(data stored in ACNUC1104 zone)

EMBL: CP001814

ID   CP001814; SV 1; circular; genomic DNA; STD; PRO; 10341314 BP.
XX
AC   CP001814; ABUU01000001-ABUU01000398;
XX
PR   Project:PRJNA21083;
XX
DT   11-DEC-2009 (Rel. 103, Created)
DT   18-JAN-2015 (Rel. 123, Last updated, Version 6)
XX
DE   Streptosporangium roseum DSM 43021, complete genome.
XX
KW   .
XX
OS   Streptosporangium roseum DSM 43021
OC   Bacteria; Actinobacteria; Streptosporangiales; Streptosporangiaceae;
OC   Streptosporangium.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-10341314
RX   PUBMED; 21304675.
RA   Nolan M., Sikorski J., Jando M., Lucas S., Lapidus A., Glavina Del Rio T.,
RA   Chen F., Tice H., Pitluck S., Cheng J.F., Chertkov O., Sims D., Meincke L.,
RA   Brettin T., Han C., Detter J.C., Bruce D., Goodwin L., Land M., Hauser L.,
RA   Chang Y.J., Jeffries C.D., Ivanova N., Mavromatis K., Mikhailova N.,
RA   Chen A., Palaniappan K., Chain P., Rohde M., Goker M., Bristow J.,
RA   Eisen J.A., Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.P.;
RT   "Complete genome sequence of Streptosporangium roseum type strain (NI
RT   9100)";
RL   Stand Genomic Sci 2(1):29-37(2010).
XX
RN   [2]
RP   1-10341314
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Sims D., Meinche L., Brettin T., Detter J.C., Han C., Larimer F., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Jando M., Schneider S., Klenk H.-P., Eisen J.A.;
RT   "The complete chromosome of Streptosporangium roseum DSM 43021";
RL   Unpublished.
XX
RN   [3]
RP   1-10341314
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Sims D., Meinche L., Brettin T., Detter J.C., Han C., Larimer F., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Jando M., Schneider S., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (10-NOV-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; bf0145487d5f260cc2b8e37dabb12c22.
DR   BioSample; SAMN00002585.
DR   CABRI; DSM 43021.
DR   EnsemblGenomes-Gn; EBG00001142824.
DR   EnsemblGenomes-Gn; EBG00001142825.
DR   EnsemblGenomes-Gn; EBG00001142826.
DR   EnsemblGenomes-Gn; EBG00001142827.
DR   EnsemblGenomes-Gn; EBG00001142828.
DR   EnsemblGenomes-Gn; EBG00001142829.
DR   EnsemblGenomes-Gn; EBG00001142830.
DR   EnsemblGenomes-Gn; EBG00001142831.
DR   EnsemblGenomes-Gn; EBG00001142832.
DR   EnsemblGenomes-Gn; EBG00001142833.
DR   EnsemblGenomes-Gn; EBG00001142834.
DR   EnsemblGenomes-Gn; EBG00001142835.
DR   EnsemblGenomes-Gn; EBG00001142836.
DR   EnsemblGenomes-Gn; EBG00001142837.
DR   EnsemblGenomes-Gn; EBG00001142838.
DR   EnsemblGenomes-Gn; EBG00001142839.
DR   EnsemblGenomes-Gn; EBG00001142840.
DR   EnsemblGenomes-Gn; EBG00001142841.
DR   EnsemblGenomes-Gn; EBG00001142842.
DR   EnsemblGenomes-Gn; EBG00001142843.
DR   EnsemblGenomes-Gn; EBG00001142844.
DR   EnsemblGenomes-Gn; EBG00001142845.
DR   EnsemblGenomes-Gn; EBG00001142846.
DR   EnsemblGenomes-Gn; EBG00001142847.
DR   EnsemblGenomes-Gn; EBG00001142848.
DR   EnsemblGenomes-Gn; EBG00001142849.
DR   EnsemblGenomes-Gn; EBG00001142850.
DR   EnsemblGenomes-Gn; EBG00001142851.
DR   EnsemblGenomes-Gn; EBG00001142852.
DR   EnsemblGenomes-Gn; EBG00001142853.
DR   EnsemblGenomes-Gn; EBG00001142854.
DR   EnsemblGenomes-Gn; EBG00001142855.
DR   EnsemblGenomes-Gn; EBG00001142856.
DR   EnsemblGenomes-Gn; EBG00001142857.
DR   EnsemblGenomes-Gn; EBG00001142858.
DR   EnsemblGenomes-Gn; EBG00001142859.
DR   EnsemblGenomes-Gn; EBG00001142860.
DR   EnsemblGenomes-Gn; EBG00001142861.
DR   EnsemblGenomes-Gn; EBG00001142862.
DR   EnsemblGenomes-Gn; EBG00001142863.
DR   EnsemblGenomes-Gn; EBG00001142864.
DR   EnsemblGenomes-Gn; EBG00001142865.
DR   EnsemblGenomes-Gn; EBG00001142866.
DR   EnsemblGenomes-Gn; EBG00001142867.
DR   EnsemblGenomes-Gn; EBG00001142868.
DR   EnsemblGenomes-Gn; EBG00001142869.
DR   EnsemblGenomes-Gn; EBG00001142870.
DR   EnsemblGenomes-Gn; EBG00001142871.
DR   EnsemblGenomes-Gn; EBG00001142872.
DR   EnsemblGenomes-Gn; EBG00001142873.
DR   EnsemblGenomes-Gn; EBG00001142874.
DR   EnsemblGenomes-Gn; EBG00001142875.
DR   EnsemblGenomes-Gn; EBG00001142876.
DR   EnsemblGenomes-Gn; EBG00001142877.
DR   EnsemblGenomes-Gn; EBG00001142878.
DR   EnsemblGenomes-Gn; EBG00001142879.
DR   EnsemblGenomes-Gn; EBG00001142880.
DR   EnsemblGenomes-Gn; EBG00001142881.
DR   EnsemblGenomes-Gn; EBG00001142882.
DR   EnsemblGenomes-Gn; EBG00001142883.
DR   EnsemblGenomes-Gn; EBG00001142884.
DR   EnsemblGenomes-Gn; EBG00001142885.
DR   EnsemblGenomes-Gn; EBG00001142886.
DR   EnsemblGenomes-Gn; EBG00001142887.
DR   EnsemblGenomes-Gn; EBG00001142888.
DR   EnsemblGenomes-Gn; EBG00001142889.
DR   EnsemblGenomes-Gn; EBG00001142890.
DR   EnsemblGenomes-Gn; EBG00001142891.
DR   EnsemblGenomes-Gn; EBG00001142892.
DR   EnsemblGenomes-Gn; EBG00001142893.
DR   EnsemblGenomes-Gn; EBG00001142894.
DR   EnsemblGenomes-Gn; EBG00001142895.
DR   EnsemblGenomes-Gn; EBG00001142896.
DR   EnsemblGenomes-Gn; EBG00001142897.
DR   EnsemblGenomes-Gn; EBG00001142898.
DR   EnsemblGenomes-Gn; EBG00001142899.
DR   EnsemblGenomes-Gn; EBG00001142900.
DR   EnsemblGenomes-Gn; EBG00001142901.
DR   EnsemblGenomes-Gn; EBG00001142902.
DR   EnsemblGenomes-Gn; EBG00001142903.
DR   EnsemblGenomes-Gn; EBG00001142904.
DR   EnsemblGenomes-Gn; EBG00001142905.
DR   EnsemblGenomes-Gn; EBG00001142906.
DR   EnsemblGenomes-Gn; EBG00001142907.
DR   EnsemblGenomes-Gn; EBG00001142908.
DR   EnsemblGenomes-Gn; EBG00001142909.
DR   EnsemblGenomes-Gn; EBG00001142910.
DR   EnsemblGenomes-Gn; EBG00001142911.
DR   EnsemblGenomes-Gn; EBG00001142912.
DR   EnsemblGenomes-Gn; EBG00001142913.
DR   EnsemblGenomes-Gn; EBG00001142914.
DR   EnsemblGenomes-Gn; EBG00001142915.
DR   EnsemblGenomes-Gn; EBG00001142916.
DR   EnsemblGenomes-Gn; EBG00001142917.
DR   EnsemblGenomes-Gn; EBG00001142918.
DR   EnsemblGenomes-Gn; EBG00001142919.
DR   EnsemblGenomes-Gn; EBG00001142920.
DR   EnsemblGenomes-Gn; EBG00001142921.
DR   EnsemblGenomes-Gn; EBG00001142922.
DR   EnsemblGenomes-Gn; EBG00001142923.
DR   EnsemblGenomes-Gn; EBG00001142924.
DR   EnsemblGenomes-Gn; EBG00001142925.
DR   EnsemblGenomes-Gn; Sros_R0001.
DR   EnsemblGenomes-Gn; Sros_R0002.
DR   EnsemblGenomes-Gn; Sros_R0003.
DR   EnsemblGenomes-Gn; Sros_R0004.
DR   EnsemblGenomes-Gn; Sros_R0005.
DR   EnsemblGenomes-Gn; Sros_R0006.
DR   EnsemblGenomes-Gn; Sros_R0007.
DR   EnsemblGenomes-Gn; Sros_R0008.
DR   EnsemblGenomes-Gn; Sros_R0009.
DR   EnsemblGenomes-Gn; Sros_R0010.
DR   EnsemblGenomes-Gn; Sros_R0011.
DR   EnsemblGenomes-Gn; Sros_R0012.
DR   EnsemblGenomes-Gn; Sros_R0013.
DR   EnsemblGenomes-Gn; Sros_R0014.
DR   EnsemblGenomes-Gn; Sros_R0015.
DR   EnsemblGenomes-Gn; Sros_R0016.
DR   EnsemblGenomes-Gn; Sros_R0017.
DR   EnsemblGenomes-Gn; Sros_R0018.
DR   EnsemblGenomes-Gn; Sros_R0019.
DR   EnsemblGenomes-Gn; Sros_R0020.
DR   EnsemblGenomes-Gn; Sros_R0021.
DR   EnsemblGenomes-Gn; Sros_R0022.
DR   EnsemblGenomes-Gn; Sros_R0023.
DR   EnsemblGenomes-Gn; Sros_R0024.
DR   EnsemblGenomes-Gn; Sros_R0025.
DR   EnsemblGenomes-Gn; Sros_R0026.
DR   EnsemblGenomes-Gn; Sros_R0027.
DR   EnsemblGenomes-Gn; Sros_R0028.
DR   EnsemblGenomes-Gn; Sros_R0029.
DR   EnsemblGenomes-Gn; Sros_R0030.
DR   EnsemblGenomes-Gn; Sros_R0031.
DR   EnsemblGenomes-Gn; Sros_R0032.
DR   EnsemblGenomes-Gn; Sros_R0033.
DR   EnsemblGenomes-Gn; Sros_R0034.
DR   EnsemblGenomes-Gn; Sros_R0035.
DR   EnsemblGenomes-Gn; Sros_R0036.
DR   EnsemblGenomes-Gn; Sros_R0037.
DR   EnsemblGenomes-Gn; Sros_R0038.
DR   EnsemblGenomes-Gn; Sros_R0039.
DR   EnsemblGenomes-Gn; Sros_R0040.
DR   EnsemblGenomes-Gn; Sros_R0041.
DR   EnsemblGenomes-Gn; Sros_R0042.
DR   EnsemblGenomes-Gn; Sros_R0043.
DR   EnsemblGenomes-Gn; Sros_R0044.
DR   EnsemblGenomes-Gn; Sros_R0045.
DR   EnsemblGenomes-Gn; Sros_R0046.
DR   EnsemblGenomes-Gn; Sros_R0047.
DR   EnsemblGenomes-Gn; Sros_R0048.
DR   EnsemblGenomes-Gn; Sros_R0049.
DR   EnsemblGenomes-Gn; Sros_R0050.
DR   EnsemblGenomes-Gn; Sros_R0051.
DR   EnsemblGenomes-Gn; Sros_R0052.
DR   EnsemblGenomes-Gn; Sros_R0053.
DR   EnsemblGenomes-Gn; Sros_R0054.
DR   EnsemblGenomes-Gn; Sros_R0055.
DR   EnsemblGenomes-Gn; Sros_R0056.
DR   EnsemblGenomes-Gn; Sros_R0057.
DR   EnsemblGenomes-Gn; Sros_R0058.
DR   EnsemblGenomes-Gn; Sros_R0059.
DR   EnsemblGenomes-Gn; Sros_R0060.
DR   EnsemblGenomes-Gn; Sros_R0061.
DR   EnsemblGenomes-Gn; Sros_R0062.
DR   EnsemblGenomes-Gn; Sros_R0063.
DR   EnsemblGenomes-Gn; Sros_R0064.
DR   EnsemblGenomes-Gn; Sros_R0065.
DR   EnsemblGenomes-Gn; Sros_R0066.
DR   EnsemblGenomes-Gn; Sros_R0067.
DR   EnsemblGenomes-Gn; Sros_R0068.
DR   EnsemblGenomes-Gn; Sros_R0069.
DR   EnsemblGenomes-Gn; Sros_R0070.
DR   EnsemblGenomes-Gn; Sros_R0071.
DR   EnsemblGenomes-Gn; Sros_R0072.
DR   EnsemblGenomes-Gn; Sros_R0073.
DR   EnsemblGenomes-Gn; Sros_R0074.
DR   EnsemblGenomes-Gn; Sros_R0075.
DR   EnsemblGenomes-Gn; Sros_R0076.
DR   EnsemblGenomes-Gn; Sros_R0077.
DR   EnsemblGenomes-Gn; Sros_R0078.
DR   EnsemblGenomes-Gn; Sros_R0079.
DR   EnsemblGenomes-Gn; Sros_R0080.
DR   EnsemblGenomes-Gn; Sros_R0081.
DR   EnsemblGenomes-Gn; Sros_R0082.
DR   EnsemblGenomes-Gn; Sros_R0083.
DR   EnsemblGenomes-Gn; Sros_R0084.
DR   EnsemblGenomes-Gn; Sros_R0085.
DR   EnsemblGenomes-Gn; Sros_R0086.
DR   EnsemblGenomes-Gn; Sros_R0087.
DR   EnsemblGenomes-Gn; Sros_R0088.
DR   EnsemblGenomes-Gn; Sros_R0089.
DR   EnsemblGenomes-Tr; EBT00001559512.
DR   EnsemblGenomes-Tr; EBT00001559513.
DR   EnsemblGenomes-Tr; EBT00001559514.
DR   EnsemblGenomes-Tr; EBT00001559515.
DR   EnsemblGenomes-Tr; EBT00001559516.
DR   EnsemblGenomes-Tr; EBT00001559517.
DR   EnsemblGenomes-Tr; EBT00001559518.
DR   EnsemblGenomes-Tr; EBT00001559519.
DR   EnsemblGenomes-Tr; EBT00001559520.
DR   EnsemblGenomes-Tr; EBT00001559521.
DR   EnsemblGenomes-Tr; EBT00001559522.
DR   EnsemblGenomes-Tr; EBT00001559523.
DR   EnsemblGenomes-Tr; EBT00001559524.
DR   EnsemblGenomes-Tr; EBT00001559525.
DR   EnsemblGenomes-Tr; EBT00001559526.
DR   EnsemblGenomes-Tr; EBT00001559527.
DR   EnsemblGenomes-Tr; EBT00001559528.
DR   EnsemblGenomes-Tr; EBT00001559529.
DR   EnsemblGenomes-Tr; EBT00001559530.
DR   EnsemblGenomes-Tr; EBT00001559531.
DR   EnsemblGenomes-Tr; EBT00001559532.
DR   EnsemblGenomes-Tr; EBT00001559533.
DR   EnsemblGenomes-Tr; EBT00001559534.
DR   EnsemblGenomes-Tr; EBT00001559535.
DR   EnsemblGenomes-Tr; EBT00001559536.
DR   EnsemblGenomes-Tr; EBT00001559537.
DR   EnsemblGenomes-Tr; EBT00001559538.
DR   EnsemblGenomes-Tr; EBT00001559539.
DR   EnsemblGenomes-Tr; EBT00001559540.
DR   EnsemblGenomes-Tr; EBT00001559541.
DR   EnsemblGenomes-Tr; EBT00001559542.
DR   EnsemblGenomes-Tr; EBT00001559543.
DR   EnsemblGenomes-Tr; EBT00001559544.
DR   EnsemblGenomes-Tr; EBT00001559545.
DR   EnsemblGenomes-Tr; EBT00001559546.
DR   EnsemblGenomes-Tr; EBT00001559547.
DR   EnsemblGenomes-Tr; EBT00001559548.
DR   EnsemblGenomes-Tr; EBT00001559549.
DR   EnsemblGenomes-Tr; EBT00001559550.
DR   EnsemblGenomes-Tr; EBT00001559551.
DR   EnsemblGenomes-Tr; EBT00001559552.
DR   EnsemblGenomes-Tr; EBT00001559553.
DR   EnsemblGenomes-Tr; EBT00001559554.
DR   EnsemblGenomes-Tr; EBT00001559555.
DR   EnsemblGenomes-Tr; EBT00001559556.
DR   EnsemblGenomes-Tr; EBT00001559557.
DR   EnsemblGenomes-Tr; EBT00001559558.
DR   EnsemblGenomes-Tr; EBT00001559559.
DR   EnsemblGenomes-Tr; EBT00001559560.
DR   EnsemblGenomes-Tr; EBT00001559561.
DR   EnsemblGenomes-Tr; EBT00001559562.
DR   EnsemblGenomes-Tr; EBT00001559563.
DR   EnsemblGenomes-Tr; EBT00001559564.
DR   EnsemblGenomes-Tr; EBT00001559565.
DR   EnsemblGenomes-Tr; EBT00001559566.
DR   EnsemblGenomes-Tr; EBT00001559567.
DR   EnsemblGenomes-Tr; EBT00001559568.
DR   EnsemblGenomes-Tr; EBT00001559569.
DR   EnsemblGenomes-Tr; EBT00001559570.
DR   EnsemblGenomes-Tr; EBT00001559571.
DR   EnsemblGenomes-Tr; EBT00001559572.
DR   EnsemblGenomes-Tr; EBT00001559573.
DR   EnsemblGenomes-Tr; EBT00001559574.
DR   EnsemblGenomes-Tr; EBT00001559575.
DR   EnsemblGenomes-Tr; EBT00001559576.
DR   EnsemblGenomes-Tr; EBT00001559577.
DR   EnsemblGenomes-Tr; EBT00001559578.
DR   EnsemblGenomes-Tr; EBT00001559579.
DR   EnsemblGenomes-Tr; EBT00001559580.
DR   EnsemblGenomes-Tr; EBT00001559581.
DR   EnsemblGenomes-Tr; EBT00001559582.
DR   EnsemblGenomes-Tr; EBT00001559583.
DR   EnsemblGenomes-Tr; EBT00001559584.
DR   EnsemblGenomes-Tr; EBT00001559585.
DR   EnsemblGenomes-Tr; EBT00001559586.
DR   EnsemblGenomes-Tr; EBT00001559587.
DR   EnsemblGenomes-Tr; EBT00001559588.
DR   EnsemblGenomes-Tr; EBT00001559589.
DR   EnsemblGenomes-Tr; EBT00001559590.
DR   EnsemblGenomes-Tr; EBT00001559591.
DR   EnsemblGenomes-Tr; EBT00001559592.
DR   EnsemblGenomes-Tr; EBT00001559593.
DR   EnsemblGenomes-Tr; EBT00001559594.
DR   EnsemblGenomes-Tr; EBT00001559595.
DR   EnsemblGenomes-Tr; EBT00001559596.
DR   EnsemblGenomes-Tr; EBT00001559597.
DR   EnsemblGenomes-Tr; EBT00001559598.
DR   EnsemblGenomes-Tr; EBT00001559599.
DR   EnsemblGenomes-Tr; EBT00001559600.
DR   EnsemblGenomes-Tr; EBT00001559601.
DR   EnsemblGenomes-Tr; EBT00001559602.
DR   EnsemblGenomes-Tr; EBT00001559603.
DR   EnsemblGenomes-Tr; EBT00001559604.
DR   EnsemblGenomes-Tr; EBT00001559605.
DR   EnsemblGenomes-Tr; EBT00001559606.
DR   EnsemblGenomes-Tr; EBT00001559607.
DR   EnsemblGenomes-Tr; EBT00001559608.
DR   EnsemblGenomes-Tr; EBT00001559609.
DR   EnsemblGenomes-Tr; EBT00001559610.
DR   EnsemblGenomes-Tr; EBT00001559611.
DR   EnsemblGenomes-Tr; EBT00001559612.
DR   EnsemblGenomes-Tr; EBT00001559613.
DR   EnsemblGenomes-Tr; Sros_R0001-1.
DR   EnsemblGenomes-Tr; Sros_R0002-1.
DR   EnsemblGenomes-Tr; Sros_R0003-1.
DR   EnsemblGenomes-Tr; Sros_R0004-1.
DR   EnsemblGenomes-Tr; Sros_R0005-1.
DR   EnsemblGenomes-Tr; Sros_R0006-1.
DR   EnsemblGenomes-Tr; Sros_R0007-1.
DR   EnsemblGenomes-Tr; Sros_R0008-1.
DR   EnsemblGenomes-Tr; Sros_R0009-1.
DR   EnsemblGenomes-Tr; Sros_R0010-1.
DR   EnsemblGenomes-Tr; Sros_R0011-1.
DR   EnsemblGenomes-Tr; Sros_R0012-1.
DR   EnsemblGenomes-Tr; Sros_R0013-1.
DR   EnsemblGenomes-Tr; Sros_R0014-1.
DR   EnsemblGenomes-Tr; Sros_R0015-1.
DR   EnsemblGenomes-Tr; Sros_R0016-1.
DR   EnsemblGenomes-Tr; Sros_R0017-1.
DR   EnsemblGenomes-Tr; Sros_R0018-1.
DR   EnsemblGenomes-Tr; Sros_R0019-1.
DR   EnsemblGenomes-Tr; Sros_R0020-1.
DR   EnsemblGenomes-Tr; Sros_R0021-1.
DR   EnsemblGenomes-Tr; Sros_R0022-1.
DR   EnsemblGenomes-Tr; Sros_R0023-1.
DR   EnsemblGenomes-Tr; Sros_R0024-1.
DR   EnsemblGenomes-Tr; Sros_R0025-1.
DR   EnsemblGenomes-Tr; Sros_R0026-1.
DR   EnsemblGenomes-Tr; Sros_R0027-1.
DR   EnsemblGenomes-Tr; Sros_R0028-1.
DR   EnsemblGenomes-Tr; Sros_R0029-1.
DR   EnsemblGenomes-Tr; Sros_R0030-1.
DR   EnsemblGenomes-Tr; Sros_R0031-1.
DR   EnsemblGenomes-Tr; Sros_R0032-1.
DR   EnsemblGenomes-Tr; Sros_R0033-1.
DR   EnsemblGenomes-Tr; Sros_R0034-1.
DR   EnsemblGenomes-Tr; Sros_R0035-1.
DR   EnsemblGenomes-Tr; Sros_R0036-1.
DR   EnsemblGenomes-Tr; Sros_R0037-1.
DR   EnsemblGenomes-Tr; Sros_R0038-1.
DR   EnsemblGenomes-Tr; Sros_R0039-1.
DR   EnsemblGenomes-Tr; Sros_R0040-1.
DR   EnsemblGenomes-Tr; Sros_R0041-1.
DR   EnsemblGenomes-Tr; Sros_R0042-1.
DR   EnsemblGenomes-Tr; Sros_R0043-1.
DR   EnsemblGenomes-Tr; Sros_R0044-1.
DR   EnsemblGenomes-Tr; Sros_R0045-1.
DR   EnsemblGenomes-Tr; Sros_R0046-1.
DR   EnsemblGenomes-Tr; Sros_R0047-1.
DR   EnsemblGenomes-Tr; Sros_R0048-1.
DR   EnsemblGenomes-Tr; Sros_R0049-1.
DR   EnsemblGenomes-Tr; Sros_R0050-1.
DR   EnsemblGenomes-Tr; Sros_R0051-1.
DR   EnsemblGenomes-Tr; Sros_R0052-1.
DR   EnsemblGenomes-Tr; Sros_R0053-1.
DR   EnsemblGenomes-Tr; Sros_R0054-1.
DR   EnsemblGenomes-Tr; Sros_R0055-1.
DR   EnsemblGenomes-Tr; Sros_R0056-1.
DR   EnsemblGenomes-Tr; Sros_R0057-1.
DR   EnsemblGenomes-Tr; Sros_R0058-1.
DR   EnsemblGenomes-Tr; Sros_R0059-1.
DR   EnsemblGenomes-Tr; Sros_R0060-1.
DR   EnsemblGenomes-Tr; Sros_R0061-1.
DR   EnsemblGenomes-Tr; Sros_R0062-1.
DR   EnsemblGenomes-Tr; Sros_R0063-1.
DR   EnsemblGenomes-Tr; Sros_R0064-1.
DR   EnsemblGenomes-Tr; Sros_R0065-1.
DR   EnsemblGenomes-Tr; Sros_R0066-1.
DR   EnsemblGenomes-Tr; Sros_R0067-1.
DR   EnsemblGenomes-Tr; Sros_R0068-1.
DR   EnsemblGenomes-Tr; Sros_R0069-1.
DR   EnsemblGenomes-Tr; Sros_R0070-1.
DR   EnsemblGenomes-Tr; Sros_R0071-1.
DR   EnsemblGenomes-Tr; Sros_R0072-1.
DR   EnsemblGenomes-Tr; Sros_R0073-1.
DR   EnsemblGenomes-Tr; Sros_R0074-1.
DR   EnsemblGenomes-Tr; Sros_R0075-1.
DR   EnsemblGenomes-Tr; Sros_R0076-1.
DR   EnsemblGenomes-Tr; Sros_R0077-1.
DR   EnsemblGenomes-Tr; Sros_R0078-1.
DR   EnsemblGenomes-Tr; Sros_R0079-1.
DR   EnsemblGenomes-Tr; Sros_R0080-1.
DR   EnsemblGenomes-Tr; Sros_R0081-1.
DR   EnsemblGenomes-Tr; Sros_R0082-1.
DR   EnsemblGenomes-Tr; Sros_R0083-1.
DR   EnsemblGenomes-Tr; Sros_R0084-1.
DR   EnsemblGenomes-Tr; Sros_R0085-1.
DR   EnsemblGenomes-Tr; Sros_R0086-1.
DR   EnsemblGenomes-Tr; Sros_R0087-1.
DR   EnsemblGenomes-Tr; Sros_R0088-1.
DR   EnsemblGenomes-Tr; Sros_R0089-1.
DR   EuropePMC; PMC4210621; 25301375.
DR   EuropePMC; PMC4604371; 26349828.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00062; HgcC.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   RFAM; RF02033; HEARO.
DR   SILVA-LSU; CP001814.
DR   SILVA-SSU; CP001814.
