRFGYSYRRHEMLKIRPRL
FT                   DLAGFNAGFGLRLAGLYFDYAFSSWSSLGTLHHLTVQTRL"
FT   sig_peptide     complement(480159..480221)
FT                   /locus_tag="Rmar_0435"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.989 at
FT                   residue 21"
FT   gene            480476..480754
FT                   /locus_tag="Rmar_0436"
FT   CDS_pept        480476..480754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47338"
FT                   /db_xref="GOA:D0MEB4"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEB4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47338.1"
FT                   /translation="MRRWQVVGLLLGLHLGFVTGMVALLSRLLGTGLPSAESLLVAVWT
FT                   LPLSVFVAWFIGGDLLQLIRRRPLLRPALAQLLLLALLLLVWAVVPT"
FT   gene            480875..482371
FT                   /locus_tag="Rmar_0437"
FT   CDS_pept        480875..482371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0437"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG: cja:CJA_3062
FT                   xylulose kinase (xylulokinase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47339"
FT                   /db_xref="GOA:D0MEB5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEB5"
FT                   /inference="protein motif:PFAM:PF00370"
FT                   /protein_id="ACY47339.1"
FT                   /translation="MLLLGFDVGSSFIKGALVEAESGRVLAAVTVPEQELKIESIHPGW
FT                   AEQDPEQWWQCVQQAVAALRGRHPFDPEAVGGIGISYQMHGLVLIDREGRVLRPAIIWC
FT                   DSRAVPVGERAFQELGPERCLRHLLNSPGNFTAAKLRWVLENEPDIYRRAYKWLLPGDY
FT                   VAFRMTGEPTTTVSGLSEGIFWDFLEEKPAFWLLDHLGIDHALMPRLVPTFGRQGELTR
FT                   EAAAALGLRPGTPVTYRAGDQPNNAFSLGVLHPGEAATTAGTSGVIYAVDDTPRYDPQT
FT                   RVNTFVHVNHTPEQRHYGILLCLNGTGILYRWLRQDLLGGTLSYEAMNEQAASVPVGAD
FT                   GVRVLPFGNGAERMLRNRNLGASVHGLDFNRHGRAHLLRAAKEGIVFALAYGLEVIRGM
FT                   GLAVEKVRAGRANLFLSPLFGRIYATVNRTVVELYDTDGAAGAARGAGVGAGVYASPEA
FT                   AFQGVPPVATIEPDPSWQEPYAEAYHHWAEILSRQLQTAD"
FT   gene            482375..483526
FT                   /locus_tag="Rmar_0438"
FT   CDS_pept        482375..483526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0438"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: aba:Acid345_0903 xylose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47340"
FT                   /db_xref="GOA:D0MEB6"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEB6"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACY47340.1"
FT                   /translation="MANAQTFHSICRWTFNAGKGGFVPANIRPAWAADRFGTVEFIYLV
FT                   KEKIAPRLPDTITLGVELHYDNEINEQNAEAVAKALAETGLHLAMITPGAHIHFGYGGI
FT                   CSLDPKERAAAEELGRRTVELAYGPLRKAWHPDSDKAPTLVIWNGSFGYDLATVGVRQM
FT                   YRNLKESLARLCQLEQEKGGLMYIGIEPKPNEGHPAMLLPTVASALLIWRQLADEFGID
FT                   RSKKGVNMEIGHSEMIGLDAVYDVVEQLEERAMVHFHLNSQGYNDGIILGGPGRYDIDH
FT                   GTRVNGMNIALAGLLEQDGYNRWLGHDMQPRPYDNEEQAIDRVVRSILSWEACRRAAQQ
FT                   LDVSELLALLARRETARAEDLMRAALVEAQRQFDALYEPTVSA"
FT   gene            complement(483558..485276)
FT                   /locus_tag="Rmar_0439"
FT   CDS_pept        complement(483558..485276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5660 putative BatD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47341"
FT                   /db_xref="GOA:D0MEB7"
FT                   /db_xref="InterPro:IPR025738"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEB7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47341.1"
FT                   /translation="MRRWLLSMLFLSVGAIPAAAQRWTVEVQARVSRTQVGMGETVVYT
FT                   VDIIGALPDGLRMPEPPPTEGLALVYPTPTVHRQYSLIGGRIQQRIRYSWRFRPVRPGK
FT                   ARIGAFRLQVGDQTLATDPIELTVYDAPTAPPAEVAPNASAAPDLFIEATLQPTIPYEG
FT                   QQTVLEYRLFFREGLQVWRSRLVGSWETEGFWREELEVEDRPLPERVLRNGAAYYTFVL
FT                   QRIALFPTRSGMLQIDPLTIESEVSLQPDPLDPFASLLRPGPSEPQRVTAPALTVTVRP
FT                   LPDGAPSGFVDAVGRFRLEAEASPTEVSVGEPVTVTIRLSGSGNLPTLTPPRPDVDTSF
FT                   AVYPADDALTLDRRGARLTGTRTLSYVLVPGRAGRFTLPPVRLAYFDPEGGVYRTLTAP
FT                   LPELVVHPASATPTAPVATASPAAVHSRSFSWIRWLPYAGGGLLVILLLLLLAQRRRAA
FT                   RRPRPSPVQPDALPPSTLEPRLFYRRLEETLRRAAGRYLGEDVRGLTRSRLCDRLRQRG
FT                   LPEAEVARMARLLAACEAACYAPTPPDPIQTLHDHREAARLLEFLEKKAPSEEGA"
FT   sig_peptide     complement(485214..485276)
FT                   /locus_tag="Rmar_0439"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.951 at
FT                   residue 21"
FT   gene            complement(485282..486016)
FT                   /locus_tag="Rmar_0440"
FT   CDS_pept        complement(485282..486016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0440"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; SMART: Tetratricopeptide domain
FT                   protein; KEGG: mxa:MXAN_5661 putative BatC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47342"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEB8"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ACY47342.1"
FT                   /translation="MRLLIGLALLLLLLADDGARQGRRGNAAYRAGRYAEAAEHYRQGL
FT                   LLTQDPATRFGLQHNLGAALLRLGQAGSARAALDAALRMAPDDAARARAAYNAGNAAFA
FT                   EGDLQAALHYYRTALLADPDFEDARFNYEYVLRHLPPSSPPPPSVGGAEQNNPNDADTQ
FT                   NTPGQGVADGNRRHNAERAPAQNDPSDSAASERQSQTPTSSAQLSPEAAARLLDALQRQ
FT                   EQEALRRALRLPTHPRTVKKDW"
FT   gene            complement(486021..487040)
FT                   /locus_tag="Rmar_0441"
FT   CDS_pept        complement(486021..487040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0441"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: mxa:MXAN_5662 BatB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47343"
FT                   /db_xref="GOA:D0MEB9"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEB9"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACY47343.1"
FT                   /translation="MNLHWLHPEWLWALAAVPGTALLLMWAARRRRRDLERLGDPVLIA
FT                   QLAAPAPGRARLRAALLLTAVALLALALAGPRLGLQPRQAERRGLDLLIALDVSNSMLA
FT                   EDVAPSRLARARYELYRLLEHLEGDRVGLILFAGDAFLQCPFTTDYGAVRLFLDVADPS
FT                   LIPTPGTDYVRMIQVALQAFEAPQPDEVPRSRVLLVVSDGENHAEGFEQALRQLQEAGI
FT                   ERLAVGVGETAGAPIPVYRDGRRVGVRRDAEGRVVHTRLEPATLQALAGPDGYFHLGRT
FT                   GEVVPALLKRLDGFARTPIATETFETYAERYQWPLALALLLLVLEALLPERRRTLQTA"
FT   gene            complement(487037..488026)
FT                   /locus_tag="Rmar_0442"
FT   CDS_pept        complement(487037..488026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0442"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; VWA containing
FT                   CoxE family protein; SMART: von Willebrand factor type A;
FT                   KEGG: bba:Bd2794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47344"
FT                   /db_xref="GOA:D0MEC0"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="InterPro:IPR033881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEC0"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACY47344.1"
FT                   /translation="MTFAQPQWLWLLALVPILALVRWWRARRRGGDLLFSSAALVEAAP
FT                   ATLWIRLRGLPFALRLAVLTLGILALARPQERQVFEKRTVEGRDLMLVLDLSSSMLAQD
FT                   FSPSRFEVARRTAIQFVQGRRADRIGLVVFAGQAFTQVPPTLDYRFLLTMLQRLQVGRL
FT                   EDGTAIGTAIATAINRLKNSEARSKVIILLTDGQNNRGEIDPLTAAELARQAGIRIYTI
FT                   GLSGRGEAPYPVQTPFGTRPQPVPVEIDEAMMREVAEKTGGRYFRATDARTLEAIYAEI
FT                   DRLEKSPVAVTRYETARERYAIFLGPALLLLLLEVILRTTRLRRLVVT"
FT   gene            488234..488509
FT                   /locus_tag="Rmar_0443"
FT   CDS_pept        488234..488509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0443"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saz:Sama_2593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47345"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEC1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47345.1"
FT                   /translation="MGGLPQQSWWDRFQELLDDQNEWPAEYLFKFIAPSSEREALRAVF
FT                   GHYPVTIRESRKGNYISLTARMEVQSSDEIIAIYKAAARVRGVIAL"
FT   gene            complement(488511..488948)
FT                   /locus_tag="Rmar_0444"
FT   CDS_pept        complement(488511..488948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0444"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   net:Neut_0138 two component, sigma54 specific,
FT                   transcriptional regulator, fis family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47346"
FT                   /db_xref="GOA:D0MEC2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEC2"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACY47346.1"
FT                   /translation="MAHSEVNGQRRLLLLVDADTALHPFIQAALRRAPYAPLRHMECHP
FT                   VVNADQLRNHLQRHRYHVALISLESIGHPTWPLEENAHRTMQLIREVPSDHQPPAVAMT
FT                   SVGTLRHRDAVLRLGFAGYLCKPFTLSALFQELATALTLNS"
FT   gene            489153..489530
FT                   /locus_tag="Rmar_0445"
FT   CDS_pept        489153..489530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47347"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47347.1"
FT                   /translation="MAEANPIRAMYLHWPRVVPDGAAEQEAIQVLEQLARELQALAQEV
FT                   EQAYADGGRLLQHVQTNLRPDLWRNAAHLQVRLEGLKEQVRAARELVERLRVATQEDRP
FT                   PMEGRGVRRSEALASAEVEPA"
FT   gene            complement(489507..490229)
FT                   /locus_tag="Rmar_0446"
FT   CDS_pept        complement(489507..490229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0446"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; HAD-superfamily hydrolase, subfamily IA, variant
FT                   3; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: sec:SC4407 nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47348"
FT                   /db_xref="GOA:D0MEC4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEC4"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ACY47348.1"
FT                   /translation="MPSLKNPSETIRFVYFDLDDTLLDHRTAEQAALADVKAAFPDVFA
FT                   HVPLEQLHHTYHTINVDLWEQYQRGQIDRPALMHARFARLIEALGLQGVTPEQLNACYM
FT                   ERYRRHWRWVPGAREAFLTVARHLPVGILTNGFAAVQYAKMERFPELRQHAKALVISEE
FT                   VGVAKPHPELFAHATRAAGVAPEAILYVGDSFGSDVLGAKNAGWQVAWFTPAAPASTPE
FT                   SVFVFARWPELLRWLNLG"
FT   gene            complement(490204..491373)
FT                   /locus_tag="Rmar_0447"
FT   CDS_pept        complement(490204..491373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_3747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47349"
FT                   /db_xref="GOA:D0MEC5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039968"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEC5"
FT                   /inference="similar to AA sequence:KEGG:MXAN_3747"
FT                   /protein_id="ACY47349.1"
FT                   /translation="MEATETLPEVRVAPPVQVMPVRGRRLLRKFIDLPYRLYRDNPYWV
FT                   PPLRRDVAEILSPRKSPFFEHGQIQPFLALDASERIVGRIAAIVNGMHLKKYNDGVGFF
FT                   GFFECVPDFAVAEALFNAAADWLRRQGLQHMRGPTNPSLNDMAGLLVNGFDRAPSILMP
FT                   YNPPYYADFLERAGFTRVMTMWAYYVHKKYLKAEKLERGVELVRRRNPTITLRTLDMRR
FT                   YDEEARTVLDIYNEAWSENWGHVPMTENEFQHLARALKQIVDPELVFILEDDGYPVGFS
FT                   LLLPNLNQALRHARDGRLFPFGLIKILLAAKLGAIYETRMPLMGIRKKYHGRGLDALLV
FT                   LETIQRGKRRGYEACEMSWVLDTNKVLLNALEHLGGVVDKEYALFEKPL"
FT   gene            complement(491360..492646)
FT                   /locus_tag="Rmar_0448"
FT   CDS_pept        complement(491360..492646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0448"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II;
FT                   aminotransferase class-III; KEGG: mxa:MXAN_3748
FT                   aminotransferase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47350"
FT                   /db_xref="GOA:D0MEC6"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEC6"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACY47350.1"
FT                   /translation="MPMSDAARTPQERLETQVSTSEPSLFAKCHKFFAPDGDYARVKAA
FT                   GLYPYFRPIERNEGTRAIINGREVIMAGSNNYLGLTSDPRVKEAAIEAIRKYGTGCTGS
FT                   RFLNGTLDLHLQLEERLARFMGKEACIVFSTGYMTNMGVIQALTSKNDIIFSDKDNHAS
FT                   IVAGTQVSLADTVRYRHNDLDHLRRLLERAQAERPEAGKLIVTDGVFSMSGVIARVPEL
FT                   VELAEEFGAALMLDDAHAVGVIGPGGRGSAAYFGLEHKVHLTVGTFSKSFASLGGFCVG
FT                   DRDVIEYIRHTSSAHIFSASMPPANVATVLKCLDIIEQEPERLERLWKISDYMREGFRS
FT                   AGFNVWNSQTPVIPVVIGDMMTCFRFWRELLEEGVFVNAVVPPAVPQGQALLRTSFMAT
FT                   HTDEELDYILEAFHRVGKRLGVIQANGSY"
FT   gene            complement(492744..493877)
FT                   /locus_tag="Rmar_0449"
FT   CDS_pept        complement(492744..493877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0449"
FT                   /product="Glycosyltransferase 28 domain protein"
FT                   /note="PFAM: Glycosyltransferase 28 domain; KEGG:
FT                   dds:Ddes_1235 teichoic acid biosynthesis related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47351"
FT                   /db_xref="GOA:D0MEC7"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEC7"
FT                   /inference="protein motif:PFAM:PF04101"
FT                   /protein_id="ACY47351.1"
FT                   /translation="MARIVYALSGQGRGHASRVLAVARALRARGHELRFCCGGTARAVL
FT                   EACGETVWPVPSLCQVLHGNRMRLLATLRANLPVMRRLRPLLDELTEKLADFRPHLVIT
FT                   DFEALTPRAAARLGLPVLSFNHQQVVTETRYRLPLRYWKDALLAHLAIQLIVPRRPLHV
FT                   LLTSFYFPPLRHPERVTLIPPIIRDEVQALMPTTGSHVLVYFNQPEGVDHLPEVLARLP
FT                   ASFVLYNVPRPPDAEKYTNLTFKAPSIEGFLEDLARCRAVLCTAGFTLMSEALYLGKPL
FT                   LVVPNRGIFEQTLNALFLEREGLGMAVFDRELRSEDVRRFLEACPHYEKRLQSHSLRCG
FT                   NEMALNFIERLLQRLETSRYRGRPARPPRENATLSFI"
FT   gene            complement(493964..494491)
FT                   /locus_tag="Rmar_0450"
FT   CDS_pept        complement(493964..494491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47352"
FT                   /db_xref="GOA:D0MEC8"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEC8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47352.1"
FT                   /translation="MTALLLALLLLPAGTPASPSPDSTRTHSPEGALWRALVLPGWGQV
FT                   YNRQYWKVPFVYAGLGGFAALAHFMNERYLLYRHAYLYAIAPDRYPQYRDEGERFRAVI
FT                   EAGRADLLRLYRDRYRRNRDLSYIALGLWYGLTVLDAYVHAHLYDFDVSENLQLRLLPR
FT                   PNGATLRLQGQF"
FT   gene            complement(494488..495441)
FT                   /locus_tag="Rmar_0451"
FT   CDS_pept        complement(494488..495441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0451"
FT                   /product="parB-like partition protein"
FT                   /note="KEGG: dal:Dalk_3716 ParB-like partition protein;
FT                   TIGRFAM: parB-like partition protein; PFAM: ParB domain
FT                   protein nuclease; SMART: ParB domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47353"
FT                   /db_xref="GOA:D0MEC9"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEC9"
FT                   /inference="protein motif:TFAM:TIGR00180"
FT                   /protein_id="ACY47353.1"
FT                   /translation="MATKKAALGRGLSALLPSANQETSTPEEVTGVETPKSRLYHFEER
FT                   LRLLGRVAEIDIDRIRPNPYQPRKDFDEEALDELARSIAQLGIIQPITVRALGNNEFEV
FT                   ISGERRLRAARRAGLKRVPAYVREADTEEMLEMALVENVQREELNPIEVALGYQRLIEE
FT                   CGLTQEQVAEKVGKNRATVANFLRLLKLPPRIQASLRDGTITAGHARALIGLPEPVQLR
FT                   LLQEIETKQLSVREVEERVRAWHRRQERKTAGEAATASAEPDPETLQIRDYEDQLRRRL
FT                   GTQVRIRHRSGRGGRIEIAYFSDEELERLLSLLLGA"
FT   sig_peptide     complement(495376..495441)
FT                   /locus_tag="Rmar_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.891) with cleavage site probability 0.652 at
FT                   residue 22"
FT   gene            complement(495460..496347)
FT                   /locus_tag="Rmar_0452"
FT   CDS_pept        complement(495460..496347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0452"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   pca:Pcar_3139 partition protein, Par-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47354"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0MED0"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ACY47354.1"
FT                   /translation="MGKVIAIANQKGGVGKTTTAINLAASLAAIEHPTLLIDIDPQANC
FT                   SSGVGINPRTVQKSTYEVLIGDISLEEAIQPTELPFLEVVPSHINLVGAEIEMIDVMER
FT                   ERILANALRRARRKYDFIIIDCPPSLGLLTLNALTAANSVLIPVQAEYFALEGLGQLLN
FT                   TIKIVRQHLNPELEIEGVLLTMFDTRLRLSNQVAEEVRRYFGDKVFRTIVQRNVRLSEA
FT                   PSFGRPVLLYDITSVGARNYMALAREIIQNNQRFLLPESTAEEASTNGLSIPAGRRSPS
FT                   SDAAPFRPHPEQDA"
FT   gene            496567..498612
FT                   /locus_tag="Rmar_0453"
FT   CDS_pept        496567..498612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0453"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: dal:Dalk_2844
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47355"
FT                   /db_xref="GOA:D0MED1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D0MED1"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACY47355.1"
FT                   /translation="MARRFVLKPEAEAPTTRLTVDYAGQLNPQQYAVVTAGGGPILVVA
FT                   GAGTGKTRTLVYRVAYLVETGTPPEEIVLLTFTRRAAREMLARAAALLDGRCERVQGGT
FT                   FHAFCLGLLRRYAGRLGYPSNFTVLDASDAADVIDLLRTAHGLHRSGRRFPRKQTIQAI
FT                   FSAAASHPDADLETILEARYPQFLEHLEALQALREDYACYKRQHGLMDYDDLLACTIEL
FT                   FRQHPDVHRQVAARCRHVLVDEYQDTNRLQAQIVQALAAVHGNVMAVGDDAQSIYRFRG
FT                   ADFRNIFEFPRLFPGTRILKLEQNYRSTQPILDLANRIIRRAHHRYDKVLFSERKQGER
FT                   PAIVPAPDERTESRFVCQMILALREQGVPLHQMAVLFRSSHNAFDLEMELNRRGIPYVK
FT                   YGGLKLSEAAHVKDLLAYLRLLENPKDAAAWNRVLQLIEGIGPRTAQRLIEWITSADAT
FT                   PFTLEERPFSPRYAEALIRLFTLLRQLWETELPLEAQLTELLHYYRPLCERRYYEDYPK
FT                   RLQDLEHLVSLSARFQSRAAFLEALVLDPLELTALEVEPLVEDEPPLVLSTIHSAKGLE
FT                   FHTVFIIHALEGILPSAYALNDPEALDEELRLLYVAVTRAREYLFISYPMVRYQAGSGS
FT                   YLTSPSRFLEDLPEEILEPWVLVEEPTASSAYELPDSGASALPPGD"
FT   gene            498616..499077
FT                   /locus_tag="Rmar_0454"
FT   CDS_pept        498616..499077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0454"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   shw:Sputw3181_0077 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47356"
FT                   /db_xref="GOA:D0MEQ6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEQ6"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACY47356.1"