DR   StrainInfo; 167561; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082769
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Streptosporangium roseum NI 9100, DSM
CC                            43021
CC   Culture Collection ID :: DSM 43021, ATCC 12428, CBS 313.56, IAM
CC                            14294, IFO 3776, JCM 3005
CC   GOLD Stamp ID         :: Gi02229
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: GeneMark
CC   Isolation Site        :: Vegetable garden soil
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Filament-shaped
CC   Sporulation           :: Sporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 28C
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Soil
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..10341314
FT                   /organism="Streptosporangium roseum DSM 43021"
FT                   /strain="DSM 43021"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:479432"
FT                   /culture_collection="DSM:43021"
FT   gene            361..2109
FT                   /locus_tag="Sros_0001"
FT   CDS_pept        361..2109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0001"
FT                   /product="ATPase involved in DNA replication
FT                   initiation-like protein"
FT                   /note="KEGG: bsu:BSU00010 chromosomal replication
FT                   initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83063"
FT                   /db_xref="GOA:D2AVU4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVU4"
FT                   /inference="protein motif:COG:COG0593"
FT                   /protein_id="ACZ83063.1"
FT                   /translation="MDAMDLGAVWARALENSLNESVPSQQRVWLSMTRPFGLMNDTVVL
FT                   AAPNDFARDVLEDKLRPLISHALSQEFGRPMRVAVMVDPSATGSDSGVASRPESYPQAP
FT                   PTSYPQSGGPQQSYAQPVTSQHHSASGAQHPYPAAGTAAPPSTEYPQHQPQAQPFSYSY
FT                   QHRDEQAQPYLPAEPSPAPPPAEQGGGYGRGGYTPRPSPPSRSEPDTFERPAQSPGAGG
FT                   VHNRWDSRGSRTQGEPARLNPKYTFETFVIGSSNRFAHAAAVAVAEAPAKAYNPLFIYG
FT                   DSGLGKTHLLHAIGHYAQSLYDGARVRYVSSEEFTNDFINSIRDHKADGFRSRYRAVDI
FT                   LLVDDIQFLEGKEQTQEEFFHTFNTLHNANKQIVISSDRAPKQLVTLEDRLRNRFEWGL
FT                   ITDVQPPELETRIAILRKKAIQEGLAAPPEVLEYIASRISTNIRELEGALIRVTAFASL
FT                   NRQSVDLQLTEVVLKDLITEDAGSEITVATIMASTAAYFGLSIDDLCGGSRSRVLVTAR
FT                   QIAMYLCRELTDMSLPKIGQQFGGRDHTTVMHADRKIRSLMAERRSIYNQVNELTTRIK
FT                   QQSRNG"
FT   gene            2672..3811
FT                   /locus_tag="Sros_0002"
FT   CDS_pept        2672..3811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0002"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: vfm:VFMJ11_0010 DNA polymerase III, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83064"
FT                   /db_xref="GOA:D2AVU5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVU5"
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /protein_id="ACZ83064.1"
FT                   /translation="MMFRIERDVLAEAVAWTARSLPARPSVPVLAGMRLEVTEKGQLKL
FT                   SGFDYEVSAEVTLEPQSGEAGVVLVSGRLLAEITRALPAQPVDFVVEGAKAVVTCGSAR
FT                   FTLLTMPVEDYPSLPTMPPAAGRVGSDVFASAVGQVAVAAGKDDTLPMLTGVRMEIEGD
FT                   TVTLAATDRYRLAVRELKWQPGQPDFSAIAMIPGKTLADAAKALGSTGAEVEVAMSSVG
FT                   GTGEGMIGFSSAGRRTTTRLLDPEFPKYRSLLPTEFSARADLSTSAFVEAVKRVALVAE
FT                   RNTPVRLAFRGDEVVLEAGSGDEAQAVEVLPVDFEGDDINIAFNHQFLLEGLGAIDSDV
FT                   ARLQMTTSTKPAILTGGKHVDDGGVPDYRYLIMPIRLSS"
FT   gene            3884..4615
FT                   /locus_tag="Sros_0003"
FT   CDS_pept        3884..4615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0003"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mll1845 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83065"
FT                   /db_xref="GOA:D2AVU6"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVU6"
FT                   /inference="similar to AA sequence:KEGG:mll1845"
FT                   /protein_id="ACZ83065.1"
FT                   /translation="MTMIKACLNGSRKAGEHPALPLTPLELAEAAREAREAGAAAVHMH
FT                   PRDEAGSESLSAVHIGAAVRAVRRACPGLPVGVSTGLWISGGDVEARREAVRGWAALPA
FT                   RDRPDFASVNLSEPGFSDLWHDLRRLGVGVEAGVWSVDDADALASTGLECVRVLVEIIG
FT                   GSADTAVSRAHAVLGRLDELSVPGPRLLHGEEGPAWILVDEAGQLGLAARIGLEDVLHS
FT                   PVGDPVDGNADLVRLALARRV"
FT   gene            4648..5589
FT                   /locus_tag="Sros_0004"
FT   CDS_pept        4648..5589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0004"
FT                   /product="6-phosphogluconate dehydrogenase-like protein"
FT                   /note="KEGG: dde:Dde_3470 6-phosphogluconate dehydrogenase-
FT                   like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83066"
FT                   /db_xref="GOA:D2AVU7"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVU7"
FT                   /inference="similar to AA sequence:KEGG:Dde_3470"
FT                   /protein_id="ACZ83066.1"
FT                   /translation="MQIGMVGLGKMGGNMAERLRRGGHDVVGYDRDPAVSDVSSLKDLV
FT                   DRLQEPRAVWVMVPAGAPTQATVEELGNLLSAGDIVIDGGNSHYLDDQKHAAELGAKKI
FT                   GFVDCGVSGGIWGLENGYALMVGGSKPDIERLMPIFETLRPEEGGFVHAGDVGAGHFAK
FT                   MVHNGIEYGMMQAFAEGWELLEASDVVTDVPGAFKSWRHGTVIRSWLLDLMVRALDEDP
FT                   ALAELKGYAQDSGEGRWTVQAAVDHAVPLPVITAALYARFASRQEDSPAMKVVAALRNQ
FT                   FGGHAVTAKEGEFAKGADAPGADVVPPVEVDK"
FT   gene            5885..7057
FT                   /locus_tag="Sros_0005"
FT   CDS_pept        5885..7057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0005"
FT                   /product="Recombinational DNA repair ATPase (RecF
FT                   pathway)-like protein"
FT                   /note="KEGG: bha:BH0004 recombination protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83067"
FT                   /db_xref="GOA:D2AVU8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVU8"
FT                   /inference="protein motif:COG:COG1195"
FT                   /protein_id="ACZ83067.1"
FT                   /translation="MHVANLSLTDFRSYDTVDLGLEPGVTAFVGPNGQGKTNLVEALGY
FT                   VATQSSHRVATDGPLVRQGAARAIVRSVVVREDRRALIELEINPGKANRARLNRSPVSR
FT                   PRDVIGLLRTVLFAPEDLSMVKGDPSERRRYLDDLLVARTPRFAGVRADYDRVLKQRGA
FT                   LLRTAAQARRGGRSGRRADNDAAFAAAGAGDPLSTLEVWDAHLARHGAELLAARLELVE
FT                   ALRPLVAASYAALAPNSAPAALEYRGTLSTEEGSDRATLEERLRAGLLEVRTSEIERGV
FT                   TLVGPHRDDLFLGLGELPARGYASHGESWSFALALRLAAYDLLRADGGDPVLILDDVFA
FT                   ELDNQRRGRLAGIVAPAEQVLITAAVAADVPAELVGARFDVTEGSVHRVR"
FT   gene            7047..7667
FT                   /locus_tag="Sros_0006"
FT   CDS_pept        7047..7667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0006"
FT                   /product="Zn-ribbon-containing possibly RNA-binding protein
FT                   and truncated derivatives-like protein"
FT                   /note="KEGG: geo:Geob_1482 protein of unknown function
FT                   DUF721"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83068"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVU9"
FT                   /inference="protein motif:COG:COG5512"
FT                   /protein_id="ACZ83068.1"
FT                   /translation="MSDERPPDSGPAPSGDARPASGGPESIGAARPAAGGTPPEPGSAK
FT                   SAAAKGAALAREKLAQAKADAAKRGQLPRREPRRRAAGPRRDFGDPQLFGRAITDLLAD
FT                   RGWEQPVAVGGVFGRWHEIVGPDLAAHTKPETFADGEVLVVADSTAWATQVRLLARTLV
FT                   RRLNEELGDGTVQRVKVRGPQNGPRPSGGLRVTGSRGPGDTYG"
FT   gene            7964..9907
FT                   /locus_tag="Sros_0007"
FT   CDS_pept        7964..9907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0007"
FT                   /product="DNA topoisomerase (ATP-hydrolyzing)"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: bha:BH0006 DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83069"
FT                   /db_xref="GOA:D2AVV0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVV0"
FT                   /inference="protein motif:PRIAM:5.99.1.3"
FT                   /protein_id="ACZ83069.1"
FT                   /translation="MSYDASSITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEVVDNSV
FT                   DEALAGHADRIEVTLLADNGVRVVDNGRGIPVGIVEAEGRPAVEVVLTVLHAGGKFDSK
FT                   SYAVSGGLHGVGVSVVNALSSKLEVEIRTDGHHWQQSYAETRPLHPLVKGEATEETGTS
FT                   ITFWADSTIFETTTWNFETLSRRFQEMAFLNKGLTISLRDERPDHINGEPKEATYHYEG
FT                   GLSDFVKHLNSKKEPAHVSVIDFEESGEGISVEIAMQWNNSYSESVYTFANTINTAEGG
FT                   THEEGFRAALTSIVNRYAREQKFLKEGKDDNLAGEDIREGLTAIISVKLADPQFEGQTK
FT                   TKLGNTEAKSFVQKACNDHLRDWFERNPGEAKDIINKSLQASRARLAARQARDLTRRKS
FT                   LLESGSGLPGKLADCQWSDPEKCELFIVEGDSAGGSAKGGRDSKFQAILPIRGKILNVE
FT                   KARIDKVLRNTEVQALITAMGTGVHDEFDITKLRYHKLILMADADVDGQHINTLLLTLL
FT                   FRFMRPLIEAGHVYLSQPPLYKIKWDRRGEDASYAYSDPERDAIIADGIARGKRDPRMH
FT                   DGIQRFKGLGEMNASQLWETTMNPETRVLRLVTLDDAAQADELFSVLMGEDVEARRSFI
FT                   IRNARDVRFLDV"
FT   gene            9950..12460
FT                   /locus_tag="Sros_0008"
FT   CDS_pept        9950..12460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0008"
FT                   /product="DNA topoisomerase (ATP-hydrolyzing)"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: bha:BH0007 DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83070"
FT                   /db_xref="GOA:D2AVV1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVV1"
FT                   /inference="protein motif:PRIAM:5.99.1.3"
FT                   /protein_id="ACZ83070.1"
FT                   /translation="MTDVNTPLVERIEPVDIQSEMQRSYMDYAMSVIVSRALPDVRDGL
FT                   KPVHRRVLYAMYDGGYRPDRGYFKCSRVVGDVMGSYHPHGDSSIYGTVVRLAQPWALRY
FT                   TLIDGQGNFGSPGNDMPAAMRYTECKLAPIAMEMIRDIDKDTVDFQPNYDGRSQEPLVL
FT                   PSRFPNLLVNGSAGIAVGMATNIPPHNLREVADGVRWALQNPEASDEELLEALIARVKG
FT                   PDFPTGALIVGRRGIDDAYRTGRGSITMRAIVEVEEDAKGRQCLVVTELPYQVNPDNLA
FT                   LSIAESVKEGRITGIADVRDESSSRVGQRLVIVLKRDAVAKVVLNNLYKHTQLQTTFGA
FT                   NMLALVDGVPRTLRLDQFVRHYVAHQIEVVVRRTRYLLRKAEERAHILRALLKALERMD
FT                   EVIALIRRSPSASAAQGGLMALLEIDEIQAQAILDMQLRKLAALERQQITDEYDTLMAH
FT                   ITDYQAILASPERQRTIVFDELSEIVSKYGDERKTEIIAYEGDMSIEDLLAEEDMVVTI
FT                   TRGGYAKRTNTDLYRAQKRGGKGVRGAQLRQDDIVDHFFVTTTHHWLLFFTNKGRVYRV
FT                   KAYELPDSGRDARGQHLANLLAMQPDEVVMEVLDLRDYEVAPYLVLATRSGLVKKTRLS
FT                   EYDSPRSGGLIAINLREDDEVIAARLVSEEDDLLLVSRGAQSIRFTASDEALRPMGRAT
FT                   SGVIGMRFLGGDELLAMNRIGDGDDVLIATEGGYAKRTPADQYPVQGRGGKGVLTAKIV
FT                   SARGKLVGAAMVRPEDEVFAITSAGGVIRTSAGEIKQSGRQTMGVRLMNLAEGDSVVAL
FT                   ARNAEALETEHNDALETEQNGEGE"
FT   gene            12533..13180
FT                   /locus_tag="Sros_0009"
FT   CDS_pept        12533..13180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsh:Dshi_1110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83071"
FT                   /db_xref="GOA:D2AVV2"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVV2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83071.1"
FT                   /translation="MDKATEADAVDVAESPADGSKPTPETDKSVTDDFKGRQNVTAIED
FT                   GKPSDSTVRIRPRSAETDSSSWAPGGLSSPAPEAPGRKAADPSPRAPRKAHLVLRRIEP
FT                   WSAMKFSFVVSLVCFVVLFVAVAVLYMVLSGLGVFDNIIQTVNQLTTADGKSTSGVDVA
FT                   SWFEPVRILGYTALIGAVNVVLITALSTLGSVIYNIASDLVGGVEVTFSEAE"
FT   gene            13319..13392
FT                   /locus_tag="Sros_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            13319..13392
FT                   /locus_tag="Sros_R0001"
FT                   /product="tRNA-Ile"
FT   gene            complement(13462..14170)
FT                   /pseudo
FT                   /locus_tag="Sros_0010"
FT   gene            complement(14215..14406)
FT                   /locus_tag="Sros_0011"
FT   CDS_pept        complement(14215..14406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83072"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVV3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83072.1"
FT                   /translation="MMPLEECVSPHLVMAQRDHVRLDWRKPYRALERVRPTAWTCACWA
FT                   TVYELCEGGGRAFLRRTI"
FT   gene            complement(14403..14687)
FT                   /pseudo
FT                   /locus_tag="Sros_0012"
FT   gene            14832..16088
FT                   /locus_tag="Sros_0013"
FT   CDS_pept        14832..16088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83073"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVV4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83073.1"
FT                   /translation="MGTPGTPPEWAARLREKRKAKVGTVADMARRLKEAAGEQRGRLPS
FT                   IDDLTRTIRGWERGDHYPSERYRLLYARALRTTEAELFDLAERPSVPVPALPLPSVAPD
FT                   ADLFERIARSVQQPSRVDQRTVDWLAICLAEHRKVEDTIGARPLLGIVRSQLGVVVELA
FT                   QHARGSLADTVVDLAAQYAQFVAWMSLDVDDQAAALAWYDRAHDWALEIGDVNMATTTL
FT                   SMKAHQAWSAGNARRCVRLADAARRHDGQVTPGVRGMAAQMAARGHALAGDARPARTLL
FT                   DEAEALIRQAAEHADDEPVWMYFYDETWFRLQRGMTELQLGNWSKAIDLLTDGLSGLPE
FT                   SYKRDRAWYGSCLAKAHAEAGDAAAAVQVSLPIMADAVALNRHARKELIDVAALITNRR
FT                   SPQGGLLEEALAAADRRNG"
FT   gene            complement(16098..16709)
FT                   /locus_tag="Sros_0014"
FT   CDS_pept        complement(16098..16709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83074"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVV5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83074.1"
FT                   /translation="MTSSPAEFHWLSDEGPLDDIFCISFIRGLPPLEVLARLGVDEITI
FT                   KEMTFDEFNELAVEQWISTGGDAPDYVGAVKLGNWAILVEPLGWRVPTYPNVLNRLSEG
FT                   TEVVSVSRHEYASDEFVHVINRDVIVRFDPLSPQYRTGVDPKRWEAVMARVGLGPFTSD
FT                   DSMPDDPIASAFALASEITGVSFTADVLDQPFLVAVATTE"
FT   gene            17425..17706
FT                   /locus_tag="Sros_0015"
FT   CDS_pept        17425..17706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpi:Rpic_3544 heavy metal
FT                   transport/detoxification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83075"
FT                   /db_xref="GOA:D2AVV6"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVV6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83075.1"
FT                   /translation="MCTACACGTQDSTAAQVEITEGKVYTVSGMTCGHCVSSVSAEVES
FT                   VGGVTGVQVDLATGLVTVSGTGFSDEEIRAAVEQAGYTLAGASPVGAS"
FT   gene            17862..19283
FT                   /locus_tag="Sros_0016"
FT   CDS_pept        17862..19283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0016"
FT                   /product="EmrB/QacA family drug resistance transporter"
FT                   /note="KEGG: bur:Bcep18194_A3935 EmrB/QacA family drug
FT                   resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83076"
FT                   /db_xref="GOA:D2AVV7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVV7"
FT                   /inference="similar to AA sequence:KEGG:Bcep18194_A3935"
FT                   /protein_id="ACZ83076.1"
FT                   /translation="MNAVNPRRWQALIVLAAAQFMVIMDTSIIGVALPDMQRDLGFSQG
FT                   SLQWVFNAYVVAFGGLLLLGGRLSDLFGARKIFTTGWVILIAGSVVAAAAGNAWVEILG
FT                   RAVQGVGGALIAPAAMTLLMMLFGHNPRELGKAMALYGAAAPAGGTAGVFLGGVITQYL
FT                   SWPWVFIIYVPIGLATLAAVPALLPATQGKRGSVDVLGAIAVTAGIALAVYTIVSAPEQ
FT                   SLTITLIEGVGAAVLLGLFLVIQRSVREPLMPLKIWKAPGLAAANLAMALLGAAWIPMW
FT                   YFLNLYLQQVLGYGAFASGAALLPMTVAIMIFMIGITARLLGKFGAKPLIVLGLLVLAA
FT                   GVAGLSLVRPDGAFVSDVLPASLIAAVGMSLAYIPAMMSAMSGARPEESGLASGIVNTT
FT                   YNVGSALGLAVMTAVATSQGAAEMGNLLKLTDGFQAAFVGAGVLAAGGAVLTLALMRRP
FT                   GRAVQEGPVTEKTGA"
FT   gene            19379..19660
FT                   /locus_tag="Sros_0017"
FT   CDS_pept        19379..19660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3495 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83077"
FT                   /db_xref="GOA:D2AVV8"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVV8"
FT                   /inference="similar to AA sequence:KEGG:Adeh_3495"
FT                   /protein_id="ACZ83077.1"
FT                   /translation="MAGCGDRKQGLAMRLRRVEGQVRGLQRMVEDDKYCIDTLTQVSAV
FT                   TSALRSFALSLLEDHVAQCVTAPAPKGGPETTARVKEATDAIARLVRS"
FT   gene            19682..19894
FT                   /locus_tag="Sros_0018"
FT   CDS_pept        19682..19894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0018"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="KEGG: bmn:BMA10247_A2118 copper-translocating P-
FT                   type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83078"
FT                   /db_xref="GOA:D2AVV9"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVV9"
FT                   /inference="similar to AA sequence:KEGG:BMA10247_A2118"
FT                   /protein_id="ACZ83078.1"
FT                   /translation="MSTAIYTVKGMTCGHCVSSVKEEVTEVAGVTGVEVDLAGGLLTVE
FT                   SDSPVETAQIIAAVEAAGYEVADRS"
FT   gene            19891..20907
FT                   /locus_tag="Sros_0019"
FT   CDS_pept        19891..20907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0019"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_3773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83079"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVW0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83079.1"
FT                   /translation="MNTPAKLVTYVAGLAVVFGAALGVGSAVGEVGAPPETTTRGEGTA
FT                   PSAGHGDSTGHGDRGDATTTPAQAAAQNTPGGLQVSENGYTLTPLTATIKPGEPADFRF
FT                   TVTGPDGRPVTDYQVQHDKKLHFIVVSRDLGSFQHVHPVEAGGGVWSVKLTFPAAGTYR
FT                   AFADFAPTGASALTLGTDVLVAGDYAPKALPQASRTVGVDGYTVTLEGDLTPGQASKLT
FT                   LKVSKDGKPVTDLQPYLGAYGHLVALRARDLAYLHVHPDGAPGDGKTQAGPEIVFYAEV
FT                   PSAGDYRLFLDFQHEGEVRTADFTLGAGEATAASTAGPSAGPSSSKGTDHDSTPHSH"
FT   sig_peptide     19891..19980
FT                   /locus_tag="Sros_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.871 at
FT                   residue 30"
FT   gene            20939..23179
FT                   /locus_tag="Sros_0020"
FT   CDS_pept        20939..23179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0020"
FT                   /product="heavy metal-transporting ATPase"
FT                   /note="KEGG: bar:GBAA3859 heavy metal-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83080"
FT                   /db_xref="GOA:D2AVW1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVW1"
FT                   /inference="similar to AA sequence:KEGG:GBAA3859"
FT                   /protein_id="ACZ83080.1"
FT                   /translation="MTSVTDDLQNAVELSIGGMTCASCANRIERKLNKLEGVTATVNYA
FT                   TEKAKVTFPEGIDPQELIATVESAGYTAALPAPPKSEAAAGEQGPEDELRPLRSRLITS
FT                   VVLAVPVIAMAMIPPLQFTNWQWLSLTLAAPVVVYAGWPFHKAAWTNLRHGAATMDTLV
FT                   SLGTIAALGWSLWALFFGTAGTPGMIHPFAFTIERTDGSGNIYLEAAAGVTAFILAGRY
FT                   FEARSKRRAGAALRALLELGARDVAVLRDGTEVRIPTDQLAVGDRFVVRPGEKIATDGV
FT                   VEEGSSAVDASMLTGESVPVEVRPGDAVTGATVNAGGRLVVRATRIGSDTQLAQMAKLV
FT                   EDAQTGKAQVQRLADRISGVFVPVVIALALGTLGFWLGTGDGVGAAFTAAVAVLIIACP
FT                   CALGLATPTALLVGTGRGAQLGILIKGPEVLESTRRIDTVVLDKTGTVTEGRMTLTDVH
FT                   LADGEDENEVLRLAGALEHASEHPIAQAVAKGASERVGALPTPEDFANVEGLGVQGIVD
FT                   GHAVLVGRPKLLAEWSQHLNADLERSLHAAQAAGRTAVAVGWDGKARAVLVVADTVKPT
FT                   SKEAIQRFRALGLTPVLLTGDNEAVAKSVAAEVGIDEVIAEVLPADKVDVVRKLQGEGK
FT                   VVAMVGDGVNDAAALAQADLGLAMGTGTDAAIEASDLTLVRGDLRVAADAIRLSRRTLG
FT                   TIKGNLFWAFAYNVAALPLAAMGLLNPMIAGAAMAFSSVFVVTNSLRLRRFK"
FT   gene            complement(23422..24099)
FT                   /locus_tag="Sros_0021"
FT   CDS_pept        complement(23422..24099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_03439 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83081"
FT                   /db_xref="GOA:D2AVW2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR013653"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVW2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83081.1"
FT                   /translation="MTTPEQRLIDHLSRWLGGRPATTGLDVIAEPGRVRPGWDGRIHPV
FT                   LGVGSPQGGILSVPPEHAEAIADQYARSLDLATFGPMIPPLAGFPERGWFTAVYRWTTR
FT                   PAPLADAGVWVPAHDPEAPEWLRPFGGEVLIARDPESGAHLAGVGVKRHDDYGRELAVV
FT                   TAPQARGRGLARRLVAQAARRILDEGAIPTYMHALDNRASAAVAEAAGFPDIGWQAFGA
FT                   TEH"
FT   gene            24157..24684
FT                   /locus_tag="Sros_0022"
FT   CDS_pept        24157..24684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0022"
FT                   /product="alkylhydroperoxidase"
FT                   /note="KEGG: xau:Xaut_0970 alkylhydroperoxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83082"
FT                   /db_xref="GOA:D2AVW3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVW3"
FT                   /inference="similar to AA sequence:KEGG:Xaut_0970"
FT                   /protein_id="ACZ83082.1"
FT                   /translation="MRRLTALDPANAPEKSRELLNDIVERRGSVGEMVSTMAHSPALLQ
FT                   GYLDFSRAMRRIKVPRALSEKISLAVQEWIGCAYCLDAHAEAGRAAGLSETDIALARQG
FT                   TSTDTREAALIAVAVRVLAEPSSLTDEDVAELRAHGWSDRIIAEIVGLVTLNLLTGAFN
FT                   LLAGLEPAERTA"
FT   gene            complement(24757..25707)
FT                   /locus_tag="Sros_0023"
FT   CDS_pept        complement(24757..25707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0023"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pau:PA14_31050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83083"
FT                   /db_xref="GOA:D2AVW4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVW4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83083.1"
FT                   /translation="MTAAVVLALYAVVAVVTLPRLLIRGELAERAPRLAIAVWLAACTS
FT                   AVASVILSALAAAVPATVIGHGLAEFFEACAAMLSHGAPLTSPGTRAALLGAAVIAARI
FT                   TYCGAAILVRARRERRQHAGMLNIIGRHDGELDAVVLDHDEAAVYCLPGRKGRAVITTA
FT                   ALRSLAPEQVAAVLAHEQAHLRGRHHLVLAAAEAFHRAFPGLPLFTRARSEVARLVELL
FT                   ADDVAARRHSRIHIAAALVRLATGRAPAFALGAGGETALTRVKRMLNPAAPLGHRERIA
FT                   GLSAVVLLLAGPAAVAATPGLRSFLAHHCHNISIF"
FT   gene            complement(25704..26072)
FT                   /locus_tag="Sros_0024"
FT   CDS_pept        complement(25704..26072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0024"
FT                   /product="transcriptional repressor, CopY family"
FT                   /note="KEGG: sus:Acid_1031 CopY family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83084"
FT                   /db_xref="GOA:D2AVW5"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVW5"
FT                   /inference="similar to AA sequence:KEGG:Acid_1031"
FT                   /protein_id="ACZ83084.1"
FT                   /translation="MRGLGDLESAIMNRLWAYRRPASVRDMLEDLRREREIAYTTVMTV
FT                   MDKLHTKGLLRRKAVGRAYVYETVATKEAYTADLMRSTLASGGNQAATLVHFLERLTPE
FT                   ESAALEAALKVYPPGGRS"
FT   gene            26497..27105
FT                   /locus_tag="Sros_0025"
FT   CDS_pept        26497..27105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0025"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csa:Csal_2715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83085"
FT                   /db_xref="GOA:D2AVW6"
FT                   /db_xref="InterPro:IPR025509"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVW6"
FT                   /inference="similar to AA sequence:KEGG:Csal_2715"
FT                   /protein_id="ACZ83085.1"
FT                   /translation="MSEPMHHMDHAGHGEHGGHHGHDSHAQAGPSHAGHSHAGPSHAGP
FT                   SHAGHSHAGHSGKVTWRAAASATLHCLTGCAIGEVLGMVIGTALGWSNAATIVLAVVLA
FT                   FFFGYALTIVGLRKSGLGWRRIVRLALAADTVSIIVMEIVDNGVMMVVPGAMDAGLASG
FT                   LFWGALAFALLVAFLITTPINKWIIGKGKGHAVVHAYHH"
FT   gene            complement(27114..29936)
FT                   /locus_tag="Sros_0026"
FT   CDS_pept        complement(27114..29936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0026"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce7795 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83086"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVW7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83086.1"
FT                   /translation="MSPFGALREQLLGAATAFADAPGALPGILSGLVDDVDRALREELE
FT                   IFPVCHHSPASALAMVRRLREKQPKVIYLELCEDLQPLLDELRNCRLPVALQAFASEID
FT                   GFPPDWGPLSVVAPITEASAEYQAIAYALDTPGVELVLVDRSADHVFQWLPREPAAPAA
FT                   ADADDDTAGHGEEAALHGDAVGVEIGDLRPRFAELEEHLLHHGKVRHWSEWWDQYVEQP
FT                   LAGADYDTYRQVMVLIGSLFRRLGPDEGDRLARDEDRERYMWTRMREHLAASDADPSQC
FT                   LYVCGAFHAASRVEQFGLAAEAPAYDISPRTATRWLYGLIPSSHSAIEAQFALASGSVS
FT                   IAAATWTKAVARHGVTPYRLEGQKGAGKRPGRARPAAPVPQGPVTDRLSGFLANPPALD
FT                   GLDEAELLGWCVDIVRLARRNGYLASTADAIAVFETSILLAGLRNRARPTPYDFQDAAV
FT                   TCIEKDVVPGRRDVRRLCEILLGGDRIGEVGYRALPPLAQDVYDRLKPLGLDLEKRTQQ
FT                   RALLNLDAEPELVPCSHLLWILRYLLPEDAVRPIMGTRRLGERPIQESWDLAIGRHQRS
FT                   IIELGYEGVTVEQVLEQRLRRTVWAPEATAAVALAAVEDATLYLGSRRFTDELGGRAVE
FT                   LLAAERTVDDAPDVLRRIRRLLAHYRATEPVLPAWCEAFVTTGYAHYCTLLPTAFVDEE
FT                   VGVRQVAAMLGFLSSMESLALALGCDRAQLELAVRQSHPEAPAKVALLWAAQFRLGMLP
FT                   QAELRSRCDELLANPLVVPAFPLYMSGFVQALEPVPALAPFVVEVMSKAFARLPDAVLL
FT                   PWLPKLITTLRDQARELVPVLVREAGRTFPAGLSSVDTWVPPWSARETPKAVAGPVPAA
FT                   AGPVADLLAGHPAACDAVAVLLGCEAGWRPSVHLAGGPEHPEVADLLVRHPEAADAVAG
FT                   LLDRRSASGR"
FT   gene            complement(29933..31048)
FT                   /locus_tag="Sros_0027"
FT   CDS_pept        complement(29933..31048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce7794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83087"
FT                   /db_xref="GOA:D2AVW8"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVW8"
FT                   /inference="similar to AA sequence:KEGG:sce7794"
FT                   /protein_id="ACZ83087.1"
FT                   /translation="MTDEMLRAPAEVKYADELDWLESVDDGPKPFSWRLSPRMVRLFVL
FT                   GSERSDGLDREISQKWFGDRSFVERAIVTLASDRGLLLIGDPGTGKSWLAELLAAAVCR
FT                   NSTLVVQGTAGTTEDHIKYSWNVSMVIAKGQSRESMIPSPIMTAMEQGVIGRFEELTRS
FT                   TSDVQDALISILSEKYVSVPELDDDNIVFAQPGFSIIATANSRDRGVNDLSSALKRRFN
FT                   FIRIPVVTNKRSEAEIVRFRTTELLRRHRIELDLPPTLLDILLQSFADLRAAAASATSD
FT                   DEKLESALSTAEQIGVIEDAILHSHFFGDRTLRAETLAGSLVGSLARRSPEDLAILNKY
FT                   WHGVVEPRSKQEGGEWKDFLEGGRQAISTLS"
FT   gene            complement(31061..32506)
FT                   /locus_tag="Sros_0028"
FT   CDS_pept        complement(31061..32506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1557 VWA containing CoxE-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83088"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVW9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83088.1"
FT                   /translation="MSDSRISADENRRQVLYWRLLARLFDGDEQPSLEAASMAIVGDLG
FT                   LPPALLDPAVSVDNIVQRFPELGAELQGLLAQEDGVASASTEGHPPGREGEDDVAPATG
FT                   DGHLPDEAEDGVASAPAGGHSPERAGAAEVRRAALVSKLLLNVFSTGTGSVSATDLARW
FT                   QQDAGWFEQALGAEPGQLRSRPGGGELAGVLAGLEGDLVRRMRLREVLADSALAARLTP
FT                   SMSLIEQLLRDKSNLSGVALANAKALIRRFVEEVAEVLRTQVEKTSVGVIDRSVPPKRV
FT                   FRNLDVERTIWKNLTNWSPEDQRLYVDRLYYRQTARRTTPARLIVVVDQSGSMVDAMVN
FT                   CTILASIFAGLPKVDVHLVAYDTRALDLTPWVHDPFEVLLRTTLGGGTNGTVAMAVARP
FT                   KIADPRNTVMVWISDFYDNRALITDFEAVHRSGVKFIPVGSVNSSGHQSVDPWFRQKLK
FT                   DLGTPVISGHIRKLVFELKNFLA"
FT   gene            complement(32503..33903)
FT                   /locus_tag="Sros_0029"
FT   CDS_pept        complement(32503..33903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_3854 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83089"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVX0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83089.1"
FT                   /translation="MLAVQLAELLDGVPPGVGEALDLVTGFDDSLVHGLARLSEERATA
FT                   LTSLAGALSATPLGGRVGEAAGKLAAGSVTEEHLTALAGGRAALFGAVHDALLARLDAA
FT                   LGRVRAPWEEPPATPAPAADNLLSGCRSWLGELAITGWRGVDHDLVSASSQTIEALLPE
FT                   PGLRRLAVLLDGLAAELRASCPVGTVERLPARRWADLWTRALLLSQAGGLPGGSESAGV
FT                   VSGRLLILGVDVHEHGTAVQMQVHGVLEPADGAPSRLVRTSVAAAKVDTIVGPALWRLL
FT                   GGYPALLGALAERRSLDVTDLPLLGSGDLVWHDDRARVGEPVDPFATARLQLAGALAPA
FT                   VPPLDRHPVRIAEPVLVEGYRVAADGTLDLGGGTLAVDVDRLPACGPLTPKLVASSSAC
FT                   IGLIRWDGGRWLLQPLAVQTTVKRQTVERHNGDWALGPTDPKVVKAEARAGDAVAVLRE
FT                   RAGRLLRR"
FT   gene            complement(33903..34394)
FT                   /locus_tag="Sros_0030"
FT   CDS_pept        complement(33903..34394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83090"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVX1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83090.1"
FT                   /translation="MNADGAAWEQRSVARVVSPVQPRKLASVPFVELADGRLQGVVSSG
FT                   SDIARVYVSSITAGTHAFNCSTNNNRPCGGLRGSPCKHLQALAGEAVLQYGLDQVARYL
FT                   HVEVGDGANLMSCLNGRHEPTPGAMVFSRFLRHLSYLELPDTTEPIAEMHWFPATGAVR
FT                   "
FT   gene            34790..36136
FT                   /locus_tag="Sros_0031"
FT   CDS_pept        34790..36136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0031"
FT                   /product="cell division cycle protein 48-related protein"
FT                   /note="KEGG: scl:sce5713 cell division cycle protein 48-
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83091"
FT                   /db_xref="GOA:D2AVX2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVX2"
FT                   /inference="similar to AA sequence:KEGG:sce5713"
FT                   /protein_id="ACZ83091.1"
FT                   /translation="MLDDAGLQALREAARFSPDNLPLRRHLADQLLTKGYLAEAEAEYR
FT                   AALMLAPQDPDITTGLAEAFTRQSSYGTALSILEPHLATPGYPPRMGVIAARALLGEGD
FT                   TAGAGYRYHEAVSRDPSAADPDLAARLAPPPRQPVVAPPQPVAASPDLPHETSAEVERS
FT                   RFTFADVAGMDAVKEALRIKLLLPLQQPELFAAFGKRAGGGVLLYGPPGAGKTHLARAA
FT                   AGELGAAFVNVGLADILDMYIGSSERNLRAVFEMARRNRPCVLFFDEVDALAARRSDMR
FT                   QAHTRQLVNQFLAELDGVDESANEGVLVLAATNAPWYVDVAFRRPGRFDQLVFVPPPDA
FT                   AARAAILRLLCRDKPLAEMDYDAVARITDQFTGADLKGLVDRAVEAKLQQSISAGRPIP
FT                   LSTPDLLAVARQVKPTAVREWLATARNYVMHANESGAWDELMPWIKGSR"
FT   gene            36133..37368
FT                   /locus_tag="Sros_0032"
FT   CDS_pept        36133..37368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_1870 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83092"
FT                   /db_xref="GOA:D2AVX3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVX3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83092.1"
FT                   /translation="MTTQASLERARGLLDLRRPAEAARELRGAIAQDPQHPTAHALLAV
FT                   ALIERGEVAEAAAEADEAVRLAPDFWFTHYTAGQVYHRARRPDRALPAIEASLALSPEY
FT                   APTWELLARVRVQGEQWAEAAQAARQGLRIDPQDSDLVSLLAVSLVMLGDAAEARPAAA
FT                   QAVRLNPESATAHLVYGRAELAFGDPGRAAEAFREVLRLDPGFDHARDLLVLALKRRNP
FT                   LYRVLTRLRGRFRGGWRLVLLLPMMPPLVAVFVLIAVLHWAAWVAESWATLRLHRGRAT
FT                   RLLLEGAQARVAALCCVLPVAGAALLASGAVSGLTAVGTAGAAVMALVTPVQEAANTGS
FT                   RRGRSVLYGWAALLTLAIVASLVLAALPATAGAGATVALLSTYAALATIWVATAVRRAT
FT                   GRGTPDRAGAGP"
FT   gene            complement(37445..38170)
FT                   /locus_tag="Sros_0033"
FT   CDS_pept        complement(37445..38170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce6114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83093"
FT                   /db_xref="GOA:D2AVX4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVX4"
FT                   /inference="similar to AA sequence:KEGG:sce6114"
FT                   /protein_id="ACZ83093.1"
FT                   /translation="MPGGRLTHQDRRQIAEGLAEGLTYTEIAGRLDRPISTVTREVTRN
FT                   GGAAGYQADRAHQATEGRARRRKPSPSPAPPATGDAHGRDLEAVHGLEEQFTAMMINTG
FT                   LPRMTARVLTCLYVTDSGSLTAAELVQRLQVSPASISKAVGELEQQELIRRERDPRRRR
FT                   DRYVIDADAWFRGWMAGARQNTMLADIARQGAEILGATTPAGTRLQDIGQFFEHVGHHM
FT                   VQAAEQWRQACAARRTADG"
FT   gene            38467..39645
FT                   /locus_tag="Sros_0034"
FT   CDS_pept        38467..39645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0034"
FT                   /product="alkaline D-peptidase"
FT                   /note="KEGG: bar:GBAA2661 alkaline D-peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83094"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVX5"
FT                   /inference="similar to AA sequence:KEGG:GBAA2661"
FT                   /protein_id="ACZ83094.1"
FT                   /translation="MTTSLPAKAGLLVAAVTMAGAALAAPAATASTASGHAGVQRALDH
FT                   AVARSGAPGIVAEVRDGRERWFGSAGAADTETGRKRRPHERFRIGSATKAFTATVVLQL
FT                   AAERKLSLEDTVEEWLPGLVKGNGYDGSKITIRQLLNHSSGIFNYGNDKAFFATGQGAA
FT                   WFEHRYDEYTPEQLVKIGLANPPYFEPGKGFGYSNTNYFLAAMIAEKATGRTYGEELTR
FT                   RILRPLGLTGTYLPDDEAKIRGAHPRHYSTLFSQDANPTIYDATEMKQSFAWAAGGVVS
FT                   TTGDLDRFFGALLGGRLLPSAQQQEMFTTIATEGGPQWIPGTRYGLGVFAQKLSCGVTL
FT                   WGNAGATYGSWVYAMGTRDGKHMVTSQVNGDWSGLSVFDDVLAAEFCPAESR"
FT   sig_peptide     38467..38541
FT                   /locus_tag="Sros_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.884 at
FT                   residue 25"
FT   gene            39788..40996
FT                   /locus_tag="Sros_0035"
FT   CDS_pept        39788..40996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce6113 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83095"
FT                   /db_xref="GOA:D2AVX6"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVX6"
FT                   /inference="similar to AA sequence:KEGG:sce6113"
FT                   /protein_id="ACZ83095.1"
FT                   /translation="MAKPLSATAPTHVTTRSLAPDLARGFMLLLIALAHAPAFVGDWDA
FT                   GPAALNTAAKFVKSLFADNQARSMFVLLFGYGLGQLAHRQHARGDDWTSVRKLLRRRAF
FT                   WLIVIGFANTVLLVPIDIIAVYGLTLLVLAPLVRARDSVLWWTSILTLIPATLLLAWQS
FT                   VAAQAGPVTMAEFMEPTFGAHLVASIPSWPVETAISTIIVVPGMLVGIWAARRRILDEP
FT                   ERHASLLRRITVIFIGVSVIGRLPAALLAAGAWTTTSAPIGWTIAIAHDLTGYAGGIGM
FT                   AAAAGLVAIRVRRGRLITALAALGQRSLTFYLLQSVVWVALFYPFTLGLRDDMSFAATF
FT                   GIAIGLWVASVLLAEWMRRAGYRGPAEVLLRRLSYRRPAPASVSDEPHGSPARQGENAG
FT                   HRL"
FT   gene            complement(41245..41949)
FT                   /locus_tag="Sros_0036"
FT   CDS_pept        complement(41245..41949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0036"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: psb:Psyr_2378 transcriptional repressor TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83096"
FT                   /db_xref="GOA:D2AVX7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVX7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83096.1"
FT                   /translation="MPRDTLTKEQIIQTAIELLDDEGLDGLNMRSLGKRLGTVATAVYW
FT                   HVKNKDDLILLVGDRLWDEVELPDLDTVDWRTAATAMATSLHAMFSRHPWLVQAFGSHL
FT                   FYGPGKARHDDHNLAVYETAGFAGTQADRAAATVFTFVLGNVLGVSATVSLTRRLSRDG
FT                   ADAEALFQDTMAKASEVAMQFPRLRARLETPAAVDYAIAPEQTFGFGLQTLLDGLEAEL
FT                   AGRHVPTGPQAR"
FT   gene            42093..42611
FT                   /locus_tag="Sros_0037"
FT   CDS_pept        42093..42611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83097"
FT                   /db_xref="GOA:D2AVX8"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVX8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83097.1"
FT                   /translation="MNAFTAAMQLLVATAFVSIPLVRHRYGSTAMAAAQAELTRQGVRT
FT                   TVLDENGMRFDAGGHETWAPVSIAAVMAAAAAANLFDGSWAEPLTWIFQTIVLLINCVI
FT                   LYSQLTATKSVQAAFQRKGDPMLARIDVPALLKAAEGGFPSWTWTLQNVRHAVVFGTSI
FT                   LALAATAIA"
FT   gene            complement(42800..43360)
FT                   /locus_tag="Sros_0038"
FT   CDS_pept        complement(42800..43360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0038"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swp:swp_3997 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83098"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVX9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83098.1"
FT                   /translation="MPRDMPKHLVRVSDGDRDRIVQRIQWAFTEGHLTPEELDERLERA
FT                   LTATSDGDLMPAVAGLPDDRMEDVVQLKSTSGRVRRVGEWSVPRVLRIESKYGGVVLDL
FT                   SRTVIDYPEIEIELQLRYGSATIVLPSGATANADGAQTEWGEVICTVPGRARPGKLHVR
FT                   VTGELAYGRLRIRYPRKWFKPRR"
FT   gene            complement(43461..44264)
FT                   /locus_tag="Sros_0039"
FT   CDS_pept        complement(43461..44264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0039"
FT                   /product="ABC-2 type transporter"
FT                   /note="KEGG: ank:AnaeK_4023 ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83099"
FT                   /db_xref="GOA:D2AVY0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVY0"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_4023"
FT                   /protein_id="ACZ83099.1"
FT                   /translation="MNALQMAIADGMTITKRNTLKIKRAPDLLGGAIILPIVFVLLFAY
FT                   VFGSMIDIPGMSYQEYMIPGIFVQTVIMSGQITGYTLVLDLQKGVFDRFRTLPMAPSAV
FT                   LTGQTVADVLMNVSSVVAMSVMGLIVGWRIHSAPHEAVLGFLLLLLFAYAFSWVTATVA
FT                   LALRTPEVFNNIATVVSMPLVFLSNAFVDSARLPGPLKAVAEWNPVSTIIQAVRELFGN
FT                   THPAIPVPDAWPLRHAVVASLLWSALLLAVFVPLSTRLYKKAVSR"
FT   gene            complement(44261..45226)
FT                   /locus_tag="Sros_0040"
FT   CDS_pept        complement(44261..45226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0040"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: aeh:Mlg_2715 daunorubicin resistance ABC
FT                   transporter ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83100"
FT                   /db_xref="GOA:D2AVY1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVY1"
FT                   /inference="similar to AA sequence:KEGG:Mlg_2715"
FT                   /protein_id="ACZ83100.1"
FT                   /translation="MPPAVVAEGLVKKYGDVMALDGMDLSVPEGTVFGLLGPNGAGKTT
FT                   TVRILTTLLKPDAGHATVAGFDVVGDAQRLRSHIGASGQYAAVDDHLTGAENLEMVGRL
FT                   YHLGTKRSKERARELLECFDLTQAADRPVQGYSGGMRRRLDLAGALVANPPVLFLDEPT
FT                   TGLDPRARAGLWDVISELVAGGTTLLLTTQYMEEADRLADRIAVVDHGRVIALGTADEL
FT                   KDQVGGDRIALTVTDPADLETARRLLAPLAVGEMQADTTALQVTVPVNNGAASLTNALA
FT                   RLAAEGVTVRDAGLRRPTLDDVFLTLTGHEAAENVKEHSR"
FT   gene            complement(45297..46139)
FT                   /locus_tag="Sros_0041"
FT   CDS_pept        complement(45297..46139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0041"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_5722 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83101"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVY2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83101.1"
FT                   /translation="MPTFDTPEPIFAVIDLAAADVRIHAGDRADTVVEIRPKDASDDAD
FT                   VQSAAQTQVDYSQGRLLVKTPKSTIRSWLWWGGSVEVRIELPADSRVEARTTGDFHCGG
FT                   RLGESRFDTAGGDIWLDRTGKLQLNTADGDITVIRSAGHTDVTTANGEIRIREIDGTAV
FT                   VRTANGAIALGEVTGDLRLRTAYGDITVDRALAGVDAKTATGDVRVGEVVRGPVVLETS
FT                   SGAIEAGIRAGSAAYLDVKTEYGSVHVALDPCDGPGQDDESVEVRARTSDGDIVIRRS"
FT   gene            complement(46222..46788)
FT                   /locus_tag="Sros_0042"
FT   CDS_pept        complement(46222..46788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0042"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_3094 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83102"
FT                   /db_xref="GOA:D2AVY3"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVY3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83102.1"
FT                   /translation="MDLAPYVDNLRRELAVAAEASGPDARALAERLTASLESAVRLTLL
FT                   EALSAAAGEITRDLAPGSVDVRLRGRDLDFSVTPAPAERAPEQARGSSLRSALAGAVEV
FT                   AMGVRAPVPETPSEADEGGTSRVSLRVPDHLKSRIEKAAGREGLSVNAWLVRAVSAALE
FT                   PGDEGRRSDRGGDPRTGRHYTGWVR"
FT   gene            complement(47427..48071)
FT                   /locus_tag="Sros_0043"
FT   CDS_pept        complement(47427..48071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0043"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: baa:BA_2332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83103"
FT                   /db_xref="GOA:D2AVY4"
FT                   /db_xref="InterPro:IPR001820"
FT                   /db_xref="InterPro:IPR008993"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVY4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83103.1"
FT                   /translation="MRHRVLAVLLLVAATLAIAPGTACACSCAPFEPKDQMEQSAAVFT
FT                   GTVTAVHQVEGDPLGPRPPIVYTFHADQVYKGRADAAFQVATNSDGASCGYSFDIGTRY
FT                   LVFASTGQTGMFETDPGVPLHTTLCSGNRMVRAGKDPLRPKDAIPDVSPLTSELLAALG
FT                   TATRPAATAAPSSPQASQDGAVSLWIYAGAVVGALGLASAGWWLFRRRGRS"
FT   sig_peptide     complement(47994..48071)
FT                   /locus_tag="Sros_0043"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 26"
FT   gene            complement(48068..48274)
FT                   /locus_tag="Sros_0044"
FT   CDS_pept        complement(48068..48274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83104"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVY5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83104.1"
FT                   /translation="MHALVRLDSHGEGLRLLEDTTLFPSRPTMPSDHVEEQGRRLVVQV
FT                   APPLSTIRHPLSNRCSERYVMEA"
FT   gene            49147..49668
FT                   /pseudo
FT                   /locus_tag="Sros_0045"
FT   gene            complement(49961..50611)
FT                   /locus_tag="Sros_0046"
FT   CDS_pept        complement(49961..50611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0046"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="KEGG: mxa:MXAN_2886 HAD-superfamily hydrolase,
FT                   subfamily IA, variant 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83105"
FT                   /db_xref="GOA:D2AVY6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVY6"
FT                   /inference="similar to AA sequence:KEGG:MXAN_2886"
FT                   /protein_id="ACZ83105.1"
FT                   /translation="MQRLVLFDLDNTLVNLDEAFREWAAEFADEHGLGDKAVNWLLVLD
FT                   QAGYPHREIFFGKVRERFTPPESVEELWSRYRKRMPYLVRCRPEVMDGLSRLRAFGWKV
FT                   AIVTNGTADNQLGKIQRTGLAEAVDAYALSGLEGVRKPDVGLFEIAAKRCGMSLADGGW
FT                   MVGDHPVADIGGGRAAGLRTVWVDRGTRPNQEHEADHVVTDVLQAMEILYGER"
FT   gene            complement(50823..50951)
FT                   /locus_tag="Sros_0047"
FT   CDS_pept        complement(50823..50951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83106"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVY7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83106.1"
FT                   /translation="MRRAYLRLLREDVDILKGATAFFVRERALGGAVRLRNRDPAC"
FT   gene            complement(51332..51463)
FT                   /pseudo
FT                   /locus_tag="Sros_0048"
FT   gene            complement(51524..52027)
FT                   /locus_tag="Sros_0049"
FT   CDS_pept        complement(51524..52027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcm:Bcenmc03_6383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83107"
FT                   /db_xref="InterPro:IPR021087"
FT                   /db_xref="InterPro:IPR038712"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVY8"
FT                   /inference="similar to AA sequence:KEGG:Bcenmc03_6383"
FT                   /protein_id="ACZ83107.1"
FT                   /translation="MSEFINVLIAIDAETILGKYGKNTDPNSPTSIPDSSSLIYMTTRQ
FT                   NQLGSTPGSELTINASPMDIIRWRETTLSLNSEYTSVLYRFNALSGQDLISTPVPRSVV
FT                   LNEPKPSSQDPLNPTTQKINSYYWESEVLDTGTVTYNFSFMILNHKGEKQGYYYWDPYI
FT                   NIQD"
FT   gene            53232..54239
FT                   /locus_tag="Sros_0050"
FT   CDS_pept        53232..54239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83108"
FT                   /db_xref="GOA:D2AVY9"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVY9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83108.1"
FT                   /translation="MFIPISPVSPRYPDHAAPRRLRRLILATAPPLLLLVVPMVLVALY
FT                   GERLPDRVYIGNWAIDTKYEPTWQGWTSQPLFGAVMWCEALLVFSFLRYWRLPQVQRGL
FT                   VVGSFLIGVAVPVSGALWLLALVDAPGVVARPAWHLAVEIAVTAGALALGWAAAGPLPP
FT                   TPVVTATPPPHAPTMTLGPWQRAMFVTSTWSARRLLVAAVMAALTAWAVSNGFGGWQGM
FT                   ALLALLTIFEAAQARTHLQIDGSGITVSLPWLPVLHRTVPYPKVRFAEAMSEPLPGRYK
FT                   LDDGEAGWGIVSGKGPVLALSLSDDRWFLYSTREAETAAALINGWLSRQRQETA"
FT   gene            54239..54604
FT                   /locus_tag="Sros_0051"
FT   CDS_pept        54239..54604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0051"
FT                   /product="transcriptional regulator protein-like protein"
FT                   /note="KEGG: bsu:BSU30460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83109"
FT                   /db_xref="GOA:D2AVZ0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVZ0"
FT                   /inference="protein motif:COG:COG1725"
FT                   /protein_id="ACZ83109.1"
FT                   /translation="MLITVDPASAQPLADQVAGSVRAALANGMAAPGDRLPSARNVATT
FT                   LGINLHTVLRGYQQLRDEGLVELRRGRAAVITDMADQFRLRLTAAAEEFARAALHTGAS
FT                   DEEALAAAREALLAMRA"
FT   gene            54831..55286
FT                   /locus_tag="Sros_0052"
FT   CDS_pept        54831..55286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83110"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVZ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83110.1"
FT                   /translation="MAVPEIIPIGYEPDYHTDTIGHWEGGQFLGSVVAAFPEGYTHTDD
FT                   WPAHKRWYAVLHTFDTAGHHLNSRIERTGTDDNHRTAVDAAQERLKQWLDTLPGHRFDD
FT                   IAIRPFRHEADDVLFGLVIETFEGTEHVELYPNNLGFYEPWDGLYDT"
FT   gene            55525..56703
FT                   /locus_tag="Sros_0053"
FT   CDS_pept        55525..56703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83111"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVZ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83111.1"
FT                   /translation="MIVFTCAGCDASLTLPVSNVALPAHAHQKYGHELLPVLMEPGTYA
FT                   VNPEPSGPPWRRWEKIGAEEAEARGVYAPTYALSYGPPGAVAVALGDVRGTVLIPERCD
FT                   GLCCGLDSRNGPNLACAQCGHAVATLIDDCSYWQVVWLDPRAVRLLDVDAPARRVLSWE
FT                   ELREQPERPPVEPIGAWSPVWEAAVSVALAHLLAASGGARVVVPDGPVADAFRPALDAL
FT                   LPAEPPTRSLALAGPGLPATVTDIALVPQHPQTGETWSSGTVTDIALVPQHPQTGETWS
FT                   SGTVTDIALVPQHPQTGETWSSGTEAAVPLAADVWMYMAFSRNRRLRPASGGLPDGVYR
FT                   DDPPPPLPSSPFRLDRQMFLHALARLPEVRQPWLRAVYDDVQDRRSNLPFWW"
FT   gene            56780..57208
FT                   /locus_tag="Sros_0054"
FT   CDS_pept        56780..57208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83112"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVZ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83112.1"
FT                   /translation="MSVTEFAGVTGDKDRGVAPKSGPYEFWTEKNAHVYLRGTDFKCLT
FT                   YQPGRPPVLWLEFLYDPRWTPSELSETPVVVFRFKGVYFVEWCEDREGHACVTAQPDAP
FT                   AGQVEHFDWDGADLFTLGTFTLRLVLQTGQAEVTVRAK"
FT   gene            complement(57409..57849)
FT                   /locus_tag="Sros_0055"
FT   CDS_pept        complement(57409..57849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83113"
FT                   /db_xref="UniProtKB/TrEMBL:D2AVZ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83113.1"
FT                   /translation="MVDLSRVERQRLVAVTAALFTHGSDDPKLVDVWLHLESVTVIVHV
FT                   AADWTLRITLDEPEESYTMPELGSRVDVVPASDEVPFVRHVGERLVRVIERFDAEAFDQ
FT                   CMEAEFVFDTGSVVAWSLGGDLHLARGGPCRRGPAPGDGDLA"
FT   gene            complement(58251..58635)
FT                   /pseudo
FT                   /locus_tag="Sros_0056"
FT   gene            complement(59056..59682)
FT                   /locus_tag="Sros_0057"
FT   CDS_pept        complement(59056..59682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_3130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83114"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXD4"
FT                   /inference="similar to AA sequence:KEGG:Acid_3130"
FT                   /protein_id="ACZ83114.1"
FT                   /translation="MTFTNRSAARRLALTAAGTGMLVLLTACGGDDRPATAPTGTPGGT
FT                   RVAATSPQPSASFNDADVTFAQMMIPHHEQAVEMAELAESRAGDPEVKELAAKIKVAQD
FT                   PEIAIMNGWLSAWGKPTGPEEGHEGHDMPGMMTGEDMAKLRESEGAEFDRMFAKLMIAH
FT                   HKGAIEMARTEQARGSSPEAKALARNIETTQQAEVEQLQRLLDRL"
FT   sig_peptide     complement(59593..59682)
FT                   /locus_tag="Sros_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.570 at
FT                   residue 30"
FT   gene            complement(59767..60204)
FT                   /locus_tag="Sros_0058"
FT   CDS_pept        complement(59767..60204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0058"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_0266 response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83115"
FT                   /db_xref="GOA:D2AXD5"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXD5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83115.1"
FT                   /translation="MDGPARRHPLRAPRRLLLLITLVLGIAGMHTLGHADHAKERSGTA
FT                   GHGVAAEHRSPEPALVSPPAPESGDGRRVSDADGDLPRLDPASVCLAVLTALLALLLGA
FT                   LWARRRAPRAGTAVLPPAPPVARPPPRRTALRLARLSVLRI"
FT   sig_peptide     complement(60097..60204)
FT                   /locus_tag="Sros_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.710) with cleavage site probability 0.399 at
FT                   residue 36"
FT   gene            60372..60854
FT                   /locus_tag="Sros_0059"
FT   CDS_pept        60372..60854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_0444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83116"
FT                   /db_xref="GOA:D2AXD6"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXD6"
FT                   /inference="similar to AA sequence:KEGG:PSPA7_0444"
FT                   /protein_id="ACZ83116.1"
FT                   /translation="MKVVVLADTHAPRRWKSCPPEVAGHLRGADLILHAGDVCTAGVLD
FT                   ELAAYAPVHVVKGNNDGPDIVAPETLELDLGGLRVAMIHDSGAARGRLARMRRRFPSAD
FT                   LVIFGHSHIPLDESDAGLRVFNPGSPTDRRRQPHGTLGLLRIEDGVLVEAGIVPVI"
FT   gene            complement(60944..61699)
FT                   /locus_tag="Sros_0060"
FT   CDS_pept        complement(60944..61699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bar:GBAA3081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83117"
FT                   /db_xref="GOA:D2AXD7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXD7"
FT                   /inference="similar to AA sequence:KEGG:GBAA3081"
FT                   /protein_id="ACZ83117.1"
FT                   /translation="MVRTFEELVAEAESVSVDGWDFSWLDGRATEERPSWGYSRLVAER
FT                   MAQASAALDVETGGGEVLAGVPRLAPLTVATESWPPNVALATERLRPRGVAVVATGDER
FT                   RLPFGDGAFDLVTSRHPVTTWWEEISRVLQPGGTYFSQQVGPRTAIEVTEFFMGPQPVG
FT                   SGRDPERARAVAEAAGLEVRDLRLESLRMVFHDIGAVIYFLRKVIWIVPGFTVDHYRTE
FT                   LKALHDRIQADGPFLAHTTRFLIEARKPA"
FT   gene            complement(61913..62929)
FT                   /locus_tag="Sros_0061"
FT   CDS_pept        complement(61913..62929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0061"
FT                   /product="homoserine O-acetyltransferase"
FT                   /note="KEGG: bra:BRADO5867 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83118"
FT                   /db_xref="GOA:D2AXD8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXD8"
FT                   /inference="similar to AA sequence:KEGG:BRADO5867"
FT                   /protein_id="ACZ83118.1"
FT                   /translation="MDYDVFDLGDVRLQSGITLPDAKLAYKTYGRLNAGKSNAIVYPTW
FT                   YSGQHYDNEWLIGEGMALDPSTYFIIIPNMLGNGLSSSPSTTPPPHDRARFPHVTMYDN
FT                   VQMQHRLVTERFGVERLELVTGWSMGAGQTYQWAVSHPDMVRRILPFCGSAKTSLHNIV
FT                   FLEGVKGALTADAAWDNGWYREQPGVGLRALARVYAGWGFSQQFYRERIYEREPLGYGS
FT                   LEDFLVGFWEGLFIKRDADNLLAMLWTWQNADVGRTPGFDGVAEALAAIRAPAIVMPAE
FT                   QDLYFPPEDSEWEVAHMPDAELRVIPGAWGHFAGGGLNPVDTKFIDDALKELLAKDV"
FT   gene            63468..64724
FT                   /locus_tag="Sros_0062"
FT   CDS_pept        63468..64724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0062"
FT                   /product="putative membrane transport protein"
FT                   /note="KEGG: yen:YE2035 putative membrane transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83119"
FT                   /db_xref="GOA:D2AXD9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXD9"
FT                   /inference="similar to AA sequence:KEGG:YE2035"
FT                   /protein_id="ACZ83119.1"
FT                   /translation="MHSYRRDLDILRDRRFTLLLVARTISVLGSSFAPVALAFGILALP
FT                   GATATTLSVVLAAEALPMVAFMLVGGVIADRLPRHRVMMAGETINAAAFFCLAAMLLTG
FT                   WTPLPALVTAAAVSGVAMAILFPALTGIIPDVVPADRLQTANALLGLGANSSRVAGLIL
FT                   SGATVVLLGGGWALVVSGAMFAVAAVLIAALRLTPAERSAAGSHSVLADLRGGWREFVS
FT                   RQWLWVVVAQFSVLVMAVQAAHGVLGPLVAKEHLGGAAAWSAILAGEAVGMIGGVFVAL
FT                   RLRPRRPILVGTILTVPTALPYLLLGLGTPLWTIVLGAVVMGVCFDIFGVLWNTTMQRE
FT                   IPAESLSRVSSYDALGSLMFGPVGLLVAGPLAIVIGPRPALLGCAAVVVLSSLAALLSP
FT                   GVRGLRAPAPAEETGALSH"
FT   sig_peptide     63468..63584
FT                   /locus_tag="Sros_0062"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.624 at
FT                   residue 39"
FT   gene            complement(64950..66041)
FT                   /locus_tag="Sros_0063"
FT   CDS_pept        complement(64950..66041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cti:RALTA_B0032 putative polysaccharide
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83120"
FT                   /db_xref="GOA:D2AXE0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXE0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83120.1"
FT                   /translation="MRWGDSMGLLGVGRVGVAVAAAGAVLAGCMPWQGEEPQDKKDTGV
FT                   AAAAKASAAAAGQAALLKARLATAAKVHANELGQIPVLMYHRVVDKPTTQDDRTPQQFR
FT                   AELERLAKEDYVPITAAEYVTGRIDIPAGRHPVVLTFDDSSPSQFDLDGMGAPKPQTAV
FT                   AILQEVAQRHPGFRPVATFYVTRDMFGKTTPEEQAQMLVWLRDKGFDIGNHTRDHKSLR
FT                   GKPEKQVSSEVAAGHRLITELLNTNPVTLALPYGNQPNQKEWGRKGVFGEISYDYGGVF
FT                   LAGYTPAMSPFSKKFDPVGIPRIRSMDKTGDCAKFCSTAWLDWLKANADERYTSDGDAK
FT                   TVAFPKFKAPFVVKRYTDRVLAY"
FT   sig_peptide     complement(65979..66041)
FT                   /locus_tag="Sros_0063"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.678) with cleavage site probability 0.329 at
FT                   residue 21"
FT   gene            66214..66687
FT                   /locus_tag="Sros_0064"
FT   CDS_pept        66214..66687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0064"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /note="KEGG: bba:Bd2755 putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83121"
FT                   /db_xref="GOA:D2AXE1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXE1"
FT                   /inference="similar to AA sequence:KEGG:Bd2755"
FT                   /protein_id="ACZ83121.1"
FT                   /translation="MSEQGGPPGTRARAAAGALFFDEAGRVMIVQPSYKTDREIPGGGV
FT                   EPGETPYEACVREVGEELGIQPPIGRLLAVDWAPHPGIGDLILFVFDGGVLGADTVRRI
FT                   VFADDELTGFGFHSVEDVDDLLNERLARRVRAAVTARERGEPAYLEHGRAVPG"
FT   gene            complement(66730..67140)
FT                   /locus_tag="Sros_0065"
FT   CDS_pept        complement(66730..67140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0065"
FT                   /product="acetyltransferase"
FT                   /note="KEGG: bar:GBAA2404 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83122"
FT                   /db_xref="GOA:D2AXE2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXE2"
FT                   /inference="similar to AA sequence:KEGG:GBAA2404"
FT                   /protein_id="ACZ83122.1"
FT                   /translation="MSTIRYTDAVDTIGADRLAGFFVGWPTPASPEQHLAVLRGSYRAV
FT                   VAIDEETDRVVGFINMISDGVLTAFVPWLEVLPEYQGQGIGSELVRRILADTEHFYSVD
FT                   LLCDASLQPYYERFGMLRLPGMTLRHRSALQG"
FT   gene            complement(67254..67652)
FT                   /locus_tag="Sros_0066"
FT   CDS_pept        complement(67254..67652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0066"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: rpe:RPE_3911 putative anti-sigma regulatory
FT                   factor, serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83123"
FT                   /db_xref="GOA:D2AXE3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXE3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83123.1"
FT                   /translation="MTGDNGQHWPIDDDLTALRQRLLRHAARAGMRGERLDDLLLAVNE
FT                   AVINVLEHGGGKGTLSIWHNDTCITVDVIDNMGDLAPQDIPPERPTGTVRGFGLWLMSQ
FT                   LCDEFSIHQATGESRVRLRMLLHPAPAL"
FT   gene            complement(67824..68195)
FT                   /locus_tag="Sros_0067"
FT   CDS_pept        complement(67824..68195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0067"
FT                   /product="anti-anti-sigma factor family protein"
FT                   /note="KEGG: mca:MCA1431 anti-anti-sigma factor family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83124"
FT                   /db_xref="GOA:D2AXE4"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXE4"
FT                   /inference="similar to AA sequence:KEGG:MCA1431"
FT                   /protein_id="ACZ83124.1"
FT                   /translation="MSTAVHVTVTSDDTLENVSLLALAGELDYTNAERLQHDLQESIGP
FT                   DSRDLIIDLKDLTFCDSTGIQVFLAVRKLVHGRGHSVVLAQLHPRLERLFHLTGLTQAF
FT                   GIQPTVGDAVEALQARQSS"
FT   gene            68808..69092
FT                   /locus_tag="Sros_0068"
FT   CDS_pept        68808..69092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bsr4717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83125"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXE5"
FT                   /inference="similar to AA sequence:KEGG:bsr4717"
FT                   /protein_id="ACZ83125.1"
FT                   /translation="MQVDVKLSPGGDFFEAEVDGKHAGQLEFVRRDGVIVYTHTEVDTE
FT                   FEGNGVGGALVRAALDGARAEGVKVVPRCPFVKTWIERHPDYADLVEGG"
FT   gene            69261..69671
FT                   /locus_tag="Sros_0069"
FT   CDS_pept        69261..69671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bsu:BSU23750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83126"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXE6"
FT                   /inference="similar to AA sequence:KEGG:BSU23750"
FT                   /protein_id="ACZ83126.1"
FT                   /translation="MLHHIELWVPDLGRAVRSWGWLLGELGYQSFQEWSVGRSWALDGV
FT                   YIVVEQSPAMTAPSHDRCRPGLNHLAFRVIGSERVDALVAAAPEHGWTLMFTDRHPHAG
FT                   GTDQYAGYLENEDGFEVELVADRDRSGESRTT"
FT   gene            69732..69944
FT                   /locus_tag="Sros_0070"
FT   CDS_pept        69732..69944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83127"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXE7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83127.1"
FT                   /translation="MARSLARLQGTVGTGRCLTPAGETVKKWGHTVKKLLVLALVALGG
FT                   LLVWRKVQADRAELDLWTEATGSEN"
FT   gene            69974..70714
FT                   /locus_tag="Sros_0071"
FT   CDS_pept        69974..70714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0071"
FT                   /product="phosphatase-like protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83128"
FT                   /db_xref="GOA:D2AXE8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXE8"
FT                   /inference="protein motif:COG:COG0546"
FT                   /protein_id="ACZ83128.1"
FT                   /translation="MVLAQGGGVTPIRLACLDLAGTTIGDIAMVERAFAEAIATQGIVP
FT                   GTGAYARAMVHVHRSRGCPTIEVFRGIFPDNEAQAQAANLTFERSYEGAIGRAGLVPMP
FT                   GTVETLEKLRAADVKICLITGFSRITLNRVLAALSWSDKIDLALCPEDAGRGRPMPDMV
FT                   LAAVLRLGIEDVRQVAVAGDSESDMLCGRRSGASVVAGVLTGVHSKERLLKGGATHILD
FT                   SIADFPTLVLGSEQVETPVCASAL"
FT   gene            71050..72192
FT                   /locus_tag="Sros_0072"
FT   CDS_pept        71050..72192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce6113 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83129"
FT                   /db_xref="GOA:D2AXE9"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXE9"
FT                   /inference="similar to AA sequence:KEGG:sce6113"
FT                   /protein_id="ACZ83129.1"
FT                   /translation="MVSTLGLRPVGEGERRLAPDLARGAMLALIAVANSAAYLYGRPYG
FT                   IRQHIIEHDLPDRVTGALAMTFVDGRAYPMFAALFGYGMVQIWNRRRSDDEGRRVLKRR
FT                   SLWLLVFGAVHGTLLFSGDVLGVYGLLGLALCRLLRVRDRILLILAGAWLVPVALSSAL
FT                   VYSTPHGTAQRSFFWSLAIEDPLTALALRPIEWVMTPVGMMGVVTAALVGVWAGRRELL
FT                   TVPDGLVRRAAVWGPLAGTLGGLPLGLVAGGFLGADGPAAVMALNAAHVVSGIAGGLGY
FT                   AALIALVSRRIGTRRGPLVAALSACGQRSMTCYLLQSVVFVTLLSPYAIGLGGRLGSAA
FT                   TVALAAGTWAATVVAAEFMRRAGVRGPAETLLRRLTYPRR"
FT   gene            72206..73435
FT                   /locus_tag="Sros_0073"
FT   CDS_pept        72206..73435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0073"
FT                   /product="Histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: acp:A2cp1_1965 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83130"
FT                   /db_xref="GOA:D2AXF0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017205"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXF0"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACZ83130.1"
FT                   /translation="MLRIHDWDRVWRALPLGFLGVATLIAEADPSVPSHDRAVTIALAA
FT                   AVAVWHWWMVLAHPDWPERALAPMACYFAGLLALAWVLSSRHPAYGLLVFACFPMAFAA
FT                   LPGRYAYLGVATTALVAVGGPSALLDAESSWQSVPMLTGAVLAAFIGWSIRAMEAEVER
FT                   RHAANRALESANLRLARLGEENAELQGRLLAAARQTGVAGERGRLAREFHDTVAQGLVA
FT                   IVTQIEATEEAVNDADAVRRRLAVVRSLARESLAEVRRSLDDLRPGPLAETRLPEALSA
FT                   LVSGWSATHELPAMLTVTGTARLLHPEVEVTVYRAVQEALANVARHAEAGKTGVTLSYM
FT                   EDVVVADIRDDGVGFDSSGAGGGGFGLTAMRQRVVRLAGNVEVESAPGQGTAVSVTVPA
FT                   IPAEAEREAT"
FT   sig_peptide     72206..72292
FT                   /locus_tag="Sros_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.714) with cleavage site probability 0.703 at
FT                   residue 29"
FT   gene            73432..74055
FT                   /locus_tag="Sros_0074"
FT   CDS_pept        73432..74055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0074"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: aca:ACP_2113 two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83131"
FT                   /db_xref="GOA:D2AXF1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXF1"
FT                   /inference="similar to AA sequence:KEGG:ACP_2113"
FT                   /protein_id="ACZ83131.1"
FT                   /translation="MSVRLVIVDDHPVVRDGLRGMFVEQADLEVVGEAEDGERGLAVAL
FT                   RERPDVVLTDLRMPGLGGAKFIGLLAERVPSARVLVLTTYDGDDDVLPALTAGAIGYLL
FT                   KDSPREEVFRAVRAAALGETVLSPAVAARLLNRVRTPAPAELSGRERTVLALVARGSTN
FT                   KEAAAALFISETTVKTHLAHIYTKLGVSDRASAVAVAYSRGLLP"
FT   gene            74314..76551
FT                   /locus_tag="Sros_0075"
FT   CDS_pept        74314..76551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0075"
FT                   /product="putative terpene cyclase"
FT                   /note="KEGG: scl:sce1440 putative terpene cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83132"
FT                   /db_xref="GOA:D2AXF2"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR034686"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXF2"
FT                   /inference="similar to AA sequence:KEGG:sce1440"
FT                   /protein_id="ACZ83132.1"
FT                   /translation="MQAFTLPEFYMPYPARINPHMERSRAHSAAWARQMGMLDAPKPGG
FT                   GVVWDDAELARMDYALMCAYTHPDCDGPTLDLITDWYVWVFFFDDHFLEQFKYSRDLLG
FT                   AKAYLDHLELFMTADGETPPEPANPAEAGLKDLWERTVPAMSHGWRQRFITSTHNLMVE
FT                   SMWELDNIDRGRIANPIEYVQMRRRVGGAPWSANLVEYAVGAEIPDGLAGTRPMRVLSD
FT                   TFSDAVHLRNDLFSYQREVQEEGENSNAVLVFERFFDCPTQEAAELVNDLLTSRLQQFE
FT                   NTTLIEVPALLAENTVPVHEQLGVAAYVKGLQDWQSGGHEWHARSSRYMNEGAASGPAG
FT                   VLRGPTGLGTSAAVPTLSPARLGLRRRSQQQSHRPFQPVGHLPLPDLYMPYPVRTSPHL
FT                   DAARRYAVGWARRMGMFDAIPGVEAGGLWDERRFIGFDFAHCAAMIHADASPEQLNLSS
FT                   DWLAWGTYGDDYFPAVFGAPRDLVAAKLCNERLSAFMPLDAGATPEPTNPIERGLEDLW
FT                   RRTAEPMSVPARQQFREAVEDMTAGWLWELVNQTQHRVPDPVDYIEMRRKTFGSDMTMS
FT                   LARLAHSDMMPAEIYQTRVMRELDTAAQDYACFTNDLFSYQKEIEFEGEVHNLVLVVEN
FT                   FLEVDRWKARDVVADLMTARMQQFEHIVANGLPALFDDFALDEQARRILTRHADDLKEW
FT                   MSGILEWHRRCARYTEAELRRSRLPGAPAGFSLLPAGLGTSAVRVGAGRRG"
FT   gene            complement(76991..77746)
FT                   /locus_tag="Sros_0076"
FT   CDS_pept        complement(76991..77746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0076"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bsu:BSU21610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83133"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXF3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83133.1"
FT                   /translation="MRRGITSITLAAVVTFATAGFALPAGVAPNVPEGTVRAKVKKIID
FT                   GDTLVLLIGRKEAKVRVLEVNAPGGKECWAKEATARAAKLMPVGSTAYTLADRKPRDRN
FT                   GLNLLYVWNSDGVFVNQNLIRYGYAKWKSMTPNDRFTESLRKMEAKAARERLRVWSGKC
FT                   GGTATPTPAPTPTGTPNPPKPSPTSKPTPTSKPSPTPKPSDTGSTGNDPRFRTCGEANA
FT                   AGYGPYRRGVDPEYAWYQDRDGDGLVCER"
FT   sig_peptide     complement(77663..77746)
FT                   /locus_tag="Sros_0076"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.622 at
FT                   residue 28"
FT   gene            78016..78091
FT                   /locus_tag="Sros_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            78016..78091
FT                   /locus_tag="Sros_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(78207..78956)
FT                   /pseudo
FT                   /locus_tag="Sros_0077"
FT   gene            complement(79038..79886)
FT                   /locus_tag="Sros_0078"
FT   CDS_pept        complement(79038..79886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0078"
FT                   /product="ab hydrolase, alpha/beta hydrolase fold protein"
FT                   /note="KEGG: baa:BA_0741 abhydrolase, alpha/beta hydrolase
FT                   fold"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83134"
FT                   /db_xref="GOA:D2AXF4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXF4"
FT                   /inference="similar to AA sequence:KEGG:BA_0741"
FT                   /protein_id="ACZ83134.1"
FT                   /translation="MDTTTTTDMTTGLLRVPGATLYYEVRGTGPVLLISQSGEGDAGRS
FT                   KDLVDQLVTDYTVVTYDRRGLSRSTPDAPARGVTMAEHADDVHRLLTAITDKPALMLGC
FT                   SLGASIGFHLAVDHPGQISTLIAHEPVTPRLLPAGQRAHHEQELEHIQRIHRRDGLAAT
FT                   FKVVAEVLGIDPANPDVEPGLTPQPMTPQRVRNFDFFVEHDFTAVIRDTLDVTALTDTR
FT                   TRIVSAAGRTTPRTVFDNKCAFALADMLDTGLHWFPGGHNGNTTHPKAYAAALRDTLNA
FT                   A"
FT   gene            79979..80449
FT                   /locus_tag="Sros_0079"
FT   CDS_pept        79979..80449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0079"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcv:XCV0481 MarR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83135"
FT                   /db_xref="GOA:D2AXF5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXF5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83135.1"
FT                   /translation="MMYLGSMNGVELFLLGRTLMKIGEEALPTEGIGRHSTSVRTVLIV
FT                   VSDVRAHPGSAVGEIATRTGLPQSAVSAAVARLREAGAITTEPDSRDRRRLLIQSASQA
FT                   SGRVEEVRSAPIDTALAAALDTDDPQRVAEIVALLDELARHLTPQALTRLRG"
FT   gene            80662..80853
FT                   /locus_tag="Sros_0080"
FT   CDS_pept        80662..80853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83136"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXF6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83136.1"
FT                   /translation="MRIGEDMPGLVVEVRGESGPGAGPECDHPVVPAIDAEVMPMKLEA
FT                   VSDLARVGWPGLLMLRHG"
FT   gene            80999..81826
FT                   /locus_tag="Sros_0081"
FT   CDS_pept        80999..81826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_1455 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83137"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXF7"
FT                   /inference="similar to AA sequence:KEGG:PSPA7_1455"
FT                   /protein_id="ACZ83137.1"
FT                   /translation="MWTHAQWQGRFLPHPLPPGERLRSYATWCNAVEGNTTFYATPSRS
FT                   TVESWARQTAPDFRFVAKLPKSITHERRLTGIDEELRSFLEAIEPLGPRAHAIWIQLPG
FT                   SFAPTDLGALAGFLHRLPRSHRYAVEVRHPAFFDDARSERLLEGVLARVDAEWIPFDTT
FT                   ALFQSPPTSDAEREAWARKPRVPRRSSALTDRPIIRYLGRDDAERTIEGWRQWVGTVTE
FT                   WVREGRSPTVFIHTPDNADAPMLARRFHEEVRTRLPGIEPLPEPVPTEPLTLF"
FT   gene            complement(81834..82244)
FT                   /locus_tag="Sros_0082"
FT   CDS_pept        complement(81834..82244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83138"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXF8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83138.1"
FT                   /translation="MGRDLVELRIRGGELTDSGSWIYVWLLEGRVIYIGTTGLPPEVRT
FT                   WLHLHDPDPDIGRVKARYPGIGTDSLDVVAFRLPESMPRSEVKVAVIAHLSAMGLLSEH
FT                   YVGDPPQRTSIGDGLSSLVLLITRRIGQPETG"
FT   gene            complement(82350..84635)
FT                   /locus_tag="Sros_0083"
FT   CDS_pept        complement(82350..84635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0083"
FT                   /product="Serine/threonine protein kinase-like protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83139"
FT                   /db_xref="GOA:D2AXF9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXF9"
FT                   /inference="protein motif:COG:COG0515"