FT                   /translation="MELYRAPVQNGAVLTIEEVGLEQLDVIRELNRAIFDEERIINTFD
FT                   RDDLMILLARVNGVPVGFKIGYRENSRTFYSAKGGVLPEYRRQGIARQLLYVMMERARQ
FT                   KGYRRFAYDTFPNRHPGMAVLGLTEGFRVTRADYNTFYRDYRLRLEKDL"
FT   gene            499352..499858
FT                   /locus_tag="Rmar_0455"
FT   CDS_pept        499352..499858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_3670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47357"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEQ7"
FT                   /inference="similar to AA sequence:KEGG:Acid_3670"
FT                   /protein_id="ACY47357.1"
FT                   /translation="MSEPWLTPDGARGAEARRADLLKGLQQVQHWIEEALHQLPDEAAL
FT                   WWEPAPGVPSIGARVQHILGASRRLAAYALDPAPDPEALAAEARTDWTPRGDSREQLLD
FT                   ALRRQFAALAERIEALSDAELDAVRPVGRRRLPVRRATILHHLIEHAAHHSGQLILLVR
FT                   LYARR"
FT   gene            499924..501162
FT                   /locus_tag="Rmar_0456"
FT   CDS_pept        499924..501162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0456"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   mxa:MXAN_4173 putative ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47358"
FT                   /db_xref="GOA:D0MEQ8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEQ8"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACY47358.1"
FT                   /translation="MSLLLFELWEGLMAALRAIAAHKLRAVLTTLGIIIGIVAVTLMAT
FT                   VINGIERDFNESLSELGTDVLYVEKWPWIVGPGSRWWEYINRPDITPELADVIEERARY
FT                   VVAAVPVLDRMGTARYGGTTVSSLTIVGAEADYPRVHAVDLALGRFYTEVEERSARAVC
FT                   VLGAEVASRLFPVEQPLGKFIRLSGHRCQVIGVLQRKGSGPDSPASTDTQVFIPFRTYA
FT                   RFFGIRNRSVSIHVKVVDPELMALAKDELTGVLRVARRLDALEKNDFEINEQQALREQL
FT                   APVKTAIYGVGLFLTGLSLLVGGVGVMNIMFVSVKERTREIGIRKAVGATRRAILVQFL
FT                   IEAILVCMIGGVIGVLLAMALTGVVNLFIDAFLPATTVALAFLICVLTGITFGLAPAWT
FT                   AARAQPIEALRYE"
FT   gene            501166..502389
FT                   /locus_tag="Rmar_0457"
FT   CDS_pept        501166..502389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0457"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   acp:A2cp1_4310 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47359"
FT                   /db_xref="GOA:D0MEQ9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEQ9"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACY47359.1"
FT                   /translation="MEFVEAFRMAWTALRTNRLRSGLTLLGMVIGVFAIISSVTAVEVI
FT                   DVYFRESMNFLGSSTFTISRYPSIRVSNEQFAYRRPITYEQIERLKRSLSQPVFISILE
FT                   DFDLGSVRYGDRETEPNVQLLGTDENFLENFSYELAEGRFITAQDVHYARPVIVLGSVI
FT                   AEELFPNETPLGKVVRFGGHRYEVIGVLKTKGSFLGFSQDRRVLIPITTAFARYGQPDR
FT                   NLAAVSVRVSSPERLGAAMDEVISKFRVIRKVPPGQPNDFEISTNDSMRSVFEAFTRTL
FT                   SIGGAGIGLIALLAAGIGIMNIMLVSVTERTREIGIRKAVGARRRDILRQFLLEAFFLC
FT                   QIGGLVGILLGALGGNLVAVYFDISAVFPWDWALGGMLLVTLVAVVFGSYPAFKAARLN
FT                   PIEALRYE"
FT   sig_peptide     501166..501291
FT                   /locus_tag="Rmar_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.886) with cleavage site probability 0.873 at
FT                   residue 42"
FT   gene            502393..503103
FT                   /locus_tag="Rmar_0458"
FT   CDS_pept        502393..503103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0458"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="KEGG: hypothetical protein; TIGRFAM: ribose
FT                   5-phosphate isomerase; PFAM: Ribose 5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47360"
FT                   /db_xref="GOA:D0MER0"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D0MER0"
FT                   /inference="protein motif:TFAM:TIGR00021"
FT                   /protein_id="ACY47360.1"
FT                   /translation="MQETLSAADRAKKAAGEKVAAMVEPGMRLGLGTGSTAAWAIRALG
FT                   RRVREEGLRVVGVPTSYAAEQLARAEGIPLVTLADVEALDLAFDGADEVSPELNLIKGR
FT                   GAAHTREKVVASLARRFVVLVDESKLVDRLGTRWPVPIEVLPMAAEPVLRQLRRMGAEP
FT                   VLRMGKCKDGPVVTDQGFWVIDARFPGGIDDPHALAVTLSTMPGVLDHGLFLGLATDVL
FT                   VGQADGQVRHIRRP"
FT   gene            complement(503378..504043)
FT                   /locus_tag="Rmar_0459"
FT   CDS_pept        complement(503378..504043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0459"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; PFAM: Gram-negative
FT                   tonB protein; KEGG: nmu:Nmul_A1049 TonB-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47361"
FT                   /db_xref="GOA:D0MER1"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D0MER1"
FT                   /inference="protein motif:TFAM:TIGR01352"
FT                   /protein_id="ACY47361.1"
FT                   /translation="MGIVRKTEEADLRKRYPLYIEIGLVITLLLLIVAFRVDWRPKQEM
FT                   QFVMEEQEVVQMEEIVQTKQEVKPPPPPRPPVPVEVPDETVLEEEDLNLDAALDINEAV
FT                   TNVPPPPPPPEEEEEPEPEVFVVVEEMPEIIGGQKALYDCIKYPEIARKAGVEGRVIIQ
FT                   FVVDENGNVTNPQVLRGVGAGLDEEALRCVSLLKFKPGRQRGRPVRVRFTLPVIFRLQ"
FT   gene            complement(504138..504488)
FT                   /locus_tag="Rmar_0460"
FT   CDS_pept        complement(504138..504488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0460"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: nmu:Nmul_A0245
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47362"
FT                   /db_xref="GOA:D0MER2"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:D0MER2"
FT                   /inference="protein motif:PFAM:PF04892"
FT                   /protein_id="ACY47362.1"
FT                   /translation="MRLFRLLAVGWTLGVLVACFIPGKLVEPIVFEWIDKIAHFVLFAG
FT                   FAGFWLSALPGNRRFALVLGAGLLLALLTEAGQYLLPIGRSAEWFDLAADGLGLLAGYA
FT                   FDRWLIIPTTRS"
FT   gene            complement(504491..506077)
FT                   /locus_tag="Rmar_0461"
FT   CDS_pept        complement(504491..506077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0461"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="TIGRFAM: carbohydrate kinase, YjeF related protein;
FT                   PFAM: YjeF-family domain protein; protein of unknown
FT                   function UPF0031; KEGG: sfu:Sfum_2168 carbohydrate kinase,
FT                   YjeF related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47363"
FT                   /db_xref="GOA:D0MER3"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:D0MER3"
FT                   /inference="protein motif:TFAM:TIGR00196"
FT                   /protein_id="ACY47363.1"
FT                   /translation="MPEALPEPVLTARAMREADRRTIEELGLPGRVLMETAGRGAADVA
FT                   ARMLGTVAGRTVVCLCGRGNNGGDGFVLARVLHARGARVHVVTLADVSAMSDDAAANYR
FT                   LLEQLAAADASGRLHLHRLDALVGLDHLPPADLYVDALLGTGLSSPLRSPIRELVQWLN
FT                   ERAAPVLAIDIPTGLDSDTGEVLGAAVAATRTVTMGALKVGLLLGEGPRLCGAIDVIEI
FT                   GIPRHVLEQVARQPGCAWRATDALIRQWLPRRAHDAHKYSAGMALVVAGSREFTGAPVM
FT                   AATAAARIGAGYVLCACPSDVRPILATKLTEVALLGLPETERGGIDQEDAFDVLDGWLE
FT                   RARALLVGPGLGRHPDTQRFVRALLERTQLPTVIDADGLNALVGFTDLIREHAQGRWIL
FT                   TPHTGEFRRLAGEVDLTRRIEVVQEYARAWGCVLLLKGMPSVVGWPDGTVWINATGNPA
FT                   LATAGTGDVLAGLCVGLVAQGLPPAQAAVCALHVGGAAADRYAAHYGTASMMALDLLAH
FT                   LPVVLRERFDR"
FT   gene            complement(506127..507794)
FT                   /locus_tag="Rmar_0462"
FT   CDS_pept        complement(506127..507794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0590 PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47364"
FT                   /db_xref="GOA:D0MER4"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:D0MER4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47364.1"
FT                   /translation="MRPARKLLWLLLGLAACANPVPPSGGPPDRTPPALVESMPPPNAT
FT                   GVQDPRIRLIFSEGIDPASVARALSITPTPERLPEVRVRGRTVTFTLPAPLRPNTTYVL
FT                   TFDTNLRDLHGVALREPIVLAFSTGPTINRGQLAGHVLDAASGRPVAGVDVYAYALPDT
FT                   LPPHAWPNAPDYRTQTDPEGRFRFAYLSEQPYFVVALADRNRNRRPDPGEAFAAPPIPM
FT                   LVADTTDRPFPEPWLLTRLDTMPPAPQRVQPLSNRRLQVRFSEPVRLQTRDPSRWRLFT
FT                   GDATVPVDVVYQVPERPLDVLLYTAPLRATTYFLRPGGVVDTAGNPVRPDTLRFTGSER
FT                   PDTLRLRFLGFEPAAEALLLPDQPLRLRFNQPPPDLTPYLSLTDTAGAPRTFHLESADG
FT                   TTYALWPDPPLRPDERLHLVLEGRIVGRPDTLWRATLARMPAAMLGSLSGVVQAADTTA
FT                   PIVVELLPETPTLPVRRQTLPPGGGAFHFKQLPEGRFRVRAFLDRNGNRRWDGGQLLPY
FT                   EPPEPLRRLPEPLQTRPRWEVAAADTLHFPSLHLRQTP"
FT   sig_peptide     complement(507717..507794)
FT                   /locus_tag="Rmar_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.689 at
FT                   residue 26"
FT   gene            complement(507778..508365)
FT                   /locus_tag="Rmar_0463"
FT   CDS_pept        complement(507778..508365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47365"
FT                   /db_xref="GOA:D0MER5"
FT                   /db_xref="UniProtKB/TrEMBL:D0MER5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47365.1"
FT                   /translation="MRRFLLFGLLCWGLGVPAGAQPTNLARFQELARSCLTLPDTLRAF
FT                   RLEAPDTLPYIRTALEARWLQEGRRVYRRDTSALPTVRYRIDAARVAYARLDHDRLQRT
FT                   VTLALQAELLDPRGRLLDVRACQPVAVDTIAQALRDRLEHPAFPETQAPLPPERPGLLE
FT                   RYVIPAVALVATTLSVYLLFTLRSRSGDASSP"
FT   sig_peptide     complement(508303..508365)
FT                   /locus_tag="Rmar_0463"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            508465..509238
FT                   /locus_tag="Rmar_0464"
FT   CDS_pept        508465..509238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0464"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O
FT                   ribose methyltransferase substrate binding; KEGG:
FT                   bsu:BSU28650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47366"
FT                   /db_xref="GOA:D0MER6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D0MER6"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ACY47366.1"
FT                   /translation="MLTRRRLKELARLHRRKDREALGQYLVEGVRLLAAALEAQAPLVE
FT                   VLVTATARRRPEVQALLARVAVPVAEVSEQEMARLSEVETSQGVLAVARMQWQPEAHLL
FT                   RCRRILALDGLQDPGNAGTILRAAAWFGIEAVVAGAGTVDLYNPKVVRAAMGSHWDLAL
FT                   VRTGALPDLLAQLQANGFTCYGADLEGTPASRWQPREPAVLVLGSEAHGLQPAVRERLT
FT                   ARVTVPGSPRRQATESLNVAMAATVLLYEWLGRTG"
FT   gene            509376..510596
FT                   /locus_tag="Rmar_0465"
FT   CDS_pept        509376..510596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0465"
FT                   /product="alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="KEGG: sat:SYN_00979 alanine dehydrogenase; TIGRFAM:
FT                   alanine dehydrogenase; PFAM: alanine dehydrogenase/PNT
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47367"
FT                   /db_xref="GOA:D0MER7"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0MER7"
FT                   /inference="protein motif:TFAM:TIGR00518"
FT                   /protein_id="ACY47367.1"
FT                   /translation="MEIPALQGMTIGQALLPMEKPLRLREQHRSLRIGVPREVANEERR
FT                   VALAPSGVATLVANGHEVYVEQGAGVLANFPDAEYMEAGAQIVATPEDLYSQCELIVKV
FT                   GRPTDDELKLLQENQVLISALHLGNTTPDFLRRLMELGVTGIGFEFIRDSDGTLPIVRM
FT                   MHEIMGSMAVQIAARYLESNEGGKGVMLGGISGVPPATVVIIGAGVVGEWAARTALGFG
FT                   AHVVVLDTDLGALRAIEHYLDRRVTTAMASVEFIRKAVRSADVVIGAKMGEGQRAPILV
FT                   TEDMVAEMQPGSVIVDTMIDQGGCIETSRPTTHSNPVFRKYDVIHYCVPNMPSNAARTA
FT                   TYALNNVLVPYLIEIGESGSIHEALWRNVGLRNGTYVYRRHLTKKSLAAMFGLPYRDIE
FT                   LLIASGL"
FT   gene            complement(510593..511636)
FT                   /locus_tag="Rmar_0466"
FT   CDS_pept        complement(510593..511636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0466"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: psp:PSPPH_2128 ribose operon
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47368"
FT                   /db_xref="GOA:D0MER8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D0MER8"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACY47368.1"
FT                   /translation="MKKRRNPTISDVARLAGVSKATVSAVLNDRDTVSAATREKVLAVI
FT                   RELNYRPREFARHRFRSDGERSIGFIIKEDDNPYYAELIAGARRVAEAKGYTILVASSE
FT                   GSFRAEQQIIQLMTAKDVNGFIITPVIDDEADLSHIFELKRRNIPFVLLEGIRGLQANL
FT                   VDIDNVRASQAAVQHLMEQGHAHIVYFAGPRYSLHTEERLEGVRRAFSASNRALRDDQV
FT                   IYAGAHARDGYEAARAYFAQRPDPMPTAVACYNDLVALGVLRALQELGIRVPDEVSVMG
FT                   FDDLAFLRYTPWPLSTVRVPKETMGEKAAEILIRNIEAEQPVPIEKVHLDFELVLRATT
FT                   RALQPST"
FT   gene            complement(511739..512881)
FT                   /locus_tag="Rmar_0467"
FT   CDS_pept        complement(511739..512881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0467"
FT                   /product="Mannan endo-1,4-beta-mannosidase"
FT                   /EC_number="3.2.1.78"
FT                   /note="PFAM: glycoside hydrolase family 26; KEGG:
FT                   cja:CJA_0236 endo-1,4-beta mannanase, putative, man26C"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47369"
FT                   /db_xref="GOA:D0MER9"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR016714"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:D0MER9"
FT                   /inference="protein motif:PRIAM:3.2.1.78"
FT                   /protein_id="ACY47369.1"
FT                   /translation="MLRTLLLLGLLLLGCNAADSQPSVAPSDPDATPETRALFHNLYRL
FT                   APRAILYGHQDDLAYGVSWWAEPGRSDVKAVTGSYPAVYGWDVGDLEHGAERNLDGVRF
FT                   DDMRRWIIEGFQRGGVITISWHMDNPVSGGNAWDTTRAVDAILPGGPQHALFRSWLDRF
FT                   ADFVRTLRGVPPGRTDTVAIPIIFRPYHEWTGSWFWWGRGHCTPDEFIQLWRFTVDYLR
FT                   REKGLHNLLLAYSSDRFHSPEDYLERYPGDDYVDLLGFDDYHSHKSEETLPFLIRELHD
FT                   VVRMARARGKLAALTETGYEAIPDSTWWTGKLLRALDHDDTTRQIIYVLTWRNAYNRPG
FT                   HYFAPYPGHPSAEDFRRFKAHPLIYFEDELPDLYRLENGR"
FT   sig_peptide     complement(512819..512881)
FT                   /locus_tag="Rmar_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.712 at
FT                   residue 21"
FT   gene            513123..514526
FT                   /locus_tag="Rmar_0468"
FT   CDS_pept        513123..514526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0468"
FT                   /product="L-fucose isomerase-like protein"
FT                   /note="PFAM: L-fucose isomerase-like-like; KEGG:
FT                   sus:Acid_1232 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47370"
FT                   /db_xref="GOA:D0MES0"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="UniProtKB/TrEMBL:D0MES0"
FT                   /inference="protein motif:PFAM:PF02952"
FT                   /protein_id="ACY47370.1"
FT                   /translation="MVTLGVLIGNRGFFPAHLCTEGRQKVLQVLESEGIRALILPEEAT
FT                   RNGAVESLEEARKYAEFFKAHRDELDGVLVSLPNFGDERAIANTLRWAGIDVPVLIHAF
FT                   PDQPDRMSINFRRDSFCGKISVCNNLYQYGIRYSLTTLHTVDPDSEAFRADLRRFAAVC
FT                   RVVRSLRGLRIGQIGARPAAFNTVRYSEKLLERAGITVEPLDLSELLGWIRRMNDQDPP
FT                   VQQKLEEIRAYTDTQGIPEESLYKLAKLGVAIDRFLQEKELKAVAIQCWTALEEFYGVV
FT                   PCTPMSMLSNRLIPSACEADIPGVLSMYLLQQASGKPAALLDWNNNYRDELDKGVVFHC
FT                   SNLPAAFFESQRMDYQEIIAGTVGKENTYGTLVGRIAPGPFTFCGLTTDEFSGRIRTYV
FT                   GEGRFTDDPLETFGGYGVFEVPGLQQLLRYICANGFPHHVAATLNHVADVLAEALGTYL
FT                   GWDVYRHQA"
FT   gene            514548..516236
FT                   /locus_tag="Rmar_0469"
FT   CDS_pept        514548..516236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0469"
FT                   /product="L-ribulokinase"
FT                   /note="TIGRFAM: L-ribulokinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: sde:Sde_0772 ribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47371"
FT                   /db_xref="GOA:D0MES1"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D0MES1"
FT                   /inference="protein motif:TFAM:TIGR01234"
FT                   /protein_id="ACY47371.1"
FT                   /translation="MQPTFAIGLDYGTNSVRALIVNVQTGEEVGTCVFPYPSGEQGILL
FT                   DASDPDLARQYPGDYLQGAEVSIRGALEQARRHPDFDPARVIGIGVDTTGSTPLPVDAE
FT                   GRPLAFDERFRNNLNAQAWLWKDHTSHAEAAEITEKARALRPHYIARYGGTYSAEWFWA
FT                   KILHCRRVDPEVFEAAYTWVEIADWIPAALTGTEHPERLRRSICAAGHKAFFNPDWGGY
FT                   PDEEFLAAIDPALVRVRRSLPDRAYDVSQPAGRLTPEWAERLGLPAGIPVAVGAFDAHL
FT                   GAVGAGIEPGVLVKIIGTSTCDIMIAPGDQPLADIPGLCGIVRDSVLPGYYGLEAGQSA
FT                   VGDIFNWFVQVVRPEGQDHASLTEAAARLRPGESGLLALDWHNGNRTVLVDQRLTGLIV
FT                   GLTLRSTPAEIYRALMEATAFGARVIMERFEEYGVLVRRVLACGGIPPKNPLLMQIYAD
FT                   VMGRRLELARSDLTCALGAAISGAVVAGKQNGGYDRFDEAIRAMTGVRPEAYEPDPERR
FT                   RVYDELFALYKNLHDAFGVSGVEMDLYPVMKRLLQIRDEVWRSKN"
FT   gene            516218..516919
FT                   /locus_tag="Rmar_0470"
FT   CDS_pept        516218..516919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0470"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: esa:ESA_03278 L-ribulose-5-phosphate 4- epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47372"
FT                   /db_xref="GOA:D0MES2"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D0MES2"
FT                   /inference="protein motif:PRIAM:5.1.3.4"
FT                   /protein_id="ACY47372.1"
FT                   /translation="MAFEKLKAAVWKTNRDIVRSGLVQLTWGNASGVDRQAGVMAIKPS
FT                   GVDYDRLRPDDMVIVELETGRVVEGTLKPSTDTPTHRYLYLAFEEIGGIVHTHSRHAVA
FT                   WAQARRPIPCLGTTHADHFYGEIPVTRPLRPEEVAEAYEHQTGVVIAECFRERGLDPLE
FT                   VPGVLVAGHGPFAWGETPEKAAENALVLELVAEMALYTCQLNPEAPVLERYVLDKHFRR
FT                   KHGSQAYYGQR"
FT   gene            516951..518624
FT                   /locus_tag="Rmar_0471"
FT   CDS_pept        516951..518624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0471"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: SLC5A10; solute carrier
FT                   family 5 (sodium/glucose cotransporter), member 10"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47373"
FT                   /db_xref="GOA:D0MES3"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D0MES3"
FT                   /inference="protein motif:TFAM:TIGR00813"
FT                   /protein_id="ACY47373.1"
FT                   /translation="MTVLDWLIVAAYFAILAGIVWWSARRVKTTTDYFLAGRDVGFFVI
FT                   GASIFASNIGSEHIVGLAGSGAANGLAQAHWELHAWILVLLAWVFVPFYYRSGVFTMPE
FT                   FLERRFNSRARWILAVVSLTAYVFTKVSVTVYAGALVFRTLLADVFGSPDQAFWVGAIA
FT                   TVLATGIYTILGGLRAVVYTEVLQTGLLILGSVFITVFGLSALGGWGELREVARLQGEQ
FT                   WALWRSNSDPVFPWLGVMISSPIVGIWYWCTDQYIVQRTLAARSLKDARRGALWGGFLK
FT                   VWPVFIFLVPGMIGYALHQKGLIHIPTDATGKIQGDMVFPTLVAELLPLGLRGLVVGGL
FT                   LSALMSSLSSLFNSCATLFTVDIYEKLRPGRPEPELVRVGRIATAVVVGLGLLWIPIMK
FT                   VMAESKAGLYDYLQNVQGFLAPPITAVFLLGLASRRINAKGAVWGLGVGFVLGLLKLTL
FT                   QSMVQNGALDPNTLLGAIGAFNGYYFSGLLFFVSVAIVVGVSLLTEAPPEEKVRGLTFG
FT                   TVSASDRSESRKTWDWRDVTLTVVVLGLVLAIYLYFSFWV"
FT   gene            518649..520697
FT                   /locus_tag="Rmar_0472"
FT   CDS_pept        518649..520697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0472"
FT                   /product="transketolase"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase central
FT                   region; Transketolase domain protein; KEGG: gbm:Gbem_1379
FT                   transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47374"
FT                   /db_xref="GOA:D0MES4"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D0MES4"
FT                   /inference="protein motif:TFAM:TIGR00232"
FT                   /protein_id="ACY47374.1"
FT                   /translation="MQEQKATEAIRETDFSPGELDNLCINTIRFLAVDAVEQAKSGHPG
FT                   MPMGAAPMAYVLWTRHLRHNPRDPKWPNRDRFVLSAGHGSMLLYALLHLTGYDLPMEEL
FT                   QRFRQWGSRTPGHPEYGLTPGVETTTGPLGQGFGNAVGMAIAEQYLAAHFNRDGFPLFD
FT                   HFTYVIASDGDLMEGISHEAASLAGHLGLGKLIVLYDDNDISIDGSTDITFTEDVGARF
FT                   EAYGWHVQRVDDGNDLVAIDAALRQAKAETERPSLIIVRTHIGYGSPNKQDTPAAHGAP
FT                   LGPEEVRLTKRNLGWPEDRTFYVPDEVYRHMRQAVTRGQQWQAEWEALRARYREAYPAE
FT                   AAELDRWLSRRLPEGWSEGLPTFEAGKAVATRNAGGAVLDVLAARIPELIGGSADLAES
FT                   NKTHPKGREAFSRDNRKGGYIHFGVREHAMAAICNGLSLHGLRAYASTFLVFSDYLRPS
FT                   LRLSALMEQPVIYVFTHDSIGLGEDGPTHQPIEHLASLRAIPHVVVLRPADATETVEAW
FT                   KVALEREDGPTVLVLTRQNVPVLDRSRLAPADGVRRGAYVLKEAQGALQAILLASGSEV
FT                   HVALAAAEQLEAEGIGTRVVSVPSWELFKKQEAAYRESVLPPEVTVRVAVEAGVGQGWE
FT                   QFVGCRGRIVSIERFGASAPGKVLFEKFGFTPERVASEVRALLAQNH"
FT   gene            520751..521422
FT                   /locus_tag="Rmar_0473"
FT   CDS_pept        520751..521422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0473"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="KEGG: acp:A2cp1_4211 transaldolase; TIGRFAM:
FT                   transaldolase; PFAM: Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47375"
FT                   /db_xref="GOA:D0MES5"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:D0MES5"
FT                   /inference="protein motif:TFAM:TIGR00875"
FT                   /protein_id="ACY47375.1"
FT                   /translation="MKFFLDTADLDEIREAASLGILDGVTTNPTLIRKAGARDFHEHIY
FT                   QICELVEGDVSAEVTATDYEGMLREARELARIHERVVVKIPLIAEGIRAIKTLTEEGIR
FT                   TNCTLCFSPTQALVAAKAGATYISPFAGRLDDVSSDGMHVIEQVVKIYRNYGFKTQVLA
FT                   ASLRHPMHVLQAALMGADVATMPFSVMMQLLKHPLTDVGLERFLKDWEAYLQAKQGVQT
FT                   A"
FT   gene            521895..523046
FT                   /locus_tag="Rmar_0474"
FT   CDS_pept        521895..523046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0474"
FT                   /product="Aldose 1-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: csa:Csal_0799 aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47376"
FT                   /db_xref="GOA:D0MES6"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="UniProtKB/TrEMBL:D0MES6"
FT                   /inference="protein motif:PRIAM:5.1.3.3"
FT                   /protein_id="ACY47376.1"
FT                   /translation="MRTFWLVLCGGLLFGCQPSSNETPSPVEATTVTVTEESFGQLPDG
FT                   RPVTLFRLRNASGMEVEVLNYGAIIRAIRVPDREGNPGDVVLGFDSLAAYLQPHPYIGA
FT                   VVGRYANRIGGARFVLDGQTYELAANDGPNHLHGGLKGFDKVLWEAEPFTNGNEAGVRL
FT                   TYVSPDGEEGYPGTLRATVTYTLADSNALVIDYEATTDKPTIVNLTQHAYFNLAGRGDI
FT                   LNHELQLFADFYTPVDERLIPTGEICPVAGTPLDFRTPQRIGARIDADHEQIRRGRGYD
FT                   HNFVLRHTERGALELAARVYEPTTGRIMRVYTTEPGIQFYSGNFLDGSLTGKGGMVYAR
FT                   RTGFCLETQHFPDSPNKTHFPSPVLRPGETYRSRTVYAFDVAE"
FT   sig_peptide     521895..521960
FT                   /locus_tag="Rmar_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.734 at
FT                   residue 22"
FT   gene            523098..524675
FT                   /locus_tag="Rmar_0475"
FT   CDS_pept        523098..524675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0475"
FT                   /product="Alpha-N-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /note="PFAM: alpha-L-arabinofuranosidase domain protein;
FT                   KEGG: bha:BH1874 alpha-L-arabinosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47377"
FT                   /db_xref="GOA:D0MES7"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D0MES7"
FT                   /inference="protein motif:PRIAM:3.2.1.55"
FT                   /protein_id="ACY47377.1"
FT                   /translation="MRGLFSKGLLLLIVLACTGSVLQAQPTHRLVIHADQGRVQISRHI
FT                   YGHFIEHLGYGIYGGFWQRDAQGRWHLRQDIVDALRRIRIPNLRWPGGCFADLYHWKDG
FT                   IGPQEQRRPILNAFWGQVVEDNSFGTHEFMALVEALGAEPYIAGNVGSGTPREMAEWVE
FT                   YLTAEDGPMARLRKQNGREQPWRVPFWGVGNESWGCGGNMDPEYYADLYRRFATYLFNY
FT                   GGNRLYKIAAGPADADTTWTSVLMRDVFRRNPGLMQGISVHYYTWISKTGRWNDKEPAT
FT                   GFDEWGWFKGLQKALFLDEVLRRHEAVMDRYDPEKRVGLIVDEWGMWHAPEPGSNPAFL
FT                   VQQNTLRDALVAAVSLNIFNHHAERVRMANLAQTINVLQALILTREGEETIVLTPTYHV
FT                   FDLYKEHQDATLLPVELEAGEYRYGDEAIPALNASASRNAEGAVHLTIANLDPHQERVV
FT                   QARLEGIQPARVEGRVLTAEAMDAHNTFEAPDRVRPVAFTAYRAVGDGVYELRLPARSV
FT                   VALTFYPR"
FT   sig_peptide     523098..523172
FT                   /locus_tag="Rmar_0475"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.745 at
FT                   residue 25"
FT   gene            524677..526608
FT                   /locus_tag="Rmar_0476"
FT   CDS_pept        524677..526608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0476"
FT                   /product="alpha-glucosidase, putative, adg97A"
FT                   /note="KEGG: cja:CJA_0817 alpha-glucosidase, putative,
FT                   adg97A"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47378"
FT                   /db_xref="GOA:D0MES8"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019563"
FT                   /db_xref="InterPro:IPR029483"
FT                   /db_xref="InterPro:IPR029486"
FT                   /db_xref="UniProtKB/TrEMBL:D0MES8"
FT                   /inference="similar to AA sequence:KEGG:CJA_0817"
FT                   /protein_id="ACY47378.1"
FT                   /translation="MRRVSLWLTLALLAAAACRPSTERSLSSPDGQLTVQVWLQDGRLL
FT                   YQVWRQGQPVLEPSPLGLVRSDADFTGGLRLEGVSPVRRVVETYTLVAGKRRVNRHEAN
FT                   ERVYRLRNAEGRLLEVVFRVANDGVAFRYRFPESDPTPREILEERTTFDFPDSARAWLQ
FT                   PLAEPKSGWRQTNPSYEEYYLQDIPVGTPSPMAGWVFPALFRVGSHWVLIIEADVDSTF
FT                   CGARLRPEAPGGAYRIGYPDAREAIPGQGHLPRSALPWQTPWRVLAVGDLKTIVESTLG
FT                   TDLAAPAIAVDTTFIRPGRASWSWALLKDPSITYEVQRRFIDYAAEMGWEYTLIDVNWD
FT                   STIGYGRMAELARYAATRGVGLWLWYNSSGNWNTTTYRPKSRLLTRADRQREFARLAAM
FT                   GIRGIKVDFFGGDGRSMIRYYHEILQDAAAHRLMVNFHGCTLPRGWTRTYPHLMTMEAV
FT                   RGFEFVTFTQEGADREANHAAMLPFTRNVFDPMDYTPLSLGEIPGVVRRTTNGFQLALT
FT                   VLFTSGVQHFAETPEGMRRVPEAVRAFLREVPVVWEETRFVDGWPGRFVVLARRAGDGR
FT                   WYLAGINGEATSRTVTLDLSFLQPGQTGLLLTDGETARAFRIDTLRYQPPLTVSMRPNG
FT                   GFVLVWSP"
FT   sig_peptide     524677..524748
FT                   /locus_tag="Rmar_0476"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.555 at
FT                   residue 24"
FT   gene            complement(526610..527668)
FT                   /locus_tag="Rmar_0477"
FT   CDS_pept        complement(526610..527668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0477"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: vpa:VP1030 LacI family
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47379"
FT                   /db_xref="GOA:D0MES9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D0MES9"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACY47379.1"
FT                   /translation="MPSEASTQKRVTISDVARYAGVSNATVSAVLNNKGTVKDSTRRRV
FT                   LEAIEKLNYRPSGAARRRLQPTLHRTIGLVVKEVDNPYFADIFLGARAVANQHGYTVLI
FT                   TSSESDFTSEHRIVDLLADKDVDGLIINPLLEEQADLSHLFELKRRNIPFVLIENVLGL
FT                   QANIVDVDNVAASKEATRYLIEGGHERIIHFAGPRYSLHTEERIEGFRRAFSETNLIFR
FT                   EDMIVYAGARLKDGYEKGLAYFQEHRDNPPTAVTCYNDLVAIGLMRALHQLGIKVPDQV
FT                   SIIGYDDIAIAEYLPIPLTTVRVPKTEMGAKAAELLIRQIEGANGRGGSDAVERIFLQA
FT                   QLVVRNSTRPLK"
FT   gene            528117..530042
FT                   /locus_tag="Rmar_0478"
FT   CDS_pept        528117..530042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0478"
FT                   /product="protein of unknown function DUF1680"
FT                   /note="PFAM: protein of unknown function DUF1680; KEGG:
FT                   bha:BH1877 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47380"
FT                   /db_xref="GOA:D0MET0"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="InterPro:IPR032275"
FT                   /db_xref="UniProtKB/TrEMBL:D0MET0"
FT                   /inference="protein motif:PFAM:PF07944"
FT                   /protein_id="ACY47380.1"
FT                   /translation="MPTRICWILLSGLLLSHTLQAQPLTAETDARSRERLRAFAFPPRA
FT                   VRLLDSPFLEAMQRDVAYLFELDPDRLLSRFRRFAGLEPKAPEYGGWESQGISGHTLGH
FT                   YLSALSMYYAATGDEKARARIDYIVSELAEVQRAHGNGYVGAIPEGDRLWAEIARGEIW
FT                   QAEPFSLNGAWVPWYTMHKIFQGLIDAYWYGGSEQALEVVTRLADWAYETTKNLTPAQW
FT                   QQMLRTEHGGMNEALANLYSITGNPKHRELSEKFYHAAVLSPLSRGIPNLTGLHANTQI
FT                   PKVIGVVRQYELIGSDSLRAVAEFFWEEVVQHHTYVIGGNSQNEHFGPRDSLANRLGEG
FT                   TAETCNTYNMLRLTRHLFALHPEKVRYVDFYERALYNHILASQDPKRGMFTYYMSLRPG
FT                   HFKTYATPEHSFWCCVGTGMENHVKYNEFIYFYNGDTLYVNLFIPSELNWERRALRLRL
FT                   ETAFPESNRVRLDFDPEVPQRLVVKVRHPSWAQDALDVRINGEVQSVTSRPGSYLTLAR
FT                   VWQPGDEVEITLPMRLRVETMPDNPDRFAILYGPIVLAGVFGSRGLPEGGAYAKDQWEF
FT                   FGWPAPPLPKLCGDLNRVEDWVKPLATGGELRFHTVGVGRPADVLLKPFYEVHHERYTI
FT                   YWDRCR"
FT   sig_peptide     528117..528182
FT                   /locus_tag="Rmar_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            530156..530659
FT                   /locus_tag="Rmar_0479"
FT   CDS_pept        530156..530659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0479"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: bsu:BSU22400 bifunctional
FT                   ATP-dependent DNA helicase/DNA polymerase III subunit
FT                   epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47381"
FT                   /db_xref="GOA:D0MET1"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D0MET1"
FT                   /inference="protein motif:PFAM:PF00929"
FT                   /protein_id="ACY47381.1"
FT                   /translation="MPLEVAPLLFFDVETSGLRPDRGAAIVELALLGAREPLLLWKGTS
FT                   AQRLQRAQFRELFAHVREGVIVGHNLRFDFWFVTYEAGRLGLAVPPIRFIDTLGLARRL
FT                   LPEQADYRLVALLHALGIEPDKPLHTAVADAQATRALFWKLVERGKLRTLADAGMKQLT
FT                   WTHR"
FT   gene            530679..533285
FT                   /locus_tag="Rmar_0480"
FT   CDS_pept        530679..533285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0480"
FT                   /product="CRISPR-associated helicase Cas3"
FT                   /note="KEGG: acp:A2cp1_0778 CRISPR-associated helicase
FT                   Cas3; TIGRFAM: CRISPR-associated helicase Cas3; PFAM:
FT                   helicase domain protein; SMART: DEAD-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47382"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:D0MET2"
FT                   /inference="protein motif:TFAM:TIGR01587"
FT                   /protein_id="ACY47382.1"
FT                   /translation="MEGAPSPAQFWAKLRYTEERHPENIVAWHPLVAHAADVAAVVEAL
FT                   LQRTLLRKRLARLIGWNDLAEVHVARLAVLAALHDAGKANHGFQDQAFDPRVRSPGHVR
FT                   PIVEILCADEPARWLEPLKIGEMAGWFVSEEVFYHFLLATWSHHGRPVLPEGDFQAHYW
FT                   RPNARRDPRAAWRRLAELVRLWFPAAFADGAEPFPADPRFQHAFNGLLTLADWIGSDTR
FT                   FFPYADETADPMCPIERAREGARRALQSLFLDAAGGRKALGDVPVGFRGVIEAGTPYPI
FT                   QQACYDLPVHPQGSLTILESDTGSGKTEAAVARFLRLYQEGLVDGMYFALPTRSAASQI
FT                   HRRITEIVARVFPEAHRPPVVLAVPGYLRVDEAEAVRLPDFRVLWDDEALRYRGWAAEH
FT                   PKRYLAGPIVVGTIDQVLLAGLQVSHAHMRAAALLRHFLVVDEVHASDPYMTTLLERIL
FT                   AFHLAAGGHALLMSATLGSVARVRYATKGGTPPPLDEAEGERYPLLTHVDAGRQRLETV
FT                   SAASSGREKPVTIRVESIASDPQAVAELALQHARVGARVLLIRNRVEDCLAVQQAFEEA
FT                   ACDDRSLLLTCNGQPVPHHGRYAPEDRRALDAAIEAAFGKNSPRRGLVAACTQTVEQSL
FT                   DIDADLLITDLCPIDVLLQRIGRLHRHERPRPKGYEQAVCLVLTPAERDLTRTIQPDGG
FT                   ARGPHGLGTVYPDLRVIEATWRVLEGQNLWQIPRDNRRLVERATHPAVLQQIVREKGER
FT                   WEAHQRHILGQEAANRYVPKITGLHFERPFGAHPFGRDIAPRTRLGDDDYRVELPEPVL
FT                   GPFGWPVGTLPVASWMVGDELPEEPKARDVTPFDGGFSFVFAGRRFHYDRLGLQIV"
FT   gene            533367..534923
FT                   /locus_tag="Rmar_0481"
FT   CDS_pept        533367..534923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0481"
FT                   /product="CRISPR-associated protein, Cse1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cse1 family;
FT                   KEGG: ank:AnaeK_0779 CRISPR-associated protein, CSE1
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47383"
FT                   /db_xref="InterPro:IPR013381"
FT                   /db_xref="UniProtKB/TrEMBL:D0MET3"
FT                   /inference="protein motif:TFAM:TIGR02547"
FT                   /protein_id="ACY47383.1"
FT                   /translation="MRYALLNEPLIRVRLKDGTVRDCTLPEVIVALLRDEVLGFEALQP
FT                   HQQQAWHSFLVQLVAMAVARITGGAFPEEAEPWRRALVELAGGEEAAWYLVVSDLSRPA
FT                   FLQPPVPEGSLEAARYRADVQTPDQLDVLITAKNHDLKARRIVQPRPEHWMFALVTLQT
FT                   MEGFLGRGNYGIVRMNGGFGNRPLVGLTRALSPGAHFRRDVQVLLDARPSFADRYDLGG
FT                   HALLWVLPWDGKKQRAIELKECDPYFIEICRRIRFLEEAGRLVCWRTNTDGPRVAAPKA
FT                   LNGITGDPWTPVEKSDKPKALTVSDSGFTYRLLQQVFLSGDYEPPVALAFREDEKDGVY
FT                   LVARTLVRGQGKTGGLHFRIVPVSQAAARWLSGSEERRTKLARRAEQRVRLAADVQRKV
FT                   LYPALAALLSGGRDARVEWEQVTPWIEAFDRAVDAQFFDRLWASVEQDEEIARRDWERF
FT                   LLTEARRQFAVAEHGMPVASAHHWRARSRAHAIFEARAREVLPYAFNATRSLSTEQEVR
FT                   S"
FT   gene            534920..535459
FT                   /locus_tag="Rmar_0482"
FT   CDS_pept        534920..535459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0482"
FT                   /product="CRISPR-associated protein, Cse2 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cse2 family;
FT                   KEGG: ank:AnaeK_0780 CRISPR-associated protein, CSE2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47384"
FT                   /db_xref="InterPro:IPR013382"
FT                   /db_xref="InterPro:IPR038287"
FT                   /db_xref="UniProtKB/TrEMBL:D0MET4"
FT                   /inference="protein motif:TFAM:TIGR02548"
FT                   /protein_id="ACY47384.1"
FT                   /translation="MKTQIQTEGPSITRGQAVGKAAGLLASEALSSGERAELRRIAFEA
FT                   PFTPALWKVLFYLRDEGAPVRIGDEADERCWATLLMGMAHCIKLHDYQVPLGRALAEAG
FT                   WSELRFTQLLRARGPQLAVFLRRMAQYLSAKNQLANWADVADLLFEQEGAKADTVRLRI
FT                   ARDYYARRYQQEREAA"
FT   gene            535507..536778
FT                   /locus_tag="Rmar_0483"
FT   CDS_pept        535507..536778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0483"
FT                   /product="CRISPR-associated protein, Cse4 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cse4 family;
FT                   KEGG: acp:A2cp1_0781 CRISPR-associated protein, CSE4
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47385"
FT                   /db_xref="InterPro:IPR010148"
FT                   /db_xref="UniProtKB/TrEMBL:D0MET5"
FT                   /inference="protein motif:TFAM:TIGR01869"
FT                   /protein_id="ACY47385.1"
FT                   /translation="MVSAFVQIHTLTAYPAALLNRDDAGFAKRLPFGGAIRTRVSSQCL
FT                   KYHWRNFSGEHALYGLDVPRSLRSRETFKRCIARPLVEEGYPLRLVVAFALHLQKLIVS
FT                   DESLSKTDFKKLMSDEVDDATLLDQLKSNQVIILGRPEVDYLTRRIRERLDALREVWAD
FT                   AAAPLSDEQLERVYQELQAIGKGELKKNLKGLYLAAGLDAALFGRMATSDVLARGDAAI
FT                   HVAHAFTTHAEESESDYFTAVDELVAQEGEGELGSGHLNNQELTSGLFYGYVVVDVPLL
FT                   VSNLEGVPPAAWQEADRTLAAEVVRRLLHLIATVSPGAKLGSTAPHAYAQFMLVEWGRS
FT                   QPRTLANAFHRPVSLDGEGVLVNSYRALGRYVEQMDRMYGKLTERRLAAIDLPEAVQRQ
FT                   LQVDTLNAVPEIADWVAEKIQGGA"
FT   gene            536778..537536
FT                   /locus_tag="Rmar_0484"
FT   CDS_pept        536778..537536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0484"
FT                   /product="CRISPR-associated protein Cas5 family"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas5 family;
FT                   CRISPR-associated protein Cas5; KEGG: ank:AnaeK_0782
FT                   CRISPR-associated protein Cas5 family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47386"
FT                   /db_xref="GOA:D0MET6"
FT                   /db_xref="InterPro:IPR010147"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:D0MET6"
FT                   /inference="protein motif:TFAM:TIGR01868"
FT                   /protein_id="ACY47386.1"
FT                   /translation="MEILLLRFDAPLMSFGAPIVDQYGFIQPYPALSMMTGLLANALGY
FT                   THAETARLERLQERLRYAVREDRRGQQLRDFQTVDLSQPFLHDERAWTTRGTLETRQGG
FT                   TASLGIHIRLRDYWADAVYTVALTLDPPDEPPTLADLEQALRFPARPLFIGRKPCLPAA
FT                   PLFIGRVEAADLLDALRRAPLDARADRADFYRVWWETGPDDPPPVEGIRENLRRPVTDR
FT                   RDWANQIHVGSRWIAMGELSVHPAGERHEG"
FT   gene            537526..538323
FT                   /locus_tag="Rmar_0485"
FT   CDS_pept        537526..538323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0485"
FT                   /product="CRISPR-associated protein, Cse3 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cse3 family;
FT                   KEGG: acp:A2cp1_0783 CRISPR-associated protein, CSE3
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47387"
FT                   /db_xref="InterPro:IPR010179"
FT                   /db_xref="UniProtKB/TrEMBL:D0MET7"