FT                   /protein_id="ACZ83139.1"
FT                   /translation="MASGEGNAVSGPHPLAEGDPRQLGDYRLTGVLGEGGQGVVYLGQA
FT                   PSGQPVAVKALHARMTADPAARERFLREAEITRRVAAFCTARVIDAGIARDRPYLVSEY
FT                   VRGPSLDELITHDGPRTGGGLDRLAITTLTALAAIHRAGIVHRDFKPSNVIMGQEGPVV
FT                   IDFGIARVLGHSTTRSGLMGTPAYLSPEQLNGHRAGTASDVFAWAATMVYAATGHPAFP
FT                   GVIPAAVISAIVTREPDLAGVPDQLRPLLTACLAKDPAARPGVADLFTALTHGAPVMGD
FT                   SGGKHPGLPFELPHDHDQVSQVGALPGTSEPRTVAPHLSTPVSTAGTPAISPQAPPPPS
FT                   GSSPQAPPPLSGSSPVAAPPSSSSSPVATSLPADSSPRRTRRRLGRTLTAAVVVILVPA
FT                   AFWLKPVLTDIFSGTVRPTAGTGSDEQPEPSVTGIPFGTLVGGRLAGPQKWILSLAVGQ
FT                   LGSRPVVVSGGYDGTVLVSDLATGIPVGSPFTGHRGPVWSVAVGQLDGRPAVVSGGSDG
FT                   TVLVSDLATGAPLGSPFKGHRGSVESVAVGQLDGRPVAVSGGNDGTVLVSDLATGTPIG
FT                   KPFTGHRHWVLAVAVGQLDGRPVVVSGGYNRTVLVSDLATGAPIGTSFTGHRGPIESIA
FT                   TGQLDGRPVAVSGGGKGDHTVRIWDLATGTPVGKPLTGHRSWALGLAVGQLGGRPTVVS
FT                   GGYNDRTVRIWDMATGAPLGEPFKGHRGLIESVAVGQLDGRPVAVSGGNDGTVRVWGLG
FT                   PPYPPPGL"
FT   gene            84900..85322
FT                   /locus_tag="Sros_0084"
FT   CDS_pept        84900..85322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll3019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83140"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXG0"
FT                   /inference="similar to AA sequence:KEGG:bll3019"
FT                   /protein_id="ACZ83140.1"
FT                   /translation="MTDIHAQDLAARYIALWIEPDVESRRRAIQELWVEGGTHILQPPQ
FT                   EIREIAAGLGFDSTTLQAHGHDELDVRVTRSYERFVAPGQFTFRARGNAVRLHDIVKFD
FT                   WEMVPVGGGEAVGSGLEVLVLDENGRITADYMFPGI"
FT   gene            complement(85448..86173)
FT                   /locus_tag="Sros_0085"
FT   CDS_pept        complement(85448..86173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0085"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /note="KEGG: ade:Adeh_3526 XRE family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83141"
FT                   /db_xref="GOA:D2AXG1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXG1"
FT                   /inference="similar to AA sequence:KEGG:Adeh_3526"
FT                   /protein_id="ACZ83141.1"
FT                   /translation="MDFPQTLRATRQRRHLSQLDLALRAGTTQRHLSFMESGRSRPGRT
FT                   MVVRLGESMELPLRERNELLLSAGYAPVYPQTSLDDPSLEHVRAALGRILAGHLPYPAI
FT                   VVDARHDLVLANDAFGLLTEGVAEHLLRPPVNVLRLSLHPEGMAPRIVNLAQWAQHILD
FT                   RIPHDDLYDELSGYVPHVAPGPDHVGFAVPVRLRSTLGELRLTTTITTFATALDVTVAE
FT                   LKLEAFLPADTATAALLAG"
FT   gene            86249..87190
FT                   /locus_tag="Sros_0086"
FT   CDS_pept        86249..87190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0086"
FT                   /product="Coenzyme F420-dependent N5 N10-methylene
FT                   tetrahydromethanopterin reductase-like protein"
FT                   /note="KEGG: swi:Swit_0704 luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83142"
FT                   /db_xref="GOA:D2AXG2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXG2"
FT                   /inference="protein motif:COG:COG2141"
FT                   /protein_id="ACZ83142.1"
FT                   /translation="MNTRLGVLLPTNHSQWNDARRLVDFGVRAERLGYDSVWANDTLLG
FT                   ARVEPLAMLAALAPVTERVTLGTAALLPAFRRPVMAAQELASIDHLSAGRLVVTVGAGF
FT                   PGRSEVEYAVSEVPWARRFGRLDDTVALWRALWAGERAFHGKVLRFDGLPESTPSYRPG
FT                   GPPIWLGGASPSALERTGRLYDGWLPYPPDPADYHEGLRTVRRAAGAAGRPAAAVTPAL
FT                   FVTVLVTDDVERGERELDAYCRATYGLPYETVRTIQVMVAGSAEQVAATLNRYAEAGAE
FT                   HVVCRIAAPALDAQLDQLELIAGIDRPATVSR"
FT   gene            87304..87927
FT                   /locus_tag="Sros_0087"
FT   CDS_pept        87304..87927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0087"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: rru:Rru_A0722 RNA polymerase sigma factor
FT                   RpoE"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83143"
FT                   /db_xref="GOA:D2AXG3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXG3"
FT                   /inference="similar to AA sequence:KEGG:Rru_A0722"
FT                   /protein_id="ACZ83143.1"
FT                   /translation="MRHESRTAAPPRPAAAEAADDAAVIERSRREPEQFATLFTRHAPA
FT                   LKRYVIRRLGQDPAEDIVAETFTVAFQSLESYDLARDDARPWLYGIATNLMRRHRRREI
FT                   GLYRALSRTGADSVVEPFTDQVDQRVAADGARRRLAAALAGLPRGHRDVLLLVAWAELT
FT                   YEQAAQALGVPVGTVRSRVSRARKKLRRVLGDIDPTSASEGTNS"
FT   gene            87924..88877
FT                   /locus_tag="Sros_0088"
FT   CDS_pept        87924..88877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_2974 CheA signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83144"
FT                   /db_xref="GOA:D2AXG4"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXG4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83144.1"
FT                   /translation="MNEIELLKSLRDEVPEQPDLRTEEHRLLAVIREGSSASRRRPARP
FT                   AARLRWGLALGGAGALAAAVVVAVAVAQPAAVPQPGGTAQPGNRQPAVRPPDAVVVLEN
FT                   AALVATRTRTADIRPDQWFYIKESQHMGDDLPTFEHWSRMDGRGSALREEGGELKIGDG
FT                   EPNARTDPARTQRELESLPTDPDALLEHFRNLKEERTPLSICRPHCPEGTEGDVRAFGA
FT                   IGWYMKFGPVIPADKTAAMYRALAKIPNVTIEENTADGDGRKGIGVVLTVGESKGYYIL
FT                   DPGDYHYLGMKVVDADGTFAMSVLDSGVVDGPGRTP"
FT   gene            complement(88933..91356)
FT                   /locus_tag="Sros_0089"
FT   CDS_pept        complement(88933..91356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0089"
FT                   /product="ABC-type transport system involved in lipoprotein
FT                   release permease component-like protein"
FT                   /note="KEGG: acp:A2cp1_1921 protein of unknown function
FT                   DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83145"
FT                   /db_xref="GOA:D2AXG5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXG5"
FT                   /inference="protein motif:COG:COG4591"
FT                   /protein_id="ACZ83145.1"
FT                   /translation="MIGFALNTLRHRKAAFAGAFLALVCAAALVCACGILLDTGLRGAV
FT                   EPVRYAGTPVLVAGDQNVRETTRDGDKVKSKAKPVSDRAWIPSSLADRLRTVPGVRKVV
FT                   TEVTFPATVEGRPVWGHGWESAPLTPFTLREGRAPAAGEVVADAAAGLSVGSRVNVRTA
FT                   TATRVYRVAGVTTEALDQRTSLFFSTEEAARLAGRPGMVSVIGVFPEVDVAPALAGTPG
FT                   VVYTGDERGRIEFLNAEKARIKLVSLGGALGGTSLIVAILVVVGTFALSIQQRQRELAL
FT                   LRAVAATPRQIRRLIGGEALLVGLPAGLLGAGLGVGLAFWLRSQFVGLGVMPANLSLVV
FT                   GFFPPAAAVLAVLGAAWTAARVSGRRTARIRPVEALGEAAVRPPGISPGRTIAGLACLG
FT                   GGVALTLLLSTLETEAASSPVTMLTALVWTIAVALLGPIIARAATAVLGLPLRAFRVSG
FT                   HLAAANLRTGTHRFASVVTPLSLMIAMTCTILFVQDTMGHAVVEQSRQGNRADYVLGPR
FT                   LPGVTADAVRRLEGVEVVTEVMRTSVRVGLERYGAQGVTTAGLERTMDLGVSAGSLGRM
FT                   GADTLAVSETAARSLGVEVADEVRLTLGDGTPVTLAVAAIYRRGLGFGDLTLPHALVAA
FT                   HVDDPLNQTALVSAPSVRRDALAAVLGGVGVLDRVEATAEQSNAGVNYVAMGLIIAFTA
FT                   IAVVNTIAMATSDRTRELALLRLVGTTRRQLMRMLRLETLMAVLVAVTLGTLIALVTLS
FT                   AFSTGMTGSALPYVPVLTYLEVIAAAAALALLATVLPALLALRSRPAEAIGTRE"
FT   sig_peptide     complement(91258..91356)
FT                   /locus_tag="Sros_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.959 at
FT                   residue 33"
FT   gene            complement(91356..92087)
FT                   /locus_tag="Sros_0090"
FT   CDS_pept        complement(91356..92087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0090"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bam:Bamb_0222 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83146"
FT                   /db_xref="GOA:D2AXG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXG6"
FT                   /inference="similar to AA sequence:KEGG:Bamb_0222"
FT                   /protein_id="ACZ83146.1"
FT                   /translation="MNDVVRLDAVSKVYGRGPNTVFALREVSVGIPHGSFTAVMGPSGS
FT                   GKSTFLHCAAGLDQPSSGSVRLGGTELAGMNETELTELRRKRIGFVFQAFNLVSSLTVT
FT                   ENITLPLRLAGVRVDRAWLEEIVDRVGLAGRTGHRPGELSGGQQQRVAIARALVTRPEV
FT                   VFGDEPTGALDTMTARDVLTLLREVVTTMRQTVVMVTHDPVAASYADTVLFLADGNVVD
FT                   AMAAPSAEKVADRMTRLGAWV"
FT   gene            92179..92793
FT                   /locus_tag="Sros_0091"
FT   CDS_pept        92179..92793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0091"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: aca:ACP_1072 DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83147"
FT                   /db_xref="GOA:D2AXG7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXG7"
FT                   /inference="similar to AA sequence:KEGG:ACP_1072"
FT                   /protein_id="ACZ83147.1"
FT                   /translation="MGVIRILIAEDQQVVRGALVALLELEPDLTVVAEVGSGDDVVPAA
FT                   LKHGPDVAVLDIDMPGGIDGLDAAAELHRQVPGCRTLVLTGQGRPGHLRRAQGAHVTGF
FT                   LLKTAPVDELITAVRAVAAGRRVLDPNLAVTAWDLGDNPLTPRESDVLRLTAEGAEATE
FT                   IAARLFLSAGTVRNHLTAIVSKLNARSRTDAVRIAGDAGWI"
FT   gene            complement(92927..95107)
FT                   /locus_tag="Sros_0092"
FT   CDS_pept        complement(92927..95107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0092"
FT                   /product="Signal transduction histidine kinase-like
FT                   protein"
FT                   /note="KEGG: sus:Acid_1273 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83148"
FT                   /db_xref="GOA:D2AXG8"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXG8"
FT                   /inference="protein motif:COG:COG4585"
FT                   /protein_id="ACZ83148.1"
FT                   /translation="MFGDSARPPGTDLAPRVARGTVTAVLAGFAAVYVLAVNSRQSGAL
FT                   QLLAAAAVAAMIFGIQLVYVYPGLKRHLSVRLLGLQAALAYLAVIPLGTSVGMLGLLAG
FT                   SLLLSSAWPVAMVVVGSAVLIEATRSPDPAATVSIAIGTALTSLVVYGLAQLADRVEEL
FT                   SAARLALALAAVAEERLRVATELNEKIGVGLDAINRLAAEPPDEVIDEVLEVARRSLAD
FT                   ARAAAVDYRSMSLSPEVARARALLSTAGIETEGRTGHTEPLGPPGALLGAVLRETVTEI
FT                   LERGRAKRCVVETVEDNGLVRLRVVSDAALDTGRLDGLAGPLRDAGGHFTAGSEPGGRS
FT                   VVEAAVPASPKRAAPLSDSAYSLSVTLLLVVLAGFAAKILLYVPVQALAGAVACLAVLG
FT                   VLQLRGTRDRPLLSLSVQVVLSFLPILWYGRGWLNVPGFLAGSLLLALPPSLSWPLVVL
FT                   AMAGVASAGVLLSLGVSVVVNLTISVLVTGLVVSGLARLTQSIKELQATREEPARAAIA
FT                   QERLRVARDLHDLLGHNLAAILLKSELVRRLLDRDPERARAELGDIVVISERARADMRA
FT                   VSGDHLELSLEEEAASARAMLTTAGIEVRVDLDHDPLPMFNDPAVNTVLSAVLREAVTN
FT                   VLRHSDARRCRIETEYARGLLQLTIANDGFSRDAVRPPAGTGLGNLTTRLAIVGGRLTA
FT                   GPEEDGWFRLRVVLDPARLVSGQTRDGVMIRQ"
FT   gene            95301..96863
FT                   /locus_tag="Sros_0093"
FT   CDS_pept        95301..96863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0093"
FT                   /product="Serine/threonine protein kinase-like protein"
FT                   /note="KEGG: ade:Adeh_0115 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83149"
FT                   /db_xref="GOA:D2AXG9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXG9"
FT                   /inference="protein motif:COG:COG0515"
FT                   /protein_id="ACZ83149.1"
FT                   /translation="MNAYGLPPVLPLHDGDPVELSQYRVIGRLGQGGMGTVYLGMGPSG
FT                   PVAIKMIKRHLATDAEFAVRFRREVASARRVHRFCTAPVLDAQLETEPFWVVTEYVPGP
FT                   DLARVLREQGPLTGSNVEALAVGVATALIAIHGAGIVHRDLKPANVLLSPFGPRVIDFG
FT                   IARAFDTSGGRPTTGMLLGTPEYMAPELVSGGAVGPASDVFAWGCVVFAAASGRSPFAS
FT                   KTVAEALFRVVNDRPALDPVDPALRETVAAALEKDPADRPTAQELLTRLTGNHEADAKA
FT                   VSGAIKLDLTDLVRTAEPARPRPVRRFLPGAAAVAAALAVAGAAALYGISETPPAPERI
FT                   LYSDAFDNKESGWIDNYTGAGRFLVGVDSDEVRWASAPLRTDLDLLLVESTFSLSGDAD
FT                   ARGGIFCDFSPEDGSRYGLMVTRNGHARITEFAISSSTSLTADTPIPGFDAGNVRFQAE
FT                   CAREDRQIRLAIWVGGRKIVDAVDGHAPDATARPEVGLMAGRGPAGVNRTEASFEDFTV
FT                   GSL"
FT   gene            complement(97010..97357)
FT                   /locus_tag="Sros_0094"
FT   CDS_pept        complement(97010..97357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0094"
FT                   /product="lactoylglutathione lyase protein"
FT                   /note="KEGG: ara:Arad_3055 lactoylglutathione lyase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83150"
FT                   /db_xref="GOA:D2AXH0"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXH0"
FT                   /inference="similar to AA sequence:KEGG:Arad_3055"
FT                   /protein_id="ACZ83150.1"
FT                   /translation="MSIRRVVPDIRSEDLEGSREFYGLLGLVEVMNQGWVMTLASPSNP
FT                   TAQLTLMGADSTAAVQPDLSIEVDDVDAVYAAVTAGGAEIVHPLQDEAWGVRRFFVIDP
FT                   NGRVVNVVGHR"
FT   gene            97616..98152
FT                   /locus_tag="Sros_0095"
FT   CDS_pept        97616..98152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83151"
FT                   /db_xref="GOA:D2AXH1"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXH1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83151.1"
FT                   /translation="MTPLLALDSVLPHPYPLIRGGGLFLIFVGLGFLLGWIFPSRWIPF
FT                   GIGGFIAGFTASGLSALLKPSLGAPSLVQIAALVVSFVVEAGLLYYVITTFKDRDDRTM
FT                   ILSILFVVGLHFIIMGMAHGPLIAILGVVTSLNAWIGLKVAPKLPLRLVGGFDALLKIG
FT                   IGSWMLFLYPALTYT"
FT   gene            98288..98800
FT                   /locus_tag="Sros_0096"
FT   CDS_pept        98288..98800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0096"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: dia:Dtpsy_1254 RNA polymerase, sigma-24
FT                   subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83152"
FT                   /db_xref="GOA:D2AXH2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXH2"
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_1254"
FT                   /protein_id="ACZ83152.1"
FT                   /translation="MDAAEERRFREFVSARSPALMRLAYLLTGGDQHAAEDLLQTALAR
FT                   TVARWRSVEAPEAYVRQAMYRQQVSWWRRRRETVVAEPPGRALADGTHGTDLRIDMRRA
FT                   LARLTARQRAVLVLRYYEDLPEAEVAGILGCSVGTVRSTAHRSLARLRELAPELREPYT
FT                   IFGEASA"
FT   gene            98797..100020
FT                   /locus_tag="Sros_0097"
FT   CDS_pept        98797..100020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83153"
FT                   /db_xref="GOA:D2AXH3"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXH3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83153.1"
FT                   /translation="MTIDELVRRTLRDWSDEARVPSDLASRVLRRRRRARVRAFAVVAG
FT                   ATAAVVAGALTVPALVQGEQVDDSRPAVVVMTDPSPSTETVGDPDSVRPTTLVAAGDTA
FT                   IYAYFTMSQVKESGGRRVLKRTWRLYDKDKKVYEQTPWAWLDVAGGGESIAVLERVAAR
FT                   RVGVTGSRGGAVRWIELERLAGAVRWSPDGRRLLVTNYDGDPDEAQAPASGGRRATSPS
FT                   RTGYTVIDLESGRAGFHPVGQPDRDLMTLGRLDFSWSADGTLVWEPGVDPSATKKFYDL
FT                   EGNPRPAPPEVARTYQEAGMSPGGRWVATGTSDTIATMAVKNVSTGQVKPLRPVGGYRI
FT                   ERLAAWADEGHLFAWACELKGIQSCSISDFRTRLILVDVDGGKTVPLSAYRSSTNDPGT
FT                   WTPVFSRR"
FT   gene            100133..100744
FT                   /locus_tag="Sros_0098"
FT   CDS_pept        100133..100744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0098"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="KEGG: aba:Acid345_4389 transcriptional regulator,
FT                   PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83154"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXH4"
FT                   /inference="similar to AA sequence:KEGG:Acid345_4389"
FT                   /protein_id="ACZ83154.1"
FT                   /translation="MAKGPDLVGLTVLALLSVKPSHPYEMHRFVLDTHKDYVTGLPRSL
FT                   YHAVDRLARDELIVPVETSREGRRPERTVYELSDEGRAELATRLRRLLSEPGPDTRGFL
FT                   AAISLVGCLPVPEAERALLTRAAALESAVFACDAHMRGLEESGLPRMLVLELECERALR
FT                   SAELTWVRSVLDRLGSGELAWTDQLRADLSGGPDGKDADV"
FT   gene            100722..101162
FT                   /locus_tag="Sros_0099"
FT   CDS_pept        100722..101162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83155"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXH5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83155.1"
FT                   /translation="MGKTLMYEAAGVIAAPVERVERLVLTIRPGPVGKDNAWLLSPTGG
FT                   TVEGGPGRFTLRAAGHVMTVEVTGRTFAAQGGWWYRGEYAVEPHPEGALLTHRVFNVAS
FT                   RGRWAVPAANRFFVGFGAKTRDGFAEGLQRIGRELGCPVRLL"
FT   gene            101255..102229
FT                   /locus_tag="Sros_0100"
FT   CDS_pept        101255..102229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0100"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smd:Smed_2515 GCN5-related N-
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83156"
FT                   /db_xref="GOA:D2AXH6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXH6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83156.1"
FT                   /translation="MLQVMTFDWTPLTKNDTGKWAELLAEVERADRVGENYGADDLADD
FT                   LDNPLLDLAEGTLAAWDGDRMVAFGVTACRPAADPVHQMTLWGAVHPDHRRRGLGGHLL
FT                   DWAVRNTPVLHGRRFPGRPLELHVHAFDSNEGAAALVAGAGMTPVRWFYGMTRDLGTEP
FT                   PAIGLPDGLTVVAYGEDLTEAAREVRNASFTDHWGSVPHTPESWKNAIVGVQAFRPEGS
FT                   FLVQDGSGGNVAVLLTHYFEADTEATGVREAWIQIIGTLREWRGKGVASALLAHALAEF
FT                   RAQGYQKAGLGVDADNPTGALGVYTRAGFEVEHRTTTYALPLG"
FT   gene            complement(102379..103797)
FT                   /locus_tag="Sros_0101"
FT   CDS_pept        complement(102379..103797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0101"
FT                   /product="Signal transduction histidine kinase-like
FT                   protein"
FT                   /note="KEGG: cti:RALTA_B2292 putative sensory histidine
FT                   kinase in two-component regulatory system; signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83157"
FT                   /db_xref="GOA:D2AXH7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXH7"
FT                   /inference="protein motif:COG:COG0642"
FT                   /protein_id="ACZ83157.1"
FT                   /translation="MSHLSVRVRATLAATAIVAVALGVAAVVLVGVLKGSLVDSASAEA
FT                   TRRAYGTAGMITASPGLIAGRVAEPLDPDVQVIEKAELSEAEWRTVLAQPAQPALPITS
FT                   GQDTPGTGAIRSDTTRSTATRGETARSDAARPDSTGPAAVRAERWAPAASFTVATMPVS
FT                   TVDGVVLVQARASLEPAGAALQTLQGLLIPGIPGLLLLVAALTWLAVGRALAPVSAIRT
FT                   EMADITASDLHRRVPVPRSRDEIARLAETMNRTLDRLELAVDRHKRFVADAAHELRSPL
FT                   AILRTRLELAPPGPLAAEALTDVERIQALTSDLLLLARLDAGEPACHGEVDLGQVAAEE
FT                   ATRARPRPEIRVELEVAADVVVRGSAEELRRLVANLVDNAVRHADSTVTVRLARDGGGA
FT                   VLDVRDDGPGIPAEHREAVFDRFTRLDEARGRDAGGSGLGLAIARDIAVRHGGGLSVVG
FT                   GGPGARLRTRLPAP"
FT   sig_peptide     complement(103717..103797)
FT                   /locus_tag="Sros_0101"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.716 at
FT                   residue 27"
FT   gene            complement(103799..104467)
FT                   /locus_tag="Sros_0102"
FT   CDS_pept        complement(103799..104467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0102"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: bam:Bamb_5988 two component heavy metal
FT                   response transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83158"
FT                   /db_xref="GOA:D2AXH8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXH8"
FT                   /inference="similar to AA sequence:KEGG:Bamb_5988"
FT                   /protein_id="ACZ83158.1"
FT                   /translation="MRVLLVEDEKRLADLLKGGLAGEGFAVDVAHDGRDGLWMASENVY
FT                   DVIVLDVMLPRMNGYTVCARLRDAENWTPILMLTAKDGVHDEAEALDTGADDFLSKPFS
FT                   YVVLLARLRALIRRGGRARPVSITVGDLTVDPAGLRCRRGEVEIALTPKEFAVLHGLAR
FT                   RPGEVVSKSELLAQAWDFSYDGDPNIVEVYISALRRKIDSPFGRSSLVTVRGAGYRLES
FT                   "
FT   gene            104592..105260
FT                   /locus_tag="Sros_0103"
FT   CDS_pept        104592..105260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0103"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83159"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXH9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83159.1"
FT                   /translation="MRIRFLAAAVVTAGALMATLTGAANASDDPAPATPEAAFTIVCEA
FT                   GDDQGAVAVRKLTDAELKDLQAKAGHWRKAIGHGPVKVTGGTGHLASVKVTEATGPGPV
FT                   KVTETTEAPDRVPSTTEAPDRVPSTTEAPDWVPATPAVPATPLDPSKQAEAEVARATTV
FT                   TVSPLEEGETRLDVISDDVRQSGRAAAAKDVPGAPLSEGVVVACAQKAERAQEPAKAGE
FT                   "
FT   sig_peptide     104592..104672
FT                   /locus_tag="Sros_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 27"
FT   gene            complement(105651..106244)
FT                   /locus_tag="Sros_0104"
FT   CDS_pept        complement(105651..106244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0104"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecy:ECSE_1455 putative phage tail fiber
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83160"
FT                   /db_xref="GOA:D2AXI0"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXI0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83160.1"
FT                   /translation="MPLAQFGKRHIEIVIPETRLNQVKAQVARAADRVGPMATHARDAA
FT                   AHARDAATHARGTANDKVYVARGWAAPKLDAAAHSFEEQLAPKISAMLSQAATRIDPAP
FT                   AAKSRKWPMVLLFTGLAVGAIGFAMYRKSADQWTEAMKESTADASRWVGEKAHSATDKA
FT                   SEMVHGVRSKTESTAEDAAHKADAQADQASKRMS"
FT   gene            106423..106959
FT                   /locus_tag="Sros_0105"
FT   CDS_pept        106423..106959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0105"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="KEGG: ade:Adeh_1652 peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83161"
FT                   /db_xref="GOA:D2AXI1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXI1"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ACZ83161.1"
FT                   /translation="MAEKLIANLKTNRGTVKIQLFPDHAPKTVRNFVELAEGTREWVNP
FT                   TTGAKTTDKLYDGTVFHRVIEGFMLQGGDPLGQGTGGPGYKFDDEIHPDLYFNRPYLLA
FT                   MANAGIQFGKGTNGSQFFITVVPTPHLNGKHSIFGEVIEGQDVVDAIAKTDTDARDRPK
FT                   EPVVLESVTIDRVQG"
FT   gene            107113..107988
FT                   /locus_tag="Sros_0106"
FT   CDS_pept        107113..107988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0106"
FT                   /product="rhomboid-like protein"
FT                   /note="KEGG: aba:Acid345_1881 rhomboid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83162"
FT                   /db_xref="GOA:D2AXI2"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXI2"
FT                   /inference="similar to AA sequence:KEGG:Acid345_1881"
FT                   /protein_id="ACZ83162.1"
FT                   /translation="MTTQPPSEPETTAVPTCYRHPGRETYVRCQRCERPICPDCMRDAS
FT                   VGFQCPECVAQGNKTVRQAQSTFGGRAVTVPRVTWALLIVNILAYAAESLSPSVVSAFQ
FT                   MSSGHVAFRGEWWRLITGAFLHMPLSAGGFALTHILFNMWALYAIGPELERRLGSLRFL
FT                   VLYLLSALGGSVAIYLFGIAAVGASGAIYGMFGALFVVSKKLGYDARGVLWLIGINVVL
FT                   TFTVPSISWQGHLGGLITGAIVGGILAYAPPKSRNAVQWGGCVAVLVVLVALVALLPPY
FT                   AFQLQYGIIS"
FT   gene            complement(108038..108283)
FT                   /locus_tag="Sros_0107"
FT   CDS_pept        complement(108038..108283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83163"
FT                   /db_xref="GOA:D2AXI3"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXI3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83163.1"
FT                   /translation="MPKPKTRKKAVYTPPQTTQQVKMSPRWLAPVMVASWIIGILWIAI
FT                   YYVAPTAPFIGDLANWNLLIGFVFIIFGVVLSTRWR"
FT   gene            108442..109116
FT                   /pseudo
FT                   /locus_tag="Sros_0108"
FT   gene            109127..109282
FT                   /locus_tag="Sros_0109"
FT   CDS_pept        109127..109282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83164"
FT                   /db_xref="GOA:D2AXI4"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXI4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83164.1"
FT                   /translation="MYGWIWRLLPGGLATKVFIAVVLAGLAAAVLWYVVFPWLEPRVPL
FT                   DHTTVG"
FT   gene            109282..109854
FT                   /locus_tag="Sros_0110"
FT   CDS_pept        109282..109854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0110"
FT                   /product="anthranilate synthase component II"
FT                   /note="KEGG: gbe:GbCGDNIH1_0821 anthranilate synthase
FT                   component II"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83165"
FT                   /db_xref="GOA:D2AXI5"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXI5"
FT                   /inference="similar to AA sequence:KEGG:GbCGDNIH1_0821"
FT                   /protein_id="ACZ83165.1"
FT                   /translation="MTRILVVDNHDSFVHTIVQYLRELGATCDVRPRDHVVAEDAAGFD
FT                   GVLVSPGPGAPEDAGVSVPLVGYCEARGLPLLGVCLGHQAIAIAHGATVARAPELMHGR
FT                   TSAITHDGRGVFAGLPSPVTMTRYHSLAVVPETVPEILEVSATTGDGLVMGLRHRTAPI
FT                   EGVQFHPESVISEHGHRLLGNWLAGIV"
FT   gene            complement(110280..112136)
FT                   /locus_tag="Sros_0111"
FT   CDS_pept        complement(110280..112136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0111"
FT                   /product="protein kinase"
FT                   /note="KEGG: bsu:BSU15770 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83166"
FT                   /db_xref="GOA:D2AXI6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXI6"
FT                   /inference="similar to AA sequence:KEGG:BSU15770"
FT                   /protein_id="ACZ83166.1"
FT                   /translation="MTQPRRLGDRYELDGVVGRGGMAEVYRARDIRLDRIVAIKTLRAD
FT                   LARDHIFQARFRREAQSAASLNHPSIVAVYDTGEDVAGSAPVPYIVMEYVDGRTLRDLL
FT                   RADRRLLPERAAELVDGILRALDYSHRGGIVHRDIKPANIMITNNGDVKVMDFGIARAM
FT                   ADSAATMTQTAQVIGTAQYLSPEQARGERVDARSDIYSTGCVLYELLTGQPPFTGDSPV
FT                   AIAYQHVREDPIPPSQIDPEIPKWADAIVLKAMAKDPAHRYQSAGEMRADIQRAMSGIP
FT                   MDAQTMALANNYGSATRTMQTPGPGGPATQRTTSVPAYEYGTEEGGRGERGRRRQQSSG
FT                   NTAVKTAAWILVPLLVIGAFIGVGYMFLSSPGDSSAANKIKVPALTSRTEAAATKALTD
FT                   LGLTVKTVEKFDEESEKGTVIETSPAAGTAVDKGAEVTLTISKGVEKAEVPNVVNMTTD
FT                   EAKAALEEAGFVPSVRTKASSGPQDKVLETNPPAGKKAPKGSTVQIYVPKEAVEVPGVV
FT                   NLTVGDAKRMLKEAGFKYKVVEQESDLPEGTVLSQAPEAGAKLQQGTTITLVVSSGQAP
FT                   QPTEPPTTDPTQEPPITEEPEPDPTETEDPIFNEAPSDDLGG"
FT   gene            complement(112219..113628)
FT                   /locus_tag="Sros_0112"
FT   CDS_pept        complement(112219..113628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0112"
FT                   /product="protein kinase"
FT                   /note="KEGG: afw:Anae109_3775 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83167"
FT                   /db_xref="GOA:D2AXI7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXI7"
FT                   /inference="similar to AA sequence:KEGG:Anae109_3775"
FT                   /protein_id="ACZ83167.1"
FT                   /translation="MTALLGGRYRPLGRIATGGMGEVWRAKDELLGREVAVKLLRRHVA
FT                   ADPAFRERFRREARIAAKLADPGIAQVFDYGEADGVAYLVMELVPGESLAGILARDGAL
FT                   SVEITLDVVYQTAKALRAAHGAGIIHRDIKPGNLLVTGAGVIKITDFGIARALEASSMT
FT                   QTGTVLGTAQYVSPEQASGDPLTFATDVYSLGVVAYECLAGRPPFVAETQVAIALMHLG
FT                   ETPPPLPGSVPAAVRELVMACLSKDPERRPAGAGELAGRAYALRESLATAGAADLAMLT
FT                   DPAGWRVEPAGEWPREVAPALASAPGPGSGPATGSGPAPVRTARIAPRRRGLGRKTVIV
FT                   AVAAGCAAAVGLGTLVVHDLTERNGESKSEEPVVPLSPVTKTPTVRPSRTKPVTTRPPV
FT                   SPTKPLRPSPTPSATVSTSVKPSPRPTTSPSPSPSPTTSTPTPTTPTATPSLTPSTTPG
FT                   PGDTEPPNGET"
FT   gene            complement(113625..115082)
FT                   /locus_tag="Sros_0113"
FT   CDS_pept        complement(113625..115082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0113"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: geo:Geob_3477 penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83168"
FT                   /db_xref="GOA:D2AXI8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXI8"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ACZ83168.1"
FT                   /translation="MNSTLKRVALACLLMFGLLMLNVNYLQGVRADDLRADSRNVRNFY
FT                   DRYEVERGRITAGDKVLAESVDTGSNTFRFERRYPEGKVYAPITGFFAPESERDMELAK
FT                   NSLLNGTSADLLIRRSIDLFTAKKTKGANVDLTINPKAQEAAYKALGASGKKGALVAIE
FT                   PKTGAILAMVSIPSYDPNPLSRANKAEVNKAYNKLADDKDQPLLNRAIERTYPPGSTFK
FT                   VVTMAAYLESDDTLGPQSQVDAPQRLDLPNTTADLPNYGGAACGSGRVTLSFALERSCN
FT                   TPFGKIAIDLGYDAVNDQARKFGIGGDALTIPMPVAASDFGPEEDKAALAQASIGQRSN
FT                   QMTPLQMAMIAAGIANNGVVMKPYLVNKIADAEGGEIEGADPEEFTTAISEDTARKLQE
FT                   MMVNVVNNGTAGAAKIPGVTVAGKTGTAETAEGRDPHAWFISFAPAEDPKVALALMVES
FT                   GSAGDDASGGHTAAPIAKSVMEAVLGR"
FT   sig_peptide     complement(114987..115082)
FT                   /locus_tag="Sros_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.419 at
FT                   residue 32"
FT   gene            complement(115079..116458)
FT                   /locus_tag="Sros_0114"
FT   CDS_pept        complement(115079..116458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0114"
FT                   /product="cell division protein FtsW"
FT                   /note="KEGG: glo:Glov_0671 cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83169"
FT                   /db_xref="GOA:D2AXI9"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXI9"
FT                   /inference="similar to AA sequence:KEGG:Glov_0671"
FT                   /protein_id="ACZ83169.1"
FT                   /translation="MSTPSVEPVPLPAKRRLAQLAMLAFAVVIVMFAYANVGLAIDKQI
FT                   PSGMLTYGLSLGGFMLAAYLVLARFAPWADPLILPLVTLVNGLGLVMIYRLEQSKAFGA
FT                   SANTQLLWTAVGVVLFSVTLIVLRDHRALQRLTYTAGAVGLLLLISPLLPFIGKNINGA
FT                   RIWIEIPGVGQLQPAEFAKLALIVFFAGYLVAKRDVLALAGRRLLFIDLPRARDLGPIL
FT                   IVWGFSLGVLILQKDLGSSLLIFGTFIAMLYIATQRTSWVLIGILLFVGGAILAGMVFD
FT                   HVHARFEVYLNPEDPELFQKVGGSEQLMQGLFAMAAGGILGTGLGQGHPDKIPLAISDF
FT                   IFPATGEELGLTGLMALLMVYALLVQRGLRTSIAARDPFSKLLAGGLSFILAWQVFIIV
FT                   GGVTNLIPLTGLVTPFMSQGGSALLANWILIALLVRMSDAARKPPPQAIQDEGMTQVFQ
FT                   R"
FT   sig_peptide     complement(116351..116458)
FT                   /locus_tag="Sros_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.901 at
FT                   residue 36"
FT   gene            complement(116463..117788)
FT                   /locus_tag="Sros_0115"
FT   CDS_pept        complement(116463..117788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0115"
FT                   /product="Phosphoprotein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="KEGG: dps:DP2574 serine/threonine protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83170"
FT                   /db_xref="GOA:D2AXJ0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXJ0"
FT                   /inference="protein motif:PRIAM:3.1.3.16"
FT                   /protein_id="ACZ83170.1"
FT                   /translation="MTIALRYAARSDVGLLREGNEDSAYASGRLLAVADGMGGHAHGEV
FT                   ASSVAIAAMSSLDEDPQGGDLLSAVEAAVRDANRRLHEMVGRDPSLKGMGTTLTAMLWS
FT                   GTRVALVHVGDSRAYLLRAGELYQITHDHTLVQSLVDDGRITLEEAATHPQRSILLRAL
FT                   DGSGEVDPDLSLREAQVGDRYLLCSDGLSGVVSAETMHHTLSTIEDPETVVRTLIDLAN
FT                   RGGGPDNITCVLADVLEVDEGLALPVEAAVVGAAGSTRPRTQLPDTPAGHAAGITMPQP
FT                   VITDDDLEEPVARATGRPARRRRLWPLMASVGGVVLVGGGLGWYFGSQWLDDQYFVGVK
FT                   GDEIVVFQGVKTNLGPIELFDVARSTTESVTALGAFQQGQVRDGIPVASVDEGLKKIEE
FT                   LKTSAAKPATKPTAKPESKPDGKGKQTSQPSGTASPEPTRSQ"
FT   gene            complement(117785..118252)
FT                   /locus_tag="Sros_0116"
FT   CDS_pept        complement(117785..118252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0116"
FT                   /product="FHA domain containing protein-like protein"
FT                   /note="KEGG: bbt:BBta_4519 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83171"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXJ1"
FT                   /inference="protein motif:COG:COG1716"
FT                   /protein_id="ACZ83171.1"
FT                   /translation="MSELTLLLIRLAFLALLWFFVIAAVGVIRTDLFGSRTTTAAPARK
FT                   APKPVKPAAKPKKGEPRQMVVIGGPLQGTTITLSETPITIGRANDATLVVSDDYASSRH
FT                   ARLFPQDGQWIVEDLGSTNGTYLDRSKVTRPTPVPLGVPIRIGKTVIELRK"
FT   sig_peptide     complement(118181..118252)
FT                   /locus_tag="Sros_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.801 at
FT                   residue 24"
FT   gene            complement(118270..119010)
FT                   /locus_tag="Sros_0117"
FT   CDS_pept        complement(118270..119010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0117"
FT                   /product="FHA domain-containing protein-like protein"
FT                   /note="KEGG: mxa:MXAN_1361 FHA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83172"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXJ2"
FT                   /inference="protein motif:COG:COG1716"
FT                   /protein_id="ACZ83172.1"
FT                   /translation="MGVLQRFERRLEGLVEGAFARAFKSDLQPVEVASAVQREMDERAA
FT                   IVAQGRTLVPNDFVVELSTTDSERLEVYADSISLELANLAREYAKEQGYSFVGPVRVRF
FT                   ETADDLAVGLFRIRSGVIRGATVEQDEIRQPVSDVPAAKPHAFGGRPRLLVSTQDDPQG
FT                   QRSYDLTTPVTLLGRGTDCDLRLVDPGVSRHHAELRVEGPQVVLVDLGSTNGTFVNGQP
FT                   VRRVELQNGTRVTLGRTTLVFRRD"
FT   gene            119167..119249
FT                   /locus_tag="Sros_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            119167..119249
FT                   /locus_tag="Sros_R0003"
FT                   /product="tRNA-Leu"
FT   gene            complement(119584..120618)
FT                   /locus_tag="Sros_0118"
FT   CDS_pept        complement(119584..120618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shl:Shal_2700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83173"
FT                   /db_xref="GOA:D2AXJ3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXJ3"
FT                   /inference="similar to AA sequence:KEGG:Shal_2700"
FT                   /protein_id="ACZ83173.1"
FT                   /translation="MSTTGALLLGVALLIGNAFFVAAEFAVISARRHRLEELAGKGGRL
FT                   TRVSARAAVRGGRELSLMLAGAQFGITLCSLGLGMVTEPAIEHLLEPVFALVGLPESLQ
FT                   VPISLVIALALVTFLHMVIGEMAPKSWALTHPEIAAMSLALPFRGFTWLIRPVLSSLNG
FT                   LTNALLRVFGVHARDELATTRTPVQLAMLVGESGRMGLLDRDEHDLLTRALRVHQQPVE
FT                   RLMLPIGEATCVTGDATETQVRRAAADSGHLRLLVNSGRPADVLGVLHVRDVLVRPGAS
FT                   PAELARPVPRLEKSTTIPEAVSVLQEAHAHVGLVTDGGGEVAGMVSLTDLLGELLDVRI
FT                   LATR"
FT   sig_peptide     complement(120547..120618)
FT                   /locus_tag="Sros_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.732 at
FT                   residue 24"
FT   gene            complement(120615..122075)
FT                   /locus_tag="Sros_0119"