FT                   /inference="protein motif:TFAM:TIGR01907"
FT                   /protein_id="ACY47387.1"
FT                   /translation="MKDNASQGRADPTPFHMVQLWLDVRRLYELGRMLDLFRARRPVSL
FT                   SYLVHCALGELFQAQAPRPFAVEGENRRGPWVRVLGYADVPWETLQELARGFASPAVYA
FT                   ICGWDRGASKPMPTEIPRGMRLAFSVRVCPVVRKASAGQSPRGRRWQKGQELDVFLDAA
FT                   WSQPEAVLDREAVYAEWLRRQMARPEKGGARVETVRMTRFSIERMTRRTNGSSRSVTVI
FT                   QRPDVTLEGVLTVTDSAAFMRMLRRGVGRHTSFGYGMLKLRRA"
FT   gene            538341..539234
FT                   /locus_tag="Rmar_0486"
FT   CDS_pept        538341..539234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0486"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1; PFAM:
FT                   protein of unknown function DUF48; KEGG: ank:AnaeK_0784
FT                   CRISPR-associated protein Cas1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47388"
FT                   /db_xref="GOA:D0MET8"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019851"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:D0MET8"
FT                   /inference="protein motif:TFAM:TIGR00287"
FT                   /protein_id="ACY47388.1"
FT                   /translation="MVFKGRLGLESARVPQADRHGLLWLERGRLSAEDGTLVFTTAGTD
FT                   RLAAGTYDIPLQQVSNILLGPGTVVSHDALRLLARQQTGLLAVGSGGVRLYAVSMPFGP
FT                   DRSERARRHARLWADETRRLEIARAMYAIRLGGALPPYIQDLDTLRGIEGARVKESYRQ
FT                   LARQFGIDWRGRRYDRQHPELNDLVNNAINHAAVAVYAAARIAVAVTGTIPQLGFIHEA
FT                   SGHAFALDIADLFRTTVTVPVAFRAVRQFITEGGRDIESVTRTLAGRTLRDEEVIPRMI
FT                   DYIKELIDGHDDRRDP"
FT   gene            539206..539634
FT                   /locus_tag="Rmar_0487"
FT   CDS_pept        539206..539634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0487"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas2; KEGG:
FT                   tmz:Tmz1t_2235 CRISPR-associated protein Cas2"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47389"
FT                   /db_xref="InterPro:IPR010152"
FT                   /db_xref="UniProtKB/TrEMBL:D0MET9"
FT                   /inference="protein motif:TFAM:TIGR01873"
FT                   /protein_id="ACY47389.1"
FT                   /translation="MAMTIAVTRNTPGRFRGFLASCMLEIAPGVYVAPRMPRDVRERVW
FT                   QVLLSWAELIPPDGGVVLLWRNRKAPSGLDVRLLGWPKKELVEYEGVWLAWRGLTAAHD
FT                   VEELARLVEAEEPPLEAGDPILRLVERPDLDEEEGSSL"
FT   repeat_region   539686..544160
FT                   /rpt_unit_range=539686..539714
FT                   /note="CRISPRs"
FT   gene            complement(544837..545325)
FT                   /locus_tag="Rmar_0488"
FT   CDS_pept        complement(544837..545325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0488"
FT                   /product="DinB family protein"
FT                   /note="PFAM: DinB family protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47390"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEU0"
FT                   /inference="protein motif:PFAM:PF05163"
FT                   /protein_id="ACY47390.1"
FT                   /translation="MTPWHRWLAYERHCIRPVVEAFQSVPEARRQAPSYQRAVTLLGHL
FT                   AVALECWLARVEGEEQTAVTLFPTDLSVEEAALRIDRALDRWERLLSRLNAEELERTVS
FT                   YRTTFGVAHRSTLADILTHLLAHGAYHRGQIMLLVRQLEGVPTKTDFIVWARSPQNPA"
FT   gene            545612..548119
FT                   /locus_tag="Rmar_0489"
FT   CDS_pept        545612..548119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0489"
FT                   /product="membrane of secreted protein"
FT                   /note="KEGG: amc:MADE_00237 membrane of secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47391"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEU1"
FT                   /inference="similar to AA sequence:KEGG:MADE_00237"
FT                   /protein_id="ACY47391.1"
FT                   /translation="MLVALAVQAQTPEPVRTFVDAQGVWRWTDTGAEVAFFGVNYTTPF
FT                   AHAYRAHRLRRVDLRRAIEADVAHLARLRLNAFRIHVWDREISDHRGNLIENEHLELLD
FT                   YLIARLKAHGIAIVLTPIAWWGTGYPEPDPKTDGFSDHYSKCELTADTTAWRIQANYLR
FT                   QFIRHVNPYTGLSYRDDPDILAVEIFNEPCHRTAPDTTTRYINTLVAALREAGLRKPIF
FT                   YNISEGYTDAHGRAVCAADVQGITFQWYPTGLVRGRMLEGNMLPNVDRYAMPPAAFPEC
FT                   RNKTRMVYEFDAADVGGAYMYPAMARSFRAAGFQWATQFAYDPLFIADANTEYPTHYVN
FT                   LVYTPAKAISLMIAAEAFRRLPRGVETGTYPESARFGPFRVDAARDLSEMVTDTAFFYS
FT                   NTTDTRPPRPEQLRHVAGVGSSPVVQYEGTGAYFLDRLAEGVWRLEVYPDAYWVRDPFG
FT                   RTGLHRPVARLVRRQRRMTIRLPDLGPDFSVQPLNPGNAHRPAVVAGAFGIRPGVYLLR
FT                   AAGAAAVDSSWLRPVPFYLPPAAEFGLQVLHAPPVELTATDTLRVQVVADAAPDSVRLY
FT                   VQRPGWRGFAAVRMVPLGGDRYGATLPPSVAQPGVLTYAITVYIGGRTHTFPADEPRDV
FT                   RDWDFAGRTFWQTTLVTPEAPIVLLDPRRDADRLLLPRFGRGFRFAVEPVPTDEPGRWA
FT                   LRATASGPDPEAQGFVFRTELPATLRDRLARGSWTHLRVRARACQGVRRLEVALVDLDG
FT                   VAWAATVTLREDWRDVRIPLHALRPVELALLPRPYPSFHPYFFRTTPRADRIDPARLDG
FT                   LQFRVRATEGAPAFEVAAVALVP"
FT   gene            complement(548125..549369)
FT                   /locus_tag="Rmar_0490"
FT   CDS_pept        complement(548125..549369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0490"
FT                   /product="galactokinase"
FT                   /note="TIGRFAM: galactokinase; PFAM: GHMP kinase; GHMP
FT                   kinase domain protein; KEGG: aba:Acid345_1701
FT                   galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47392"
FT                   /db_xref="GOA:D0MEU2"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022963"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEU2"
FT                   /inference="protein motif:TFAM:TIGR00131"
FT                   /protein_id="ACY47392.1"
FT                   /translation="MPSSATNSIVTRLLEAFAAHFGAPAPAVVARAPGRVNLIGDHTDY
FT                   NDGFVLPMTLDRAVYLAVRPRPDREVRLLSLNFDETIRFEIGTPPTETPRWAAYVQGVV
FT                   TELHRRALLPNGFEGVLYGDVPLGSGLSSSAALEVATLVTLQHLFGFAMSGEEAARLCQ
FT                   YVEHTYVGVQCGIMDQFAARLGRRGHALFLDCRSLAYRHVPVHLKDWLFVIIDSRAPRE
FT                   LAASRYNERRAECEAGVAFFRRFDPEIRALRDVSPELLWAHPDQPTPTIWRRCRHVVEE
FT                   NRRVQEAVVDLEQDRLEAFGQRMNASHDSLRDLYEVSSPALDLIVDTARQVEGVLGARL
FT                   TGAGFGGCTVVLLHRDALPELEQRVARAYEATFGRQPAFYPLDHNVEAGPIWPKTAALP
FT                   VSSASESDEAGASEE"
FT   gene            complement(549383..550912)
FT                   /locus_tag="Rmar_0491"
FT   CDS_pept        complement(549383..550912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0491"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: vfm:VFMJ11_A0389
FT                   sodium/glucose cotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47393"
FT                   /db_xref="GOA:D0MEU3"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEU3"
FT                   /inference="protein motif:TFAM:TIGR00813"
FT                   /protein_id="ACY47393.1"
FT                   /translation="MTFGIVDLIAFVGFIAFVIGFSLYASRKEETGEDYFLAGRGLTWW
FT                   LIGFSLIASNISTEHFVGMAGRGFELGLAIASYEWMAAITLVLVAFFFLPKFLRAGIYT
FT                   MPEYLEYRYNTTARTIMATFMMLAYVFVALATVLYSGALALEAIFGLDTVLGIWLIGLL
FT                   AGFYTVYGGLKAVVWTDLLQGAALLLGGLLVTVLGFQALGGVDVFFAQAGDKLHTVLPW
FT                   DHPEMPWVAVFIGGLWIPNLFYWGLNQFITQRTLGARSLEEGQKGIMLAALLKLLIPFI
FT                   IVFPGIMAAILYPQEVTQADQAYPVLIRELLPVGLRGIMLAALFGAVMSSLDSMLNSAA
FT                   TIFTIDLYQRHWKKGQATPRELVTIGRVATAAFVLFGCLWAPIVGRTGSVFQYIQMFWG
FT                   FISPGITAAFLFGLFSKRTPPEAAIGAMLLGIPVYGLLLWKLPHVAFLHHMMITFLVLA
FT                   AFMWIVTKLRPLPEPPKMPDAPPIPMETSPRLRRMGLGIVGLTALLYLLFW"
FT   gene            complement(550935..551990)
FT                   /locus_tag="Rmar_0492"
FT   CDS_pept        complement(550935..551990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0492"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="KEGG: aba:Acid345_1703 galactose-1-phosphate
FT                   uridylyltransferase; TIGRFAM: galactose-1-phosphate
FT                   uridylyltransferase; PFAM: galactose-1-phosphate uridyl
FT                   transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47394"
FT                   /db_xref="GOA:D0MEU4"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR019779"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEU4"
FT                   /inference="protein motif:TFAM:TIGR00209"
FT                   /protein_id="ACY47394.1"
FT                   /translation="MEASWLAETPHRRRNALTGEWVLVSPHRARRPWQGLVESIPAETR
FT                   PAYDSTCYLCPGNARAGGRRNPPYTETFVFDNDFAALQPDAPEAHWTADGLLEAHAERG
FT                   ICRVVCFSPRHDLTLAELDVAAIRRVVDVWTEQYRELGARPEIRYVQIFENKGELMGCS
FT                   NPHPHGQIWAQETIPNEPLKECRQQQAYFERTGRTLLADYLALELRLDQRIVCANDHFV
FT                   ALVPFWAVWPFETLVISRRPVPSLLELTDAERDGLADLLKRLLVRYDNLFQISFPYSAG
FT                   FHQAPTDGRPHPEWHLHLHVYPPLLRSATIRKFMVGYEMLGMPQRDLTPEMAAARLRAL
FT                   SEVHYRMQPAS"
FT   gene            552250..552591
FT                   /locus_tag="Rmar_0493"
FT   CDS_pept        552250..552591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0493"
FT                   /product="protein of unknown function DUF486"
FT                   /note="PFAM: protein of unknown function DUF486; KEGG:
FT                   dar:Daro_3184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47395"
FT                   /db_xref="GOA:D0MEU5"
FT                   /db_xref="InterPro:IPR007437"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEU5"
FT                   /inference="protein motif:PFAM:PF04342"
FT                   /protein_id="ACY47395.1"
FT                   /translation="MHPLWQTIGLLMLSNLFMTFAWYGHLRHLGDRPWYVAVLVSWSIA
FT                   LFEYMLQVPANRIGFTVLNLAQLKILQEVITLSVFVPFAVFYMHQPIRLNYLWAALCLL
FT                   GAVYFIFKG"
FT   gene            552688..553605
FT                   /locus_tag="Rmar_0494"
FT   CDS_pept        552688..553605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0494"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   bph:Bphy_4666 dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47396"
FT                   /db_xref="GOA:D0MEU6"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEU6"
FT                   /inference="protein motif:PFAM:PF00701"
FT                   /protein_id="ACY47396.1"
FT                   /translation="METPGSNWQGVFPAVTTPFTEEDRVDVPGLHRLVDFLIEGGVDGL
FT                   IMLGTLGEGSVLSPEEKELVLREALAAADGRVPVLAGVAETTTRAACRFAERAAALGVQ
FT                   GFMALPALLYNALPHETLAHFQALARATDLPLMLYNNPVLYGVDVTPEMLAELADESRI
FT                   VAVKESSEDVRRITDIRVHTGDRYRLFVGVDDLVLEGVAAGADGWVAGLTNAFPRESVA
FT                   LFRLARAGRLDEARRLYHWFMPLLHLDASPQLVQHIKLAQALVGVGSEHVRPPRRPLQG
FT                   ERRRAVEALIRKALDTHAEIEDLL"
FT   gene            553625..555073
FT                   /locus_tag="Rmar_0495"
FT   CDS_pept        553625..555073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0495"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: lch:Lcho_1119
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47397"
FT                   /db_xref="GOA:D0MEU7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEU7"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACY47397.1"
FT                   /translation="MQTKTYGHFINGEWVVGTETFPNVNPSDTRDVIGHYAQGTEADVR
FT                   AAVEAAAAAFPRWAASTPQERFDVLDRVGSEMLARAEELGTLLAREEGKTLKEAIGEVK
FT                   RAGQIFKFFAGEALRMSGEHLRSVRPGVEIDLIREPVGVVGLITPWNFPIAIPAWKVAP
FT                   ALAYGNTVVLKPAEQAPASAWALAEILLRSGLPPGAFNLVLGDGTVGAALVAQPGVSAI
FT                   SFTGSREVGRQVAEACARRMIRVQVEMGGKNPLVVLDDAPLEAAVEAAVNGAYFSAGER
FT                   CTASSRLIVTEGIYERFRAALLERIRRLRVGPALDPNTYIGPVIDEAQLRRILHYIELG
FT                   QQEGAVLACGGQRLELGTPGFYLAPALFDETDNRMTINREEIFGPVAALIRVRDYEEAL
FT                   AVANDTDYGLSAGIFTRSLRYAHHFRRHVQAGTVMVNLPTAGLDYHIPFGGHKASGYGP
FT                   KEQGRYAQEFYTVVKTCYVAPEIT"
FT   gene            555077..555733
FT                   /locus_tag="Rmar_0496"
FT   CDS_pept        555077..555733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0496"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   oca:OCAR_6855 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47398"
FT                   /db_xref="GOA:D0MEU8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEU8"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACY47398.1"
FT                   /translation="MNVKRASLADRAYEALEHRIVTLQLAPGTIVTEKELIREVGLGRT
FT                   PLREAVLRLAQEQLVTVLPRKGIYIAEINLTDQLAALEVRRELDRLMARRAARLARPQE
FT                   RVQFAELAQSMRNLGEEDLDLFMHLDRLFDRLVEKACHNRFAVRAAAPLHTLGRRFWYA
FT                   YHHEGDLEASIQLHAHLMEQIAKGDAEAAEAAAVELIDAMIGFTQRVLQQTIEPR"
FT   gene            555730..557493
FT                   /locus_tag="Rmar_0497"
FT   CDS_pept        555730..557493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0497"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   sbm:Shew185_4353 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47399"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEU9"
FT                   /inference="protein motif:PFAM:PF05960"
FT                   /protein_id="ACY47399.1"
FT                   /translation="MRTLRWSGLLLLAGLLSACRPAPDPAAQFRALLDESWAFLLRENP
FT                   LTATYVGVHTYDDRLPSVTPADLARRDSFWAQVEQRLNAIDPAQLSEDDRITYDIFRHW
FT                   LTHQRAVYRYRGYLIPITSDEGFHIALGRLPEWLVLRTEADYRNYLARLKAVPTYMAQH
FT                   IALMREGLRQGITQPKVVLQNYTATITGYIVEDPAQSVFFRPFREFPPGIPDSVQQQLR
FT                   AEALRVIREQVIPAYRDFLQFMETEYIPGARTTTALSDLPEGRAYYEHLVRYYTTLDLT
FT                   PEAVHEIGRREVARIRAEMDSVMRRTGFRGSFQEFLHFLRTDPRFYARSADELLREAAW
FT                   IAKQMDGRLPALFHVRTLPRQPYGVAPVPPHLQPRYTGGRYIPAPPASRTGAYYWVNPY
FT                   PLDGRPLYVLEALTLHEAVPGHHLQYAIRQELTGVHPFRRWVSFSAFGEGWALYAEKLG
FT                   KEVGFYSDPYREFGRLTYEMWRACRLVVDTGLHALGWTRRQAIDYMAANTALSLHEITT
FT                   EVDRYISWPGQALAYKMGELTILRLRREAETRLGDRFDLRDFHEVVLRQGDVPLGTLER
FT                   LVHAYIEQQAK"
FT   sig_peptide     555730..555786
FT                   /locus_tag="Rmar_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.858) with cleavage site probability 0.709 at
FT                   residue 19"
FT   gene            557493..558494
FT                   /locus_tag="Rmar_0498"
FT   CDS_pept        557493..558494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0498"
FT                   /product="proline racemase"
FT                   /note="PFAM: proline racemase; KEGG: bcs:BCAN_A1830 proline
FT                   racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47400"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEV0"
FT                   /inference="protein motif:PFAM:PF05544"
FT                   /protein_id="ACY47400.1"
FT                   /translation="MARYTFSCIDAHTCGNPVRVVVGGAPQLQGDTMAEKRLDFMARYD
FT                   WIRTGLMFEPRGHDMMSGSLLYPSRRPDCDIGLVFIETSGCLPMCGHGTIGTVTVLLEH
FT                   GLVQPRTEGVVALEVPAGRVEAYYRKSGEYVESVRIVNVPSFLYAEGLRVECPDLGELT
FT                   VDVAYGGNFYAIIEPQENYPGLDAISALDILRWSPVVRERLNAAHRFVHPEDPRIAGLS
FT                   HVMWTGPPRNPEAHARNAVFYGMKAIDRSPCGTGTSARMAQLYAKGKLRVGDTFVHESI
FT                   IGSLFVGRVEATAQVDNFTAIVPSIEGWARVTGFNTIFIDERDPYCHGFQVL"
FT   gene            558538..559785
FT                   /locus_tag="Rmar_0499"
FT   CDS_pept        558538..559785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0499"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   spl:Spea_0813 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47401"
FT                   /db_xref="GOA:D0MEV1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEV1"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACY47401.1"
FT                   /translation="MPSVVIIGGGAIGLASAFFLQQRGTFSITVIDQGPIGDGCSYGNA
FT                   GFISPSHLVPLAAPGVIGKGLRWLLDPESPFYIRPRWDPELFRWLWLFRRAANEAHVTR
FT                   SAPVLQALLERSRELTARLQEGVGDFEFRRDGLLMPYQSEEGRHECAQLAREAERLGMA
FT                   HEWIPAERLAELAGTKVHAEGGLFFPGDAHLRPDRFTAALHRYLERQGVRFLAETPVTE
FT                   LERRGGRVRGVRTPDGVLSADQVVVAAGAWSARLVRAVGYRLPLQPAKGYSLTFTPPPE
FT                   GMPRRPLLLTETKVAVTPFREAFRLAGTLELSGLELSIRDRRVQAIYRAAGRYLPALRL
FT                   PRMEQAEIWAGLRPCTPDGLPVVDRVPGTENLWLATGHAMLGISLAAVTGELVAALISG
FT                   AEPPVDPTPLRADRWR"
FT   gene            559859..560680
FT                   /locus_tag="Rmar_0500"
FT   CDS_pept        559859..560680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0500"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47402"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEV2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47402.1"
FT                   /translation="MAPRMSGTRQVATDEYFRFDVPGCYRTQAFQALLARHPEALQLYA
FT                   RHVEAQAHEPAYLQRVRQLVPRLVRWLGAEVAADGRPGLCVQTSALLSRLLEELGIWNY
FT                   VVAGGCVLSFVPADVRPRVFYLFDLQPVEVPHAWVVAPPYDVIDLTLRQQRYPGPEGRR
FT                   IPTQVLSCRAPQVTVQPEDVCTPALLQGLLLRGWTRETLLRRAFPEFWHFLKQFPARRV
FT                   QTPTVSVTYIPARLLLPPWHEAWERMPLINGKSFVQFRSEMTLVLSGNGAA"
FT   gene            complement(560677..561510)
FT                   /locus_tag="Rmar_0501"
FT   CDS_pept        complement(560677..561510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0501"
FT                   /product="mannosyl-3-phosphoglycerate phosphatase"
FT                   /note="TIGRFAM: mannosyl-3-phosphoglycerate phosphatase;
FT                   mannosyl-3-phosphoglycerate phosphatase family; HAD-
FT                   superfamily hydrolase, subfamily IIB; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase type 3; KEGG:
FT                   dal:Dalk_4107 mannosyl-3-phosphoglycerate phosphatase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47403"
FT                   /db_xref="GOA:D0MEV3"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006381"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR033980"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEV3"
FT                   /inference="protein motif:TFAM:TIGR02461"
FT                   /protein_id="ACY47403.1"
FT                   /translation="MNRTPTPLPVIFTDLDGTLLDLHTYDPGPAREAVARLQERGIPIV
FT                   FCSSKTRAEQLAYRRQLGIRDPFIVENGAAIFIPRGYFTVPHEARPTSHGLEVIELGRP
FT                   AAEIRRALREIRKETGLSFRGYHEMTVEEVAELTGLPPEAARRAMTREYSETIIVDFGP
FT                   ADWQRFNAALVAHGLVCFAGGRFHTVVGLGTDKGQAVHRLAELYRQQHGAILTVGLGDS
FT                   PNDVPMLRAVDRPFLVQRPDGTWESVDVPGLVPIPAPGPEGWCMAVEQLLTQLAL"
FT   gene            complement(561507..562790)
FT                   /locus_tag="Rmar_0502"
FT   CDS_pept        complement(561507..562790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0502"
FT                   /product="mannosyl-3-phosphoglycerate synthase"
FT                   /EC_number="2.4.1.217"
FT                   /note="TIGRFAM: mannosyl-3-phosphoglycerate synthase; KEGG:
FT                   hypothetical protein; K05947 mannosyl-3- phosphoglycerate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47404"
FT                   /db_xref="GOA:D0MEV4"
FT                   /db_xref="InterPro:IPR012812"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEV4"
FT                   /inference="protein motif:TFAM:TIGR02460"
FT                   /protein_id="ACY47404.1"
FT                   /translation="MRIEIPREAERFGANHIYGVQKVYELDSGLRQDAPASENSVIQNL
FT                   PYETLYEIERDMAIVVPIRDERLKLLEGVLFGIPHQCTVIIVSNSRRAPVDRFKMEQDA
FT                   VETWSRFTQKQLLLVHQKDPFIARALAEAGYPYILDENDLVANGKAEGMIMATLLARIL
FT                   GKRYIGFIDADNYFPGAVYEYVHEYAAGFALSKSPYTMVRIAWHSKPKVVQSQLFFAKY
FT                   GRTSVVTNRFLNQLISYYTGFETEVIRTGNAGEHAMTMELAMLLDYATGYAIEPYHYID
FT                   LLEKYGGVIESAHPEVMQHQVNVFQIESRNPHLHESKGEEHIDDMILSSLQVIYHSKIC
FT                   PEPIKREVLRELYRRGILSKGEEPAPPRIYPALLHVDLEAFRNALMRAPYGEQLETLAQ
FT                   RRGYRRRLPRPTVTPPEGDGSEQVATPA"
FT   gene            563040..564398
FT                   /locus_tag="Rmar_0503"
FT   CDS_pept        563040..564398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0503"
FT                   /product="glycoside hydrolase family 37"
FT                   /note="PFAM: glycoside hydrolase family 37; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47405"
FT                   /db_xref="GOA:D0MEV5"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEV5"
FT                   /inference="protein motif:PFAM:PF01204"
FT                   /protein_id="ACY47405.1"
FT                   /translation="MRTTTALREQACQVLEANWTGRFTKPAPRLYPHQWSWDAAFIALG
FT                   WMHENQERAQQELRHLFRAQWKNGLVPHIVFHRRARGYFPGPGVWETHRSPDAPARIAT
FT                   SGIVQPPVHATAAWAMYRQARDRRATRAFLEELFPKLMAWHDYLFRERDYHSEGLVYIR
FT                   HPWESGMDNAPLWDGIEQRMHLNPGDRPRYRRVDTTLVAEADRPTGAEYDRYLYLVRLF
FT                   AEAGYDEARLRESCPFLVEDVLFNTLICQAEQDLAEIAAELGDDPEPFRQRARRVAEAV
FT                   NRKLWDDRRALYFDYDLVLDRPIWVRMAACFTPLFAGIPDGLQAARLVSHLEASGFFNW
FT                   DGSCYSVPSYDPNGLGFSPVQYWRGPVWININWLLIEGLARYGYTEHAAHLGRTVRLLV
FT                   ERNGFYEYYHPYTGEGHGSEQFSWTAALVLDLLARRPEWMQWGVRSTRRRAVA"
FT   gene            564462..567428
FT                   /locus_tag="Rmar_0504"
FT   CDS_pept        564462..567428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0504"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; SMART:
FT                   Hedgehog/intein hint domain protein; KEGG: pca:Pcar_0019
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47406"
FT                   /db_xref="GOA:D0MEV6"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEV6"
FT                   /inference="protein motif:PFAM:PF01139"
FT                   /protein_id="ACY47406.1"
FT                   /translation="MAELRFVKIHDYLWEIPRTGGMRVPARIYASEKILRELKEDQAPQ
FT                   QAVNVAHLPGIVKYSLAMPDIHWGYGFPIGGVAAFDLDEGVISPGGVGYDINCLTGEAR
FT                   VLHAHGYYRTIAEIVEAGTNDPLCSYRFAVRRPESARIIYRFGETPRTRVWRVWTRGGD
FT                   TVEATEDHPFWTPQGMVPLRELRPGDRVAFCPFEGVPYEAPSSETILSPEAFWEALRQL
FT                   GIPDRGRRYRQLVRYLTRRGLLPLRYDSPALPLLCKLLGYLLGDGTCYRERNGRIRLVA
FT                   YGRAEDLEAMRHDLEALGVRAARLRRRRRRHRVQTVYRPYAFEREEVSLHITSRAFALL
FT                   LVALGMPIGDRTAQDFEAPAWLERAPRWQKRLFLAGLFGAELSAPRLMSGHARTFATPV
FT                   LTLTKRAPFAESGRRFLETLARWAAELGVRTQAIEARRELLATGERVRWQWRMASDPAS
FT                   LRALWGRIGYEYNFRRQHEAACALQYVKYKEQVVRQRQEAVRLLRRWRAAGVSVGEATR
FT                   RLADQDINRRFVERTYYEQRGDTPRIGDAVCSYAAFRRERQNGQEPLGCVWEEIVRIEP
FT                   VERPELRVYDLTVDHPDHNFIANGFVVSNCGVRLLASRLTYEEVEPHLERLVEMLFRRV
FT                   PTGVGASGALRVSKQELRRVAVEGAHWAVRHGFGSEVDLEFIEENGRIEGADPAAVSER
FT                   AYERGADQLGTLGSGNHFLEVGYVAQIFDDEAARVMGLFPGQVTVIIHTGSRGFGYQIC
FT                   DDYLAVMDRALARYHIRLPDRQLACAPLRSPEGQQYLAAMRCGINFAFANRQIIAHNTR
FT                   KAFAEALGMREEDIGLRTVYEVAHNIAKIEEHTIDGERRRVCVHRKGATRAFPPGHSQI
FT                   PAAYRSIGQPVLIPGDMGRYSYVLVGTEQAMQETFGSTCHGAGRQLSRTKAKKVASGRH
FT                   VAEELRARGIIVRGASIRTINEEIPEAYKDVAEVVEVCHRAGISRKVAQLRPIGCIKG"
FT   gene            complement(567819..568628)
FT                   /locus_tag="Rmar_0505"
FT   CDS_pept        complement(567819..568628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0505"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; KEGG:
FT                   mxa:MXAN_4018 tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47407"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEV7"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ACY47407.1"
FT                   /translation="MRRVVRRCLPILPGILLGITALAQPVRAPEPLLQAVWRAYQALDY
FT                   EQADSLARNALNDYQRFTPDQLVELHTVLALVAMSRNETTEARRHFKAALSLNPELQLD
FT                   PVLASPKVREFFEQIRQEMQSAPPVTASSEATIRYVVQPDPRPEAALRSLLLPGWGQHY
FT                   KGQHLKGWILTGSWGLLLGASLAAHLQYTRAYDRYRRETDPARIERRYRTANRWFKARN
FT                   GLLMGLAAVWAYSYLDALLQPVAPSASPVVRPYVSGTGAGLEMRWHF"
FT   sig_peptide     complement(568557..568628)
FT                   /locus_tag="Rmar_0505"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.988 at
FT                   residue 24"
FT   gene            complement(568633..569925)
FT                   /locus_tag="Rmar_0506"
FT   CDS_pept        complement(568633..569925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0506"
FT                   /product="Kelch repeat-containing protein"
FT                   /note="PFAM: Kelch repeat-containing protein; Kelch repeat
FT                   protein; SMART: Kelch repeat-containing protein; KEGG:
FT                   hypothetical protein LOC100074916"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47408"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEV8"
FT                   /inference="protein motif:PFAM:PF01344"
FT                   /protein_id="ACY47408.1"
FT                   /translation="MRILAFCSLLLIALPLRAQVWHELPPMPTPRYAAAAAELNGYLYV
FT                   IGGIGENDALLTTVEVYDPVQGVWIHEVPQLDEPRAYATAVVLENHLYLIGGLEGDTLA
FT                   NAEATDDVLVFDPEGGWKEVASLEEERYGLAAVVFKGQIYAIGGLSREAQFFNDRLNRQ
FT                   PAPLSTIEVYDPQQDRWETVARLPQAVAFAAAALLGEDVYVIGGLSSNIPVTLIQRYRP
FT                   ATNEVIPLTTALPQEWWAGTALTYRDRILLLGGLGGARGTPLANVYALTFTSGRLEFRD
FT                   LPGLQQARFSFAAASYNDTVFVFGGLDQPEGHPLDSAEAASASILTPRESPELPADFDL
FT                   APPTPHPFREQVTFTLSVSARRSDAPVQLVVYDLLGRPIARLLDRPLPPGRHVLSWNGT
FT                   DAVGHPVPAGVYLVRLTQGPYHREHLLIRIR"
FT   sig_peptide     complement(569869..569925)
FT                   /locus_tag="Rmar_0506"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.970 at
FT                   residue 19"
FT   gene            complement(570033..571742)
FT                   /locus_tag="Rmar_0507"
FT   CDS_pept        complement(570033..571742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0507"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: dar:Daro_0438
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47409"
FT                   /db_xref="GOA:D0MEV9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEV9"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY47409.1"
FT                   /translation="MGRPERIGDLQPFAELASGPTATVYKAYQASLDRFVLLKILRPEL
FT                   AEDEAFVQRFEEEARLAARVQHPNVVAVYAFGREGPHVYFATEFVEGVSLRELLAHGPL
FT                   PPALALYIVAEVARGLKAAHEKGVLHRDLKPANILISLEGQVKLTDFGMASLLACGDGE
FT                   IRGTPGYLAPEQVLGEAPGPATDLFALGATLFEMLTGTPAFPGETPGEIFDAVLHHDPI
FT                   PRLRNLAAVPDDVVALCARLLAKRPEQRYPDAAALLQDLEELRRRPELHATAEDLAAYV
FT                   EDPTAFPRTPVPTAQPEPPAPPPARRRRRWLPATAVALLLGLGLLLRERLSVRPEHGSP
FT                   PSLTASARTTPESESLTTPPEQPPPAAGSFTATDTLASRPQPAASGSTPDRSSEPAQTP
FT                   AGTSRTPASAAAPPSRTPPRPARLRLEVTPWAYVVLERPDGHDSLGATPLEAPLTLPPG
FT                   SYTLHMHNPEFPPYRLRLTLRPGQDTLVVVSLWMQVARLWLEVHPWAHVYIDNRYHDVV
FT                   PPQQRPFILTPGLHRLRLVHPELGARDTLIQLQAGTEQTLRIDLLRRRPPER"
FT   gene            complement(571721..573208)
FT                   /locus_tag="Rmar_0508"
FT   CDS_pept        complement(571721..573208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0508"
FT                   /product="transcriptional regulator, NifA subfamily, Fis
FT                   Family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; GAF domain protein;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: GAF domain protein; AAA ATPase; KEGG:
FT                   afw:Anae109_2092 NifA subfamily transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47410"
FT                   /db_xref="GOA:D0MEW0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEW0"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACY47410.1"
FT                   /translation="MSASPTRTSLDALVEIAQTINTLRDPEAVLEKVLEIAMETLEAER
FT                   GFILLKAPQHPEGFAIRSQRNFTDQQLGELVRISTSVVHEVLRRGEPVLVYEAQQDERY
FT                   GKAESIVLQRIQSIACVPLRIKERLIGAIYLDSLSQRGRFTRDNLPFLEAFAHQAAIAI
FT                   ENAQLYQALREENRRLRSEIQRLHGFDEIVGQSPAMREVFDTMARVLDTDATVLIEGES
FT                   GTGKELIARAIHYNSERKDKPFVVVFCGSLPDELLESELFGYKKGAFTGALSDKKGLFE
FT                   VADGGTVFLDEVGDLSPRMQTALLRVLQEGEIRRVGDTQVRKVDVRVISATNKPLRELV
FT                   QQGKFREDLYYRLNTIQITVPPLRHRRGDIPLLAHHFLDKYAVKKRAHIKGFTPEALEL
FT                   LERYHWPGNVRELENTIERAVVLARGELITPEDLRLPDTDGADPFEPDLPLKEVERRVV
FT                   LRTLKRHGGNISETARVLGVSRRWLHYKLKEWDVQNA"
FT   gene            complement(573205..574224)
FT                   /locus_tag="Rmar_0509"
FT   CDS_pept        complement(573205..574224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0509"
FT                   /product="Cna B domain protein"
FT                   /note="PFAM: Cna B domain protein; KEGG: afw:Anae109_0292
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47411"
FT                   /db_xref="GOA:D0MEW1"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEW1"
FT                   /inference="protein motif:PFAM:PF05738"
FT                   /protein_id="ACY47411.1"
FT                   /translation="MSELWKRWLIVLLGPLLWAGCLGDLPRDNPLDPRSDRYKPQGRLE
FT                   GVVTRLYPPYPPLAGVAVRLLPAADSLQGGRLVYTGPNGRFAFDELPPGDYRLVAQAAG
FT                   FRALEDTLTVSITAGQTQSVTVRMNALPRFTDYTAVTVHISRWWPATDLYRLEIEATVT
FT                   DPDDVRDVVRVWLKIPALGFADTLEATQPAGRFFKALLQQELPGGSLHNLLGYALYLGA
FT                   RDRTGDTVYTPAFQLARVIEAVPVALDPRGLAAVDTTRPVLRWEPMNLPFTFTYRIDLV
FT                   RREADLDIPILTLEGLASTLDSVRVPQPLTSGVYYWMVSVVDIFGNRSRSKEAGFQVP"
FT   gene            complement(574229..574849)
FT                   /locus_tag="Rmar_0510"
FT   CDS_pept        complement(574229..574849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47412"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEW2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47412.1"
FT                   /translation="MSIRRAPIYKTVLKIALLAAVVVLNWQCRTLRAWQALRQVDFYID
FT                   RVSGVNLAGVELDHVRSYEDLTLEQTLRISQALARGTLPLRFRLHLVAENPADNPVTAR
FT                   LERLEWTLLLDDHPTLSGTLNQVYRLRPGVPQEIPLDFELDLLDFFEKNLQDLVELTLA
FT                   LAGAEGVTKRVGLEARPFIETPLGPLSYPRPIRILTREVGRTS"
FT   gene            574868..576160
FT                   /locus_tag="Rmar_0511"
FT   CDS_pept        574868..576160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0511"
FT                   /product="L-sorbosone dehydrogenase"
FT                   /note="KEGG: noc:Noc_2145 L-sorbosone dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47413"
FT                   /db_xref="GOA:D0MEW3"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEW3"
FT                   /inference="similar to AA sequence:KEGG:Noc_2145"
FT                   /protein_id="ACY47413.1"
FT                   /translation="MKSNRKIVAQWLLVLLLAGCNGINSRPVQQSLACDPDNGGITLPE
FT                   GFCALVVADNVGRARHIVVRDNGDIYVALMRLQNGHGIAALRDTSGDGRADLIAYFGDV
FT                   PGTGIDIRDGYLYFAPDTALLRYRLVEGELLPQEPPELVAGGLPERGQHAAKTFAFDEA
FT                   GYVYINIGAPSNACQSRDRQRGVPGMDPCPLLERYGGIWRFRADVLGQRQDDGLRYATG
FT                   IRNAVAIAWNPFADALYVVQHGRDQLDTLWPEYFDAEDNANLPAEEFFRVDEGDDFGWP
FT                   YCYYDPIQNKKVLAPEYGGDGQTVGRCDQFEDPIVAYPAHWAPNDLIFYDGTQFPERYR
FT                   GGAFIAFHGSWNRAPLPQAGYNVVFQPMNADGTPAGDWEVFADGFAGTDQIRSTGDAKH
FT                   RPMGLAVGPDGSLYISDSVRGRIWRVIYRGS"
FT   sig_peptide     574868..574945
FT                   /locus_tag="Rmar_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.791) with cleavage site probability 0.365 at
FT                   residue 26"
FT   gene            complement(576145..577614)
FT                   /locus_tag="Rmar_0512"
FT   CDS_pept        complement(576145..577614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0512"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   acr:Acry_3107 heavy metal sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47414"
FT                   /db_xref="GOA:D0MEW4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEW4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACY47414.1"
FT                   /translation="MPPSSRHPSFLNRLLVQSGGTLIAALALLGLLAWLAAYGWINELA
FT                   RLPLRNEIQLVASRIVRDDHLDVDAYYWDEPHHRLLERHVDPYFLQVFDARGHLIRQSA
FT                   NIRLLSDRYPEVLLHAPVQHEPFWKPLQTFQVGEYRLYYLVFPLHDPAGRYLGAIQLAR
FT                   FEPGFVALYRQLALGLFVSWVLLSGLILTLLAVSGRRVLRPLHELTRATAALSPESLHE
FT                   PIRLTSPLDRETAQLLATLNALLHRLHRAFDELRRFTANAAHELKTPLAILHGQAELAL
FT                   RRPRSTDSYRTTLRQILDQTEQMTRLVQHLLLLSRLDQPEAAFPFAPVDFSELAAREQE
FT                   LFATRARTRGVTLTASLAPDARLYGVETLLQEVVRNVLDNAVKYTTQGQIDVVVHTANA
FT                   HVLFEVRDTGIGIPREALPHVTERFYRAPQTAPDIEGHGLGLALVARIVALHQGTLEIT
FT                   SDPGQGTTVRITLPALSVTASEPTPMAQLPR"
FT   sig_peptide     complement(577495..577614)
FT                   /locus_tag="Rmar_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.688 at
FT                   residue 40"
FT   gene            complement(577618..578304)
FT                   /locus_tag="Rmar_0513"
FT   CDS_pept        complement(577618..578304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0513"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: vsp:VS_II1475 putative DNA-binding response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47415"
FT                   /db_xref="GOA:D0MEW5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEW5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACY47415.1"
FT                   /translation="MPRPILLVEDEIAMAALLRQGLEEEGYAVEWVLTGEEALARLEHL
FT                   EPALLVLDVRLPGMDGVEVCRQVRQRWPDLPVLMLTALDDVENRVRGLRAGADDYLPKP
FT                   FAFEELLARIEALLRRSKRQPTRHLLRNGPLTLDLNARTATCGERTLSLTPREFDLLAY
FT                   LMQHPRRAISRLQIYREVWGHDFDHGTSLLEVYISYLRRKLQEAGCPGYIATVRGVGYR
FT                   YEPAEG"
FT   gene            578469..579650
FT                   /locus_tag="Rmar_0514"
FT   CDS_pept        578469..579650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0514"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   hne:HNE_1715 RND family efflux transporter MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47416"
FT                   /db_xref="GOA:D0MEW6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEW6"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACY47416.1"
FT                   /translation="MRRITLTILVLMSLSACRRAPIEALLPEAIGVPPSLQADSASASY
FT                   RVVRLDTAQQRRLQVQVAPVRYERATYTVSIPGEVYPAPGLMAQVSTPIDGRVARLYVP
FT                   EGEAVQRGQVLLELESLAFAELVSAFLQAQAEEAYLARQVARLRQLVTEQLTPQSTLDQ
FT                   TEADYLRAQARRQAAEVRLRALGVTPEVAQALGQQERPLLPLRAPIDGYVDQHQVELGQ
FT                   AVSANQTLMTIVDPSRVHIRGFLAPDDALGLQPGDSVRLVLQVPDSLTLGARVHTINPA
FT                   LDPENRAVVVNILADTRQGWPRPGQNVRLWIRLRTPRPVYVVPLAALTYDGQQAIVFVQ
FT                   QAPDTYEVRPVTVWRTDAAQALLLEGVREGERVVVHPVFSLKALMRYSEFAEE"
FT   gene            579654..582797
FT                   /locus_tag="Rmar_0515"
FT   CDS_pept        579654..582797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0515"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: scl:sce8711 RND
FT                   divalent metal cation efflux transporter CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47417"
FT                   /db_xref="GOA:D0MEW7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEW7"
FT                   /inference="protein motif:TFAM:TIGR00914"
FT                   /protein_id="ACY47417.1"
FT                   /translation="MLHRLIDFSLRQRFVALSLVALMAFGGIVALERIPINSLPDVTPV
FT                   QVLIITKAGRYSPYDVEQLVSFPIETAMTGLPRVREVRSISQFGLSAVTVEFEEGTDIY
FT                   FARQLVAQRLQDVREQLPPDVSSPQLGPISTALGEIYQYVVRGDGYSLTELREIQDWII
FT                   APQLRAVPGVTEVNSFGGFVKQYEVIVDPEQLRALRLSLRDIIDAIERNNSVSGGNYLE
FT                   HNQEQYIIRGFGQIRTTDDLERIVVARRGERPIYLRDVATVRLGRQIRQGAVTQDGKGE
FT                   VVTGIVMMLRGENGREVIRRVEEKIEEINPRLPPGVRIEKFYDQSDLIARTTGTIKENL
FT                   LEGGFLVIAVLLLLLGEIKGALIVASVIPLSMLFAFIGMRAFGLAANLMSLGAIDFGMI
FT                   VDGSVVMVEHMVHRLETDRSGRSRLALLRQAAHEVARPMFFGVLIILMVYVPIATFRGM
FT                   EGILYRPMAITVASAVFGSLLLALVYVPAIATLVFRRGVRVRRNYLMDWLRPRYRRFLE
FT                   KSLNRRKTTLAVALLVFGAALALLPFLGTEFLPELDEGSILIEEVRMPSVTLETSVENA
FT                   NWLAGQLIRHIPEIQTVVPKTGRSDLANDWMGVHQTDVWIILKPRDQWRPGMTKEKIIE
FT                   QIRPFLETEPGLAYNFTQPIAMRVDELTSGVKSDIAVKLYGENLDTLAAVAARIARFLP
FT                   DLPGTDNFYVEKFAGQPYLNIEIDREAIAAFGLNVEDVQQVIEAGLGGAPAGQVFEGQR
FT                   RFDIVVRFPEAYRNNFEAIMEAPVALPGGGTIPLRRVAHIRAEEGPREIARENGWRRLV
FT                   VGINIKDIDIGTYVSNLQRAIATQVKLPPGVFLEYGGTFENQQRAMRHLYVAVPLALLI
FT                   IIGLLYLMFGEMRYPLMILSVLPLALAGGVFALWLRGMYLSISAAVGFIALFGVAVLNG
FT                   VVMIAHLNALRRQGLSVREAVLQGATDRLRPVLMTALVASLGFVPMAFNTGPGSEVQRP
FT                   LATVVIGGLITATLLTLRVLPTIYDWLERDDRPPRGPEPEWEEDGQMAAPVSAANTRT"
FT   sig_peptide     579654..579746
FT                   /locus_tag="Rmar_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.566 at
FT                   residue 31"
FT   gene            582810..584051
FT                   /locus_tag="Rmar_0516"
FT   CDS_pept        582810..584051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0516"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   dac:Daci_1714 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47418"
FT                   /db_xref="GOA:D0MEW8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEW8"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="ACY47418.1"