FT   CDS_pept        complement(120615..122075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0119"
FT                   /product="protein of unknown function DUF21"
FT                   /note="KEGG: pde:Pden_3115 protein of unknown function
FT                   DUF21"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83174"
FT                   /db_xref="GOA:D2AXJ4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXJ4"
FT                   /inference="similar to AA sequence:KEGG:Pden_3115"
FT                   /protein_id="ACZ83174.1"
FT                   /translation="MNTALGLLAVLLLTLATGYFVAQEFAFVAADRGVLREQAEAGDAA
FT                   AKRALEVTGRLSFMLSGAQLGITVTALLVGFIAEPAIATVIRPGLEAAGVPEAAVPGIA
FT                   VALAIAVATVVQMVLGELAPKNLGIARPEPVAKFLSGSTIVYLKIAGPVIRLFDSAATG
FT                   LLRRVGVEPVEEVEHGASPEELSRIISESATAGDLPPRLSELLERALEFGDRTAEDVMV
FT                   PRPRVVLLRAERPISDLLDAVREHGHSRYPVLCKDNGEDVVGVTGVRELLKSGLTDGSL
FT                   EEITRPALLVPDSLPLPVVLERMRAAGDDLACVIDEYGGLAGVVTVEDLAEELVGELID
FT                   ENDPEPAGVVANDDGTWDLPGTLRLDEVERATKLELPESDGYETIAGLVLATLGRMAEP
FT                   GDQVTVTLTLETDLLENDSADEADAVLTVLSVHRRVPEWVRLAPAAAEVPGKAEVPGKN
FT                   GEHAMAAPRMIDRGADRPMIERSVVDGR"
FT   sig_peptide     complement(121995..122075)
FT                   /locus_tag="Sros_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.594 at
FT                   residue 27"
FT   gene            122665..123645
FT                   /locus_tag="Sros_0120"
FT   CDS_pept        122665..123645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0120"
FT                   /product="Transcriptional regulator-like protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83175"
FT                   /db_xref="GOA:D2AXJ5"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXJ5"
FT                   /inference="protein motif:COG:COG1316"
FT                   /protein_id="ACZ83175.1"
FT                   /translation="MPSMTWRPKRPGRLIARILIGLLVVLLVLAVGGYFVINSRLTRIE
FT                   ALTDYDGRPADTPGTNWLLVGSDSRAGLTKAQRRKLATGSSVGRRTDTMMLLHIPDTGD
FT                   RPTLVSLPRDSYVPIDGHGSGKLNAAYAYQDGGPKLLAKTVEKVTGLRIDHYMEIGFGG
FT                   FVGIVDAIGGVEINVKQAIKDPKAGIDLKKGLQTMDGGTALGYVRTRATGAIPDFDRTQ
FT                   RQRQFFSAVVKKAASPGVLINPFRSIPLALSATDSVAVGEESGAFNLLSLGLAMGDNPV
FT                   TTVVPVGSLPTINGEAVVKWDTAKALRMFDALAEDRPVPKDALGK"
FT   sig_peptide     122665..122757
FT                   /locus_tag="Sros_0120"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.862) with cleavage site probability 0.752 at
FT                   residue 31"
FT   gene            complement(124586..125245)
FT                   /locus_tag="Sros_0121"
FT   CDS_pept        complement(124586..125245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH0832 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83176"
FT                   /db_xref="GOA:D2AXJ6"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="InterPro:IPR038261"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXJ6"
FT                   /inference="similar to AA sequence:KEGG:BH0832"
FT                   /protein_id="ACZ83176.1"
FT                   /translation="MTTIIAEEVLLLAYSEVEGKQLIGSSELDAALGGALLAELAIDGR
FT                   IDLADKKVTVLDPTPLGDEELDAALARIVGEPKERKPDWWVYKLHSAKLRKRLLSRLAE
FT                   RGVLSEEPRKILGIFPSTRYPERDPRVEQGIRESVQSVLSGAVPDERAAVLIAVLHAAK
FT                   IDRKAFPGASKERIKEITEGEWAGAAVAKTIAAINSAVMTAVIAGSIAASTAATSG"
FT   gene            125356..125934
FT                   /locus_tag="Sros_0122"
FT   CDS_pept        125356..125934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eli:ELI_07270 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83177"
FT                   /db_xref="GOA:D2AXJ7"
FT                   /db_xref="InterPro:IPR019545"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXJ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83177.1"
FT                   /translation="MRIRRLLRHPAAWAVMTLGAVALGVALYLFQPWRLFTTVEVDEAV
FT                   PVAAVTPRATPEAGGRTTATRPPDGRAKAAEGPRTLAAGTFVSHEHSTEGRARVLELAD
FT                   GSRVLRIEGLETSDGPDLRVWLSDQPVKEGRAGWFNLDDGKHLELGELKGNRGNANYAI
FT                   PAGADLDSLRTATIWCKRFGVSFGAAALT"
FT   sig_peptide     125356..125430
FT                   /locus_tag="Sros_0122"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.636 at
FT                   residue 25"
FT   gene            125950..126555
FT                   /locus_tag="Sros_0123"
FT   CDS_pept        125950..126555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0123"
FT                   /product="putative transcriptional activator, TenA family"
FT                   /note="KEGG: bha:BH2679 transcriptional regulator of
FT                   extracellular enzyme genes"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83178"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXJ8"
FT                   /inference="similar to AA sequence:KEGG:BH2679"
FT                   /protein_id="ACZ83178.1"
FT                   /translation="MSISAELHAIGRPLVEAQLAHPTVVGIAKGNLAEPVFRSWLEQDY
FT                   LFLLDYVRVFSRLAWQAPDGHLGDLVDLAHATFHEELALHRSLSAEFGADLDGAKKGPA
FT                   CVAYTSFLLDSAADYADGLAALYPCMWGYSTLGRVLAENPPAEPRYRAWVDTYAHPGFA
FT                   ELTGRIAVMIDEAVPDLGRAGALFTEGMAHELAFWDVP"
FT   gene            126830..127162
FT                   /locus_tag="Sros_0124"
FT   CDS_pept        126830..127162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0124"
FT                   /product="Rhodanese-related sulfurtransferase-like protein"
FT                   /note="KEGG: tbd:Tbd_2399 rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83179"
FT                   /db_xref="GOA:D2AXJ9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXJ9"
FT                   /inference="protein motif:COG:COG0607"
FT                   /protein_id="ACZ83179.1"
FT                   /translation="MDAMSVPEVEVQDVPDGAFLLDVRENDEWRAGHAPAAVHIPLGEL
FT                   QARVGEVPKDAPVYVVCRAGSRSAHAAAWLGHVGWDAINVGGGMQSWEVAGRPMVSESG
FT                   QDPFVA"
FT   misc_binding    127208..127348
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 47.87"
FT   gene            127338..128684
FT                   /locus_tag="Sros_0125"
FT   CDS_pept        127338..128684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0125"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /note="KEGG: lch:Lcho_2203 permease for cytosine/purines
FT                   uracil thiamine allantoin"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83180"
FT                   /db_xref="GOA:D2AXK0"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXK0"
FT                   /inference="similar to AA sequence:KEGG:Lcho_2203"
FT                   /protein_id="ACZ83180.1"
FT                   /translation="MTSDVIDAKHAEAPLTLDQAPPKTLGALDQGAFWANLGVSLLGFS
FT                   FALFLINPLNDDNPLTFTAALVASLVGSLIGTAMVGLAAVPGAQTGQPAMVLLRGLFGA
FT                   RLSAVPTVLNIIQMIGWGAFELWVVAMGAQAIFGTSVPYAAWAIAAGVLTTALTIYPLG
FT                   AIRLLRRFVTVGVVISIIWFAVVFLRDTPAQTGGSWDAFAPAVDFVIALSVSWVPVAAD
FT                   YARYSRSSRAAFGGVVGGYTIAQVACLAVGVYAVALAGHGAVSDQPTAVFAPFVAAPLG
FT                   ALFFGILVLRETDQSFANVYSTAMSLQNLMPRVDRRIFSVAIGVLTTGVALVVDVNSYG
FT                   AFLGIIGAVFVPMLGVLAVDYFLLGHGRDWDTSENAPSRWLMVIPWVLGFATWWLLAAP
FT                   SAVPWWAAIWNGVRQAVGFTPQPWMSAAVGAFLVAGLVTLGLGALRRRR"
FT   gene            complement(128741..129325)
FT                   /locus_tag="Sros_0126"
FT   CDS_pept        complement(128741..129325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0126"
FT                   /product="Methylated DNA-protein cysteine
FT                   methyltransferase-like protein"
FT                   /note="KEGG: mms:mma_0136 methylated-DNA-[protein]-
FT                   cysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83181"
FT                   /db_xref="GOA:D2AXK1"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXK1"
FT                   /inference="protein motif:COG:COG0350"
FT                   /protein_id="ACZ83181.1"
FT                   /translation="MSSGDIDALLRVTSPDYIGKTHPDIAFGTLDGPVGRLILAVTNRG
FT                   VVACSYEDENVVFERVSREVGSFIGPDPRRLDPVRRELDAYFSGRLRAFTITADLRLAT
FT                   SFARTVLQMMIAVPYGTVTTYREIAERIGRPRALRAVGNALGSNPVCVIVPCHRVVENE
FT                   AVLGGYAGGATAKGRLLRVEGANGSRSPGGS"
FT   gene            129400..131322
FT                   /locus_tag="Sros_0127"
FT   CDS_pept        129400..131322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0127"
FT                   /product="Osmosensitive K+ channel histidine kinase-like
FT                   protein"
FT                   /note="KEGG: afw:Anae109_3103 GAF sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83182"
FT                   /db_xref="GOA:D2AXK2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXK2"
FT                   /inference="protein motif:COG:COG2205"
FT                   /protein_id="ACZ83182.1"
FT                   /translation="MRTKVPRSGWLTRHYGCVGDNRAASDDGIGRAVIAGAPNAIVAID
FT                   RDQAVLTWNPAAERLFGWSAGELLGRRVPLVPEELTAEHNAVLERVRTGGQVSLRTKRF
FT                   RRDGSLIDVRVDTSALRSEAGVLLGYVSVYHLTQDDETAHDRVARRAQLVRRLTDVVAD
FT                   INAERELPAVLDRIAASLAELTGADAGGFVLIEGDRVRLVASHRLPGSLRDSTADLRTS
FT                   LVGKLLRTGRTVMLETGDQARLDELIWSQLPGLHTIALGVAAVGGRPYGALYALFAKRK
FT                   AGHVELELLELLAGHAGIAVANAMAYQEAVRQRAHERAVFDASADGIAVLDGAGRVIQW
FT                   NPAATELTGFHAAEVIGGPPPFQLPEPGDKLTLQLPSGAWLDVLCAEIVETGEIVVDFR
FT                   DITRAKELEEAKDLFLATTSHELRTPITVVRGFAGTLDSRWDNMTDAERRAAVHTIAER
FT                   ARSLGQLMDHLLLGSRAGAGELTLRIEGFDLGELLRAATLGLPVLSDLHRVEVSIPEDL
FT                   PSVSGDALATDIMLGQLLENAFKYSPDGGLIRVEAWAAGERVIVVVDDEGVGIDPASRE
FT                   RVFERFVQGDSGDRRRFGGVGLGLYIVRSLAQAQGAEVSAHPRPGGGTRMRLALRIADT
FT                   PGALT"
FT   gene            131395..131934
FT                   /pseudo
FT                   /locus_tag="Sros_0128"
FT   gene            complement(132013..132708)
FT                   /locus_tag="Sros_0129"
FT   CDS_pept        complement(132013..132708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0129"
FT                   /product="putative inner membrane protein translocase
FT                   component YidC"
FT                   /note="KEGG: sal:Sala_0004 putative inner membrane protein
FT                   translocase component YidC"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83183"
FT                   /db_xref="GOA:D2AXK3"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXK3"
FT                   /inference="similar to AA sequence:KEGG:Sala_0004"
FT                   /protein_id="ACZ83183.1"
FT                   /translation="MFDPVIEFTADLITALAQPLGSTALAIVLFTLGVRLLLLPLSVMQ
FT                   ARGERVRARLAPEVQELRRRHGRDPERLHRELTALYAGEKASPLAGCLPGFAQMPFFML
FT                   MYQVFASSVIAGHANALLTHGLFGVPLGQQFAGAVAGFGLLSVPTLVFAGLFLLLLAVA
FT                   SVTSRRMRRTMGEQVQPELLRRVMPLLPFGTLLAAAVLPLAAGLYLLVTTAWAAGERAV
FT                   LYRAAPAGG"
FT   gene            complement(132779..133045)
FT                   /locus_tag="Sros_0130"
FT   CDS_pept        complement(132779..133045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83184"
FT                   /db_xref="GOA:D2AXK4"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXK4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83184.1"
FT                   /translation="MSVLLALQTLSVWMFDGGGAVTATAVVGLGVLLLAWALRALPLTS
FT                   EAGPRSALSRRDRARQTMFVRQRDPDAAGRSRPRAPSPGPAPA"
FT   gene            complement(133042..133194)
FT                   /locus_tag="Sros_0131"
FT   CDS_pept        complement(133042..133194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83185"
FT                   /db_xref="GOA:D2AXK5"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXK5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83185.1"
FT                   /translation="MAVLGVVLALYVVFGLVLPALFGLFKFLIVLALVAFVVVAVVTVA
FT                   GKFAK"
FT   gene            133325..134020
FT                   /locus_tag="Sros_0132"
FT   CDS_pept        133325..134020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0132"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: bha:BH1580 two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83186"
FT                   /db_xref="GOA:D2AXK6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXK6"
FT                   /inference="similar to AA sequence:KEGG:BH1580"
FT                   /protein_id="ACZ83186.1"
FT                   /translation="MSARILVVDDDPTVAEVVARYLERDGHVVECVGDGAEALRRALSD
FT                   PPDLLVLDLMLPKMDGLQVCRKLRERWPVPVIMLTALGEEIDRVVGLETGADDYVTKPF
FT                   SPRELALRVQSVLRRARGASTPAGTGVLRDGTLVVDVGAHEVRLGDGQIMLTAREFDLL
FT                   AHLMRNPRQAFSRSALLDQVWGWSFGDSSTVTVHVRRLREKIEPDPTAPRRIVTVWGVG
FT                   YRYEPLTQP"
FT   gene            134017..135144
FT                   /locus_tag="Sros_0133"
FT   CDS_pept        134017..135144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0133"
FT                   /product="histidine kinase"
FT                   /note="KEGG: lch:Lcho_2475 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83187"
FT                   /db_xref="GOA:D2AXK7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXK7"
FT                   /inference="similar to AA sequence:KEGG:Lcho_2475"
FT                   /protein_id="ACZ83187.1"
FT                   /translation="MIPEILLIVAVTAGLGLLVALAGLGAMRLLRERSIGVMLAVVAVV
FT                   TVLATVGGVVAITLKMIIEGTPRDIVLSVVAVGGLVGLGVATVLARRVVAASRKLVAAV
FT                   HAVPPSGEFAPPRGLPAELDTIARTLEEAYERLRLGHERERALESARRELVAWVSHDLR
FT                   TPLAGMRAMAEALEDGVVADPETVRRYHTQIRLEVERLSGMVGDLFELSRIHAGALRLS
FT                   RRRIGLSDLVADALAGVEPLARAKGVRLAGQVDQAVPVQADAGELSRALRNLVVNAIRH
FT                   TPGDGTVRVRALVEDGLACLQVADCCGGIPADDLPRVFDVAFRGEAARTPSADGAGAGL
FT                   GLAIARGIVEAHEGAIDVVNAGPGCRFEIRLPLST"
FT   sig_peptide     134017..134085
FT                   /locus_tag="Sros_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.904 at
FT                   residue 23"
FT   gene            complement(135234..135785)
FT                   /locus_tag="Sros_0134"
FT   CDS_pept        complement(135234..135785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0134"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to 30 kDa spicule matrix protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83188"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXK8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83188.1"
FT                   /translation="MITRTEKATSWHDAANSLRGLVNREGYVPIRTRLATEDLDFLEGA
FT                   REELLGFAALGVRLLDLHQPRDAGGITSDAAHPILRCRSCMWRWPCPTFRAMAESFGSP
FT                   RTPTSCQHVEPDDGENDEDAQVTLVVPGRSQSPGHAKGPGRPGEGGRVEEAGRPGEAGR
FT                   AGEEIRVLMTPHGVVGDMTV"
FT   gene            136070..136423
FT                   /locus_tag="Sros_0135"
FT   CDS_pept        136070..136423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0135"
FT                   /product="anti-sigma F factor antagonist"
FT                   /note="KEGG: sat:SYN_02356 anti-sigma F factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83189"
FT                   /db_xref="GOA:D2AXK9"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXK9"
FT                   /inference="similar to AA sequence:KEGG:SYN_02356"
FT                   /protein_id="ACZ83189.1"
FT                   /translation="MELKVSTRSHAGHTVMTIVGEIDLYTAPGLQSEFTRLLQESPTTY
FT                   VVIDMSGVEFCDSTGMNVLLSALKRLKERGGTLELAAPRPAVRKILQVTGLDSVFTVHE
FT                   AVPGKLLTAEPKG"
FT   gene            136420..137100
FT                   /locus_tag="Sros_0136"
FT   CDS_pept        136420..137100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0136"
FT                   /product="dolichyl-phosphate mannose synthase"
FT                   /note="KEGG: bha:BH2769 dolichyl-phosphate mannose
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83190"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXL0"
FT                   /inference="similar to AA sequence:KEGG:BH2769"
FT                   /protein_id="ACZ83190.1"
FT                   /translation="MTGTAVIIPAKDEADRIGATVAAALALSGVDLVMVVDDGSTDQTG
FT                   RVAKAAGARVVRHSRNRGKAAAMESGAEAVRLFDGEEPRHLLFLDADLGESAHAAAPLI
FT                   KPVMAGEADMTIAVFVTRVKLGGHGLVVRLAREGIERATGWTPTQPLNGQRCLTRAAFE
FT                   AARPLAHGFGVETALTIDLLRRGFRVREVEVEMSHRATGTDWKAQLHRARQFRDVARAL
FT                   LARR"
FT   gene            137140..138618
FT                   /locus_tag="Sros_0137"
FT   CDS_pept        137140..138618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0137"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_0338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83191"
FT                   /db_xref="GOA:D2AXL1"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXL1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83191.1"
FT                   /translation="MCWNLRVTRVPLAVDERRVPVSGVPRGLGAAAFAAVGLSVTLTIL
FT                   IGLLGPSAMVPRLPGPSWQPPYSLDLRPDGHLVIAMAAAAIVLGGLGLAVALRSRWGPD
FT                   PRLLLVAGCVAAALAALLPPSGSADHLNYAAYGRLVTLGRDPYAVTPAMLPGDPVTGAV
FT                   EEWAGVTSVYGPVATAVQALASFAGGDSVRLTVFVMAAFNAAAFIATALLLHRFTRGDA
FT                   DLQRRAALLWAANPLMIYHLAAGMHVDTLAVACMVAVFMARGAGSGLLLGVGIGVKLNA
FT                   GLVALGPAWELRRSPGRLAVVAGTATATVLVVYGLAGPHVLDRVGVASRMVSYGTPWHL
FT                   IKIGLQEAFGPGAYSAWIQAGSLLLLAVLAWLMLRAAPRDTAPVIAAVMVVAWLFAAPY
FT                   ALPWYDGLAFALLAMASWPALESFMVARVVILSLGYLPAREALRPEDLLWLKTVVRERA
FT                   VPWSLLALTLVLAWWAARAGARARRRPASAAPRP"
FT   gene            complement(138500..140713)
FT                   /locus_tag="Sros_0138"
FT   CDS_pept        complement(138500..140713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0138"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH0549 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83192"
FT                   /db_xref="GOA:D2AXL2"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXL2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83192.1"
FT                   /translation="MGAAHEGRSRRTRHRAACVLLAVVLLVLSGAGTAAASARSLPAGV
FT                   VVVGVPGLQWSDLDRARTPNLWKLVEQGGAASLSTRAVPLPDRGVTCQVAGWLTVSAGQ
FT                   RAGAPGTDCAPPAPPLPAPDGGASVPGWPGLVTYNTEETSYKPTLGLLGQLVADAGGKV
FT                   AAVGPGAALGAADRSGKVGKYAATIDGLGDLAPYRLVMVEAADLARALTGTGRDDGPAP
FT                   AGGQDRQAAVAGADRQVGAVLDRLPPETTVLLGGLSDTSAAPHLHVAVARGPSPDGGPY
FT                   PRGYLTTTSTRQDGLVTNTDLTATVIALLGLETPNGVVGHAWQSAGPSGEPAAATVRNL
FT                   AGEDLASQVLRKVRGPFFTVFVAVQILFYLLAAVAIRRGWGGSRALTATRAVAVVSGAI
FT                   AIATFLAQLMPWWSLPAPMAAVILTITGIACAIAGIAFAGPWRAHVLGPLTVVAAITSL
FT                   ALLVDVMTGSRLQVNAVTGYEPVTGGRFYGFSNIAFAVYSAGTILALAGIAQWLISRGR
FT                   RTLALAVCAAYGLFAVFADGWPAWGADFGGVPAFLVGVAVFLILLSGSRVSPVKLGLIG
FT                   LVGVLLIGAIAVADWLKPAAQRTHLGSFVQQVLDGEAWTVIGRKLGAMVGVTVGNWSLT
FT                   LLSLVALAFLFLVLDRPSRWGASALGRAYLLAPALRAGLIGALTCALIGFLMNDSGIAI
FT                   PAMALTVAVPLTLASCVRALQLSPPTTPERASAPAGTTAPPAL"
FT   sig_peptide     complement(140603..140713)
FT                   /locus_tag="Sros_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.336 at
FT                   residue 37"
FT   gene            140781..142094
FT                   /locus_tag="Sros_0139"
FT   CDS_pept        140781..142094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr3063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83193"
FT                   /db_xref="GOA:D2AXL3"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXL3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83193.1"
FT                   /translation="MTTGEATTTERPLWGWPLALLLIAVAVAPLVFQWLGNVDDQRLVD
FT                   LDVYRTGGQAILEGRPVYDFVTPAPQLLPFTYPPIAALLATPLAAMSWPAAQWAWTALV
FT                   FVTLAVSVGYGFRALLGHAVPYRAVLGRALGRRVARDRDAPGRAGGPGLPMAFALLMVA
FT                   CTYLMPVRDQVRFGQVDILLVALCLADCVARRPVWPRGMLIGLATAVKLTPGVFLIYLL
FT                   ITGFGPGARPEQRRTFFMAAFTAALLTLLPFLVIPADAAEFWFHALLDPERLGANAATT
FT                   NQSMRGMLIRLYLPEWLTSLLWLALVAVVAWYGFRHARRALLDGHPVTGVALVGLMAVL
FT                   LSPVAWIHHLAWVVVVLGALAGDGRDPVRVRVAAGVWLYYVVPIPWWGVTIKAAEIPVL
FT                   SPVLGKIVQNGFGLGALALVWLLGVWLPRRREVFRTLP"
FT   gene            142117..142533
FT                   /locus_tag="Sros_0140"
FT   CDS_pept        142117..142533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83194"
FT                   /db_xref="GOA:D2AXL4"
FT                   /db_xref="InterPro:IPR027981"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXL4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83194.1"
FT                   /translation="MFVTVGIVVGVVAGVAGVVIGALALWQTRGAVGDRSRMQAVEGAG
FT                   SPGDLRAIRDVAVFRYDAVEEMTGQLSFSVALMNGLGDGIVLTSINGHSEARTYVRPLR
FT                   GGKGRQPLSPEEEHAVRAARLGLGPEAEPHFGRE"
FT   sig_peptide     142117..142191
FT                   /locus_tag="Sros_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.629) with cleavage site probability 0.501 at
FT                   residue 25"
FT   gene            142690..143610
FT                   /locus_tag="Sros_0141"
FT   CDS_pept        142690..143610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0141"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="KEGG: ade:Adeh_1779 prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83195"
FT                   /db_xref="GOA:D2AXL5"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXL5"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ACZ83195.1"
FT                   /translation="MPKLAYLGPEGTFTEEALRILAPQAERLPRANVSAALDAARRGEA
FT                   DGAVVPLENSLEGAITTTLDEFAWGGPLLITAELLLPVEFSLLARPGTRIGRIKRVFTH
FT                   PAAITQCRTFIARELPDAVVVAAPSTAAAAQEVALPGSPYDAAIAARIAGEHYGLVELA
FT                   TGIGDRSDTVTRFVRVSRPGPLPEPTGSDRTTLVAFLTDDHPGALLEMLTEFSVRGVNL
FT                   TRIESRPTGDGIGRYFFHFDFEGHVADARVGEAISGLHRICADVRFLGSYPRADGLSPQ
FT                   VKRGTANGDFTEATGWLSRIRTGQV"
FT   gene            143750..145012
FT                   /locus_tag="Sros_0142"
FT   CDS_pept        143750..145012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0142"
FT                   /product="Serine--tRNA ligase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: bsu:BSU00130 seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83196"
FT                   /db_xref="GOA:D2AXL6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXL6"
FT                   /inference="protein motif:PRIAM:6.1.1.11"
FT                   /protein_id="ACZ83196.1"
FT                   /translation="MIDLRTLREDPDRLRASQRARGEDDSVVETLLDLDSRRRGALSRF
FT                   ETLRAEQKSIGKTVSRASGDEKAALLDRAKDLAAQVKSAESEAEKLAGELDNLLYTVPN
FT                   LVEEGAPAGGEDDFVLIEEVGEKPSFDFEPKDHLELGELLGAIDMERGAKVSGSRFFFL
FT                   RGVGARLQLGLLNMAMQQAIEAGFIPMIPPVLVKPESMKGTGFLGEHASEVYHLPEDDL
FT                   FLVGTSEVPMAAYHADEILDGGSLPYRYAGWSTCFRREAGSYGKDTRGIIRVHQFDKVE
FT                   MFSYTRPEDAHEEHLRLLDWEKEMLAKVELPYRVIDIAGGDLGVSAARKFDCEAWLPTQ
FT                   GQYREVTSTSNCTGFQARRLAVRYRDKDGKPQHVATLNGTLATTRWIAAILENHQQADG
FT                   SVVVPKALRPYVGLDVLEPVK"
FT   gene            complement(145631..145834)
FT                   /locus_tag="Sros_0143"
FT   CDS_pept        complement(145631..145834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0143"
FT                   /product="putative cold-shock DNA-binding domain protein"
FT                   /note="KEGG: reh:H16_B2025 cold shock protein, DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83197"
FT                   /db_xref="GOA:D2AXL7"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXL7"
FT                   /inference="similar to AA sequence:KEGG:H16_B2025"
FT                   /protein_id="ACZ83197.1"
FT                   /translation="MAQGTVKWFNAEKGFGFIAPDGGAPDVFVHFSEIQGNGYRSLEDG
FT                   QRVEFEITQGQKGPQASQVRAV"
FT   gene            146072..146869
FT                   /locus_tag="Sros_0144"
FT   CDS_pept        146072..146869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0144"
FT                   /product="phosphatase YbhA"
FT                   /note="KEGG: aha:AHA_3603 phosphatase YbhA"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83198"
FT                   /db_xref="GOA:D2AXL8"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXL8"
FT                   /inference="similar to AA sequence:KEGG:AHA_3603"
FT                   /protein_id="ACZ83198.1"
FT                   /translation="MGSPRLVATDLDGTALRSDGTVSPRTAAAFARVERAGATLVFVTG
FT                   RPPRWMHAVAGAVRHRGLAICANGALVYDLHTEQIVKSHLIASDVLEEVVRRLREKVPE
FT                   LAFSVEYEGGFAHESDFRLGRWDGKAVAGLRVGTSTLTSRPCAKLLALHPRMDPDALQE
FT                   TVCELVGDLVTPTHSSGRALIEMSAHGVTKASALATLAEGHAITSADVIAFGDMPNDLP
FT                   MLRWAGTSYAVANAHAEVLAAVDHVTAANNDDGVARVLEDLYR"
FT   gene            complement(146860..147369)
FT                   /locus_tag="Sros_0145"
FT   CDS_pept        complement(146860..147369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83199"
FT                   /db_xref="GOA:D2AXL9"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXL9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83199.1"
FT                   /translation="MNAEESTPHIVVMGPQGAQAEEDGEGRSITDLVEQPAKVMRIGSM
FT                   IRQLLEEVRAAPLDEASRKRLKEIHQSSIKELEDGLAPELVDELERLSLPFTEDDNGTP
FT                   PSEAELRVAHAQLVGWLEGLFHGIQTTLFAQQMAARAQLENMRKALPSGISLPQEGHQG
FT                   SSGPYL"
FT   gene            complement(147375..148331)
FT                   /locus_tag="Sros_0146"
FT   CDS_pept        complement(147375..148331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83200"
FT                   /db_xref="GOA:D2AXM0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXM0"
FT                   /inference="similar to AA sequence:KEGG:PHYPADRAFT_233029"
FT                   /protein_id="ACZ83200.1"
FT                   /translation="MHAIVIDKPGGPEVLTWREVPEPRPGPGDVLIDVAASAVNRADVM
FT                   QRQGLYGPPPGAPPYPGLECSGVVAEVGSDVEDFKPGDRVSALLAGGGYAERVAVPWQQ
FT                   VMRVPEGVDLVEAAALPEVACTVWSNVFMTARLRKGETLLVHGGASGIGTLAVQLAKAF
FT                   GSHVVVTAGSAEKIARCVELGADEGINYREEDFAERVRADVILDIVGGRYLPGNVKALK
FT                   TGGRLVVIGMQGGSKGELDLGALLVKRASVHGTTLRSRPVDEKGVIVRGVVENVWPLVE
FT                   AGAIRPVIHARVPMSDAAQAHRILESGDHVGKILLVS"
FT   gene            148447..151146
FT                   /locus_tag="Sros_0147"
FT   CDS_pept        148447..151146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0147"
FT                   /product="ATPase involved in chromosome partitioning-like
FT                   protein"
FT                   /note="KEGG: Hypothetical protein CBG04386"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83201"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXM1"
FT                   /inference="protein motif:COG:COG0455"
FT                   /protein_id="ACZ83201.1"
FT                   /translation="MARHDREESLEEQLAWLDAIKEQEETPPVTVKSAAMDTVDDAAIS
FT                   PYPKDPWSSVPSEPDVASSPLFRTAVDSAYDPAGAPVTMADPPAEEADAADWMAAGDTV
FT                   RAFTLPSVTAPPSQDNDGFLAPLKPLPRQEQDEGGGHTTGEFTGPEARAPRAESEPRQE
FT                   PSRGLFEQPRRPDEPAESFTFLPDEPAGPTLEPFKPPAPEPEGFAFGGTGSDRDGFTLP
FT                   NAGVERDAFAFGGADRDRFALPNAGSDRDAFTFGGADRDRFALPNAGAEREVSVFGGTE
FT                   QRDDRSGSAERDDPRSGSAEQHEDRPVSGAEQDAPRSGAESPEDRSASAGAEQDRDQPV
FT                   FKAGAEHDRDRQAFKAGAEHDRDRDRPVFKAEPFTGGDFLRPAPERSDPEVAEPFRVPE
FT                   SFGADRPNQATPPERAPGSFGSDSSGSPGFARDWDRPFGPDRDAPSTPAGKTAFTPEGE
FT                   TASASGRDTSPASGRGAAFTSERDRPFTPDRDAPSASGRETAFTSERETPFTAERDRPF
FT                   ASGRDTPSASGRETAFTSERDRPFAADRDTPSASGGDTAEPAREPYQARRRQSVPPPAF
FT                   SAPSRQQVPGAPRPSADSLDPESLLRGRRNGPAGGWRKLIYKASAGLIKPGESPEVRRR
FT                   RELVGRARTPVATGHHRVAVLSLKGGVGKTTTTVGLGATLAQVRGDRVIAVDANPDRGT
FT                   LSDKLELETSATVRDLLNERQQIKRYVDIRAFTSQAPSRLEILASDRDPSVSEAFSSSD
FT                   YQSVAQVLENFYSICITDCGTGLLHSAMSGVLGLADQLVLVSSPSVDGARAASATLDWL
FT                   EAHHYEELVRSATVVLCSVRPRSKSTVDLDRLEAHFAARCRAVIRIPYDPHLEEGAEID
FT                   LERLQSTTRESYLRLAASVGDGFAGTQL"
FT   gene            151267..151355
FT                   /locus_tag="Sros_R0004"
FT                   /note="tRNA-Ser1"
FT   tRNA            151267..151355
FT                   /locus_tag="Sros_R0004"
FT                   /product="tRNA-Ser"
FT   gene            complement(151568..152938)
FT                   /locus_tag="Sros_0148"
FT   CDS_pept        complement(151568..152938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0148"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_1611 integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83202"
FT                   /db_xref="GOA:D2AXM2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXM2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83202.1"
FT                   /translation="MNTSYDVKFWEIRRNASSKTPSYVIRWKVGGREKSKTLRTKALAE
FT                   SFLSDLRQAAKRGEAFDLETGLPLSLLAVKSAVTWFSFAMAYVDMKWPHAAAKTRDSLT
FT                   DALATITPALVNEDVPDKPDVLVLREALRQFAFPPAARRFPRSEEIRSALVWLERHSLR
FT                   VTDLAKVRNVRLGLDALTLRLDGGAAAATTIARKRSVFYNALQYAVDLEELPSNPIDKV
FT                   KAWKPPKVREVVDRRVVVNPTQARELLTAVTYVGRLNRGRHLRGFFACLYFAGLRPAEA
FT                   LGLRQEDCHLPVTGWGRLILAKSKPQTNKKWTDSGEAHDDRGLKHRAEDEGRPVPIPPE
FT                   LVAILREHIDEFGVHEDGRLFRTSRGGVISIGTYCEAWKAARAFALTPEQQASPLAARP
FT                   YDLRHAAVSLWLNAGVAAPDVAERAGHGVDVLLKVYAKCIDGGTEVANRRIDGALVA"
FT   gene            complement(152935..153129)
FT                   /locus_tag="Sros_0149"
FT   CDS_pept        complement(152935..153129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83203"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXM3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83203.1"
FT                   /translation="MSKGRDQLMTVPEILDELGGVSRRTFYRWREIGHAPQGLKLPNGE
FT                   IRIYRSEFTAWLETLREAA"
FT   gene            complement(153126..154859)
FT                   /locus_tag="Sros_0150"
FT   CDS_pept        complement(153126..154859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83204"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXM4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83204.1"
FT                   /translation="MTDTLVHPPIPSTTDPVNASDRTLPRLVRDTLPLALDVAVEVAKL
FT                   NGVCIRPIEMRRMDTLTGTTEPFDIPCGTTHEAKCPPCAKRNKQLRMAQCREGWHLDHE
FT                   PVAEPHPSTEDQRWLIEFRADVQAKRDQAERDGEEVADWDEAIAGIDAEINAAGMRGNV
FT                   LGGRTAPKRSRSTRRRQDAPDLPKRAKQDTTLGRTFIASDGRVYRPSLFVTLTLPSYGK
FT                   IRSGHGVPVDPASYDYARAARDALHFSKLVDRFVQNLRRVAGYDVQYFATVEPQKRLAP
FT                   HLHMAIRGTLPRAEIKQIAAATYHQVWWPSVDEVRFDGDHLPVWSARADLGDGAAYPDG
FT                   QSGDYLDPATGELLPTWDEALDRLDADEDAEPLHVLRFGAQVDVQGIVAGSPDAHKRIG
FT                   YLTKYLTKSLGDPLDPTDVGNHARRDHAARMVEALRYEPCSPTCPNWLRYGIQPKGAKP
FT                   GMLPGRCKSKAHKAEHLGYAGRRVLVSRKWSNKTLREHKQDRRAWVLDMLGLHDETTDP
FT                   HRYVWRPVSTKDPNRTPLAKRLLRGVADRHRTRARLRELEARAEGLPVTDLSAVEMREA
FT                   A"
FT   gene            complement(154856..155032)
FT                   /locus_tag="Sros_0151"
FT   CDS_pept        complement(154856..155032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83205"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXM5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83205.1"
FT                   /translation="MRVVFHATLAELGAYGLLDLHEAEIPPCFELANLRLRKDPYSDAY
FT                   RLCADVLDREEAM"
FT   gene            complement(155032..156477)
FT                   /locus_tag="Sros_0152"
FT   CDS_pept        complement(155032..156477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0152"
FT                   /product="DNA segregation ATPase FtsK/SpoIIIE and related
FT                   protein-like protein"
FT                   /note="KEGG: pna:Pnap_4588 cell divisionFtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83206"
FT                   /db_xref="GOA:D2AXM6"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXM6"
FT                   /inference="protein motif:COG:COG1674"
FT                   /protein_id="ACZ83206.1"
FT                   /translation="MFKKLPGDEAQQLVSTTPDTAVVFRPAVVRTPAFITIVIFAWRVL
FT                   SALVRLVWRHPIASTATAVPCALGWLYGWQWGVVLVALVLVGLTAWRFVDRASFLRLAG
FT                   WRLLAWWRLVWVYRRHWQPVMIISGLGRHVRGRDYLPRLVGVSCTSWADLVTVRMLTGQ
FT                   AVTDWSDRIEHLAHGFGATSCRVTVSRPGRLLLAFPRRDPLAVPLPALPIPAAASVGPV
FT                   EIGKREDGTPWWLKVHGTHVLVAGATGAGKGSIIWSTIRGLLPAVRAGLVQIWALDPKL
FT                   MELSFGRNLFDRYAADPAACAELLEAAVKVMQERAGRFAGVQRNHIPTVDDPFVLVVVD
FT                   EVAFLTAYQSDKGLKLRISAALATLTTQGRAVGVGVLAALQDPRKDVLSIRNLFPDKIA
FT                   LRLDESEQVDMVLGDGARDRGALADLISPDPELGAGIAYARLETSPEPMRARAGYVSDA
FT                   DIRAMVAAFAADTVPLPQTGEVA"
FT   gene            complement(156567..156998)
FT                   /locus_tag="Sros_0153"
FT   CDS_pept        complement(156567..156998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83207"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXM7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83207.1"
FT                   /translation="MAIQGPIPVSFDQVFPHGCYIVGEVEQVKDFDASSKGRTVYAKDK
FT                   TTGEPVWQVAVMDADPTVKAGQKTVSVKILSAVQPVPPAPLPGLPFVPVEFDAMTVTPY
FT                   VGQNTGRLAWSIRARAMRAPRTTAAPAKQSAATSKDIAA"
FT   gene            complement(157111..157848)
FT                   /locus_tag="Sros_0154"
FT   CDS_pept        complement(157111..157848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0154"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="KEGG: rpi:Rpic_4094 transcriptional regulator, GntR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83208"
FT                   /db_xref="GOA:D2AXM8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXM8"
FT                   /inference="similar to AA sequence:KEGG:Rpic_4094"
FT                   /protein_id="ACZ83208.1"
FT                   /translation="MSVSDEEYAPPKYAQIVTAIRRKIADGTYPPGSQLPSETQLVREF
FT                   AVSRPTVVRALQVLQLRGIIDREHGKGSYVKTPPPGSDDAPSRPGRAVLDRVEAAEGGA
FT                   VIEVGSHPAPANVAAMLSLPERTPVMMRRVLLSEADEPCELITFWCPIELAEGTDLGRQ
FT                   VPLTVSVRQHLQGARGLRLDHVVERLAARHPLPHEAKVLGLGKSAAVLGVLARVYDASG
FT                   RPVLVIDIALPGALHELEDAYTL"
FT   gene            complement(158299..158613)
FT                   /locus_tag="Sros_0155"
FT   CDS_pept        complement(158299..158613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83209"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXM9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83209.1"
FT                   /translation="MNAAFVAGGISPLETAESLRAELDRWKISADVHGGYGLALVSVWV
FT                   GLVVWCDGDRFWWRTGWDDRRERFTYAWHPAIEPARAARRVAFRYRDLRDAPPPSEPIA
FT                   "
FT   gene            complement(158906..159691)
FT                   /locus_tag="Sros_0156"
FT   CDS_pept        complement(158906..159691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0156"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="KEGG: dar:Daro_2866 GntR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83210"
FT                   /db_xref="GOA:D2AXN0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXN0"
FT                   /inference="protein motif:COG:COG2188"
FT                   /protein_id="ACZ83210.1"
FT                   /translation="MAELPLPDLDPTSDRAVFRQIADHIRHAIEQGTLAEGDKVPSEAQ