FT                   /translation="MLGLLLGLSLLLGNPDVAPAPDTLGIREALALALSHHPQLQALRA
FT                   RREALQGRRLQAYGIETPQLYFFREGIGSGQAFAEQGWTLVERIDFPLVTYYRLQANGL
FT                   ESRALTAELEATTARIRADVKRAYTDVLYAQELVHLRQEEVALLEQLREAVRARVAAGL
FT                   ATDLEVTRTEIQLADAQSRLETARRDFMQARYELFRVVGLDPEAQRYDIVFPDTLTYVA
FT                   VEIPQEAVLARLDQLPELHSQQAQLQAARATVRQARASLLPQLQLDVYPQDYGNGYRFV
FT                   GFQIGISLPLGFLPGYRGRVREARALYERRRWELEDLRLQLKKQAEQAWHGYETARIVV
FT                   ERYARQIRDRSRELLHRLQRGYRLGEVSLIELLDAQRLVLESEQRYYEALRDYYHQLIE
FT                   LERFLGHELTFTNP"
FT   gene            584058..584564
FT                   /locus_tag="Rmar_0517"
FT   CDS_pept        584058..584564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce3289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47419"
FT                   /db_xref="GOA:D0MEW9"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEW9"
FT                   /inference="similar to AA sequence:KEGG:sce3289"
FT                   /protein_id="ACY47419.1"
FT                   /translation="MNAAHLHLLANHLPLFAVLLGLLVGLYGAWRREESVVRVALMLFV
FT                   LAALGAVAAYFSGHGAEEIVEELGRSHDAIEAHEETGNLAAYLTIALGVLSLVTLIRRG
FT                   PVAPAWRTALFVLALVVLGVVGYAANLGGRISHPEITGAALQETTRSPVPGPEAAEEAE
FT                   EPHED"
FT   gene            complement(584575..585321)
FT                   /locus_tag="Rmar_0518"
FT   CDS_pept        complement(584575..585321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0518"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ank:AnaeK_2072 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47420"
FT                   /db_xref="GOA:D0MEX0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEX0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY47420.1"
FT                   /translation="MSTIALEVQGCSRRFRSRKGTVQALQDVTFQVPEGACCGLLGPNG
FT                   AGKSTLIRILANVLKPDAGRISVLGEPLRWGKHAYKQQVGFMLEDLALMERLTGREQLE
FT                   LAARLYGLSPEQATATIEALVAPFEVATALDRWIETYSHGMRRQLAFLLALLHRPRLLV
FT                   LDEPFEAMDAQALEAAITLLHAHHRQGATLLISSHRLDKLERLCDHLVVLHRGRVRFAG
FT                   SLADFRDHLPAAESLETAYLHWLREG"
FT   gene            complement(585318..585959)
FT                   /locus_tag="Rmar_0519"
FT   CDS_pept        complement(585318..585959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI3316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47421"
FT                   /db_xref="GOA:D0MEX1"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEX1"
FT                   /inference="similar to AA sequence:KEGG:GDI3316"
FT                   /protein_id="ACY47421.1"
FT                   /translation="MHSVHRLLFRLHRRHRFWWAAFLALALMALLLRQLGRHALEAHGT
FT                   LRLLYAIGSGMMLIAPFFEWFIDDREWLCYRLWGVDLAEVLRRKSRVLLHQQGLLALAV
FT                   LGCWTALHPASRHADLLRLAALALTALGSGPVIGLAVYPGVRRWLMQAPMIAGFIGGGA
FT                   QLLALGLALLSYLQPLLAPLLLVLCWYYGCQKFTRSAHALDQMELPVERS"
FT   sig_peptide     complement(585840..585959)
FT                   /locus_tag="Rmar_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.905 at
FT                   residue 40"
FT   gene            complement(585963..586787)
FT                   /locus_tag="Rmar_0520"
FT   CDS_pept        complement(585963..586787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0520"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fph:Fphi_0874 nicotinamide ribonucleoside (NR)
FT                   uptake permease (PnuC) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47422"
FT                   /db_xref="GOA:D0MEX2"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEX2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47422.1"
FT                   /translation="MDTIFEQCYFWSHRGWRISCIRVYRLNSSGFWLRLNYRLIGRGWS
FT                   LLGFWALVASLGIVCWLQGFMLPLFQHLNPRNTGNAATYTFSILLYGFLLLLYPVVRLS
FT                   RRTDWHPNVLFRSPRMSAHALAFFALEPGLLMLSGLYLLGLAVGLLAFFPPMQALAAVG
FT                   LTLPAVAGLLALLFAAWYRWSPRLQGRRELVALIPVMVWLLVLPNIAANLIPAVRAFVA
FT                   WLLALYRYVPLLGPYGEAMAAVLSGAPALAPTLWLLGHTAAALLIGWWASRG"
FT   gene            587160..587699
FT                   /locus_tag="Rmar_0521"
FT   CDS_pept        587160..587699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0521"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plu:plu2152 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47423"
FT                   /db_xref="GOA:D0MEX3"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEX3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47423.1"
FT                   /translation="MAIVTVPRVLREKLGEEGAEALVVLLNEALHHERNNLLGILEERF
FT                   ERRVTDEGKRLDNLITEVEARLNERITEVEARLNERITEVEARLNERITEVEARLNERI
FT                   TEVEARLNERITEVEARLNERITSVEAKLEKQIAEVEARLGERLAGVRADLIRWMFLFW
FT                   VGQIGTFVALLFAFLR"
FT   gene            587721..590057
FT                   /locus_tag="Rmar_0522"
FT   CDS_pept        587721..590057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0522"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; cadmium-translocating P-type ATPase; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: cak:Caul_2290 heavy metal
FT                   translocating P- type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47424"
FT                   /db_xref="GOA:D0MEX4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEX4"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ACY47424.1"
FT                   /translation="MADEAQEKACAELVEQSAAEADGLVQVEVDPASGRLTLTYDRARL
FT                   SAAEAERLARRLAAAFEERPARCTLHVQEQGGRSCETCALALERRLQALPGVRQARVSF
FT                   RGGVLHVVYDAAQTTPEELARVVERFGVRTLPPKPEVSWRLWLEGTRREALFVALTLAG
FT                   LVTGWLAGRLGAPLVAAVAYGVAYVFGGWDGLRNGIGALRHRTVDVDLLMVLAALGALV
FT                   IGAPAEGATLLFLFSLSNLLQHYAIGRSRRAIQALMELRPDRARVLREGQEVEVPVEEV
FT                   RVGEVFVLRPGDRVPLDGVIVRGESALDESSITGESMPVDKGPGQEVFAGTINTTGSLE
FT                   VRVTRPASASTLARMIELVEQAQSEKAVTQRLIDRLEQPYALGVLAMTALAIVISVAFL
FT                   NEPFARAFYRAMTLMVAASPCAVVISTPAAVLSAIAAGARRGVLFKGGVYVEALARVRA
FT                   IAFDKTGTLTEGRTRLVQVGARPGVGLSEDELLRLAAAVQQRSEHHLARATVAAARERG
FT                   LTISEAEGFQAVVGKGVRAVVEGATLHVGNLRYFEAAWQAADGFDEGRAAVEALARQGR
FT                   TAVLVARERDGQREVLGWLAFADRLRPGAAETIRRLRALGVAHVALLTGDNRHVAEAIG
FT                   REAGVDAVHAELLPAQKVAHVKALVDRYGAAAMVGDGVNDAPALAAATVGIAMGGAGTD
FT                   VALETADVVLMRDDLGQLPYVLALSRATRRTLLVNFAIAFGMMGLMIGAILLQGLPLPL
FT                   AVVGHEGSTVLVSLNGLRLLGFRAS"
FT   gene            complement(590058..591047)
FT                   /locus_tag="Rmar_0523"
FT   CDS_pept        complement(590058..591047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0523"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swi:Swit_1316 diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47425"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEX5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47425.1"
FT                   /translation="MTPRALLWMVLLVVAGCRTTQPVTVTLPASLPEPPTVLLPWYDGW
FT                   LLGGGKVLWWLRDKRPIHRWILPAAVQGGVVDPEGVLWLGTGAGLVRLTAPTAQPERVP
FT                   LPALNRFPSVTTLTLDAQQRLWVGTAQHGVFLRADTSWRPVLAAAPVYALATTTDGTVW
FT                   VGTGIGLFRQTSDGWLVYSEEGTANHGLPDNIVERLVALPEGLWVIMSEAVSFFPVDEV
FT                   DHPVEFAYLGHPGNRIHDVVDLPESGYLLATDDGLVWLRELPHFDTHGGLRELRVMEYD
FT                   LARPLSPASLALPDEPITRLDRRGNWLYLAGPSGLFRRLLPPAALAHR"
FT   sig_peptide     complement(590985..591047)
FT                   /locus_tag="Rmar_0523"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.798) with cleavage site probability 0.720 at
FT                   residue 21"
FT   gene            591294..593324
FT                   /locus_tag="Rmar_0524"
FT   CDS_pept        591294..593324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0524"
FT                   /product="Alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /note="KEGG: acp:A2cp1_1040 alkaline phosphatase; PFAM:
FT                   Alkaline phosphatase; SMART: Alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47426"
FT                   /db_xref="GOA:D0MEX6"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEX6"
FT                   /inference="protein motif:PRIAM:3.1.3.1"
FT                   /protein_id="ACY47426.1"
FT                   /translation="MRRTLQWALMLLLCLPASLTAQTRKHVILYIGDGHGIAPRTATRM
FT                   ALGQGRPGSRFSDEPNFHLLAQDRLRYNAMVTTHSLNSWITDSAPGASVYAVGKRGKID
FT                   NEFISLDPETFEPLETILEAAKKAGYAVGLVTTTRVTHATPAAFAAHIWNRDLEDYIAA
FT                   QYLSSSQEEYEAIFNAGPGYDPARDWVLPEPKVGVEIDVILGGGARHFLPRNNPDVNGN
FT                   ATVRDRNGQPITDGNGQPVVLSGRRSDNVDLIEIAKDRGYVYVNSRDALLGILDRLDEF
FT                   SPENDAKLLGLFSSSHRSYEAERQQLYPWEPALWEMTMVAIEVLKRKSDKGFFLVVEGG
FT                   RIDHLEHANAGGIGYEGDRYTVVADVEAIIADDVYGGGTDRLAGVYGSDYMIKEVLDFD
FT                   YAIEEGLNFMNDATAGQTLILSTSDHECGGFTVVGLHDAEDAQGNGTLIRTYARQPEKT
FT                   DGQFTPVPENIDRGDDEIGGWFPEYELVEFQGKLWPEPAGPNARRIVIAYGSNPLVNGN
FT                   GGTIGTTPGNHTPQDVWVGADDNVDGAFASRITGRGLLDNTDLFPIMRDFLGVTTTSNE
FT                   RLPDEKRSGLGAVEAYPNPFGEKLAVTLAIDRPQTVSLEVYNALGQRVRVLQPSAQLTP
FT                   GTHTIAWDGRDDTGASVASGLYLVVARSGEQVVSRQVVRIR"
FT   sig_peptide     591294..591359
FT                   /locus_tag="Rmar_0524"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 22"
FT   gene            complement(593398..595227)
FT                   /locus_tag="Rmar_0525"
FT   CDS_pept        complement(593398..595227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0525"
FT                   /product="glycoside hydrolase family 9"
FT                   /note="PFAM: glycoside hydrolase family 9; KEGG:
FT                   aba:Acid345_0426 glycoside hydrolase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47427"
FT                   /db_xref="GOA:D0MEX7"
FT                   /db_xref="InterPro:IPR001701"
FT                   /db_xref="InterPro:IPR004197"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEX7"
FT                   /inference="protein motif:PFAM:PF00759"
FT                   /protein_id="ACY47427.1"
FT                   /translation="MLLALLLIFGIVLDTTFTPRILTDHVGYEIHGPKQALLQGPASLQ
FT                   PTTCALYRENAPEPVASLMPEPLGRVADWPAWYFWRLDFSDVTAPGFYRLRCETKQGPV
FT                   TSFPFELRENLLERRTLSDVLFYFKSQRSSGRYDRADRCRPFEGGFRKGCVDVHGGWYD
FT                   ATGDYGKHLSHLSFSTYFNPQQTPLVVWALLETYRLLTERNDPNFHQYRIRALDEALYG
FT                   ADFLVRMRDPYGSFFRSVAAPGPEKRPEDRVIAATRAAYALADATTRTKQEQVLAVNDS
FT                   IALYDVSYRAGGGLAIAALARASTLPVHGDFDQATYLQAAEAAFAFLEQHNRQLTNDGR
FT                   ENILDDYSALLAATELYRATGNPHYREAADRRADRLMARLTAWESYSDYWRADDTDRPF
FT                   FHPSDAGLPVVSLLNYLTVADSSRHAAVLEVVRRSLRFELAITREVVNPFGYARQLVQD
FT                   TTGRRYSAFFFPHNTEAAPWWQGENARLASLAAAARMAAPYFAADTAFYRALQQYAWDQ
FT                   LHWILGRNPYDVCMLKGVGRNNPEYLFFNSYAYTNAPGGISNGITGGLEGPGGIAYNLG
FT                   YAVTGQDTDWRWTEQWLPHAAWYLYAIALPHAW"
FT   gene            complement(595365..596996)
FT                   /locus_tag="Rmar_0526"
FT   CDS_pept        complement(595365..596996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0526"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   gme:Gmet_1677 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47428"
FT                   /db_xref="GOA:D0MEX8"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEX8"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACY47428.1"
FT                   /translation="MQPLLHREAFLERLRKQEQWDVLIIGGGATGLGVALDAAARGFRT
FT                   VLFEQHDFGKGTSSRSTKLIHGGVRYLREGDLGLVREALRERARLRHNAPHLVWPRLFV
FT                   VPCYRWWERPFYGIGLWLYDRLAGKGRLGLTRRLDAVETHALLPTLRQNHLRGGLAYPD
FT                   GQFDDARLLVHLAWTAAEHGAVVLNYMPVEALMGTRSHLEGVVVRDLDSGERFEVRGRV
FT                   IVNATGVFADTVRRMDNPNATPLIVPSQGVHLVLPRRFLPGEAALLIPRTDDGRVLFVI
FT                   PWHGQVLLGTTDEPVPNPELEPLPTEEEITYLLTHAGRYLEPAPTRADIRAVFAGLRPL
FT                   VQRGGMQEDTAHLSREHVLLVSRRGLVTVTGGKWTTYRLMAEETVDRALEVGGLPHRTS
FT                   PTATLRLHGATRHVNVADPWHVYGTDARHLRRLMEAEPELAAPLHPRLPYRMVEVVWAA
FT                   RYEMARTVEDVLARRTRALFLDAAAALEAAPAVARRLAAELGRDSAWVNAQLRDFVALV
FT                   RRYVPDLHTHDPNDTSRSEQTAPRRD"
FT   gene            597093..600038
FT                   /locus_tag="Rmar_0527"
FT   CDS_pept        597093..600038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sde:Sde_1755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47429"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="InterPro:IPR031924"
FT                   /db_xref="InterPro:IPR041437"
FT                   /db_xref="InterPro:IPR042301"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEX9"
FT                   /inference="similar to AA sequence:KEGG:Sde_1755"
FT                   /protein_id="ACY47429.1"
FT                   /translation="MLSQMRALLLLLTGLLLIESAPAQPLSSYVQDTCPDDCFALAENG
FT                   RVVSIVASRADDPVVLRAIEDLAADLERVTGRRPVVHYDTWPAEPSLVVGSLAHSPLIR
FT                   ELVETGQLAPGEIEGRWEAFLLQVVPDVRGADRLVIAGSDPRGTVFGIYDLSRAMGVSP
FT                   WYWWADVPVPHRPALYVARTLRRTDYPRVRYRGLFINDEAPALSGWAYEKFGGFNHRFY
FT                   ARVFELILRLKGNFLWPAMWGRSLFEEDSLNIPTAARYGIVIGTSHHEPMLRAHVEWQW
FT                   HGKGPWDYTKNAATLQAFWREGIRRMKHNEAIVTVGMRGDGDEPMSEETAIELLERIIR
FT                   DQRRILAEETGRDPSEIPQAWTIYKEVQDYYEKGMRVPEDITIVFTDDNWGNVRLLPPP
FT                   GSPPRKGGYGMYYHFDYVGAPRSYKWINTVQIERTWEQMRLTYRHGVDRIWVVNVGDIK
FT                   PMELPLTFFMDMAWDPERFTAADLPRYYERWAAEQFGPRYAAEIATLLATYTKYNARRK
FT                   PELLDADTYSLHHYREFARVVADYRALAARAQALFSRMPAAYRDAFYQLVAYPVMASAN
FT                   LYEMYHALALNRLYARQRRAATNRMAEKVRRLFARDAELAAYYNHVMGAGRWNHMMDQP
FT                   RIGYTSWDDPDENIMPEIETIAVPDTALPAVAVEGQPDTWPGPDVPAALPVFDDLTRPV
FT                   HYLEVFNRGRQPFRFRIQTESPGLAFSATEGEVTEQQRIQVTVDWAQVPPGAAQLVFYV
FT                   EGPGMRVPVVAPLERIVDRIPPDFEGFVARDGHLAIEAHHFSRQVSAGEARWEVIPNLG
FT                   RTASAVTPLPVTMRAQAPGADSPRLEYDVLLPAPGRIRVHLYLAPTYNFVNRPGGLRLA
FT                   VSLDDAPPQLLEVHAADTIPDWRYGRVWMDAVASNVRIVTSEHEITRPGPHTLKLWAVD
FT                   GGVVVERIVIDTGGLRPSYLGPPESPFVRNRRTHWPPEPEAGSAYPARDTR"
FT   sig_peptide     597093..597179
FT                   /locus_tag="Rmar_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.876) with cleavage site probability 0.540 at
FT                   residue 29"
FT   gene            600422..600937
FT                   /locus_tag="Rmar_0528"
FT   CDS_pept        600422..600937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0528"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: [2Fe-2S]-binding domain protein; ferredoxin;
FT                   KEGG: rce:RC1_1076 carbon monoxide dehydrogenase small
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47430"
FT                   /db_xref="GOA:D0MEY0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEY0"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ACY47430.1"
FT                   /translation="MRHTIQVTVNGQTHRVEVEPRLLLVELIRDVLGLTGTHVGCDTSQ
FT                   CGACTVHVNGEAVKSCTMFAVQADGCEITTIEGLARDGALHPLQEGFWQEHGLQCGFCT
FT                   PGIIMAAADLLRRNPDPSEEEIRHALEGNFCRCTGYHNIVRAIQYAAARMRGEAVVPRG
FT                   EAASTGAS"
FT   gene            600977..603349
FT                   /locus_tag="Rmar_0529"
FT   CDS_pept        600977..603349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0529"
FT                   /product="Carbon-monoxide dehydrogenase (acceptor)"
FT                   /EC_number="1.2.99.2"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead; KEGG: rce:RC1_1075 carbon
FT                   monoxide dehydrogenase large chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47431"
FT                   /db_xref="GOA:D0MEY1"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEY1"
FT                   /inference="protein motif:PRIAM:1.2.99.2"
FT                   /protein_id="ACY47431.1"
FT                   /translation="MEARGYIGAPIRRVEDRRFVTGRGRYTDDIVLPGMLYAWIVRSPH
FT                   AHARIRAIRTEKARQHPGVVAVFTGKDLLDDGVGSLPTGWQIGPDMKEPPHYALAVDKV
FT                   RYVGDGVAVVIAETKAAARDAAELVEVDYEELPAVVDAAEALKEGAPLVHDDAPGNLCY
FT                   VWELGDREATDRALAAAHHVTKLEFVNQRLIPNAIEPRSAIGHYDPGRDELTLYTSSQN
FT                   PHLIRLLLSAFVLKIPEHKVRVISPDVGGGFGSKIFHYPEEVICAWSSRKLGRPVKWTA
FT                   VRSESFMSDAHGRDHVTTAEMGFDRDGRIVGLRVRTIANLGAYLSTFAPGVPTWLYGTL
FT                   LAGQYKTPHIHVEVKGVFTNTTPVDAYRGAGRPEATYVVERLVELGAHELGIDPAELRR
FT                   RNFIQPDEFPYQTPVVLQYDSGNYEGALNKALEMADYWKLREEQKRAREQGRLIGIGLS
FT                   CYIEACGLAPSKVAGAIGVRAGLYESAAIRVMPTGKVQVFTGTHSHGQGHETTFAQIVA
FT                   HELGIPLEDVEVIHGDTAEIPFGMGTYGSRSLATGGSAIYRALEKIKAKARKIAAHKLE
FT                   VAEEDLEFRNGQFIVKGTDRAIGFGDIALTAYVPHDYPEGLEPGLEENAFYDPANFTFP
FT                   FGTHLSVVEVDPETGRVKLLRYIAVDDVGRIINPMIVEGQIHGGVAQGVGQALLEGAVY
FT                   DRSSGQLLTGSLLDYALPRADDLPSFEVGHQETPCPHNPLGAKGAGEAGTIAATACVVN
FT                   AVVDALYHLGVRDIRMPLTPERVWRAMRGLPTDGHAS"
FT   gene            603374..604243
FT                   /locus_tag="Rmar_0530"
FT   CDS_pept        603374..604243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0530"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG:
FT                   bxe:Bxe_C0029 carbon monoxide dehydrogenase, medium
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47432"
FT                   /db_xref="GOA:D0MEY2"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEY2"
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /protein_id="ACY47432.1"
FT                   /translation="MIPQTFAYRKAHTIDEALALLREHGDEAKVLAGGHSLIPLMKLRL
FT                   STPELLVDIGGIRELTEIRERDGRLELGALVTHRTIEFSELLRQKCPVLPEAAAQIGDP
FT                   QVRNKGTIGGSLAHADPAADYPAVVLALDAEIEATGPDGRRTIPARDFFQGLFTTALRP
FT                   GELLTRVRVPVMPPRSGAAYLKFPNPASRYAVVGVAAFVKLAPDDTCAEVRIGITGAAA
FT                   AAFRATEAEKRLVGKTIDERTLAASLEDMVDPDDLLSDLAASAEYRAHLCHVLARRALR
FT                   QAFERARG"
FT   gene            complement(604307..604678)
FT                   /locus_tag="Rmar_0531"
FT   CDS_pept        complement(604307..604678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nis:NIS_1760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47433"
FT                   /db_xref="InterPro:IPR022285"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEY3"
FT                   /inference="similar to AA sequence:KEGG:NIS_1760"
FT                   /protein_id="ACY47433.1"
FT                   /translation="MPVEVTPQPVDLDQRALQVFLKAIELAGGPRGLLERKRLTWLPSL
FT                   MEAAYAVVLEAEHHRSVDEIARFLGLSTAATRNLLRASTEAVRERLEQEEPSERNVHIA
FT                   GGLARLAYEALQREAARAG"
FT   gene            complement(604681..605586)
FT                   /locus_tag="Rmar_0532"
FT   CDS_pept        complement(604681..605586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0532"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /note="PFAM: Circadian clock protein KaiC central region;
FT                   KEGG: nis:NIS_1761 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47434"
FT                   /db_xref="GOA:D0MEY4"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR022373"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEY4"
FT                   /inference="protein motif:PFAM:PF06745"
FT                   /protein_id="ACY47434.1"
FT                   /translation="MAGAVSREAGPLVEAIVSLRHAAAAAPPLEGVPTGVEGLDELFFT
FT                   TEWREGRPVRKPLGGIPRYAVLQVTGVADTGKSLLVEQFAVAQARHGQVCLFLTTESPA
FT                   PFVAMGLRTRAAAMGADWNAIEDRIVLVDAATHTILTQDLPTLFNTLAHAIKTYHVRAV
FT                   VIDSITGLYEAREMLARDVVRPIFTFLKKWHQTALLVSQKRSGHELLTAEAAGGYAVGH
FT                   ILDGTLVLAKQPITSAQQARLYRVPIGETVRLFRIDGCRLCGHDTSTHLLEITPTGLVR
FT                   IGPSLQTFHQEASVEPNYQT"
FT   gene            complement(605677..606771)
FT                   /locus_tag="Rmar_0533"
FT   CDS_pept        complement(605677..606771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0533"
FT                   /product="protein of unknown function DUF43"
FT                   /note="PFAM: protein of unknown function DUF43; KEGG:
FT                   rpd:RPD_3346 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47435"
FT                   /db_xref="GOA:D0MEY5"
FT                   /db_xref="InterPro:IPR002723"
FT                   /db_xref="InterPro:IPR014435"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEY5"
FT                   /inference="protein motif:PFAM:PF01861"
FT                   /protein_id="ACY47435.1"
FT                   /translation="MPHTKTFPETSAVELRDRLLETVRQQMPVPFTERDAERALAALLT
FT                   TDNLWEAIRLSRVPLRVLSAFWHRLIAEGLLEAHDGALRLTESGQALAQALGVAPVREA
FT                   TCVHCEGRSVDYRTLPEDVVERFAEICRHRPEAIQDYDQGFVTEATTLARIAFAWHRGD
FT                   LEGKQLLVLGDDDLMSIAAALTGAPAYVLAVDIDDRLIQFINDVARREGLDRLEAVRYD
FT                   LREPLPTSWLRKFDTFMTDPTESFLGFKTTIERGLLALRGPGCAGYFGLTHVESSYEKW
FT                   AQIQRFLLDSGVVLTDLIDDFSAYVNWGYIESMRSWEWLPTHRLPERPWYYSALHRIEL
FT                   LRTPALENAAVEGDIFTDEEAATT"
FT   gene            606982..607479
FT                   /pseudo
FT                   /locus_tag="Rmar_0534"
FT   gene            complement(607496..607891)
FT                   /locus_tag="Rmar_0535"
FT   CDS_pept        complement(607496..607891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0535"
FT                   /product="HIRAN protein"
FT                   /note="PFAM: HIRAN; KEGG: gsu:GSU0050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47436"
FT                   /db_xref="GOA:D0MEY6"
FT                   /db_xref="InterPro:IPR014905"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEY6"
FT                   /inference="protein motif:PFAM:PF08797"
FT                   /protein_id="ACY47436.1"
FT                   /translation="MFTRRAFLKTLVALGLWPGVTDSGRRARSVVLLETWVAGFRYHQG
FT                   PRVQHRLRVGQPLVLRREPANPYDDRAIALYTGDGVKLGYVPRVDNSVLATMLDQGVPL
FT                   KAVITDVACEAPPWERVRFRIKMAWGG"
FT   gene            608068..610332
FT                   /locus_tag="Rmar_0536"
FT   CDS_pept        608068..610332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0536"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: sal:Sala_1014 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47437"
FT                   /db_xref="GOA:D0MEY7"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEY7"
FT                   /inference="protein motif:PFAM:PF01915"
FT                   /protein_id="ACY47437.1"
FT                   /translation="MRTLRLLTLSLLWSGWLLPAIAQVDRAREDSLIEALLARMTLEEK
FT                   LGQLTLYNGGMAETGPVVREGEPDAIRRGRVGAVMNFFGAEAVCAMQRQAVEESRLGIP
FT                   LLFALDVIHGFRTIFPVPLAEAATFDPALVEQAARVAAGEASAVGLNWTFAPMVDIARD
FT                   ARWGRIVEGSGEDPYLGAVMAAARVRGFQGRDLRDPTTILATAKHFAAYGAAEAGRDYN
FT                   TVDVSERTLREVYLPPFEAAVRAGALSIMSAFNEIGGVPATADRWLLTDVLRHEWGFEG
FT                   LVVSDYTSVWELLFHGIAADSAEVGRKALEAGVDMDMVSGIYVRKLAEEVRAGRLSEAV
FT                   VDEAVRRVLRVKYRLGLFEDPYRYCRDASREQVLLSPAHRRLAREVARKAIVLLKNEGE
FT                   LLPLADTLQRVAVIGALANDSASVLGPWAAAGRPEDAVTILEGIRAALPGATVRYAPGY
FT                   AEVPSGSFQEMVAAALSPDTSGFAEAEAVARWAEVVILVLGEHRELSGEAASRASVELP
FT                   GVQLALAWRLLALGRPVVVVLMNGRPLAIPELAASAPAIVEAWFLGTEMGHAVADVLLG
FT                   KASPGGRLPVSFPRATGQEPLYYNHKPTGRPPRAEEKYTSKYVDVPWTPLYPFGYGLTY
FT                   TTFAYDSLRLSRRRLGLDDTLEVVVSVTNTGRRRGEEVVQLYVRDEVASVTRPVKELKG
FT                   FARVELAPGETKAVQFRLPVRALRFWGLEGGWVVEPGWFTLWVGPSSAEGLQARFEVVS
FT                   P"
FT   sig_peptide     608068..608136
FT                   /locus_tag="Rmar_0536"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.968 at
FT                   residue 23"
FT   gene            complement(610322..610966)
FT                   /locus_tag="Rmar_0537"
FT   CDS_pept        complement(610322..610966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0537"
FT                   /product="Ferric reductase domain protein protein
FT                   transmembrane component domain protein"
FT                   /note="PFAM: Ferric reductase domain protein transmembrane
FT                   component domain; KEGG: sus:Acid_7537 ferric reductase
FT                   domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47438"
FT                   /db_xref="GOA:D0MEY8"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEY8"
FT                   /inference="protein motif:PFAM:PF01794"
FT                   /protein_id="ACY47438.1"
FT                   /translation="MRRLSPWLNVLVWLGVAAPLLYLSWGLWTDRLGANPIQEITHQTG
FT                   RWTLRFLLATLAITPLRRLTGWNGWIRWRRRLGLAAFFYASIHLLLYLWLDQFFDWGEI
FT                   GRDILKRRFITVGLLAYGLMVPLAMTSTAGWIRRLGGRTWRRLHRLVYAIAVLGVLHYW
FT                   WAVKFDWRPPLAYGLILLALFLLRLRRPRVGRIDATALPRRTAAPVGDPTD"
FT   gene            complement(610966..611913)
FT                   /locus_tag="Rmar_0538"
FT   CDS_pept        complement(610966..611913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0538"
FT                   /product="oxidoreductase molybdopterin binding protein"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   tgr:Tgr7_1503 oxidoreductase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47439"
FT                   /db_xref="GOA:D0MEY9"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEY9"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ACY47439.1"
FT                   /translation="MLIRTETPIPSSEITDERLYWNRREWLRQAGLLAGAAVAGLLTPG
FT                   CRAEGKQVRRKSNPGPYDTDEPWTSYEDITTYNNFYEFGTGKRDPARNAHRLRTRPWTI
FT                   RVEGLCHRPATYELEDFIKPYTLEERVYRLRCVEGWSMVIPWLGFPLAEVLRRAEPMSS
FT                   AKFVEFTTLYDPEQMPGQKAPILDGPYVEGLRLDEALHPLTILAVGLYGKMLPNQNGAP
FT                   IRLVVPWKYGFKSIKSIVRIRFVEKQPITTWMKAAPHEYGFYSNVNPNVDHPRWSQKTE
FT                   RRIGEFRKRKTLLFNGYAEQVAHLYEGMDLRKYF"
FT   gene            complement(612005..613090)
FT                   /locus_tag="Rmar_0539"
FT   CDS_pept        complement(612005..613090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0539"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bsu:BSU40480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47440"
FT                   /db_xref="GOA:D0MEZ0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEZ0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACY47440.1"
FT                   /translation="MGPLIPHLQHDLSLSHAAVGLLTTLPLLAFGLGSFGASRLAARFG
FT                   MARVLLLSMVLLTVGELVRPFPAPFYLFTGTLLVGAAIAVNNVLLPAVVKESFPARLGV
FT                   LTGLYLATMHLMASLASGLSVPMAESWGLGWEGALRCWALLAFVAALLWIPPARRAPIT
FT                   TSPESTRRTLPWRSALAWQVTLFMGLQSFFFYCMITWIPALAQDRGFSATTAGWILFVF
FT                   LLAQLPLLFITPVLAERRPHQQSLALAAGLLTIAGVVGFMIGKGVVLWSAAILAGAGAG
FT                   MGFSLAMTLFPLRTRTPLRAADLSAMAQAIGYLLAAVGPTAFGFLYDQTHRFATSLWML
FT                   LGITLLMLGFGVAASRPRFVD"
FT   gene            complement(613209..613967)
FT                   /locus_tag="Rmar_0540"
FT   CDS_pept        complement(613209..613967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0540"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   gsu:GSU2415 lipase/acylhydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47441"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEZ1"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ACY47441.1"
FT                   /translation="MYRFDLLITGLTDSVLKLLLLPLLMLLAACGGAPEPPRSEASPDT
FT                   TAPAVRNTARAERTINVLVLGNSLAAGYGLSPDEAFPAVLQRKVDSLGWPVRIINAGLS
FT                   GETSAGGLRRIEWLLRERIDVLILELGANDGLRGIDPEVTRRNLQGIIDKVRARYPDAD
FT                   IILAGMQLPPNLGPDYTAAFRAIYPELARANDAHLIPFLLEGVGGVPELNQADGIHPTA
FT                   EGQRIVAENVWRVLRPVLERQLSRPTRNAS"
FT   gene            613983..614684
FT                   /locus_tag="Rmar_0541"
FT   CDS_pept        613983..614684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0541"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: reu:Reut_A1385 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47442"
FT                   /db_xref="GOA:D0MEZ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEZ2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY47442.1"
FT                   /translation="MLQVAHLTKTYRSGTRTLTVLQDVSFSVAEGEICAVVGPSGSGKT
FT                   TLLGLCAGLDLPTAGKVWLDGQDLTVLDEDARAALRNRLVGFVFQTFQLLPTLTALENV
FT                   MVPAELRGDRTARRRAIELLERVGLGDRLHHYPRQLSGGEQQRVALARAFINRPRILFA
FT                   DEPTGNLDAETGAVVEDLLFELNATAGTTLVIVTHNLELARRTGRILHLRAGRIVADEP
FT                   VHATTSATRHG"
FT   gene            614677..617208
FT                   /locus_tag="Rmar_0542"
FT   CDS_pept        614677..617208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0542"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   sus:Acid_1832 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47443"
FT                   /db_xref="GOA:D0MEZ3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEZ3"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACY47443.1"
FT                   /translation="MAEPRTGTLRWALRMAWRDSRGSRRRLLLFLSAMVLGLAALVAIS
FT                   GVGGNLRRAVDEQARQLLGADLRLEREAPFGELEALIDSIGGRQTRVVSFPSMVYFPRT
FT                   SRVRLASVRAVAGTWPLYGRLQTDPPEAAARYLQEGGALVDGTLLDAYGARVGDSVRVG
FT                   RRSYPILGRLLATPSESAAMALAAPRVYIPLAGIDTLLLGFGSRAEYAVYFRFDDGRDA
FT                   EALGDRLRQELRPLRVRVDTVEEIREDWDEALTNLYRFLGLVGFIALILGGIGIASAVH
FT                   VYVRQRVDAVAVLRCLGATPAQTVAVYLLQALAMGLVAGVAGTLLGLGLQALLPRLLAE
FT                   FLPVAVPLHIEPAAVGLGLLSGPAITLLFALLPLLPVRRVTPLRALQASVDPVPAGRDP
FT                   LRWLAWLLLAGGLTAFAMLQAPAPAIGAGYAVGLMLVFGALTLLARGLMRLLRRVVPDR
FT                   WPYVFRQGLANLYRPHNQTLVLMLALGLGTFLVVLVLLVERTLLAQVRLAGGGERPDLV
FT                   FFDVQPDQRDSLIALVEAHGAPVLETVPIVTMRLAAVNGRRIEALRADTTVRLSWAFRR
FT                   EYRSSYRDYLTDTETLLAGTFTPSVPPGTAVPPVSLEEEIAAELGVTLGDTLVWNVQGV
FT                   EIPTVVGSIRRVDWRRFRTNFFVLFPRGVLEEAPQMFVLLVRAGEASPRIQRAAVEAFP
FT                   SVSAIDLQLILNVADEIFGRVGLVLQFMALFSVLTGVIVLLGAIAVTRVAREEETVLLK
FT                   TLGASRRQVLQITAVEYGLLGLLAATVGLVLAVGAAALLAGLVFEAPPVWTPDVLVAAL
FT                   LSAVVLTLGVGLLGNRRVYGRPPLDVLRAAG"
FT   sig_peptide     614677..614814
FT                   /locus_tag="Rmar_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.524 at
FT                   residue 46"
FT   gene            complement(617284..617844)
FT                   /locus_tag="Rmar_0543"
FT   CDS_pept        complement(617284..617844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47444"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEZ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47444.1"
FT                   /translation="MGRCGYLIALLTGLLAGCGGTREIVMAPPRPAAPGMPDTTAVPAR
FT                   LSLTVAADSVLPPPFQALTLTLHPLALRRADGHRQPLPFARRTLTFSATTPRTWTLLEA
FT                   APVPPGRYDTLWIRLSDVSVRFGPNAGGTLTVETDTLALPVTLTLDPDRAHSYRLLFEL
FT                   RRSLQAEPDCRWRFVPRMHLEVR"
FT   gene            complement(617823..618518)
FT                   /locus_tag="Rmar_0544"
FT   CDS_pept        complement(617823..618518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cak:Caul_3171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47445"
FT                   /db_xref="InterPro:IPR012808"
FT                   /db_xref="InterPro:IPR015996"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEZ5"
FT                   /inference="similar to AA sequence:KEGG:Caul_3171"
FT                   /protein_id="ACY47445.1"
FT                   /translation="MTIPYDFPPFPGFRPEALDFLRALKQHNRREWFKPRKAIYEDEVR
FT                   WPMQCLVADVGRELARRGLPLRGDPELGLFRIYRDTRFSKDKRPYKTHIGAVLSRTGSR
FT                   RDLGVVYIHVEPGESFLGAGFWKPDATFLRRWRRKMVQESEAFLEIVHQLRAHGLTLET
FT                   DTALKRMPRGFEEAADSPVAEYLRWNSFLVSQDVPDEAVRHPEFAQTVLRFAEIVLPLL
FT                   EFGWDAADT"
FT   gene            complement(618515..619717)
FT                   /locus_tag="Rmar_0545"
FT   CDS_pept        complement(618515..619717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0545"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: bha:BH1613 N-acyl-L-amino acid amidohydrolase;
FT                   TIGRFAM: amidohydrolase; PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47446"
FT                   /db_xref="GOA:D0MEZ6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEZ6"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACY47446.1"
FT                   /translation="MLREIQALSEEIFPEVVRLRRTIHANPELAFEEYETARLVVETLQ
FT                   PLGLELQTGVARTGVVATLRGAESGPTVLLRADMDALPIPEENDFDFRSRNPGKMHACG
FT                   HDAHTASLLGTAMILSRLRDRLRGQVRMVFQPSEEKLPGGAQAMIREGVLEASDGIPAP
FT                   AVVFAQHVQPDLPVGTIGVRSGMYMASADELYITVRAEGGHAAAPHRLAADGVLVAAHI
FT                   IVALQSVVSRNAPPDVPTVLSIGRVLAEGATNVLPPTVRMEGTFRAMDEDWRFRAHALI
FT                   RRVVEQTARAFGAEADVEIVVGYPALYNHEEPTALVREAAREYVGPERVVELEPWFASE
FT                   DFAYFLQQRPGCFYRIGTGNPEKGIVYGLHTPRFTIDEEALRIAPGFMAYLTWRYLQSA
FT                   A"
FT   gene            complement(619728..621467)
FT                   /locus_tag="Rmar_0546"
FT   CDS_pept        complement(619728..621467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0546"
FT                   /product="peptidase M28"
FT                   /note="PFAM: peptidase M28; peptidase M20; KEGG:
FT                   sus:Acid_6315 peptidase M28"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47447"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEZ7"
FT                   /inference="protein motif:PFAM:PF04389"
FT                   /protein_id="ACY47447.1"
FT                   /translation="MRQRIARTFFGVLLACWPLLSQAQSQRPAPTPTVFDQPALVQRYQ
FT                   TTITPEDLAAHLFIVASDYFEGRETTTRGQKLAAYYLASQYRKLGLEPAGTLKPDHPYA
FT                   PEAYFQPFTVYGQRLQEAHLIAVQGADTLAALAFGPEQADPNGYLWLGVRPESTGELVF
FT                   GGYGIADPELGYNDYAALAADSIDLVGRWLLILADEPLANDSTSLLTPDGRPSRWTTQP
FT                   FLKLRRALEAGVAGVILVGDRSPQADEPLAERAARAALRARTSVGRLSLTPPQQGGFQL
FT                   PPIWVVSSQVADALLAPSGRTIAELQQQLDESRQPVVFAVPAVTIHGRLVQETYQAQTE
FT                   NVLAYIEGADSLLKHEVVVLSSHYDHVGVDPTAEGDGIYNGADDDGTGTVALLEIAEAF
FT                   MQAARDGYPPRRSILFLHVSGEEKGLLGSAYYTDHEPVFPLEQTVTNLNIDMIGRHDPT
FT                   REGDSNYVYIIGSNLISQELHEINLRVNEITGTRLVLDERFNSKDDPNRFYARSDHWNF
FT                   GKHGIPFIFFFTGTHEDYHGVDDEPHKIDYDRMARIVRLIFGTAWQVANQDNRPAVTGT
FT                   GFN"
FT   sig_peptide     complement(621396..621467)
FT                   /locus_tag="Rmar_0546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.974 at
FT                   residue 24"
FT   gene            complement(621668..622600)
FT                   /locus_tag="Rmar_0547"
FT   CDS_pept        complement(621668..622600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0547"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; SMART: von
FT                   Willebrand factor type A; KEGG: afw:Anae109_4421
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47448"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEZ8"
FT                   /inference="protein motif:PFAM:PF01882"
FT                   /protein_id="ACY47448.1"
FT                   /translation="MARPTALQYLDPAVLSRLKNMELRARLIVEGFITGLHRSPYHGFS
FT                   VEFAEHRPYNPGDELRHIDWKVYGKTDRFYVKQYEEETNLRHYVVLDTSPSMRYRYRAP
FT                   LTKLEYGAYLAAALHFLMLRQRDATGLIAFDERVHTLIPPKSKPGYLHTLLAHLERLVR
FT                   LEDAETRRTAVASVLHEVAERIHRRSLVVLITDLFDNRAAHDELLRGLRHLRHRGHEVL
FT                   VFHVLEGATERRFELPDRPLRLFDVETGEEMTLHPAQFRDAYVQAVQAFTEQFRRRCLE
FT                   HRIDFIELDTGQPYDTALLAYLNKRQRLR"
FT   gene            622712..623020
FT                   /locus_tag="Rmar_0548"
FT   CDS_pept        622712..623020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0548"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: ppd:Ppro_1148 DNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47449"
FT                   /db_xref="GOA:D0MEZ9"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D0MEZ9"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ACY47449.1"
FT                   /translation="MEARIPELEKLRQQLRALLPELRARFGVVSLALFGSYVRGQAGAE
FT                   SDLDVLVELDDRPFSLLQFVELEQWLSDRLGVRVDLVEKRALKEELKAFILQEAVPI"
FT   gene            623227..623439
FT                   /locus_tag="Rmar_0549"
FT   CDS_pept        623227..623439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_7064 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47450"
FT                   /db_xref="InterPro:IPR019239"
FT                   /db_xref="UniProtKB/TrEMBL:D0MF00"
FT                   /inference="similar to AA sequence:KEGG:Acid_7064"
FT                   /protein_id="ACY47450.1"
FT                   /translation="MRTSIEIDDELMRKVLRVTGLKTKREAMELGLRTLLRLKQQERIK
FT                   DFRGKLRWEGDLDVLRTDRPEHDRG"
FT   gene            623426..623818
FT                   /locus_tag="Rmar_0550"
FT   CDS_pept        623426..623818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0550"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   cak:Caul_0838 PilT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47451"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D0MF01"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACY47451.1"
FT                   /translation="MIVVDSSVWIDYFNGRATPQTDRLDALLGVEPLAIGDVMLVEVLQ