FT                   LMQHYGVARMTICNALQVLQGEGLTVAEHGRGVFVRSHPPVRRLASDRFARRHREQGKA
FT                   AFIAETEGAGGKPTVDSIKITEERPSADVAELLGITSEDHVIARSRRYLINGQPVETAV
FT                   SYIPAEIARDTQIAQPDSGPGGIYARLEELGYRLDHFVEEIRSRMPLRDEVRALKLAPG
FT                   VPVFHLVRTAYATDGRAVEVCDTVMSSDAYVLSYELPAR"
FT   gene            159764..160213
FT                   /locus_tag="Sros_0157"
FT   CDS_pept        159764..160213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0157"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="KEGG: aca:ACP_2902 hydrolase, NUDIX family"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83211"
FT                   /db_xref="GOA:D2AXN1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXN1"
FT                   /inference="similar to AA sequence:KEGG:ACP_2902"
FT                   /protein_id="ACZ83211.1"
FT                   /translation="MDHHNTHSVSVAGVIIDDQGRALLTQRRDNGHWEAPGGVLERDED
FT                   ITSGLLREIQEETGLHVEPVTLTGVYKNMTRGIVALVFRCKVIGGRLTETDETRAFRWV
FT                   TADEVQELASEAFAIRVLDAMHRDQAPAIRHHDGTRLLGASQLHE"
FT   gene            complement(160629..161891)
FT                   /locus_tag="Sros_0158"
FT   CDS_pept        complement(160629..161891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0158"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sea:SeAg_B2655 sec-C motif domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83212"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXN2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83212.1"
FT                   /translation="MSAETAGDKAEKRAQEVAAHLGIADFVYGQPLVRKGKGWREVGDG
FT                   LLVIGDRGAILQVKSREPAPGLRDSKDKAERVVRKYIEAAIKQGYGSKRTIQLHLASGK
FT                   PLSATPVRALDFPSVHSSIFALKLSRSCEQWPIIVIVDHPRNPIFSLSVPPGVFCISLL
FT                   DWEQLHEHTRSVSGILRYIDLVFKSRLPTVIGREEERFSKLAGFVRQPNIPNQWESHPW
FT                   FSTAARDDPLGVSVYRELLTKVWTGLPRGPGISPEDIRTMLAFLDDVPTSVMVVIGRWI
FT                   LRKRREFRETGNLASGGMTTGNKILVYLHGSEQQCSDQAQWTSELTFLTLTRLHEWTET
FT                   YSAKAVALGVGTRETENGIEYTHVYLEGAGGLTKEIRDMIEWKYGVHNYRLGHVHHLKY
FT                   GRNETCPCGSGMKYKRCHGSR"
FT   gene            complement(161945..164392)
FT                   /locus_tag="Sros_0159"
FT   CDS_pept        complement(161945..164392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0159"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSc0831 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83213"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXN3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83213.1"
FT                   /translation="MGNRMGRRRRADRQIVTGDTEISHALFEKIQTIVGRLNPGEDFLQ
FT                   YARRRDSILRDKVMTISNLVAPYDAFDVIDLMRQREMPLILDGYRESLDEGRAAAIEIV
FT                   ALILLARGRREGGSPNLADAPNSIIQELHHHTLEMLDVGTFALLAEGTESSHGPLAPLA
FT                   ADYRSSELNIRNKQYAHIHDRFNEALFGSPVCGSLILDALGFTYEEFIAVRESIRDIYV
FT                   DGITSNLDALGEVAMNWNGGKDGYEQNAEEIETGRAAATSIFFFPGNRASTNPEAVSQK
FT                   SGVGIDQVRAILRLFSVSFESADPVHSVQEFFDGKNVFSRAALICDGADNFLTLSSPIG
FT                   NDCFRHVAEDALKPSPAWNKYDRLRTRVSEGLATDYLQSLLDCEASYTQLKYFRPKKGV
FT                   ETAALGAAAVGLTELADEAEADALFLIEDVAICVEVKGRSVSERAKLGMVKRLATDLEV
FT                   TVGEAASQAHRLEELITTNGGIWISKDQWLALDHISEVRSIAICLDDMGPLAVALDQLV
FT                   RSGILQTKKLPWIVSLHDLAVIAETLDRPSEFLLYLRRRSDSDISKHYIAVDELDMFML
FT                   FLAGGLYIEPDPELVYKLHPTAGKPTGAARARYRAQAIPTRVGTHTDELDAWIYYQEGA
FT                   STTEQTKPRFRSNDDVLRIVDFLADGHKPGWLRFGADLLNLSSEAQENLSTGMLKTIRQ
FT                   TQIDHQRHSLAQGYAGAWGFPSLFICSQPIGSSQNDCLQWMSTYMVAKKHQLQSDRCLG
FT                   LLMLERGDISAVRYDNSPVRQSAELDQLVVDMQLQPLDRIGRTIPPSARRAKKQLRGSR
FT                   GKG"
FT   gene            complement(165104..165447)
FT                   /pseudo
FT                   /locus_tag="Sros_0160"
FT   gene            complement(165470..165788)
FT                   /pseudo
FT                   /locus_tag="Sros_0161"
FT   gene            complement(166060..166401)
FT                   /locus_tag="Sros_0162"
FT   CDS_pept        complement(166060..166401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83214"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXN4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83214.1"
FT                   /translation="MPSPTQVVPVPSALLSPVRPGGCDEAAAALTAYRRNGGTIRSSQA
FT                   AAAHQTYLDLMGAVLDAQGVVGAKISRLAAEFRELNFRLTGMTGGDPNQVIADINTDVA
FT                   ELKRLCGSV"
FT   gene            167090..167446
FT                   /locus_tag="Sros_0163"
FT   CDS_pept        167090..167446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83215"
FT                   /db_xref="GOA:D2AXN5"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXN5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83215.1"
FT                   /translation="MIDKQPAPSHQHQKKASRFRTFIVCSVTAGSILVGGLFLLNRDDS
FT                   RQTEMSTVLNQIGSGKVSTAKLVEAERRIEIITIDKKHFHSYWSEAGDQRSELAEELDK
FT                   AELPDGYTVEVPKR"
FT   gene            167795..167947
FT                   /locus_tag="Sros_0164"
FT   CDS_pept        167795..167947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83216"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXN6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83216.1"
FT                   /translation="MIRADRAGLRALAVHLLALSEPDGPTYYHAHLDPGEIDDESMPLI
FT                   LDHSD"
FT   gene            168280..169242
FT                   /locus_tag="Sros_0165"
FT   CDS_pept        168280..169242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Ankyrin repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83217"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXN7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83217.1"
FT                   /translation="MIVNDGSGWSGIGWDGWTDLGLIRARLDAGADPNSGVFFHAPPLH
FT                   AAAERGSPEVLAELVRRVDDVDAEHEGRTALWEAVFNNRPGNARALVAAGADPWRPMMN
FT                   GWSPGRLSLATATPGLFTLPDGEAGLSTPETAAVAEARRLIAALGRLDDDGYSIACTAD
FT                   ITAAEAVRRLEAVPADHADVEEIMEDPWSDLDDSLAVVGVTDVPGGCVVVQPWGYAAST
FT                   PGVIERLSVGTVCYGLFANPKSGNQGAVARDGVIEEWDTHPGGGSVYSEESAEEILATY
FT                   LYHGEAEAYCYAGAGLRPIDNRSITDQVDVWLRLPEHLH"
FT   gene            169609..171033
FT                   /locus_tag="Sros_0166"
FT   CDS_pept        169609..171033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0166"
FT                   /product="integrase domain-containing protein"
FT                   /note="KEGG: xau:Xaut_0805 integrase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83218"
FT                   /db_xref="GOA:D2AXN8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXN8"
FT                   /inference="similar to AA sequence:KEGG:Xaut_0805"
FT                   /protein_id="ACZ83218.1"
FT                   /translation="MDDPLLGSLGDLDEWLDRRDVLDGQPFLLSPQGEYDVALNRYFEQ
FT                   IGMATAPWNTQAAHARDLRNFLDFLWANRGGRPWREATPEDRAAYERWRRKDPAGPRVE
FT                   PTTWDREVATVNAFFAWVVRQGYIEVSPIVQRESRDRRSRPGRRSTQTTPAEASHTGAR
FT                   RHVEWLTPGMYRRWRDIGIRGHTPDGALDPSFRGRFASRNAAFTDLMIRTGLRISEQIG
FT                   LSLYELPRTQAGILNSRTWLPAPIAKWGSARYVYIPTGVLRDIWDYVEIERADAVERAR
FT                   DLGLYERIVEPLLIEDPSQPVVRIGGRRLPLTKLRQAERARVLVRTDHGWEPAALWLNE
FT                   SGLPGSAAGYRELFKDANRRCRRHGLTVSTHPHGLRHSFAVIELEHLWRGHLEQLQETN
FT                   PQARMTYQRVYGDPLLWVSCRLGHRSIETSAIYLHTLQELEMETRMALIPDWWERTGVD
FT                   PAQLDDPPTDGAEEHA"
FT   gene            171030..172919
FT                   /locus_tag="Sros_0167"
FT   CDS_pept        171030..172919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0167"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_4143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83219"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83219.1"
FT                   /translation="MTFVDQSPLPKTGRGRPTARPDGLYEPAWITGSVLVQGGVRVPFT
FT                   GEDGRGRTYKFGKLPLPGMHEDLAAAFALRTGSTGGRRTLASANIAWQAVRTVLTFLDG
FT                   LPYPPCDLPALRRSHLERLRRHLRLTHQERSAINTMVEVLQILQKADPARLRPEVRAFT
FT                   HQRGHHQREHGQDGGLPGYSDREFGQIMRAARSRVAEIRDRIRAGERLVALAQTTPEEL
FT                   TAEERDEARWLAEMARTGEVPSRRRDGGWPRTNLVDATAKLQAAKRLFLTSEDLLPPLV
FT                   LMVALTERNPETVKELPAQHRVLEERAVAVATVKRRRGKALSRMTLHWEIGTDSRRLHT
FT                   PGGLYLLIHELTARSRALSGTASLWAVWSHTGGHIGAFDKSLGRVMFLSRWAAAEGLTA
FT                   DAPEGAGPIPLQLRLDRLKTAAEVRRAKATGGHMPSTATTNTMDVSYLHYLRNDPVIQA
FT                   WAEDIIDAALADAEQSSRTFHLRILGVDFRDRFLADSETVARELGTTAAKVADALAGNL
FT                   DTLVASCLDIYHNPDTGGHCEVSFLTCLRCPNALVLERHLPMLYLLLDHLQTRLDQMSV
FT                   QEWCRRHGVIWLIITRLILPRFSPAQRDAARQTLPDQTALDLLALLDGPKEEA"
FT   gene            172916..174997
FT                   /locus_tag="Sros_0168"
FT   CDS_pept        172916..174997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pzu:PHZ_c1494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83220"
FT                   /db_xref="GOA:D2AXP0"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXP0"
FT                   /inference="similar to AA sequence:KEGG:PHZ_c1494"
FT                   /protein_id="ACZ83220.1"
FT                   /translation="MNTAAAARLHLWDANPYVLTKRQVRRGTRRAETSRFHDDIWTLTP
FT                   AILQRHKNALILNFTTVPERFRITAKELCYALLSLDLPPGERVSNVETIRGYHAGVSQF
FT                   LTWVDSRGIPTLASITAVDLDAYNDHILTTGRSSSWAAQLRYAVRLLWTYSSKLPTDSL
FT                   ALDPGIVDSWRQVATRNRPPENATPRIPEQVISPLLTWALIWINELADDVLAAAAEWRP
FT                   LHANTRLNRRRRNAPRTTGIAAQLGVVLRRYRIEGRPLPGGKKGQPMHSHLAREIGCTP
FT                   GALIAKGCQELLTKAAAELGVADTAYLRTPAAAFLDGEPWIEQIPYAAMEELGRMLQTA
FT                   AWITIAYLSGMRDSEVKHLKRGCLEVSRTEDGHIYRRKINSLAFKGEDDPVGVPATWIV
FT                   GQPVERAIQLLEQLQPRHQDQLFAILPGSRGHLRTNATGAKSTQQTNNDLAAFTDWIND
FT                   FCHQRQRRDGIPLVNGQRWNLTTSQFRRTLAWFIARQPGGVIAGAMAYRHHRLQMFEGY
FT                   AGTSASGFRAEVEAEEAIARGEHLCDLVVNHDYHPLTGPAAAEAETRLLDFQRHVTFEG
FT                   KIITEPRRLKRVMDRHDPHIYPGQHVTCVYNADRALCRRDDPAEGPSLPDCQPLACRNV
FT                   TLSTDNLDALRHHRARLERALGRGGLTAPYLRHRLEQQHAEIGAFLDKYTSAPARETT"
FT   gene            174994..175392
FT                   /locus_tag="Sros_0169"
FT   CDS_pept        174994..175392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83221"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXP1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83221.1"
FT                   /translation="MRRQLPTDAQVAAEMDRVLAESAKNGRHATIAAVERALDIPHATF
FT                   DRNYRQLIDQFQQQARAQHLASAHTEPNRPRTDPEETLQRLRRDNEDLRRLLKIYAESI
FT                   RQLTLNRDELHAALNASAKITTLPTRRD"
FT   gene            complement(175435..175638)
FT                   /pseudo
FT                   /locus_tag="Sros_0170"
FT   gene            complement(175698..176900)
FT                   /locus_tag="Sros_0171"
FT   CDS_pept        complement(175698..176900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83222"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXP2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83222.1"
FT                   /translation="MPSRLLASLIVLLLCSCSTATPGGPAPAAATTAPAGRAYEGPALP
FT                   GLATEQAWTLPLGSIRDAVAVGKSFAVLGRAADTFALQVIDAATGKELKSIPIEDEDAT
FT                   LRADTDHGKPVAVVRHRRQLAASGLTAESSQVSDLVIDETGSEVWRSPEDGDGRQGTFF
FT                   IGGYAAEGEADGAGLSNVSKLSTLAGEQAVALPIGAEEENSLLGVIKDKAVYWPRGMLL
FT                   DEEAAVVHGFDLSKGGSLAWRLPRDVQGRTIVGDFLLTWQSDGMSSTHSLYDLMAGERV
FT                   GGFEVSNSVGVRCATSAFDADSDTVLCDEPLTLIDSRTGKLLVPTVENQREVSVESAFG
FT                   GIAYLKVKQEQGAEPLYLALDDRTGKVLGDNLPAAPLAVSTDDYALIWHKLHAFGFKRT
FT                   A"
FT   sig_peptide     complement(176808..176900)
FT                   /locus_tag="Sros_0171"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.899 at
FT                   residue 31"
FT   gene            complement(176941..177513)
FT                   /locus_tag="Sros_0172"
FT   CDS_pept        complement(176941..177513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aca:ACP_3078 YceI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83223"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXP3"
FT                   /inference="protein motif:COG:COG2353"
FT                   /protein_id="ACZ83223.1"
FT                   /translation="MEDSDGMHRRGTSPGVYRIDPDATTVRFTTRAVFGLLPVQGFFTV
FT                   DHGRILITENIGDSAVDVVIRATSFESGNPQRDEHVRSLDYLDAAAHPEIVFRSRDVER
FT                   SAEGASVQGSLTVRGVTRPTALTLGPVITDDQRLRAQAATRIDRYAFGLTKARGMIIRG
FT                   VEDRPLSAPETGGSPLNKMIGLRGGRL"
FT   gene            178093..178485
FT                   /locus_tag="Sros_0173"
FT   CDS_pept        178093..178485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83224"
FT                   /db_xref="InterPro:IPR040846"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXP4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83224.1"
FT                   /translation="MRPSRTLAGLLVLLAVLLAGCASADGGKGIAIPDSPVGKQLRWYL
FT                   DAVNRTPIAESELNEHLSQDFLKEIPPQKFNEIAQGLKGLTVDELSKTEPAALTGLASI
FT                   PLGQKYDTKISVGTDGKIDYLLFEPK"
FT   sig_peptide     178093..178167
FT                   /locus_tag="Sros_0173"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 25"
FT   gene            complement(178633..179286)
FT                   /locus_tag="Sros_0174"
FT   CDS_pept        complement(178633..179286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0174"
FT                   /product="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis-like protein"
FT                   /note="KEGG: rso:RSc3026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83225"
FT                   /db_xref="GOA:D2AXP5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXP5"
FT                   /inference="protein motif:COG:COG2226"
FT                   /protein_id="ACZ83225.1"
FT                   /translation="MPEPSYLTATRASYDTVAVDYAERYGNALVSMPLTRAMLAAFAEL
FT                   VQAAGDGPVADIGCGPGHVAAHLNALGVPVFGVDLSPKMVEVARQRYPDLRFQEGSMTA
FT                   LDLRDGELGGVVAWYSTHHTPPEQLPAVFAEFHRTLAPGGHLLLGTHVGDERLHFQQAY
FT                   GHPVSFGAYLLPPDRITELLAEAGLIVSARLLEEPGEGRKRPHVCLLARKSGPS"
FT   gene            179438..179683
FT                   /pseudo
FT                   /locus_tag="Sros_0175"
FT   gene            complement(179803..180663)
FT                   /locus_tag="Sros_0176"
FT   CDS_pept        complement(179803..180663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83226"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXP6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83226.1"
FT                   /translation="MEVLEPETWRARTEAHRQRVEVWTAPHLARRARGETHPIEDFLFT
FT                   YYGYRPTRLRQWHPGTGVVLKGAHDFGRDYLDTPGGATLDTTALMDRRRPAVEWIARLL
FT                   AATAARPAYFGCFGLHEWAMVYKTAEVRHGAWPLRLSGEEIAGVVEQRGVRCGHFDAFR
FT                   FFTPEARPLNALQPTRQQQQELEQPGCLHANMDLYKWAYKLSPLVSSELVADCFMLARD
FT                   IRAVDMRASPYDLSSLGYRAIRVETAEGRAEYAAEQRGFSERARPQRQRLLDACERLLA
FT                   GTRSP"
FT   gene            180794..180973
FT                   /locus_tag="Sros_0177"
FT   CDS_pept        180794..180973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83227"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXP7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83227.1"
FT                   /translation="MRQEGQLLHVHGVLKGVVEGRPFGLTPASRPRHGAVARGRSGWDV
FT                   KAKVRAAPAAKRSP"
FT   gene            181000..181323
FT                   /locus_tag="Sros_0178"
FT   CDS_pept        181000..181323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83228"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXP8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83228.1"
FT                   /translation="MYGKRCLSLLGSALLATLVLGPAGAPVLADSVKAAVAGASQGAAT
FT                   MAAEQPSPCDKACRQGYGRGFSDGFADCVDGNSYRHDYNLGGASWDRGYVAGYGEGFGS
FT                   CAG"
FT   sig_peptide     181000..181089
FT                   /locus_tag="Sros_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 30"
FT   gene            complement(181421..181807)
FT                   /locus_tag="Sros_0179"
FT   CDS_pept        complement(181421..181807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83229"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXP9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83229.1"
FT                   /translation="MLPGRVLDVSALIDIAVAKTEYSRSIAAMCLFRGGGICIPATGLA
FT                   AVLSISPISTQVELFELVTTPGVKIDDFTHGKVGEIAEILDGSRDITAGHVVWCARSTK
FT                   WPILTDRGGELVQYDQHITIDPLP"
FT   gene            complement(181811..182158)
FT                   /locus_tag="Sros_0180"
FT   CDS_pept        complement(181811..182158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83230"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXQ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83230.1"
FT                   /translation="MQEPAPVPLWLAHLQPREGLEGISTPAPDTSITIELDKADFEALS
FT                   RKARSTGSRITDVIHAAVQREIGNKPHVITLMHRWSLHREDLDMAAGALGVAPLSEAEW
FT                   GQIGSRRGRRA"
FT   gene            complement(182569..183021)
FT                   /locus_tag="Sros_0181"
FT   CDS_pept        complement(182569..183021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0181"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="KEGG: plu:plu4153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83231"
FT                   /db_xref="GOA:D2AXQ1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXQ1"
FT                   /inference="similar to AA sequence:KEGG:plu4153"
FT                   /protein_id="ACZ83231.1"
FT                   /translation="MDDVDRKILAELQQDGRLTLTELAERVRLSLSPCHRRLRALESSG
FT                   AISGYHATLDAHALGLTFEALVFVTMRAADRATVDAFEQAVAAVPHVLQAQRLFGDPDY
FT                   LLRVITRDLPAFQRLYDERLATLPGVQRLSSTLVMKSVVENRPLPL"
FT   gene            183159..183776
FT                   /locus_tag="Sros_0182"
FT   CDS_pept        183159..183776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0182"
FT                   /product="amino acid transporter LysE"
FT                   /note="KEGG: pfl:PFL_2679 amino acid transporter LysE"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83232"
FT                   /db_xref="GOA:D2AXQ2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D2AXQ2"
FT                   /inference="similar to AA sequence:KEGG:PFL_2679"
FT                   /protein_id="ACZ83232.1"
FT                   /translation="MAIATLTAFWAVSLMFVVTPGADWAYAIAAGLRHRTVLPAVGGLL
FT                   AGHLAATAVVAAGVAALVARTPLVLTALTAVGAAYLVWMGVGMLTRPPAPQAGTEQAAG
FT                   SWLRQAVRGAGVSGLNPKVFLLFLALLPQFTDPDAAWPLPVQIMALGLAHVASCAVVYT
FT                   GVGMGARRVLRARPAAARVVSRVSGAVMISLGGVLLAGQLIT"
FT   sig_peptide     183159..183236
FT                   /locus_tag="Sros_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.914) with cleavage site probability 0.604 at
FT                   residue 26"
FT   gene            complement(183945..184670)
FT                   /locus_tag="Sros_0183"
FT   CDS_pept        complement(183945..184670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0183"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GA24403 gene product from transcript GA24403-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83233"
FT                   /db_xref="GOA:D2AZ48"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ48"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83233.1"
FT                   /translation="MGYPPPYGRPPKGETGRGLAVIVIMIVGLLIGAALSVTTVLDPAA
FT                   SSKSPPAARDSEHSETTVRQAAQVGLDAYSGGSYGDFWDLWSAQAQAAVAREEYVRLFQ
FT                   LCPQPVPDVRFAITTVTVTGDDARVQAARSGATTDFAFRYEGGSWRYVPPPEELQEYRT
FT                   QGVDQLARLRQAAGTCGTAASTPPTSAPSVPDPSASAPSVPGPATSAPSVPDPSASVPA
FT                   VPDPSASDPAVPDPATPPA"
FT   gene            184854..185423
FT                   /locus_tag="Sros_0184"
FT   CDS_pept        184854..185423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0184"
FT                   /product="cadmium resistance transporter, putative"
FT                   /note="KEGG: scl:sce4012 cadmium resistance transporter,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83234"
FT                   /db_xref="GOA:D2AZ49"
FT                   /db_xref="InterPro:IPR004676"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ49"
FT                   /inference="similar to AA sequence:KEGG:sce4012"
FT                   /protein_id="ACZ83234.1"
FT                   /translation="MGESIGTAAAVFAGTNVDDIVILTVLFLASRAGGVPRPWQIVAGQ
FT                   YAGIAILVAVSAVAALGLTVVPDRWAGLLGLVPFGMGVWGLVRKDDGGEAGPVASGVVS
FT                   VAGVTLANGADNISVYTPMFRTIGPSASLVTIAVFALLVAVWCAAASWLGSHKKIIGLV
FT                   ERSGRWLVPMVFMVIGAVIVVESAFR"
FT   gene            185476..186285
FT                   /locus_tag="Sros_0185"
FT   CDS_pept        185476..186285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83235"
FT                   /db_xref="GOA:D2AZ50"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ50"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83235.1"
FT                   /translation="MREHFRFYRHRWFKVWIAMAALSAALIAMTEAVGNRAVMPAAFFY
FT                   GAAAGPVGLLVAIHDRTRIGASVPGLTLMGMFLFGGGVALLLGGYFDALLIPDKHGPSI
FT                   LQVGWIEESAKCVPLLLVALTGRYLTKAAGVALGLSCATGFAIMESMSYAWKSVDDTGA
FT                   VNAGMVLFMRGLATPFSHLVWTGLICAVAFGVWQARGRIVITFSVVGAFAMAAVLHSLN
FT                   DGLLTLDIPGPARLLFLVVAAESYWLFHRATRDLTPAPVLEPAPSRA"
FT   sig_peptide     185476..185568
FT                   /locus_tag="Sros_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.549 at
FT                   residue 31"
FT   gene            complement(186415..187329)
FT                   /locus_tag="Sros_0186"
FT   CDS_pept        complement(186415..187329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0186"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: baa:BA_2274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83236"
FT                   /db_xref="GOA:D2AZ51"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ51"
FT                   /inference="protein motif:COG:COG3689"
FT                   /protein_id="ACZ83236.1"
FT                   /translation="MAAAVNRVTQNLVLIMLGCAVLRISAFSTTYLNYVKPGFRPFLIG
FT                   AGAVLMILGVAGLIQAWRPGKGSSGAGAHGGSPEHHAHSGDGSPDSRDLSAEPGRTPSP
FT                   EPEPELELEPVHDRGRERVRHPRDQGHGNGHDHAHGGPRVAWLMCLPVFAIFMIAPPAL
FT                   GSFAAARSETPPPRDQALTAFTPLSGDGPVDMPVGEFIGRAWDDDSRSLTGRAVRLTGF
FT                   VVPSKKKGQWYVTRMQIACCAADAFPLKVAVKGIQAPPPDTWVEVTGTWIPQTFGKMPN
FT                   GVVYPQLSGTDLVKVDTPDEPYE"
FT   gene            complement(187314..188345)
FT                   /locus_tag="Sros_0187"
FT   CDS_pept        complement(187314..188345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0187"
FT                   /product="permease-like protein"
FT                   /note="KEGG: bar:GBAA2051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83237"
FT                   /db_xref="GOA:D2AZ52"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ52"
FT                   /inference="protein motif:COG:COG0701"
FT                   /protein_id="ACZ83237.1"
FT                   /translation="MSELRADPRSPWADEDETVPPDSWGRRNGPKHTLPWGFALVVVLL
FT                   VVGRFTLAPHLTAPALQTWATIFVAICVQALPFLVFGVALSAAITAFVPASFWTRALPR
FT                   HPAAAVPVAGMAGAVLPGCECASVPVASGLMARGVPPAAALAFLLASPAINPIVLVATA
FT                   VAFPGQPLMVVSRFGASLAVAVLVGWLWLRFGRSEWLPIPSRPHGDGPKWARFGEAMRH
FT                   DLLHAGGFLIVGGLAAATLNVMVPREWLAALAEVPWLAVVVMALLAVLLSICSEADAFV
FT                   AASMTAFSPTAKLAFLVVGPMVDLKLIALQAGTFGRAFALRFVPLTFVLAVLVSALFGW
FT                   LLL"
FT   gene            complement(188389..189252)
FT                   /locus_tag="Sros_0188"
FT   CDS_pept        complement(188389..189252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0188"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bra:BRADO6602 putative NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83238"
FT                   /db_xref="GOA:D2AZ53"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ53"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83238.1"
FT                   /translation="MAAKDGDGWAHCERGHRHWGVHGASGLLAVHHDAAGTPHVLMQER
FT                   AVWSHHGGTWGLPGGALDSHEDPITGALREAGEEAALTGDGLRVQGVYLDDHGGWSFST
FT                   VIAEAAALLDAAPANSESADLRWLTPEQIAAKNLHPGFAETWPAISRALSPLVVVLDVA
FT                   NIVGARSEHGWWKDRAGAAAKLVAEVRALATGGLRDLPGEIPDLERWFPRFVMVVEGAA
FT                   RGVSPLPGVSVVSAPGLGDDAVVQAVRDVPPGERVLVVTADRGLRERVTALGAMVTGPR
FT                   WLLSQL"
FT   gene            complement(189495..190223)
FT                   /locus_tag="Sros_0189"
FT   CDS_pept        complement(189495..190223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_0435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83239"
FT                   /db_xref="GOA:D2AZ54"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ54"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83239.1"
FT                   /translation="MAAAACGATATSQPAQPAQPASPSAAPSSAPATSPPATGAPTPGP
FT                   TASPSPTTPPKFSAEVTKVARDRLRYSWRPGCPVPVGDLRLITMTYWGFDDKPHTGEMV
FT                   VNKNAADDIVTVFRRLYDWRWPIRKMELVDVYKGDDFDSIDADNTSAFNCRPATGSSSW
FT                   SQHAYGRAVDINPRENPYLSADGSVAHKNARKFARRPLDEPGVINPGDRVVRAFERVDW
FT                   EWGGYWSGIKDYQHFSKGGG"
FT   gene            190909..192090
FT                   /locus_tag="Sros_0190"
FT   CDS_pept        190909..192090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0190"
FT                   /product="ATPase"
FT                   /note="KEGG: geo:Geob_1221 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83240"
FT                   /db_xref="GOA:D2AZ55"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ55"
FT                   /inference="similar to AA sequence:KEGG:Geob_1221"
FT                   /protein_id="ACZ83240.1"
FT                   /translation="MDPVRNPYAPGAGQRPPELAGRDRELQQFEIVLERVARGRPERSM
FT                   VVTGLRGVGKTVLLNTFKSMAMQRLWGTGKIEARPDQSIRRPVAAALHLAIRELAPRHR
FT                   APERIEEFLGVLKAFAMRDPAAAKGTSHWSPGIDVPASRGRADSGDLEIDLTELFVDAA
FT                   GVATDLGVGIALFIDEMQDVQTPDVSALCAACHELSQSGGPLIVVGAGLPHLPSVLSAS
FT                   KSYSERLFRYARIDRLDREAADLALIAPAESEGVAFTQEALDALYEAADGYPYFVQAYG
FT                   KVAWDLALRSPITVDDIRVSAPEAEEELAVGFFGSRYERATPAERDYMHAMATIGDEPV
FT                   ATAEVAEGLGRKPSSLSPARDSLIKKGLIYSAERGLIAFTVPHFGKFLRSQPV"
FT   gene            complement(192212..193051)
FT                   /locus_tag="Sros_0191"
FT   CDS_pept        complement(192212..193051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83241"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ56"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83241.1"
FT                   /translation="MLTTIAAAQLPALGALLAAGALAKVRTAMNESEPNALSRLGPAAL
FT                   VVDHWRVPALLGCAAGEVILLVGLMATGHSLFRWGAATFFAVSTYVLWELRRRRPDVGC
FT                   GCFGEVSAIPVGLRSLGRTMVLTAMSVGTVWAPPVPGWTMVAGLTWSQLPAVAGGLLLL
FT                   AALSPEIEEAAARLRHRAPCEQRPLDPATALSRLRSSAAWRSHERLLSSTDPVDSWREL
FT                   CWRFFVYPGHSHAGAPADVVFAIYLSGRHPAVRVAMVDAAGRPIEIGPLQESIPVSA"
FT   sig_peptide     complement(192980..193051)
FT                   /locus_tag="Sros_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.990 at
FT                   residue 24"
FT   gene            complement(193057..194007)
FT                   /locus_tag="Sros_0192"
FT   CDS_pept        complement(193057..194007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83242"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ57"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83242.1"
FT                   /translation="MPYRSVDRRRVLAAAALGRTLDEPGAVSSDGELLQSVTGEILDVS
FT                   PHLIVIDTPDGREERLVIAPWATAWRGEAVAPADLPLGAQVIIRALRSGRVVDRIWADI
FT                   TRITGVIQSVGSGAGDRTMELYCGPHRGRRTVVIPYRASGRLRVRHPQFEPGYLFDAIG
FT                   VRENGVAQARLPATSQPPYRWTAVPEPPPGYSGAQSRISGTATWSDAFDHDEQGAAYPM
FT                   LERSDTDCEDAGVSCTGLPYLALGSVLNVRNVCAGRTSVLPIVACGCLAGRFCDRCLEC
FT                   GTSPRGRIVELSATAFVELGGDLTKGCFNARVGLG"
FT   gene            194256..194825
FT                   /locus_tag="Sros_0193"
FT   CDS_pept        194256..194825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0193"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: bcj:BCAM1661 RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83243"
FT                   /db_xref="GOA:D2AZ58"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ58"
FT                   /inference="similar to AA sequence:KEGG:BCAM1661"
FT                   /protein_id="ACZ83243.1"
FT                   /translation="MGSGCDSGHETHPDHRLVIAVTGGTHEEFREYVVARGPTLLRAAY
FT                   QLTGHPSDAEDLLQAALVKTYLAWDRIQERAAMDAYVRRAMVNINISWWRRRKLEEYPS
FT                   EELPEPVLTGGYGYLPERVEQALDRLPTRMRAAIMLRYYEDMTEPEIAKALGISVGTVK
FT                   STVSRAMAKLRGDLTIPEQRQLEPQA"
FT   gene            complement(194902..195387)
FT                   /locus_tag="Sros_0194"
FT   CDS_pept        complement(194902..195387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0194"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_4236 transcriptional regulator, MarR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83244"
FT                   /db_xref="GOA:D2AZ59"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ59"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83244.1"
FT                   /translation="MNVIPSDDSRLTAMGLLAEAYTGLSAKMHLSFTAVGLSDIDFETL
FT                   IRLARSPGQRLRMSDLAAQTSLSTSGVTRVVDRLEREGLVVRQACASDRRASYAAITDA
FT                   GTDRLGAVLPQHLADIETWFTGLLSAEQLDTLLDTLRIIRDAVRPCATAGAELTPSE"
FT   gene            195483..196046
FT                   /locus_tag="Sros_0195"
FT   CDS_pept        195483..196046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0195"
FT                   /product="YceI family protein"
FT                   /note="KEGG: afw:Anae109_3192 YceI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83245"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ60"
FT                   /inference="similar to AA sequence:KEGG:Anae109_3192"
FT                   /protein_id="ACZ83245.1"
FT                   /translation="MITRTWEDLQLPAPGTFALDVAHTRIGFMAKHMMVSKVRGSFTDF
FT                   SGTVAIAENPLDSSAEIAIRTESITTGSADRDGHLRSEDFLAVEKFPEITFHTTRVVGY
FT                   SSGEFTVLGDLTIRDVTKQVELTVEYGGAGTNPWGQEVWGFSITTEIDREEFGLTWNQA
FT                   LETGGVLVGKKVKIEIEGEANPAA"
FT   gene            196314..196403
FT                   /locus_tag="Sros_R0005"
FT                   /note="tRNA-Ser2"
FT   tRNA            196314..196403
FT                   /locus_tag="Sros_R0005"
FT                   /product="tRNA-Ser"
FT   gene            complement(196493..196819)
FT                   /locus_tag="Sros_0196"
FT   CDS_pept        complement(196493..196819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpc:RPC_0772 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83246"
FT                   /db_xref="GOA:D2AZ61"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ61"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83246.1"
FT                   /translation="MAPANLLRPQDPADLAAGDEDARRAGGGGQAVQRPLRRGAFIGRD
FT                   QVAGLVAGQAAATLLIEQGVNIRVVQEVLGHTRVTTTERYTHVSTPLMRDAGERLASAL
FT                   WGKL"
FT   gene            196981..197361
FT                   /pseudo
FT                   /locus_tag="Sros_0197"
FT   gene            complement(197398..197982)
FT                   /locus_tag="Sros_0198"
FT   CDS_pept        complement(197398..197982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0198"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pen:PSEEN2314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83247"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ62"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83247.1"
FT                   /translation="MEDPTGIAALTEILPADLGADEEIDWSAAEARWGTRFPRDYMAFM
FT                   SVYGAGSFDEVVILMPLPKEYIQWDPGTFEEETENARYTWEMLGGQEGLDIDPDHILAW
FT                   GVTSGSDILCWLTTDPDPDQWPVLVCGRHTREDFTLFPCGMVEFLRRLLLDEYDPYPLS
FT                   IDLRAASPRYVHWLEEQKRWKAGLDPASGLP"
FT   gene            complement(198184..198825)
FT                   /locus_tag="Sros_0199"
FT   CDS_pept        complement(198184..198825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0199"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: scl:sce5431 two-component system response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83248"
FT                   /db_xref="GOA:D2AZ63"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ63"
FT                   /inference="similar to AA sequence:KEGG:sce5431"
FT                   /protein_id="ACZ83248.1"
FT                   /translation="MIVDDQELLRNGLTMVVRSQPDMEVVAEAADGLAALKALESRRVD
FT                   VVVMDIRMPRMDGVIATREIQRLDGPPKVLVLTTFDLDEHALAALRAGASGFMLKDAPG
FT                   EEIIAAIRHVHRGDSIIAPATTRRLIGRLVAKADTDPDAVLKVLTEREREVFLSLARGA
FT                   SNAEIGVELFLSETTVKTHVGRILTKLGLRDRVQAVVLAYESGVVTPGER"
FT   gene            complement(198822..200096)
FT                   /locus_tag="Sros_0200"
FT   CDS_pept        complement(198822..200096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0200"
FT                   /product="Signal transduction histidine kinase-like
FT                   protein"
FT                   /note="KEGG: mmr:Mmar10_2544 putative signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83249"
FT                   /db_xref="GOA:D2AZ64"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ64"
FT                   /inference="protein motif:COG:COG4585"
FT                   /protein_id="ACZ83249.1"
FT                   /translation="MVGVRESPSPAGAVMDSFLNRHQVSTDAMLAVLLVLPLGLVSLSL
FT                   LRASDSPLSLRLLAGLGLLVLHGCVVPRRLRPLAAYGLAAVAMLLLVALPPLHDPDGAY
FT                   YPAVLLPSTLVFGLLLYTASGRLGLLPSLVCLAVALMGVVLVLARLWNPASWGGSSGSY
FT                   ELVAWRIGLSVGLFAAAACLWSLGRLSRIRMLFLSELRAKAERAEADRARERQEAARAE
FT                   RDRISREMHDVVSHSLAVMVSQAEGGRLSDPGSPGAGVFATIAGVGREALRDMRGLLGV
FT                   LRADGGTTPQPGLGDLSDLLDQVRDTGVRLAVQEVGDALPLRPAVDLTAYRVIQEGLTN
FT                   VIKHAGATAAADMTLAWRADRLHITITNDGAGPPAGEAGVGLTGMRERLSMVGGTLEAG
FT                   RRLGAGFELSATLPYEPRSLPSSGS"
FT   gene            complement(200096..201073)
FT                   /locus_tag="Sros_0201"
FT   CDS_pept        complement(200096..201073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0201"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A2625 ABC-type transporter, permease
FT                   component: HAAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83250"
FT                   /db_xref="GOA:D2AZ65"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ65"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83250.1"
FT                   /translation="MPVLIIVVWSASYLALGLLWAFGGPGYPFDASRAGAGNTLLDPLP
FT                   AAAGGGVLAMSALVAGVVAVLAARGPLNRAPAVVAVVAGVGLAVLLPDVRIMMTAGYLP
FT                   VMLAAALVGQAEFSMIATMLTWPSVNLLILMAAGVSLMLLGTRALIGGPGRPGSAAGAL
FT                   RIGRYATAVAVAVPVVYAVTRFGWLLGVPVGISDQFLAYISEITSIGAGLSTLGLVGAV
FT                   LTVGLVRPWGEIWPRWVPFLRGRPIPARLPAYSALAVSLPITSAGLMYVRKKLTGEQVG
FT                   PAGAADELGAWLPEMLWPLWGVALAVAALAYLSRRRHLAHARRP"
FT   gene            201102..201350
FT                   /locus_tag="Sros_0202"
FT   CDS_pept        201102..201350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83251"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ66"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83251.1"