FT                   GFCREADYQTARSLLLSLTVFEMPGVSYALCSAENYRRLRRQGIPIRKTIDVIIATYCI
FT                   EEGHALLFSNRDFLPLVEHLYLQAVV"
FT   gene            623870..624190
FT                   /locus_tag="Rmar_0551"
FT   CDS_pept        623870..624190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0551"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: noc:Noc_2535 DNA polymerase, beta-like region"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47452"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:D0MF02"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ACY47452.1"
FT                   /translation="MNATRSKLPFHAEIDLAEVRRILREHLSGLPVRIYLFGSFARGTP
FT                   HRGSDIDVAVWSEQPIDRERWIALRDALESANILFRVDLVDLSEVDPVFRERVFREGIP
FT                   WN"
FT   gene            624187..624594
FT                   /pseudo
FT                   /locus_tag="Rmar_0552"
FT   gene            624669..625247
FT                   /locus_tag="Rmar_0553"
FT   CDS_pept        624669..625247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0553"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: bha:BH2541
FT                   pyrimidine regulatory protein PyrR"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47453"
FT                   /db_xref="GOA:D0MF03"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D0MF03"
FT                   /inference="protein motif:PRIAM:2.4.2.9"
FT                   /protein_id="ACY47453.1"
FT                   /translation="MEAQDRIKAQLMDAADLDRTLERMARQIIERAALDAGGEEKLALV
FT                   GMQTRGVYLARRLQEKIRKAAGLEVPVGILDVTLYRDDVRLRAHQPVVRPTHIPFDVTG
FT                   RHLVLIDDVIYTGRTARAALDALMDLGRPAAVYLLVMIDRGLRELPLCPDIVGRQVPTL
FT                   PGEEVRVRLREVDDREGVWLVETASTPTP"
FT   gene            625367..625729
FT                   /locus_tag="Rmar_0554"
FT   CDS_pept        625367..625729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47454"
FT                   /db_xref="UniProtKB/TrEMBL:D0MF04"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47454.1"
FT                   /translation="MTRWQSLARWIGRLGLLLMLAVAGCGKDEPSESPVKVEDFRYQEL
FT                   PGGTRIVTGVVRNLTDQPLANLQLEIGLYDRHNRLIGTMQVPVQDVPPKGRKRFRQPLD
FT                   TDQDVHGARVRSVLVL"
FT   gene            625733..626236
FT                   /locus_tag="Rmar_0555"
FT   CDS_pept        625733..626236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0555"
FT                   /product="carbohydrate kinase, thermoresistant glucokinase
FT                   family"
FT                   /EC_number="2.7.1.12"
FT                   /note="KEGG: bmj:BMULJ_00517 gluconokinase; TIGRFAM:
FT                   carbohydrate kinase, thermoresistant glucokinase family;
FT                   PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47455"
FT                   /db_xref="GOA:D0MF05"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D0MF05"
FT                   /inference="protein motif:TFAM:TIGR01313"
FT                   /protein_id="ACY47455.1"
FT                   /translation="MVIVVMGVSGAGKTTVGRALAETLGWPFYDGDDFHPPANIEKMRR
FT                   GVPLTDADRRPWLEALQALIARHLQEGRPAVVACSALKRSYRDVLRRAGEGVRFVHLAA
FT                   DYETIRRRLETRQGHFFDPKLLQSQFDDLEAPDADEALILEAARPVSALVRAIITRWNL
FT                   QGRR"
FT   gene            complement(626241..627581)
FT                   /locus_tag="Rmar_0556"
FT   CDS_pept        complement(626241..627581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0556"
FT                   /product="gluconate transporter"
FT                   /note="TIGRFAM: gluconate transporter; PFAM: Gluconate
FT                   transporter; Citrate transporter; KEGG: csa:Csal_0925
FT                   gluconate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47456"
FT                   /db_xref="GOA:D0MF06"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:D0MF06"
FT                   /inference="protein motif:TFAM:TIGR00791"
FT                   /protein_id="ACY47456.1"
FT                   /translation="MDTLALTGLVLLAVAVLLVLVLLVRLHAFVALLLTSLLVALLGGI
FT                   PPERVADVLREGMGGTLGYIAVVIGLGAMIGELLQHSGGTACIARSLLDRFGERRAPWA
FT                   LALTGFLVAIPVFFDVALILLLPLVYSLAHRTGRSLLYYALPLAAGIAVAHSFVPPTPG
FT                   PVAVAGLLGADLGWVVLFGAIVGLPATVLGGIVFGRWMAARLHVPVPAHLFDEATDETR
FT                   PLPSFLQALSVILVPLALILMGTAAGAFLPEDHALRPPLRLLGHPFTALVLGTLLACYL
FT                   LGVRLGYPMRTVQQITSKALEPVGLILLVTGAGGVLSRVLVETGVGQALAEQLAASRLP
FT                   LVVLAFGIALAARVAQGSATVSMVTAAGLIAPVVQTGSYSQPLLALTTLAIAAGATACS
FT                   HVNDSGFWLVSRYLDLSEADTLRVWTVLETILGVSGLIVVLLLSLVV"
FT   sig_peptide     complement(627495..627581)
FT                   /locus_tag="Rmar_0556"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.532 at
FT                   residue 29"
FT   gene            complement(627696..628766)
FT                   /locus_tag="Rmar_0557"
FT   CDS_pept        complement(627696..628766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC743860"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47457"
FT                   /db_xref="InterPro:IPR000533"
FT                   /db_xref="UniProtKB/TrEMBL:D0MF07"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47457.1"
FT                   /translation="MPFEIQDFHDLVRLLEAHPEWRAELRRLVLSEELLRLPELVQQLI
FT                   EAHRRAEERLQHVEERLDRLEATVAQLVEAQRKAEERLQHVEERLDRLEATVAQLIEAQ
FT                   RKAEERLDRLEATVAQLVEAHRRAEERLDRLEATVAQLIEAQRKAEERLDRLEATVAQL
FT                   IEAQRKAEERLQRTEARLERVEKRLERVEKRLEHVEIRLDGVEKRLEKTEDRLSKVWGG
FT                   FLESRYRERAHAYFAPILSRIRVLSSEHLVQLLDEALEAGRLTEADRRDLLLADLVLQG
FT                   RRDDQTVYLVAEVSGLISEDDVRRAVDRAQALARATDRPVIAAVAGETLPTDVQALAAQ
FT                   RGVWCITDGHVLSPAP"
FT   gene            630192..631478
FT                   /locus_tag="Rmar_0558"
FT   CDS_pept        630192..631478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0558"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   pat:Patl_0174 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47458"
FT                   /db_xref="GOA:D0MF08"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D0MF08"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACY47458.1"
FT                   /translation="MRAARKKLAELAEKHGFRPQLLQPRRTFIYKVRHPSGRVVTGEQK
FT                   AYTAEELAQALRKMGLEVIRVERKVLDLQLKPPRTDIIMFVRLAANLLREKLPFDEVLN
FT                   LLVNDVSSNALRQVIRDLNADLKAGMEAQQAFMKHQHVLGKFTAYMLGLASKSGNMAEI
FT                   FESTARFLERQNEFHKSIRSAMITPAITIIALVATFIWYVWYIFPMTAGLLADLGMELP
FT                   PMTAATLVFSQWLDRNILWLTLAFTAAVVGFVAFARSPRGQLIVHRWLIKLPIIGGLLH
FT                   KLNIEIFCRVFAILYSNSGENISVIKIAAEACGNRYMEHRIKTVTVPLMVAQGMDLVRA
FT                   MEASGVFTQMALARFRSGSETGNVRGAAEQMANYYESETTLKLKAVVEGIQTIIAILIT
FT                   IAIAVLTIISSEVALIQPSSTDLMRMGGR"
FT   gene            631636..635016
FT                   /locus_tag="Rmar_0559"
FT   CDS_pept        631636..635016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0559"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   scl:sce4467 type IV pilus biogenesis protein PilB"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47459"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:D0MF09"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACY47459.1"
FT                   /translation="MSWSDLFGRRRSPREWNEELRRLKFGTKQEESGKDDGTDAAGKAY
FT                   PEDASDRPEPKPAEAQPLSGLWLELAGDGHAEDALPELPETPEPEEAEAETAEAEPSDR
FT                   AAALTDVSAEVASARPQASLADATPGREGARQEPPRPKQEPTAEPPGASVDRGGVPPTA
FT                   RDSRTASLPEGAFMPELAEMFEDDVVMALLYGGAVRLDQIARAIVLRRRRPEQRLWRCL
FT                   LEVPGVDRETVLAEAARVGGIAPAPVDEERPSVEFIKAILLLLPPSVQHMLFDWQLLPC
FT                   GFAQGKEGGRVLLLATHDPTRPELKQVLQELRLPAELRYAPERILTKRLAELESFRPPV
FT                   LEPEPPTPEAQPQVQAPEPEIDRTPAQPEPEPPEPVAETPTPEAADPDAVRKAALPESP
FT                   EDDEPDGGVGLQEAGTAEVSEPAAPEIQPAEEVPATFAREAPPVADSPAEPLFEPLQGE
FT                   ALEEPKAETTPEAQAEAALETAPEVAVETLDAASDAIGDEKQEADAPEAADDGEDVPPP
FT                   VKIVLDDLPELKAAIARDRVVSRLLEKDVVALHQVYQAYQRQQDEGLKEPLWRVLAQSD
FT                   HVPQDAIYEEAARLYAFPIARLEPGKPSPEFVRSVMDTFEEEVRERLIELRVVPFEVDL
FT                   DAQTGAVKLVLVTHDPMRPEVHRLVHRLKLERFELQYAPRGVIMQALMEAYPRRNEYLE
FT                   RVKEEAAYDLGTSYDAQTELIDEDALEAEINRSKLINLFEATLVEAVRQGASDIHIFPN
FT                   NQKKVEIHFRIDGRLTRWHVEDKVHPEAFIAVIKDQSMNVDRFERDAAQDGFIQRWIDD
FT                   HLIRFRVSVLPIANALEDLRSESIVIRVLDDRKVIKDLRLLGLNKKALERFERAIRQPH
FT                   GMVIVTGPTGSGKSTTLYAALHQVVSPEVNVLTIEDPVEYIIPGVRQIKLNHKLGLEEA
FT                   LRAILRHDPDIVMVGEMRDRQTAELAIKLANTGHLTFSTLHTNDAPSAVSRLYKMGIEP
FT                   FLIAYAINLVVAQRLIRKVCPACKVEDKDPDYVMLRKLGFTDEEIARTTFYKAGRDRNC
FT                   KVCKGVGYKGRRAIVEAMYFSRTIRHMIVEAQGSIDEDALREQAIKEGMQTLRDAAREV
FT                   VLAGETTIEEMIRVTTTEE"
FT   gene            635253..635804
FT                   /locus_tag="Rmar_0560"
FT   CDS_pept        635253..635804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47460"
FT                   /db_xref="UniProtKB/TrEMBL:D0MF10"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47460.1"
FT                   /translation="MAQSFFALLALVLTVNFAMSVNQWYATFQRATLYREVEEMAQSVA
FT                   VETMEIVRTRAFDQAVVDGTITGTAADLALFSDADAFGISGNATCQAFGGTATCDDLDD
FT                   FHGQQVLRPFVMGQDTVWFAVDLTVRYVNWNASTGQATPASGKTFYKQVIVKVQDDWGG
FT                   DLKPFLPTPIQLDRVFAYGF"
FT   sig_peptide     635253..635315
FT                   /locus_tag="Rmar_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.942 at
FT                   residue 21"
FT   gene            635817..636461
FT                   /locus_tag="Rmar_0561"
FT   CDS_pept        635817..636461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47461"
FT                   /db_xref="UniProtKB/TrEMBL:D0MF11"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47461.1"
FT                   /translation="MWFIFDNLNALIVGGMLFLMLLGIQQRVAEMNLEQTVNYIVKRQA
FT                   GDLATWLEDDLLKLGRNVDWESETPFENPVDSAGVTVRFVFFHDSTDAGGNTVRVYVRY
FT                   RLKPAGERVIRNDTIPVYRLYREECIGSGCPSGGWQASGGGPGLLSYFKIDLLDQDAQP
FT                   VADPVNNADQVQNTRVRFTMATPFEVARAQVLRQVYYGSTLLIQRQMQQGS"
FT   gene            636483..637619
FT                   /locus_tag="Rmar_0562"
FT   CDS_pept        636483..637619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47462"
FT                   /db_xref="UniProtKB/TrEMBL:D0MF12"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47462.1"
FT                   /translation="MGKAILLAVTAVVVGASVMLLESSTNRLQADTRQAARQEEALARE
FT                   IARSAYNLIVSRARQLEVEQPDLGLADLVALVNGNEGKLTGQLNGGSYEAWIYPIGASS
FT                   YGAVAIGRYGDASHQVGNHRVLRSVLEVDQPSQVKVTFLESMAGYCSAIYIQRFVPKNN
FT                   NGMGNNPDQCDPSNPAHGSSCETQEDIELHGNGNGKYIALEPELVFAPGNNRDGGEALY
FT                   STVLNPGERANFILAVDADFNCERRGDTSIDIDDPFYEYTRPALLESVDDFNQMQEGDY
FT                   AMIQPHPTRPNVWRIAFEDLIFSKAKLEDVKRWGYGDREWKKRRGSQWGERRNKYSYGG
FT                   WGWTEVDGRGYYRLEDFGHMPDFSDQVIEIEFIPVPAS"
FT   sig_peptide     636483..636551
FT                   /locus_tag="Rmar_0562"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.820) with cleavage site probability 0.317 at
FT                   residue 23"
FT   gene            637761..639059
FT                   /locus_tag="Rmar_0563"
FT   CDS_pept        637761..639059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0563"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   pst:PSPTO_5045 twitching motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47463"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0MF13"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACY47463.1"
FT                   /translation="MSNGNPALAELLAQHASAAQRPRVRPVPPLPKICKTILESVPPSL
FT                   VGEDRARYLAEQVNALLDKDRTLLREHMQLLVKRMLDLNASDLDMGGPASNGFVWYRVH
FT                   GDKRPYEEMGTYSCDEAALLMLNLLTERQLQLFFEECSLDFSYELPIEGRNGMPRRFRA
FT                   TVYFDMDHVALNMRAISDEIRPLKSLGFHPLIERGLMFRHVRDGLTLVTGVTGSGKSTT
FT                   LDAIIDANNDDVYAHVVIIARPIEYVHRSRKCLIRHREVGRDVRTFKDGIVQALRQDPD
FT                   IIVIGEMRDPETISAALEITDSGHKVFSTLHTSSAVETIDRIVAEYPPDEQDRVRNRLA
FT                   DVLRCVISQKLVPKIGGGRILAKEVLWMTPSARAAIKNKNTGEIYQMMWEGGALGMTTL
FT                   EQDLYRLVRQQLITPEVAFDFANNKRRLQQLLQ"
FT   gene            639111..640844
FT                   /locus_tag="Rmar_0564"
FT   CDS_pept        639111..640844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0564"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   mxa:MXAN_5775 type IV pilus biogenesis protein PilN"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47464"
FT                   /db_xref="GOA:D0MF14"
FT                   /db_xref="UniProtKB/TrEMBL:D0MF14"
FT                   /inference="protein motif:PFAM:PF05137"
FT                   /protein_id="ACY47464.1"
FT                   /translation="MKAKQQKVARTKAPYVLGVTIAGRTVYAVLLKREGDGLEVVRRFT
FT                   RQRVARFASVQQGVPEVKGQEAGGDFSIQFGGGGGGATPFLKSEFDLSGDGAGGEQAPP
FT                   ASLFTMELTDILAECREAGYGDPEVAFCLPSVELAYVELRLPRRARVKDQETGPVDRKA
FT                   LLELLEQQVGTALEEEQVAFLPMTPSDAETHRFLAIYPRPSEPVTATLQALKAESNRKL
FT                   PRTRLFETEVSLYLGLVRTALRQLVPEAPEARSLVLRVGSDDTLVLFVQGETLQHAESL
FT                   RSLTVHDTPETICSRILLLQDEYGIGEVAYVFLVGEQGEADIQRSLEVFFPNARVENLR
FT                   HYLPLDDQEIGPGSLAAQLAALRLVGDPDFLKAFEPVNLFPSSLRRRWELPFGWHVWAL
FT                   YALLFVTTLFFVWRYLTLEAEIGERQERLRRLPPAIAETDARALQARIDSLNARTQQAL
FT                   RALDVLDSLLVGSDRWSRSLAQLSREVAAVRGIWVDSWSPRTSGVELKGSAVARDRVVE
FT                   LARRLNGVIRSLTFSEIREWPVYAFVIEIPLPNELPEPARYLREQFAANTQATQSKPSN
FT                   P"
FT   gene            640851..641807
FT                   /locus_tag="Rmar_0565"
FT   CDS_pept        640851..641807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47465"
FT                   /db_xref="UniProtKB/TrEMBL:D0MF15"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47465.1"
FT                   /translation="MWKKYGNALLLFVAWLILTGVGVYLTYFKLPDEIAHYEKLEKLAH
FT                   MRETEMGSLLAEYSASEERAREVESRWRSRYRYIPASLTTPEVVARLNELSRQGFETFN
FT                   VQFMGSGQTQSVNYYTFRIEGRGYFYHLYRFVWEIENTPELYRIRNLSLDHIDLVKADR
FT                   ASGKERMMVMVSFNMQLEAYYGGLPDLQVAHMADSLYRRLPRAVFPEKNPPVNPFYPGI
FT                   LEQLPPNSDNLIDIEKAKLVSIVGGRAVFQDASGLRTVGVGENVYLGQITEIDPIEGRV
FT                   VARLNRGGILDEVELHLETGERYRQALGPVMLTPLNQ"
FT   gene            641832..643193
FT                   /locus_tag="Rmar_0566"
FT   CDS_pept        641832..643193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0566"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: type II and III secretion system protein;
FT                   KEGG: pst:PSPTO_3307 general secretion pathway protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47466"
FT                   /db_xref="GOA:D0MF16"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="UniProtKB/TrEMBL:D0MF16"
FT                   /inference="protein motif:PFAM:PF00263"
FT                   /protein_id="ACY47466.1"
FT                   /translation="MEPVQTRTWIATALGLLLIGSLLAWPGLSQDRPPQRVMRTYVPPD
FT                   QLVSFLPTTPLNQFFELLNPIFQRVTGKQIVDPEERTDPIGVSISGMHFFDAFELVLQT
FT                   KGLTYRETDKFFIIEKAPEKTEVVIGPRRATGEAGAVQAGAVLPATVDTREIQINAILF
FT                   SVNLTKARDIGINWDQFFGLTTGTGTGTGGTTGGGTSGTGGQNNVEFYLKTEDLFDPLA
FT                   PLIEAPNRISFRQLTNFLRFLETEGIGETVASPQITVQSGEQGRIQIGSDVPIQTRDFA
FT                   GNTITQFVSTGIIIDVTPTLLVEPAADTAGAPLIEFVHLDVMVENSSATPSAAGLIIDR
FT                   NTADTQVLLLDGEQTIIGGLYSTRESISRKGIPFLKDLPWWFFGLRYIFGRTQRTITQS
FT                   ELLIVLQVKVLDPLTARASRPLERNLLERSRRELMERLERFSEQTARQTRMPRN"
FT   sig_peptide     641832..641906
FT                   /locus_tag="Rmar_0566"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.814 at
FT                   residue 25"
FT   gene            643522..644901
FT                   /locus_tag="Rmar_0567"
FT   CDS_pept        643522..644901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0567"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_6111 peptidase M28"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47467"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:D0MF17"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY47467.1"
FT                   /translation="MYRLLVISGLALGLAACGPAPRPAEEGPVQLHEPDNPLLLAEHLD
FT                   VLLRPEMQGRVTGSRSFALAAQYVEDRMREFRLQPALEGHYRIVYDARVHLPWPAVLGW
FT                   ADRDTAAFLPGLEFWPDARSDTGRVVADRVALCVQPRTCPAAPVWVLPDTSAEATSRLA
FT                   PARSVQAVLRVGPLRPTLTDAPIPGLRLLQLTPEAAARLLALPASALRAHLTDTASVTL
FT                   QLRRPIFLRVRRMGEPRVGALNVLGFVAGKDPGFRNELVIVCADLDVVALPGSPLLFDG
FT                   AHLGEGVAALLELARFYSTLASYWPQPRRTLLFAVWSGARQGHQGLRAYLRKPLWDPTA
FT                   TRRIVYLDPDPGTLAELHRLAEQYGMTLTPVLPPDSLQEDRRVFWRVPSEWQQIYRRIY
FT                   NAPAAVSIPEPEKLRMRALQRARALVRAAQAILLPEAITPGPWTPVPEDTLRPPVTENH
FT                   P"
FT   sig_peptide     643522..643602
FT                   /locus_tag="Rmar_0567"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.801) with cleavage site probability 0.667 at
FT                   residue 27"
FT   gene            644898..645716
FT                   /locus_tag="Rmar_0568"
FT   CDS_pept        644898..645716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0568"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sus:Acid_5954 xylose isomerase domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmar_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACY47468"
FT                   /db_xref="GOA:D0MF18"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D0MF18"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACY47468.1"
FT                   /translation="MIPALLTDTVTLNLDRALYLTLLWGLEGVELRTIGGPSDRVPFVN
FT                   EEKLRRRLLENELPAVAIVPGMFEGPVRDRRTWMNEVAAFDEVLSFCRRIDCPCVVVSA
FT                   FAAEDEGTPIEEAARALRMAGDKAADYGVRMAVLNEPGSAFPTGRALATLLETANHPAV
FT                   GGAWNPGAALQAGENPSEGLQALAGRVFLVRCSDWRLDPDRGVWEPAPFGEGAVGWPAQ
FT                   LRLLRDMDFTGPLSLEVRAEPRAKRGLHDATRLLQLLRQVRKPSSATTER"
FT   gene            645723..646541
FT                   /locus_tag="Rmar_0569"
FT   CDS_pept        645723..646541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmar_0569"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="KEGG: 1-acyl-sn-glycerol-3-phosphate acyltransferase
FT                   ; K00655 1-acyl-sn- glycerol-3-phosphate acyltransferase;
FT                   TIGRFAM: 1-acyl-sn-glycerol-3-phosphate acyltransferase;
FT                   PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol ac