FT                   /translation="MFTLPNLPSRRCPAHRHRVSAGSSGGRDGVVPEEDLTPRIAAGLQ
FT                   ARVLSPCLTDNAAATFCQGLYGVEIRKIRLRGGSLSW"
FT   gene            201360..201724
FT                   /pseudo
FT                   /locus_tag="Sros_0203"
FT   gene            201841..202320
FT                   /pseudo
FT                   /locus_tag="Sros_0204"
FT   gene            203846..204331
FT                   /locus_tag="Sros_0205"
FT   CDS_pept        203846..204331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83252"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ67"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83252.1"
FT                   /translation="MGELITYLLEKVHDDPGRWMVVDGAAINGEEMAPWEQEWGRYEDW
FT                   IEVGPNALVCDTPRDITADVRLELWSDQPPAPESAWDHSWTGEIFLRSGKIQLRGFYNG
FT                   EWGVHEVFDLGHRDATWLVRAQHKTLENDRETDFPRDIYRADIYKFQFWRPILQQGS"
FT   gene            204613..204936
FT                   /pseudo
FT                   /locus_tag="Sros_0206"
FT   gene            205826..207619
FT                   /locus_tag="Sros_0207"
FT   CDS_pept        205826..207619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0207"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psb:Psyr_1608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83253"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ68"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83253.1"
FT                   /translation="MTALTYTILTDPTSLEASVDGRSPSTGTMYLMVTNTRRTVPWLRI
FT                   EVKVPVGDGAGHLTRDISTIKPRGEYTDTQSNPQADTQPVIVQPQGANVFQVTSQSGRI
FT                   EGFAPGDYMVLTLENVTVAPTAGVAVLMVTEIIKTNKGWQTSQAAVPVVKAAPKEIPAP
FT                   RDFRPDKAMLDAGEDLALSWDGSDDFSYEIRFPGGRADIAQGTHTWSPAEAPKRATTYI
FT                   LVATDPTTQKQHFLTTTVQVRYPVLETLTATTGIDTPWVQGTANKGRVTFTGTGVEIFN
FT                   NSGGLGTVTADKADLNGVNTEWVQGRSTDDGKITFPQDGLDVRQGSGAWGTVHADKADL
FT                   NGVNTEWVQGRSTDDGKITFPQDGLDVRQGSGAWGTVHADTADLNGVNTEWVQGRSTDD
FT                   GKITFPQDGLDVRQGSGAWGTVHADTADLNGVNTEWVQGRSTDDGKITFPQDGLDVRQG
FT                   SGAWGTVHADTADLNGVNTEWVQGRSTDDGWISFPKEGLNVRKGAGQAWGTVFADKADV
FT                   NSVITNEIHGSGEGKGYIQFLDQDKGVRIFGGVSAGWIRGLSDDDAWIRFNEKGIWVLK
FT                   NQNGKRESANVSCATVNDRPA"
FT   gene            complement(208139..208300)
FT                   /pseudo
FT                   /locus_tag="Sros_0208"
FT   gene            208300..208449
FT                   /pseudo
FT                   /locus_tag="Sros_0209"
FT   gene            complement(208466..208813)
FT                   /pseudo
FT                   /locus_tag="Sros_0210"
FT   gene            complement(208863..209501)
FT                   /locus_tag="Sros_0211"
FT   CDS_pept        complement(208863..209501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0211"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pat:Patl_0638 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83254"
FT                   /db_xref="GOA:D2AZ69"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ69"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83254.1"
FT                   /translation="MRLRSLLASTAVLAITATAALAVGSPAQATTDDPTVAKSLAAEVQ
FT                   KGGKVRAIIEIEHGQSLADVARTAEAASSETKVISKAGSDGFLVATIDKPTLAELKTDS
FT                   RVKAIYKDEVSKPTLDVSTKLIGSDKANQAGWTGKGSTIAILDTGIDRDHPFFAGRIVG
FT                   EACFSSSDFDPYYLAVLVCPNGADAKPGTRPLRPQHGHRPSAGPGPGHV"
FT   sig_peptide     complement(209412..209501)
FT                   /locus_tag="Sros_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.609 at
FT                   residue 30"
FT   gene            complement(209810..209965)
FT                   /pseudo
FT                   /locus_tag="Sros_0212"
FT   gene            complement(210235..211008)
FT                   /locus_tag="Sros_0213"
FT   CDS_pept        complement(210235..211008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0213"
FT                   /product="ABC transporter permease"
FT                   /note="KEGG: bar:GBAA3492 ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83255"
FT                   /db_xref="GOA:D2AZ70"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ70"
FT                   /inference="similar to AA sequence:KEGG:GBAA3492"
FT                   /protein_id="ACZ83255.1"
FT                   /translation="MSTLTFAMRDSSTMVRRQLKRLLRYPSMTVQLIATPVIILFLFVY
FT                   VLGGTLGDGLGGGRSTYVNYVVPGILLMAAATAATGTAVMVATDMTEGIIARFRTMRIS
FT                   RASVLTGHVVGSVVQQLLGMAVLIGIALAIGFRPNATAAEWLAATGMLTLFAVAITWLS
FT                   VALGLKSPTPEAAGNAPMPLILLPFLGSGFVPTDSMPTALRWFAEYQPFTPIMETVRGL
FT                   LLGTPIGNSAAIATAWCVGIAAVSYLWAKNIFNKA"
FT   gene            complement(211005..211943)
FT                   /locus_tag="Sros_0214"
FT   CDS_pept        complement(211005..211943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0214"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: mes:Meso_2101 daunorubicin resistance ABC
FT                   transporter ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83256"
FT                   /db_xref="GOA:D2AZ71"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ71"
FT                   /inference="similar to AA sequence:KEGG:Meso_2101"
FT                   /protein_id="ACZ83256.1"
FT                   /translation="MTNLAIAANGLRKSYGDKAVLDGVDLAVPEGTIFSLLGPNGAGKT
FT                   TTVQILSTLIPADGGTVQVAGHDLVRRPDDVRGAIGVTGQYSAVDKLLTGEENLLLMAD
FT                   LKHLPRRDGKRKAAELLDRFDLVDSARKPAGTYSGGMQRRLDLAMTLVGDPRLIFLDEP
FT                   TTGLDPRSRRSMWQIVRELVASGVTIFLTTQYLEEADELADRIALLDHGRLIAEGTAEE
FT                   LKRRIPGGHIELTFADTHLLDTARHLLGAGIADPEALTLQVPSDGGVRAIRELLALLDE
FT                   RSIDIDDMSVHTPDLDDVFLTLTGQQKEATR"
FT   gene            complement(211969..212640)
FT                   /locus_tag="Sros_0215"
FT   CDS_pept        complement(211969..212640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0215"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aca:ACP_0525 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83257"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ72"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83257.1"
FT                   /translation="MQKFDTPTPVTAILNIPAGRIRFIAADRADTVIEVLPANASKSRD
FT                   VKAAEQTEVAYGDGVLRIKAPEAKNQILGASGSIEVTVQLPAGSRIEAQAAGAELRGVG
FT                   RLGDVAFEAAQGSVKLDETASARLTLLAGDVSVGRLGGPAQISTQKGDLRITEAVRGTV
FT                   TLRTEAGEISIGAARGVSASLDAGTSYGRIHNALKNTDGADAALTIHATTAYGDITARS
FT                   L"
FT   gene            212818..213310
FT                   /pseudo
FT                   /locus_tag="Sros_0216"
FT   gene            complement(213362..213991)
FT                   /locus_tag="Sros_0217"
FT   CDS_pept        complement(213362..213991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0217"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ara:Arad_15011 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83258"
FT                   /db_xref="GOA:D2AZ73"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ73"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83258.1"
FT                   /translation="MDSLRWADSRERRAGDSFGDVADPELGLGDVGVNDRGLLAVVLLG
FT                   SSGQGGPAGFDDVVLIARSHVGGELEGGHAAGVQEASPGAFAVRAGSAGHLADEQLRRE
FT                   VNSGLQVAENRNSANDKIFYGREGVLSGADHEHAEVSMLALRLLRSSPVFINTQLLQAV
FT                   LRAPAWANKLAAEDRRALTSLFWAHVIPYGRFHLAMDSRLDLGTAV"
FT   gene            complement(214120..214593)
FT                   /locus_tag="Sros_0218"
FT   CDS_pept        complement(214120..214593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0218"
FT                   /product="spermine/spermidine acetyltransferase"
FT                   /note="KEGG: vfm:VFMJ11_A0700 spermine/spermidine
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83259"
FT                   /db_xref="GOA:D2AZ74"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ74"
FT                   /inference="similar to AA sequence:KEGG:VFMJ11_A0700"
FT                   /protein_id="ACZ83259.1"
FT                   /translation="MPKSLRLAPITPANIETAIAVKVRPDQEHFVSPVAKSLAEAYVHP
FT                   GVAWPRLIFDGDHPVGFLMAFLDIDWDGKGIDFRSGLWRLNVTPDAQGRGVGRFAFESV
FT                   AAEVRRRGGTHMYVTWEPGEGGPEGFYQKLGFQLTGEKSGGQTVGVLDLTDPS"
FT   gene            complement(214910..215014)
FT                   /locus_tag="Sros_0219"
FT   CDS_pept        complement(214910..215014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83260"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ75"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83260.1"
FT                   /translation="MVKEAEDAEGNLEVWFDPESEDTSYIVSASTWPC"
FT   gene            215303..216028
FT                   /locus_tag="Sros_0220"
FT   CDS_pept        215303..216028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0220"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: mes:Meso_0091 two component transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83261"
FT                   /db_xref="GOA:D2AZ76"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ76"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83261.1"
FT                   /translation="MDESVSLAQLAHRLEEVVGELRGIPVDVERLGDSELVRQQIAQAT
FT                   QSASELRAMHPVGSREQGRQEQKSRRSVLDELRRGMAMRTIVHASVLDDPRKAARISEL
FT                   HAAGNLHRVVDEPIQQLLVFDRTVAFLRITPVAYSPGALAIRQQSLITILIDLFERTWA
FT                   KGREVTEPTHRLTPREREVLALIAEGRSNSAIAHALSITEAAVGKHVASVFVKLELPAT
FT                   KDDNRRVLAVLAYLRGAAR"
FT   gene            216062..216634
FT                   /locus_tag="Sros_0221"
FT   CDS_pept        216062..216634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83262"
FT                   /db_xref="GOA:D2AZ77"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ77"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83262.1"
FT                   /translation="MQTESGTDFNDVMQRMTGLLVGAVFGAVFVVVNAQSPLNTVAVNI
FT                   LRVAACLGAASVLAMWFASARKERPTAGPQRNMFGRGYLIVVFAEVILLFGGIRVLTAW
FT                   ERPEQTNVAWVAFVVGVHFIAFAPIWKDWSIAIPGVVLTLLGVAGLVMVSTAAIAWVPF
FT                   VSGVLSGVVLLTGTVTFGWRAMTARTA"
FT   gene            complement(216790..217281)
FT                   /locus_tag="Sros_0222"
FT   CDS_pept        complement(216790..217281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_0673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83263"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ78"
FT                   /inference="similar to AA sequence:KEGG:Sden_0673"
FT                   /protein_id="ACZ83263.1"
FT                   /translation="MQPQYQPATGRDSGSGLVPDDFTVPPDLATSQFRLEPLGPRHNAA
FT                   DHAAWTGSIEHIRATPGFQERGWPPAAGMPLEANLTDLRRHADDFARRRGFTYTVLEPA
FT                   GDEVIGCVYIYPSRSDGYDTDVASWVRADRAELDAPLYGAVTAWLSGHWPLGRLNYHPR
FT                   "
FT   gene            complement(217296..217397)
FT                   /pseudo
FT                   /locus_tag="Sros_0223"
FT   gene            complement(217618..218130)
FT                   /locus_tag="Sros_0224"
FT   CDS_pept        complement(217618..218130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bid:Bind_2941 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83264"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ79"
FT                   /inference="similar to AA sequence:KEGG:Bind_2941"
FT                   /protein_id="ACZ83264.1"
FT                   /translation="MTPQLVDRGPVTCLSVTGRGEPGGTEHVSAIRALHTVAAVLNVQV
FT                   GPLEGLWWVEDEQHWTEAPRDQWRWHLLLSLPGAPEPGAADAARETARVSGAAVDRVQV
FT                   VTFTEGQCVELLHEGPYSEEHVSLKVMDDFMAARGLVRNGLHHEVYLSDFDDPAPRTLL
FT                   RQPVALA"
FT   gene            complement(218127..218915)
FT                   /locus_tag="Sros_0225"
FT   CDS_pept        complement(218127..218915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0225"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="KEGG: cvi:CV_4236 MerR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83265"
FT                   /db_xref="GOA:D2AZ80"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ80"
FT                   /inference="similar to AA sequence:KEGG:CV_4236"
FT                   /protein_id="ACZ83265.1"
FT                   /translation="MLKGMDGDLLPIGQFARLGRLSVKQLRRYDELGLLVPAYVDEQTG
FT                   YRYYRPAQAREALSIGLLRSLDVPLAVIGQVLSGTAGVLAGVRDDLEAELARRRRTIRT
FT                   LERVMAEGLPSTQIRLVTEPARRVAIVRESAAGPQDIGRATSAAVARLGTGAPGLPVQL
FT                   IGLFPIDLGDPVPVDVALVTGEPVSGAELDMLPGGVFACATHIGPYDQIPLTTHALLSW
FT                   CAEHGHPVHGPIREVYVSDPATTAPEQLVTHLMIPLEEQS"
FT   gene            219004..219387
FT                   /locus_tag="Sros_0226"
FT   CDS_pept        219004..219387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rlt:Rleg2_1526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83266"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ81"
FT                   /inference="similar to AA sequence:KEGG:Rleg2_1526"
FT                   /protein_id="ACZ83266.1"
FT                   /translation="MALVVQNVAIDCADAYELARFWSGVTGHPLHPEDGPGDPEVQVML
FT                   PEGPLLHFNQVPEAKTIKNRIHLCLRPETSREAEVERLLGFGATLVADHRKPDGSGWAV
FT                   LADPEGNEFCVLRSESDRAATTA"
FT   gene            complement(219418..220119)
FT                   /locus_tag="Sros_0227"
FT   CDS_pept        complement(219418..220119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hso:HS_1632 large adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83267"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ82"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83267.1"
FT                   /translation="MTSNGNRSALSPQPGRRVRAWIVATTVISAFLAGSHQAPAGAAAE
FT                   KPDTSLPYPVSRNGGTALISHFGGPSGNSTFLTPGGCKNAYGKQSKCLRGPQGPQGLQG
FT                   VRGPQGAQGPQGLPGPQGPQGPQGSSASLATAFQGSLTFIGAARSDGATLIRDLRTVPR
FT                   WVDISSLANYPGSVVAVSLASMGNDIHVTVRSAIGEIAHTRCTVQPTPGTPGNPAWPGN
FT                   CTAFVDLTPPN"
FT   sig_peptide     complement(219991..220119)
FT                   /locus_tag="Sros_0227"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.824) with cleavage site probability 0.333 at
FT                   residue 43"
FT   gene            complement(220543..221715)
FT                   /locus_tag="Sros_0228"
FT   CDS_pept        complement(220543..221715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abb:ABBFA_003338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83268"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ83"
FT                   /inference="similar to AA sequence:KEGG:ABBFA_003338"
FT                   /protein_id="ACZ83268.1"
FT                   /translation="MTITLGAAVLALAMAAPAVADPWRPGFDRATLTGFASLPAQTFVP
FT                   GSEPSGAQLGTAPVNGVTPPFAGQPVQGFSGIVRRHDGTFDALSDNGYGAKANSADFLL
FT                   RVHRIRPDFRRGKVEVLGGFDLSDPDGHVTWPLTRTDRKLTGADFDVESIVRTLDGTYW
FT                   IGDEFGPFLLHFSPTGRLLEAPVSLPDVKAPENPFLDGGQPNLGRSKGFEGMARSVDGR
FT                   RLYPLLEGTVTGDPSGSLRMHEFDLRRRAYTGKRWTYRLDSSDNAIGDMIAVDRNRFLV
FT                   IERDNLQGDAARTKRIYLVDTRDRDLRKTLVADLLDLANPRGLGGFGETFRFPFQTIED
FT                   IVILDDRTLGVLDDNNFPFSAGRTPDRPDDNEFITIRLSRPLLADPRVYL"
FT   sig_peptide     complement(221653..221715)
FT                   /locus_tag="Sros_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            221957..222469
FT                   /locus_tag="Sros_0229"
FT   CDS_pept        221957..222469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0229"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: ade:Adeh_2145 sigma-24 (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83269"
FT                   /db_xref="GOA:D2AZ84"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ84"
FT                   /inference="similar to AA sequence:KEGG:Adeh_2145"
FT                   /protein_id="ACZ83269.1"
FT                   /translation="MQQNGGPPRPWVVEFTDFVAARGNALYRYGYVLTGNAEDAADLTQ
FT                   EALMRLGDAWSRIRKKDDPEGYVRTTMARLHISLWRRLRRERLVEAVPEVTYTDDRLDG
FT                   DVGLWKELEGLPPKQRAVLVLRYYEDLPDQEIAELLGISRGTVRSQAARALDKLRIRIT
FT                   DLETGRV"
FT   gene            222469..223911
FT                   /locus_tag="Sros_0230"
FT   CDS_pept        222469..223911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83270"
FT                   /db_xref="GOA:D2AZ85"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ85"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83270.1"
FT                   /translation="MTYDRSEAELARTLAGAADAAPPPVGDLLTAVHRRRGRRTRRRVQ
FT                   SALAVAGVIAVIGGGTAVARGTFSSGGGEGRILADATATATTSVGPTGTGTGKIAIRPA
FT                   AEVWPAAVTKIPIKTADGWRYRPVAGLSATELLLVAESSFEKAGRLEAYDTAARRSTVL
FT                   TDTPAPEGVKGYFVQAVEVGSEYIAWWGETPNNSDKWADFWVVPRAGGTAKQVGQVTGD
FT                   LSEVERIGVTADSVVWSAAGGGIYRMPLAGGSPEKIAGTDGLHLMSWPWAVDVANGREG
FT                   EGEQKNQTKVVNLETGQTTEVNVPDGVQGLRCGPVWCFGKEKDQENNASVVQRVDGSDR
FT                   KSPPDLSAWGGGHHLARGFGLFQVSGVVGRDARGEEIEDAQAPLAAVYDPVTGTTAGIG
FT                   KRDPSGGGGYGTGTSSSPTSVLYWDEGQRQVEKCRKVDATSVPRPPGEPVPTGKVTSCT
FT                   TTVEGGGKEYTVVNLLAVPPSE"
FT   gene            223922..224392
FT                   /locus_tag="Sros_0231"
FT   CDS_pept        223922..224392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0231"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="KEGG: reh:H16_B0667 acyl dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83271"
FT                   /db_xref="GOA:D2AZ86"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039375"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ86"
FT                   /inference="protein motif:PRIAM:4.2.1.17"
FT                   /protein_id="ACZ83271.1"
FT                   /translation="MRIFNNVRELKAAVGEHLGYTEWRRITQERVNLFADATDDHQWIH
FT                   VDVDKAKEGPFGGTIAHGYLSLSLLPSFMTELVRVDGLAMGINYGLNKVRFPAPVPVGA
FT                   LIRAGAELVDVKGTPSGYLSNMRLTIEAEGQKRPVCIAETLSLYVPVPDESS"
FT   gene            complement(224362..225003)
FT                   /locus_tag="Sros_0232"
FT   CDS_pept        complement(224362..225003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0232"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: scl:sce5431 two-component system response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83272"
FT                   /db_xref="GOA:D2AZ87"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ87"
FT                   /inference="similar to AA sequence:KEGG:sce5431"
FT                   /protein_id="ACZ83272.1"
FT                   /translation="MTIRVLVADDHAAVRAGIVLILEGQEDIEVVGQASDGEQAVAMAL
FT                   GLRPDVVLMDIRMPKLDGISATRELSGIADVLILTTFDIDEYIFGALRAGAAGFLLKNT
FT                   DADALVEAVRVVARGDGLISPSVTRRLISAFGTAVPERRPQEVGGLTPREREVLACIGR
FT                   GMSNAEISVELDMAEATTKTHVSRLLNKLGLRSRVQAAILAQELSSGTGT"
FT   gene            complement(225000..226139)
FT                   /locus_tag="Sros_0233"
FT   CDS_pept        complement(225000..226139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0233"
FT                   /product="putative two-component system sensor kinase"
FT                   /note="KEGG: scl:sce5432 putative two-component system
FT                   sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83273"
FT                   /db_xref="GOA:D2AZ88"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ88"
FT                   /inference="similar to AA sequence:KEGG:sce5432"
FT                   /protein_id="ACZ83273.1"
FT                   /translation="MEGMRRDDALWAVACFAGGLVLLAAHAYPHRATPAYLLVGPLLVS
FT                   CLGVAVRRSSPMAALWLGLVAIVADGFLGPSMGTILVFTDNLYAAVRYGPARLGKWMLG
FT                   ITSVFAVVGGTAAWFFSRDLSLLAVAVVQLGLIGVTPVSTGMIIKQLHDRAESERSRAE
FT                   QVARLAELDRQAAVDSERARMARELHDMIANHFSAIAIQSTAVLSRKDLNAEAVRNVME
FT                   SIRENSVQGMAEMRTMIGLLRQDGEEAEATRRRVAEVEDLAERAREAGLEVRFRVDGDA
FT                   RDLPASVDLAGYRIVQESLTNALKHGGKVADLVIGYRPGLLTLTVDNPVDGAGRALPGA
FT                   GAGLIGMRERAVLVGGSIEAGPHDDGWRVRAELPTGEIS"
FT   sig_peptide     complement(226056..226139)
FT                   /locus_tag="Sros_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.601) with cleavage site probability 0.472 at
FT                   residue 28"
FT   gene            226274..226864
FT                   /locus_tag="Sros_0234"
FT   CDS_pept        226274..226864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bsu:BSU17070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83274"
FT                   /db_xref="GOA:D2AZ89"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ89"
FT                   /inference="similar to AA sequence:KEGG:BSU17070"
FT                   /protein_id="ACZ83274.1"
FT                   /translation="MILAVIIGCEIGFWVLLGLGLASRYLWGMRRLSTVLLVSVPLLDV
FT                   VLLTAAVIDMRGGAQAAWHHGLAAAYLGYSIVFGHRTVKWADAAFAHRFAGGPAPQKPP
FT                   PGGMARARYEWGVWIRIVIAYGITCALLFGLIRIVDDPSRTAALTAFMGSLLKVPLIAA
FT                   LWPVSYTLFPKKTPKEAADDRDGGGKVTSDSSA"
FT   gene            227649..227721
FT                   /locus_tag="Sros_R0006"
FT                   /note="tRNA-Arg1"
FT   tRNA            227649..227721
FT                   /locus_tag="Sros_R0006"
FT                   /product="tRNA-Arg"
FT   gene            227876..228262
FT                   /locus_tag="Sros_0235"
FT   CDS_pept        227876..228262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83275"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ90"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83275.1"
FT                   /translation="MTGTRILSFKAWRGGRYVGLAEVLTSLGAPIDGHRWRLTIDWLVS
FT                   PELEAITEATAGSLVTTGRLIELFSVECQLIDGELVGHGDSPSAPEVKIRAFDSGHWDV
FT                   QTDSPELLEKIVTLYPDAQELPEW"
FT   gene            228256..228381
FT                   /locus_tag="Sros_0236"
FT   CDS_pept        228256..228381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83276"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ91"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83276.1"
FT                   /translation="MVNPRDMLRKTLQERRILEGLRTLYGVEIRGIHLRGGLPSW"
FT   gene            228391..228900
FT                   /pseudo
FT                   /locus_tag="Sros_0237"
FT   gene            228897..229407
FT                   /pseudo
FT                   /locus_tag="Sros_0238"
FT   gene            229507..230088
FT                   /locus_tag="Sros_0239"
FT   CDS_pept        229507..230088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0239"
FT                   /product="putative transposase"
FT                   /note="KEGG: pol:Bpro_2745 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83277"
FT                   /db_xref="GOA:D2AZ92"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ92"
FT                   /inference="similar to AA sequence:KEGG:Bpro_2745"
FT                   /protein_id="ACZ83277.1"
FT                   /translation="MPKLLYARPPADAEEERQIRKLAGARHAPADWITRAQMIAFSWQG
FT                   QRTSAIAARLGCHMQTVRERIERFNAEGLAGLGDRPGAGRKPRLTEIERGCVIALARSA
FT                   PPGRPVREGAGDLVADDESGPAQWTLDSLTAAARAQGIVIARSQVRRILLTEKVRWRHT
FT                   RSWSESTDPQFTPKGPKSSASTPTRRPAPR"
FT   gene            230085..230639
FT                   /locus_tag="Sros_0240"
FT   CDS_pept        230085..230639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0240"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_5589 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83278"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ93"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83278.1"
FT                   /translation="MICADELGPVTPRTFPPAPGWSVGGHRIKDRLEYSRGTDKTWVYG
FT                   ALRIRDGTELTFCAPSRNSDGWIQLLQQIATANRRGPIVVITDNLSSHFSWRVRQWLAR
FT                   HPRIRQVFIPVRACWLNLAEGWWRLLRRAAFAGQTFADATEIAYAVALATAQLNAHAQP
FT                   WIWGRPSPQPRILRHKFVYLL"
FT   gene            230975..232165
FT                   /locus_tag="Sros_0241"
FT   CDS_pept        230975..232165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_1238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83279"
FT                   /db_xref="GOA:D2AZ94"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR017510"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ94"
FT                   /inference="similar to AA sequence:KEGG:MXAN_1238"
FT                   /protein_id="ACZ83279.1"
FT                   /translation="MSQQHSRQESSLPSTTAMGPATVAVFASPASWIESDALAQCHQVA
FT                   ALDGMMHVAAMPDLHPGKGAPIGAAMASTVLYPFLVGSDIGCGIAVFPMKLKRAVPEKL
FT                   AARFPDLDRALDPEQDADDPAWDVVKGDIPAGHVEGLGTVGRGNHFVELARIGTVFEPG
FT                   HASRLGLADGDLVLIVHSGSRGLGERILRAHTAVHGAGPAPDPGAYLAMHDDAVRWGSL
FT                   NRRLMAARVAHALGAEPAEPLVDQCHNLVEVRDGVYLHRKGAAPGDGRDVLIAGTRGTP
FT                   SYLVAAHAGPDANHSVAHGAGRKMSRADALRRGRAKHTVEELRRTPVGSLVVCGDRQLL
FT                   FEEAPTAYKRIEQVIADLVDHDLATPVATTVPLVTYKTPDLGSAPQRDQRRKRGRQ"
FT   sig_peptide     230975..231058
FT                   /locus_tag="Sros_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.816) with cleavage site probability 0.803 at
FT                   residue 28"
FT   gene            232162..232821
FT                   /locus_tag="Sros_0242"
FT   CDS_pept        232162..232821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0242"
FT                   /product="peptide chain release factor-like protein"
FT                   /note="KEGG: bur:Bcep18194_A4861 peptide chain release
FT                   factor-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83280"
FT                   /db_xref="GOA:D2AZ95"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR017509"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ95"
FT                   /inference="similar to AA sequence:KEGG:Bcep18194_A4861"
FT                   /protein_id="ACZ83280.1"
FT                   /translation="MSVHLLLSAGRGPQECAWALARLLRRLEADATRQNLETHRAQTVP
FT                   GDRPDTYRSVLIQISGAGAEAFAASWTGTLCWQAPSPYRAGTGRKNWYVIAQPCQVDTP
FT                   RTTFAEADVDIVACRTGGPGGQHRNKASTAVRATHRPSGIVVVVDTERQFSLNRRIAMR
FT                   LLRQRIEDGDATAGRAVTTARWRVHDELVRGNPTRIERPEMPEQDLASQGQTRRRP"
FT   gene            233271..233939
FT                   /locus_tag="Sros_0243"
FT   CDS_pept        233271..233939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_C6900 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83281"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ96"
FT                   /inference="similar to AA sequence:KEGG:Bcep18194_C6900"
FT                   /protein_id="ACZ83281.1"
FT                   /translation="MTAQDVARLLPGVPMLRDLCRSMAVLEAILSPEWESRYHSFDAAW
FT                   SPREEMASMRNGSGDEYSVVFSAMGAYIRGFDHESVMSPYANDGPWPGVLDSVPGVFRH
FT                   CVEEPAFCDEDGMPIVTACLWREAGDDRRRAGEIEYPDCESDPDGAAHLFGLLVDPPAE
FT                   AFRRFAEDYYEVPVDLDAVRHVHALRPLTQAVVTALNADLTLRDLAEDLAASRYPSAAD
FT                   "
FT   gene            complement(234299..234448)
FT                   /pseudo
FT                   /locus_tag="Sros_0244"
FT   gene            complement(234652..235479)
FT                   /locus_tag="Sros_0245"
FT   CDS_pept        complement(234652..235479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83282"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ97"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83282.1"
FT                   /translation="MKLFFAGLVATAAVVCAVAVPAQAASVASVQAAPVNPVKALKAQL
FT                   VPGKGVKITETSGITLDFTADDRAMQVQVSTRTVGTLAFDKGNVAAADLRVRMSSRPKG
FT                   PNPPYRIIAEGRNAYVTNAGIAKALPSGRSWIQSKASGRENAVLDMGVTPAQLQFMLDN
FT                   ASEVATGQYQGTATLADFQHDKSAGEGNVEFHLYFDEHNLLTRTVVDTTAYPDGDTAAY
FT                   DQMVFHTDTKYSDWGAKVKIAAPAAGKVISEKKLNAKIRKAVIKAGYPESGPF"
FT   sig_peptide     complement(235405..235479)
FT                   /locus_tag="Sros_0245"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 25"
FT   gene            235931..236473
FT                   /pseudo
FT                   /locus_tag="Sros_0246"
FT   gene            236644..238197
FT                   /locus_tag="Sros_0247"
FT   CDS_pept        236644..238197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0247"
FT                   /product="Acetylcholinesterase"
FT                   /EC_number="3.1.1.7"
FT                   /note="KEGG: xac:XAC1213 carboxylesterase, type B"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83283"
FT                   /db_xref="GOA:D2AZ98"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ98"
FT                   /inference="protein motif:PRIAM:3.1.1.7"
FT                   /protein_id="ACZ83283.1"
FT                   /translation="MTFIRTLNSAVVSLVIVMAGAAPADAAPRNAVRTDAGWVRGEIAR
FT                   DHRIFQGIPYAASPVGNLRWQSPRPVTPWHGVRDATRPGNRCAQSADLWGLPASDSEDC
FT                   LYLNVTVPRSATPSRPRPVMVWLHGGSLTKGAGSDYDATRLATRGDVVVVTVNYRLGVF
FT                   GFFGHPGLADGGAYGLEDQQAALRWVQRNVAAFGGDHRNVTLFGESAGAHSACSHLASP
FT                   TAAGLFRRAILQSTPCSQAAFTRSGLRPLLDIPMWVPKAAHEAHGATIATALGCTDPET
FT                   AVTCLRGKPVSKLLAQEPLALPSYGNTVLPADPETVFAQGRFHRVPILTGITRDEGTLF
FT                   AALMFPGLTEQGYQEGLRRFFGDKATAIAAEYPSRGRPVQAAAAILSDLDWAWAGRASD
FT                   RMLSEHTPVYSYGFADRTAPPIFPLPGGVEPLASHGSELSFLFPGAALTREQRKLGDTM
FT                   ITYWSRFAATGDPNAPGLPRWSPVRTGHVHRLAPGPGGVGIYDQDALHKLAFWDRLADR
FT                   "
FT   sig_peptide     236644..236724
FT                   /locus_tag="Sros_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 27"
FT   gene            complement(238019..238885)
FT                   /locus_tag="Sros_0248"
FT   CDS_pept        complement(238019..238885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0248"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: col-61; COLlagen"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83284"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZ99"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83284.1"
FT                   /translation="MCWLNYDCAIEVIAAAYARKLPSIGEALAAADLMATTGSADLTAA
FT                   IGTSTGELAEHSLRRLNGTQVTRRMAMRALADLSAPGTGMLERWIRASARQGRLLRALA
FT                   DMRTAGAPPSVPPDRPPDVAKGAPLNLWGAPFVMPHWLTPPNQSTKPQPEQEPGRTIQK
FT                   ANHNQQDHQRREPPSTTVPSTRSCRKGHVLTCGTASSSGRFDSSCSGLPIGGPTMSTTP
FT                   ARMGVRQVSGRPGGPRRPACGGRPDRRCRRHRGPEPGDGHARCARDSSAAGQERWGRRS
FT                   PRSGTST"
FT   gene            complement(239156..240235)
FT                   /locus_tag="Sros_0249"
FT   CDS_pept        complement(239156..240235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0249"
FT                   /product="Serine phosphatase RsbU regulator of sigma
FT                   subunit-like protein"
FT                   /note="KEGG: sus:Acid_5354 response regulator receiver
FT                   modulated serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83285"
FT                   /db_xref="GOA:D2AZA0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZA0"
FT                   /inference="protein motif:COG:COG2208"
FT                   /protein_id="ACZ83285.1"
FT                   /translation="MLLAPLALTAVVTVVAVLTPSHLYFSRFLVVAPALAASMWPVVET
FT                   VALGLLALAIDVLIAVTIGQPEESHTHLFTIAVIAGVTVAAASASHVRQQREETLAQVR
FT                   SVAETTQKVLLRPMPHRLGRLDIDALYLAAAAQAHVGGDFYEALETPHGVRLIIGDVRG
FT                   KGLPAVGVASAIVGCFREAAYDEPDLARLARRLDVSMNRYTTLLFGDDLEYFATALLAE
FT                   FPDNGSVVEIVNCGHPSPLLLRAGAVREVTPTAPSPPINMGALLGQEYHIDPLPFAAGD
FT                   QLLLYTDGVTETRDHTGAFFPLTQHAGQWDADSPSRLLEQLHRDLVHYSHGRLDDDIAA
FT                   VAVRATDDRPGGPSSPGRR"
FT   sig_peptide     complement(240125..240235)
FT                   /locus_tag="Sros_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.751) with cleavage site probability 0.547 at
FT                   residue 37"
FT   gene            complement(240434..240637)
FT                   /locus_tag="Sros_0250"
FT   CDS_pept        complement(240434..240637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83286"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZA1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83286.1"
FT                   /translation="MKPPITDHDCCGRCRRGWDCLSAAQRDYDGPGNFAHTYFAEMFLN
FT                   PRGAVREVSQAVDSADAALCQV"
FT   gene            complement(240691..241911)
FT                   /locus_tag="Sros_0251"
FT   CDS_pept        complement(240691..241911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0251"
FT                   /product="sugar efflux transporter"
FT                   /note="KEGG: psp:PSPPH_0900 sugar efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83287"
FT                   /db_xref="GOA:D2AZA2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZA2"
FT                   /inference="similar to AA sequence:KEGG:PSPPH_0900"
FT                   /protein_id="ACZ83287.1"
FT                   /translation="MQRARTGRDRTITRRPAPWHRLAVLGALMLAALTFNTAENLPVGL
FT                   LRLMSEDLRVSLSAVGLLVTGYGVAVAIASVPIAHVVRAVPRRYVLTGLLAALVVSSLV
FT                   AALTPSYWLLLVARLLTALAQALFWAVMGPVAVGLFAPEVRGRVVGALSVAGSLALVLG
FT                   VPAGTWLGRQSTWQVPIAMLAALGLVSLVTIAVLLPTSRPEEEPAAYATSPDVWRFGTV
FT                   LAAGALSAAGAFTGYTYIVTFLGDVSGFSPSAVSVLFVVFGVACLAGVSITGAFLDRFP
FT                   QSALATAVATQAVGMLGLYAFGAHPVAAVMSLTLMGGALGPVFMTTQNTMLHCAPGRTD
FT                   IAFAANSGAYNAGIAAGAALGGLVLSLADVRSTFLAGGLLTVGSCAVLLGGHLLHGRRR
FT                   PERSTLR"
FT   sig_peptide     complement(241795..241911)
FT                   /locus_tag="Sros_0251"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.802) with cleavage site probability 0.560 at
FT                   residue 39"
FT   gene            242177..242596
FT                   /locus_tag="Sros_0252"
FT   CDS_pept        242177..242596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0252"
FT                   /product="putative transposase"
FT                   /note="KEGG: mrd:Mrad2831_6137 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83288"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZA3"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_6137"
FT                   /protein_id="ACZ83288.1"
FT                   /translation="MVRRGELTDKAWQRIGPLLPATDGRGHPWRDHREVINGILWRLRT
FT                   GASWRDIPERYGPWRTCYERFKRWDEDGTWARILEDLQVKDDSIGTVELTVSIDSTIAR
FT                   AHQHAAGARKRGTTAGRSTRNNPKGDKTSDAPAVD"
FT   gene            242611..243018
FT                   /pseudo
FT                   /locus_tag="Sros_0253"
FT   gene            244259..245197
FT                   /locus_tag="Sros_0254"
FT   CDS_pept        244259..245197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83289"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZA4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83289.1"
FT                   /translation="MVGVRQWLRQPPAAQFPAIMWIDQPRFRTAPRQHTAVPGQRKHRG
FT                   RRLLCPPQRPTVLQVEGGHGGVTTPATDDDRLRGSHDMPRKWRQPGTPHHSPCREIEAG
FT                   QLIGVMRQNQATIAGDYDGAWPGSYRNVPADRAVVAIQADKPSMALMDDDAIFRHRHRR
FT                   SGTPLMELSLPQCLPDHLPSSAGKCRSHQPRQELEVTSAEARKGEAPSGVGNRALAVHE
FT                   AVTAAEPAHEDSRRVGHRSGTSPLDSQVQERALLGESLQSSRLAVSSAEGTGMSVSAPQ
FT                   PVRRASMTWKPSTLVPLTTNSVQVVWTLRTS"
FT   gene            complement(245038..245835)
FT                   /locus_tag="Sros_0255"
FT   CDS_pept        complement(245038..245835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83290"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZA5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83290.1"
FT                   /translation="MRRWIATMAVAVTVSVAVTGLGTAVDAQTAPISPADALRRQLVEN
FT                   RGVTMSEVITWGRDGGKNRSRQKTRAEFGKGTVTAIDFRDVPRSNASEPPVRFLRFKGR
FT                   TYCQGWICPAPEGKTWVLFYEDEKSRPFLKSGEIDLGDPAALQAVLATTEAKRPGGVYD
FT                   GTRTTIHQGTITYAQLYKASPAFRDQYGRKPPTGRNTKVKVSWRLWLGKDQLVRRVQTT
FT                   WTELVVNGTSVEGFHVIDARLTGWGAETDIPVPSADETARRDD"
FT   sig_peptide     complement(245752..245835)
FT                   /locus_tag="Sros_0255"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.761 at
FT                   residue 28"
FT   gene            complement(246346..246678)
FT                   /locus_tag="Sros_0256"
FT   CDS_pept        complement(246346..246678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83291"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZA6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83291.1"
FT                   /translation="MDDVDFVAPPLDGQSASVRLDAPDDGWTVEPKPFVLRPGVLYHAF
FT                   GYQGRGSNQVNTNDVSFSADSVAKLKPGLVLVQRYDERQSPSGWVDVVITQEEFDRQGQ
FT                   DPTDCQ"
FT   gene            complement(247056..247370)
FT                   /pseudo
FT                   /locus_tag="Sros_0257"
FT   gene            complement(247778..248260)
FT                   /locus_tag="Sros_0258"
FT   CDS_pept        complement(247778..248260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83292"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZA7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83292.1"
FT                   /translation="MRTWPFALLLAACTACGVGPTDVIDAGEPARGFIQGTRLYFVQDD
FT                   RLVSVGRPEGPLEAAEAVELLAGGPTSKESERSFVTRLPKNMAVRVNDDGFALDKSVSM
FT                   LVGGRWLPPVSRLSRMATGQLVCTIAAATAAKRGVDVDDVRVTVPDRGQVRCEDFK"
FT   sig_peptide     complement(248189..248260)
FT                   /locus_tag="Sros_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.427 at
FT                   residue 24"
FT   gene            complement(248283..249665)
FT                   /locus_tag="Sros_0259"
FT   CDS_pept        complement(248283..249665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0259"
FT                   /product="Signal transduction histidine kinase-like
FT                   protein"
FT                   /note="KEGG: sus:Acid_5033 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83293"
FT                   /db_xref="GOA:D2AZA8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZA8"
FT                   /inference="protein motif:COG:COG0642"
FT                   /protein_id="ACZ83293.1"
FT                   /translation="MTWLRGLRARLVITFVLVGGLSAVGAAGLTYYKAQGNLLAGVQNR
FT                   LLKDFKNRVLLLSRDVALPAGDAELALLAEDLEVGDREVYVVRDGAIPSDARITAELRA
FT                   RVLRRPELAWQRVTRDGVPYLVGGSRVMLLAGGTPSGITVYLVESLAQAASDEAAVLRA
FT                   AQAAALPAVLLAVLAGLLAARGVLRPVADLDLAARRLGEGRLETRLPVRGGDELARLAG
FT                   RFNETAAALERSVGELREMETKSRRFVADVSHELRTPLAAAIAVTDVLEAGADRLDADA
FT                   GTAARLVTAEIARLTKLVDDLMEISRFDAGAAVLNLNDVDVGAAVAACLRSRGWSSGVT
FT                   TDLPPDIRVPLDPRRLDVIVANLVGNALRHGAPPVTVRVRATGQAVAVEVADHGPGLPA
FT                   DVLPHVFERFYKADAARARSEGSGLGLAIARENALLHGGDLTVAPGPGAVFTLTLPGNR
FT                   PS"
FT   sig_peptide     complement(249585..249665)
FT                   /locus_tag="Sros_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.743 at
FT                   residue 27"
FT   gene            complement(249662..250336)
FT                   /locus_tag="Sros_0260"
FT   CDS_pept        complement(249662..250336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0260"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: sus:Acid_5032 two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83294"
FT                   /db_xref="GOA:D2AZA9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZA9"
FT                   /inference="similar to AA sequence:KEGG:Acid_5032"
FT                   /protein_id="ACZ83294.1"
FT                   /translation="MARVLLIEDDPSVRNALTLALKGRDHEVESAASGEDGLERLARFA
FT                   ADVVVLDLMLPGIDGFEVCRRIRAASSTSIVMLSARGDDFDVVGGLEAGADDYVVKPVR
FT                   PQVLEARIRAVLRRTDGVPSPVETYGALCVDRASLTVSRGGRQIALPPIELRLLLYLSA
FT                   APGQVFSRQQLLESVWEHDYLGDSRLVDACVQRLRAKIEDVPAEPKYVQTVRGFGYRFG
FT                   PV"
FT   gene            250475..250978
FT                   /locus_tag="Sros_0261"
FT   CDS_pept        250475..250978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83295"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83295.1"
FT                   /translation="MLITKRRLAVLAALPTLALSAACGAQSFASASSPAPDSAKPSWHE
FT                   TAVKFAGCMRQNGIDIPDPVKGQDIDTSAVTKVTQAKLDAGMKACKEWDSVLLGSAEPS
FT                   SPEDDAKFAVWAECLRKGGVWQPIDKDEEKPAGFKQVKPGSAAEKRVFDGCASLQPPAP
FT                   YEED"
FT   sig_peptide     250475..250564
FT                   /locus_tag="Sros_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.386 at
FT                   residue 30"
FT   gene            251262..251435
FT                   /locus_tag="Sros_0262"
FT   CDS_pept        251262..251435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83296"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZB1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83296.1"
FT                   /translation="MGVDAERDGRIGVAGPGGDDMDGGAGQERRRGVDVAKVVAIPKLT
FT                   ERMVRICTLLKA"
FT   gene            complement(251498..252172)
FT                   /locus_tag="Sros_0263"
FT   CDS_pept        complement(251498..252172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83297"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83297.1"
FT                   /translation="MIVWDSRQCSGSVYPVIVGTDIYGFIETRHPRADEDWYEGDAWAL
FT                   SIPLYPLYDDRDYESFGCLFGVRNWLGWTPTAAGRGLPADVSEPVRTDHANSARIDAAV
FT                   HGCTWVSWAELRDLDMTVRPAARGVLQIQSGQDSSIRRYRIDDQWPDELVKLYRMPPVG
FT                   TSPVGAPASRWEASGATLEYGPLTRLDVLGPGTGWEHVFGVMQALARRFGPDGVRLVVW
FT                   FD"
FT   gene            252699..253019
FT                   /locus_tag="Sros_0264"
FT   CDS_pept        252699..253019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_6264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83298"
FT                   /db_xref="InterPro:IPR014845"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZB3"
FT                   /inference="similar to AA sequence:KEGG:Acid_6264"
FT                   /protein_id="ACZ83298.1"
FT                   /translation="MPKYLIQATYTADGLKGVLHDGGTGRRQAVERMAESVGGRVEQMY
FT                   FAFGETDTYVIVDLPSNAASAAVGLTISASGAVRTKTAVLLTPEEIDDAARMEVAYRAP
FT                   GA"
FT   gene            complement(253234..253507)
FT                   /pseudo
FT                   /locus_tag="Sros_0265"
FT   gene            complement(253615..254067)
FT                   /pseudo
FT                   /locus_tag="Sros_0266"
FT   gene            254149..255540
FT                   /locus_tag="Sros_0267"
FT   CDS_pept        254149..255540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0267"
FT                   /product="5'-nucleotidase/2' 3'-cyclic phosphodiesterase
FT                   and related esterase-like protein"
FT                   /note="KEGG: har:HEAR1476 putative 5'-nucleotidase family
FT                   protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83299"
FT                   /db_xref="GOA:D2AZB4"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZB4"
FT                   /inference="protein motif:COG:COG0737"
FT                   /protein_id="ACZ83299.1"
FT                   /translation="MGLSGSVGRRIGVLVAVIAMASGAFVSGAQAAPNPVVFGTASASP
FT                   KAHTGACPATVTLSTTVKVKAPVALKYAWTFSDGDRSRAKTYKVGGKGLKTVRLSTSIK
FT                   VTGDARGWGAVRLVSPVKKTSGKASFAVTCAGDTESTGDVWDSVATSAEGSETPDVSAT
FT                   PPPAGQDDDKPAQNLVRKATIVFERTTASKCPVTFKIHGHFEGLPAGAQAVQYRLVGTQ
FT                   EWKTVNVPADHGAVFTTVLETFNWDWETDQTSVQIQIRQPDGLMSNTLYYFKCGPPSDK
FT                   ESFGATAEKITLTAAGGPLVELVADAYLDAVQAVSGAQVALVSRYGFRAELNAGPVTYE
FT                   ELWATQPAGLAVDVNAMTGAQLKKLLAHPNPSGWVLTPSSSLRYTLQGGAVTEITLNGT
FT                   PVTDTQVIKIAANYILMGGWQGFPRWEGSTSVYHGGPDDTGALASYIVKNSPVRAPKGD
FT                   RVTIR"
FT   sig_peptide     254149..254244
FT                   /locus_tag="Sros_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 32"
FT   gene            complement(255609..256490)
FT                   /locus_tag="Sros_0268"
FT   CDS_pept        complement(255609..256490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83300"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZB5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83300.1"
FT                   /translation="MRRWAALALAVLIASVPVATSPAAAQAGAPDPAHALKRQLRNEHG
FT                   VRISETNRYFFGTKSTVSGSGTRSSGSLQLAPSGPVAADFTWWDLPRPTGGGAPAEKPG
FT                   PYRVIRVGKDVYDDSDQYPGPVPDGKKWIRFPNKHRGQMARDMARDASLQPLNVYDPSM
FT                   MKAVLKCSAGKPVSGGFLYRGTMSYKELRKISKDTLINWASGKPIGEKTKGKISWQLWA
FT                   DRDGLLKRLVTTDTVGAGKDPLVKRSDTRYTRWGFRLVITAPPADEVIDEDDLLEYIRI
FT                   QNTPIPPDDKNT"
FT   sig_peptide     complement(256413..256490)
FT                   /locus_tag="Sros_0268"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.508 at
FT                   residue 26"
FT   gene            complement(256658..259129)
FT                   /locus_tag="Sros_0269"
FT   CDS_pept        complement(256658..259129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0269"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_1773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83301"
FT                   /db_xref="GOA:D2AZB6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZB6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83301.1"
FT                   /translation="MIRTALSLAGLSGLVVAFLAVFGGMALLTGSGVIIESGLRSSVST
FT                   QRLPGADVIVSARQSIPQKEDLPAALPERAVVPGSLVAQLAAVPGVAAAVGDLSFPAAV
FT                   LPVTASTSGPVTASMSGHGWSSAALAGAGRKVTGTPPNTGDEIALPYSMERARIGQTVR
FT                   VIAGGTAGDYRVTALVDAPGLYFSDEAAAKLAARDAGPRAKTVDLVALRAEDGVTAAAL
FT                   ADELAERLGDRYEISTGRARGDAEAPGTAAARGMLIALPASISGISLMVVGFVVAGGLA
FT                   LSINRQRRDLALLRAAGATPRQVRKLVAVQGTAAALAAMAPGAALGYYLAARFGELLVS
FT                   VGTLPGDLPLSYSPLPAVAAALLLSGVVRMSTWGASLRASRMPAVAAVAESAGEPRTPS
FT                   RIRTNGGLLLILASVVLSTAPLLIRTEMAAVGPATAALLAVIGLAMAGPWLVQRATGLL
FT                   ARRLPPGLSAPAWLAVSNTHGYALRTAGAIAALGMVVTLSLSVVLTQTTIAKASGDEAA
FT                   QGIRADATITAPLLGGIPHGLLSDIRATRGVTAATAFTTTTVLTRSLALGDDSRRLEPR
FT                   PAMVLGPDAEGLVDLGIVGGSLAALKGDTIAVDERAGKLGDHVDLTLGDGTAVTARVVA
FT                   TYTRALGFGPVAVSRDLASGHTTTGLDSTILVRLAPGPSPLPALLKQWPGTVLSGDPAA
FT                   PEMGRPSGEILVNIAVLAVLLGYVLVAVVNRLVATTTARSAELTALRDLGATPRQLRTM
FT                   IRWEALVIAAAAAGSGLLLSTAPLTMLSIGFLSRPWPAGPVWLAPAVVLTITVVVWLAL
FT                   AIPSRQMIRRA"
FT   sig_peptide     complement(259058..259129)
FT                   /locus_tag="Sros_0269"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.428 at
FT                   residue 24"
FT   gene            complement(259126..259857)
FT                   /locus_tag="Sros_0270"
FT   CDS_pept        complement(259126..259857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0270"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: aeh:Mlg_2408 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83302"
FT                   /db_xref="GOA:D2AZB7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZB7"
FT                   /inference="similar to AA sequence:KEGG:Mlg_2408"
FT                   /protein_id="ACZ83302.1"
FT                   /translation="MSGVVTLTDVVKKHGELVALDNVSLAFPRGRFVAVMGPSGSGKST
FT                   LLNCAAGLDTPTSGAVTIGGVDVTRLNETKRTELRRKHIGFVFQSYNLLPAVSVEHNIT
FT                   LPLRLAGLRPDPAWLRELVERVGLGGRLRHRPAELSGGQQQRAAIVRALAARPDVVFAD
FT                   EPTGALDLRSASQVLDLLRELVDDLGQTVVMVTHDPAAAARAHDTLVMADGRVVDLLSA
FT                   PTASDLAQRLTQLTAVPEGAR"
FT   gene            complement(259854..260099)
FT                   /locus_tag="Sros_0271"
FT   CDS_pept        complement(259854..260099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83303"
FT                   /db_xref="GOA:D2AZB8"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZB8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83303.1"
FT                   /translation="MNDPHRLDLSGRPPAPVSGPRGGGTALRALLWIVLIVSASINIVL
FT                   NTFGSATATVPGTAAGIVAVACIAGLVTHHFRRRRS"
FT   gene            complement(260320..261933)
FT                   /locus_tag="Sros_0272"
FT   CDS_pept        complement(260320..261933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83304"
FT                   /db_xref="GOA:D2AZB9"
FT                   /db_xref="InterPro:IPR000768"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZB9"
FT                   /inference="similar to AA sequence:KEGG:MONBRDRAFT_11392"
FT                   /protein_id="ACZ83304.1"
FT                   /translation="MSDVDAATPPDPNDPLALAELFKGGGEPWLPLLKPVIEAQPAAAT
FT                   FIGPGRSPQVVPVRELTFQALKPNPPHKWKVVVFGQNPYPRAESATGIAMFDNTFHDWD
FT                   DSQFGKVITIRCIIKAAAMWKHGIPKKTPIADIRALLKKHDTVQPPEWFQAMLTQGVLL
FT                   LNAALTASGDKAMATDRHTAFWRPVVEKLVEEILKAKQNADEKDRGVVFAWWGAHARSL
FT                   KEVVLRLQQKYPEVEVWHIDHPNPAAQGDIFCDGNHFAAVNTALKALGTDEIDWLPGKG
FT                   WNKLAARTDGADADAADRMGAFIASTMELHKLYLERLAGVKDEGLELPAITGVFDTPLM
FT                   DFREAVAPVAKLLSGLDWHMEQSHRFGRQQADGAADGLSADEIAALYLYTCESAFYRKI
FT                   NAILRDPDRTRIVPYRSYLRLLFSAVSRLPARKEPLWRGVSLDLRAQYPLGRTVTWWGV
FT                   SSCTSKLSVAQAFLGRGKRTLFEVLPMRAVGIRGFSAFTGEEEFILAPGTQLKVTDVKA
FT                   ERGGLYTVKLTELAEQHLVA"
FT   gene            262251..262925
FT                   /locus_tag="Sros_0273"
FT   CDS_pept        262251..262925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0273"
FT                   /product="phosphatase like to the domain of histone
FT                   macroH2A1"
FT                   /note="KEGG: dal:Dalk_0690 Appr-1-p processing domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83305"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZC0"
FT                   /inference="protein motif:COG:COG2110"
FT                   /protein_id="ACZ83305.1"
FT                   /translation="MTIKHVKPPLKVVLVDVNAKVVQAGRAAFADTPEVEIHKGSILTR
FT                   HVDAWVSPTNSRGRMDGGVDAAIKRHLGAGIQLRVQRAIRDRFGGSLPVGSAVCVPSGA
FT                   TNPKFLISTPTMVESVQDVSETLNVALACAAAFQAIHMQNEAEPGSIESVALVGMGAAT
FT                   GGVPPRVCANLMWTGYTLFNDYYFRDYDDLRKTIREQLDDIGSRPEDERVRISPPTDRA
FT                   RG"
FT   gene            263238..264149
FT                   /locus_tag="Sros_0274"
FT   CDS_pept        263238..264149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0274"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sus:Acid_6967 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83306"
FT                   /db_xref="GOA:D2AZC1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZC1"
FT                   /inference="similar to AA sequence:KEGG:Acid_6967"
FT                   /protein_id="ACZ83306.1"
FT                   /translation="MAVIEVTGLRKRYADLTVLDGVSFSVEEGEIFGILGPNGTGKTTA
FT                   VECVEGLRRPDGGSIRVLGLDPVKDGRELREQIGVQLQHTQLPENIKVWEALDLYASFY
FT                   AKPRDWRELLEEWGLAGKRDARFGKLSGGQKQRLFIALALVGDPRVAFLDELTTGLDPQ
FT                   ARRTTWELIKRVRASGVTVVLVSHFMDEVEELCDRVAVFDRGRVVAIDTPAGLIDGIDA
FT                   EHHMRFTLMSGDLVELGELPGVTGVSRDGNRVVVRGRGDFATAVTAQLARHHILVSDLR
FT                   IDKRTLDDAFVALTGRSFDSTH"
FT   gene            264161..264856
FT                   /locus_tag="Sros_0275"
FT   CDS_pept        264161..264856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0275"
FT                   /product="ABC-2 type transporter"
FT                   /note="KEGG: sus:Acid_6966 ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83307"
FT                   /db_xref="GOA:D2AZC2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZC2"
FT                   /inference="similar to AA sequence:KEGG:Acid_6966"
FT                   /protein_id="ACZ83307.1"
FT                   /translation="MTKLAVVELKLLTREPGAMFSLLIPLFILVIFGSSIEPGDTVLLP
FT                   MALAIAVGLVGLYMLPTTMATYRERGILRRLSTTPVRPASMLVVQLVLQFVLAMVACGL
FT                   LLTVAGTVLGAQLPSRGLLIAVTFLLGTAGMFAIGLLIAALAPNGRAANGVGVLLYFPM
FT                   AFLAGLIQPTDQMPVILAHVGKYTPLGAFRQSLQDVWAGGAPDPLLLVVMAAYALVISI
FT                   AAARFFRWE"
FT   gene            264860..266023
FT                   /locus_tag="Sros_0276"
FT   CDS_pept        264860..266023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0276"
FT                   /product="Histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: sus:Acid_2189 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83308"
FT                   /db_xref="GOA:D2AZC3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017205"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZC3"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACZ83308.1"
FT                   /translation="MTGQLDRWERLLERQMAAAPYVLLVISMVLSLLIDGRSWLTVTLV
FT                   AVAAAWIRLVPRGGLYVAGLVVLIGVLCTRGMWFASFFGFTGYLHSWQYLKGTWRFAGV
FT                   TATAAISVAAYNGGLPDPTPSAIFTYLFFTAAIVAVVGVFSFVGEITTERSAERKRMVA
FT                   QLEKAMRENAGLHAQLLVQAREAGVLDERQRMAAEIHDTLAQGLTGIITQLQAAQQAED
FT                   WRRHMDNAVRLARESLAEARRSVHAVGPGQLEAAPLPEALREVVARWSEFNGVRADFTT
FT                   TGTVRPMHPEVEETLLRTAQEALANAAKHAGASRVGLTLSYMEDVVTLDVRDDGAGFDP
FT                   ERVRDGGGFGLTSMGKRVSRLAGTLEIESEPGGGTAVSASVPAVARG"
FT   gene            266016..266660
FT                   /locus_tag="Sros_0277"
FT   CDS_pept        266016..266660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0277"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: aca:ACP_2113 two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83309"
FT                   /db_xref="GOA:D2AZC4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZC4"
FT                   /inference="similar to AA sequence:KEGG:ACP_2113"
FT                   /protein_id="ACZ83309.1"
FT                   /translation="MAEAPIRLLIADDHPIVRDGIRGMFAGDPGFEVLAEAGDGAQAVE
FT                   LARALNPDVILMDLRMPKMDGVMAIKELARLGVAARVLVLTTYDTDKDVLPAVEAGATG
FT                   YLLKDTQRDDLIRAVRTAARGEAVLSPSVATRLLGQVRAPADPLSARELEVLELIAQGT
FT                   TNREVAARLFISEATVKSHLLHIYTKLGVNDRAAAVAVAFRRGLLDLGNDG"
FT   gene            266744..267034
FT                   /locus_tag="Sros_0278"
FT   CDS_pept        266744..267034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bra:BRADO6156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83310"
FT                   /db_xref="GOA:D2AZC5"
FT                   /db_xref="InterPro:IPR008024"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZC5"
FT                   /inference="similar to AA sequence:KEGG:BRADO6156"
FT                   /protein_id="ACZ83310.1"
FT                   /translation="MSKPLQPVMTAAYYAQSVISFGVALGSVALGIVFLPIDPWLRAFL
FT                   AVAVLYTVTSAFGLAKCVRDRQEVVSVSSRVDQARLDKLLSEHDPYKVDGL"
FT   gene            complement(267054..267704)
FT                   /locus_tag="Sros_0279"
FT   CDS_pept        complement(267054..267704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0279"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: eba:ebA6278 nitrate/nitrite response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83311"
FT                   /db_xref="GOA:D2AZC6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZC6"
FT                   /inference="similar to AA sequence:KEGG:ebA6278"
FT                   /protein_id="ACZ83311.1"
FT                   /translation="MTSALRVMVVDDHPMWRDAVARDLENAMYEVVAAVGEGRQALRVA
FT                   AAVRPDVVILDLRLPDLPGVEVARGLAASSHPPRVLVLSASGEHEDVLEAVKAGASGYL
FT                   VKSASREEFLDAVRRTAEGEPVFTPGLAGLVLGEYRRLATQRPADDGPRLTDRETEVLR
FT                   LVAKGLSYRQVAERLVLSHRTVQNHVQNTLNKLQLHNRAELVRYAIERGLDEA"
FT   gene            complement(267736..268884)
FT                   /locus_tag="Sros_0280"
FT   CDS_pept        complement(267736..268884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0280"
FT                   /product="Signal transduction histidine kinase-like
FT                   protein"
FT                   /note="KEGG: mpt:Mpe_A1687 signal transduction histidine
FT                   kinase, nitrate/nitrite-specific, NarQ"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83312"
FT                   /db_xref="GOA:D2AZC7"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZC7"
FT                   /inference="protein motif:COG:COG4585"
FT                   /protein_id="ACZ83312.1"
FT                   /translation="MGIEGSFWRAIAVYRIASLGYAALLLAGAGGYQRPVAGWLVLGVM
FT                   TVWTAATTVAYSTARSRPLLVLDVLVTLGCMLASPYVQGPDAGPAGVMPVTATWIGGPV
FT                   LAWAVYGGRRAGGVAAVVLSLGDLWLRGLHGFDLSVPVNGVVLLILAGTVVGHVARLTG
FT                   QAEERLQRAVEIEAAGRERERLARGIHDSVLQVLALVQRRGLEIGGEAAELGRLAGEQE
FT                   AALREMIRSGPAMAEQDGAGLVDVGARLRRYTTATVTVSTPATPLPLPAGQAHEVVAAV
FT                   GAALDNVRRHCGEDARAWVFAENDDVSMTVTVRDEGPGIPAGRLPEAEAEGRLGIAQSI
FT                   RGRIAGLGGTAGFTSVPGQGTEVELIIPVPARPAAHEQARTA"
FT   gene            269062..269586
FT                   /locus_tag="Sros_0281"
FT   CDS_pept        269062..269586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0281"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: hha:Hhal_0437 fis family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83313"
FT                   /db_xref="GOA:D2AZC8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZC8"
FT                   /inference="protein motif:COG:COG1595"
FT                   /protein_id="ACZ83313.1"
FT                   /translation="MEADPRFAEFVAERGDALLRYGYVLAGNPHDAADLVQEALLKLRA
FT                   AWPRLLAKENPESYVRTIMARLHTATWRLRRRELLSWELPEHGYHDALPSGDEQAMWEA
FT                   LAGLPRKQRVVVVLRYYEGFSDAEIAATLGISRGTVRSQASRALDKLRSAVPAGSHGIS
FT                   EGVRSEHGGRR"
FT   gene            269583..270797
FT                   /locus_tag="Sros_0282"
FT   CDS_pept        269583..270797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83314"
FT                   /db_xref="GOA:D2AZC9"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZC9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83314.1"
FT                   /translation="MSDFEDALRRSLGHAAERAPRLPGAAAGQLEIGYRRRRRRFQALL
FT                   AAAAVVVVAGGAGVGLRAGGGGAAPPAVNPSDVPSVVVTLPEAAPEPIEKVWPQAVWKM
FT                   PAKGADGRELQPVALIDDRTLLVKAWRTFDRTEVVYAYDLAGRNLRKIADVPAPKGTVR
FT                   FASDFSFGDGQVAWWTTTKGVTHIWAAPLDGGEARLVADRKTEGDDVSPLDGLGVADGN
FT                   VVFSLSAGGVFSVPLAGGPVTPVQAGAGLHLLSWPWAGSPGTGGPPGRPPFSKLVNLET
FT                   GQTSTAAVHQGEQVYACGVRSCTGMTADGRAFTRLRDGSQQKDIPVGYLIPEPPTQSRF
FT                   HVRNLKSDGPGLGLYDLTTGTFADLGIREEAATRGEVPVADRAGRLMTYRLKNDRYVID
FT                   LSRIP"
FT   gene            271003..271758
FT                   /locus_tag="Sros_0283"
FT   CDS_pept        271003..271758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0283"
FT                   /product="chitin-binding protein"
FT                   /note="KEGG: bha:BH1303 chitin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83315"
FT                   /db_xref="GOA:D2AZD0"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR004302"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZD0"
FT                   /inference="similar to AA sequence:KEGG:BH1303"
FT                   /protein_id="ACZ83315.1"
FT                   /translation="MRKLITVLAATIIAVASVVVVASPALAHGYITSPPSRQALCAQGK
FT                   VANCGQIIWEPASVEGPKGQRNCSGGDARWAPLDDDSKAWPVTNVGDSVTFNWRIEARH
FT                   ATSTWEYFVGGTRIAVFDDRGKLPGATVSHAVNLGGRTGRLKVLAIWNIADTAMAFYNC
FT                   VDVKVGGGPDPTPTPTPTPTPTPTPTVSPTPTPTASPTQGPAGPWTAGTAYAAGAQAIY
FT                   NGVTYQCLQQHTALPGWEPPYVPALWRRQ"
FT   sig_peptide     271003..271086
FT                   /locus_tag="Sros_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.912 at
FT                   residue 28"
FT   gene            272081..272452
FT                   /locus_tag="Sros_0284"
FT   CDS_pept        272081..272452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce6646 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83316"
FT                   /db_xref="GOA:D2AZD1"
FT                   /db_xref="InterPro:IPR025363"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZD1"
FT                   /inference="similar to AA sequence:KEGG:sce6646"
FT                   /protein_id="ACZ83316.1"
FT                   /translation="MLSPIAYGLAILLNLFIIFIGLRFLLVPHAAAAGYGVPAKKDGDA
FT                   AYLAIKGLRDFSYGVVGLALLAFVGPQAEAWYMLAVALVPLGDTVIVLRHGGTKATAFG
FT                   IHFATAVIVLINAALLFAV"
FT   gene            complement(272550..273563)
FT                   /locus_tag="Sros_0285"
FT   CDS_pept        complement(272550..273563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0285"
FT                   /product="integral membrane protein TerC"
FT                   /note="KEGG: csa:Csal_1104 integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83317"
FT                   /db_xref="GOA:D2AZD2"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZD2"
FT                   /inference="similar to AA sequence:KEGG:Csal_1104"
FT                   /protein_id="ACZ83317.1"
FT                   /translation="MPTEATLSMANLETIGSPKLWTITVAGLLLLLAVDFMLTRRPHDV
FT                   RMREAVGWSIFYLALPLIFGAYLWGAFGTGVAVEFFTGYVVEKSLSVDNLFVFMLLLAA
FT                   FAVPTALAQRVLLYGIIGALVLRAIFIALGAAVLQSGTWAFLLFGGILIVTAGKILKDA
FT                   LSGEEQKVDISSMRTIRLLRRFIPVTEDYRGSHLVVREGGRRALTPLALATVAVFATDI
FT                   VFAVDSVPAVYGVTEDPFLVFATNAFALLGLRALYFVLQGVLAKLRHLNHGLGIILAFI
FT                   GIKLVLHWAHGIWTWVPEIPTLLSLGVIIVVLATVTITSVYANRRDAEPASSPTER"
FT   gene            273951..274133
FT                   /locus_tag="Sros_0286"
FT   CDS_pept        273951..274133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83318"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZD3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83318.1"
FT                   /translation="MSTAALAELLLGVLLTISAIVTAAVLWPGRPRPRLPSAPEPPPPR
FT                   RPPVTGGRRRNMAGR"
FT   sig_peptide     273951..274022
FT                   /locus_tag="Sros_0286"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.975 at
FT                   residue 24"
FT   gene            274215..275285
FT                   /locus_tag="Sros_0287"
FT   CDS_pept        274215..275285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xau:Xaut_3687 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83319"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZD4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83319.1"
FT                   /translation="MQREAAEIREEWLGRALSTLPADRPAAEAAISGLYRLIGLPPPRF
FT                   HWVSSPVAALATVPPGVRLASSEAGDRISEWALPPRFSSLMRELCRELDAQVRWVHQPM
FT                   DQMIRQVVRGSLSQSTTGSLLIPLRAAHDSRHRPGDAWYGTQCVSWVAHYDALRRVAGV
FT                   VFTPEQTRRFELWAAAARSCGSWWPHDGVCVLSERPVAMHTEVWGDDGEVRLHRADGPA
FT                   VRYTDGWEAYAWHGTRVPSWVITDPSVPRIAGEANVEVRRCAIEHIGWASYIDRAGLRL
FT                   VAAAPDPGNPGSELRLFDMRGETRVLLAVNGSVERDGRRRQYGLTVPGSLDDPIAAAGW
FT                   TYGLSAEQYSLLVRRT"
FT   gene            275296..275733
FT                   /locus_tag="Sros_0288"
FT   CDS_pept        275296..275733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83320"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZD5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83320.1"
FT                   /translation="MTVTLASLSQQTGLAVLDHLEQSVSIPVVDGLQAQGDLIVIPLPV
FT                   VAPSVRPRPGAGWTDVPVEGVELLRGAAGGNPHTLVADPGTCRWTTDVSDSDGLAIGIF
FT                   ETSAVAYLLHPEHGATGCTPGAYVIRRQREREGHRARLVAD"
FT   gene            complement(275802..276683)
FT                   /locus_tag="Sros_0289"
FT   CDS_pept        complement(275802..276683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0289"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding
FT                   protein"
FT                   /note="KEGG: smd:Smed_2232 6-phosphogluconate dehydrogenase
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83321"
FT                   /db_xref="GOA:D2AZD6"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZD6"
FT                   /inference="similar to AA sequence:KEGG:Smed_2232"
FT                   /protein_id="ACZ83321.1"
FT                   /translation="MDDNTFGKTRLTLLGLGAMGTALARTWLAAGHPLTVWNRTPSRAD
FT                   PLAAEGATVAGTAAEAVAASDLVVLCLLDDASVGEALADADLTGKDLVNLTTGTPAQAR
FT                   ARAEWAEERGARFLDGGIMAVPPMIGVPETGGYVFYSGSRTLFDAHLSTLAVPAGTTYV
FT                   GEDPGFAALHDVALLSAMTGMFAGLSHAFALIRKEDVAPGDLAPLLVNWLTAMAPSAYE
FT                   LADQLESGDYTKGVVSNLAMMVEGNSTMLRTAEDQRVSAELLTPFMALMERRLADGHGD
FT                   EGTAGVVDLLTR"
FT   sig_peptide     complement(276609..276683)
FT                   /locus_tag="Sros_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.870 at
FT                   residue 25"
FT   gene            276779..277243
FT                   /locus_tag="Sros_0290"
FT   CDS_pept        276779..277243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0290"
FT                   /product="transcriptional regulator protein-like protein"
FT                   /note="KEGG: amc:MADE_01970 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83322"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZD7"
FT                   /inference="protein motif:COG:COG1733"
FT                   /protein_id="ACZ83322.1"
FT                   /translation="MATVRRPGAYHCGIDAAMDVIGGKWKVLILWALDERTCRFGELRR
FT                   QVSGVTEKVLASHLRELEEDGIVHREVYDEVPPRVEYSLTPLGVLLNEALAPLGAWGRE
FT                   HVIGGVEDARHVRRQGFSPASPDGVAENRGEYAGGAAHPLVLQGGRPDSR"
FT   gene            complement(277201..277839)
FT                   /locus_tag="Sros_0291"
FT   CDS_pept        complement(277201..277839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0291"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: scl:sce6308 TetR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83323"
FT                   /db_xref="GOA:D2AZD8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZD8"
FT                   /inference="similar to AA sequence:KEGG:sce6308"
FT                   /protein_id="ACZ83323.1"
FT                   /translation="MARRRSADETSHIPLRERKKARAQASIQREAMRLFAENGYEATTV
FT                   DEISEAAEVSRATFFRYFPTKADLVLHDIADLMVIDALPEHLDGTNLIGALRGAVTTLV
FT                   DTATAEQHELNRQREELLCSVPDLRARVPGHIAAALPLLTEALARRLGRPTDDLHLLTV
FT                   SGAVIGVAIAAWNAAANDLSEGFAQRRRRLLDDALAHLESGLPPWSTRG"
FT   gene            complement(277843..278715)
FT                   /locus_tag="Sros_0292"
FT   CDS_pept        complement(277843..278715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0292"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /note="KEGG: mes:Meso_0481 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83324"
FT                   /db_xref="GOA:D2AZD9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZD9"
FT                   /inference="similar to AA sequence:KEGG:Meso_0481"
FT                   /protein_id="ACZ83324.1"
FT                   /translation="MPERLSPWDGRVKPTPFEEYSRKYEEFFVMTRREGIIELRMHTDG
FT                   GPFRHSWIGHNAWHQAWAEVGNDPENEVLIITGTGDRWHTGDPAELWHTPFPQWSTDSQ
FT                   LKMYGDMVKLLENFVSALDIPTIAAVNGPGTHCEFATACDITLCVEDADFFDPHFLGGG
FT                   VPGDGMGLTLQHTIGTKRASYYMYTGEPIDGPTALRLGLVNEVLPRERLLPRAWEIAEM
FT                   MMARPRASRLLTHAIASRPWKRAFLDDLGFHAAHQLWGMAIGEAGQLDRLRQMTERFRG
FT                   PQAGESSRE"
FT   gene            278812..279450
FT                   /locus_tag="Sros_0293"
FT   CDS_pept        278812..279450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_I1321 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83325"
FT                   /db_xref="GOA:D2AZE0"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZE0"
FT                   /inference="similar to AA sequence:KEGG:BTH_I1321"
FT                   /protein_id="ACZ83325.1"
FT                   /translation="MTDDVLDLAGGLAGSPWLYLVVFLCALLDGFLPLLPSEGVLLLAG
FT                   AFAATGRPDIVLVALAAASGALAGDHICYLIGRRLGPPVLRRLRPGTKRHTAARWLSEL
FT                   LGRRGGVIVVVGRFLPGMRSITTLTAGATAYPLRAFALFDAVGALMWGVSGALLGYFAG
FT                   AAFQDSPAKGLLVALALVAVVITIGEVARYAQRRPGASGGGDDRAVPED"
FT   gene            complement(279505..280341)
FT                   /locus_tag="Sros_0294"
FT   CDS_pept        complement(279505..280341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0294"
FT                   /product="ABC sugar transporter, inner membrane subunit"
FT                   /note="KEGG: rsp:RSP_3943 ABC sugar transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83326"
FT                   /db_xref="GOA:D2AZE1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZE1"
FT                   /inference="similar to AA sequence:KEGG:RSP_3943"
FT                   /protein_id="ACZ83326.1"
FT                   /translation="MVSRLGFLGVIARLFMWVFLLGLAVVVLYPLLWMALNGFKTNAEL
FT                   FGNPFALPVDWSFENYRKAWNRGVSDYLTTSVLVTVTSTIATVFVSAWAAYGLTRVNIP
FT                   FSKAITAVILGGLMLAPTVALVPLVKMFQAMGLYNSFWALLILYTAFRVPFTTFLIRAY
FT                   MLDLPREIDEAADVDGAGRWTAFWRIILPMCKPIITSTVLLHILFAWNEYLFAMVFTSG
FT                   SGVQTLPVGLTSLMSKHGTDFPVVFAGMVIAAVPVVLLFFFGQRYIVKGLADGIGK"
FT   gene            complement(280335..281237)
FT                   /locus_tag="Sros_0295"
FT   CDS_pept        complement(280335..281237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0295"
FT                   /product="ABC-type sugar transport system periplasmic
FT                   component-like protein"
FT                   /note="KEGG: rsq:Rsph17025_3650 ABC-type sugar transport
FT                   system periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83327"
FT                   /db_xref="GOA:D2AZE2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZE2"
FT                   /inference="similar to AA sequence:KEGG:Rsph17025_3650"
FT                   /protein_id="ACZ83327.1"
FT                   /translation="MRTIFRRAPFQRALGLAWVIPALALVGVFVYLPLVQNFGFSTLKW
FT                   DIYSGSQEYVGLGNYRKLVDDPVFWSSFGNNLLYAVVSIAFQVFGALLLAALVESIRSE
FT                   RWRRGLRAIYFIPSAISLTVAGLLFYFVYEPNLGLLNHALEAVGLGRFGQSWLGQGDTA
FT                   MFAIIAMSQWQGFGYSTLLFAVAIQRIPSEIYGAAAIDGTGPIRRFVHVTVPLVREMTG
FT                   LMMMVTISGAFQVFNEVMVMTGGGPDNSTQVLGTWLYRSGFVRNNFGYAAAIATVLFVI
FT                   TLGIAMAQLWVTRRRRVEW"
FT   sig_peptide     complement(281163..281237)
FT                   /locus_tag="Sros_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.690) with cleavage site probability 0.271 at
FT                   residue 25"
FT   gene            complement(281264..282583)
FT                   /locus_tag="Sros_0296"
FT   CDS_pept        complement(281264..282583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_3651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83328"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZE3"
FT                   /inference="similar to AA sequence:KEGG:Rsph17025_3651"
FT                   /protein_id="ACZ83328.1"
FT                   /translation="MRPRALTTFAALAGASVLTLAGCSGGPANAPAADVAAEAEFSGTL
FT                   SILTKFAGDPLSPYFEDLAAEYERLHPGVKIELIQETDQSIKDKTKTLTASDALPDIYF
FT                   TWTGNWAENFVRGGRAADLSKVIGPDTPWGRTFSKASLSAFAYDGRYYGIPLYNNGKFM
FT                   GYNKAAFAKAGVKVPATFEELLSSCPTLREAGYEPVAFGNKDGWPALHYLQQLFAYTVP
FT                   EATLQADFRPATAKLDHPGYVTALKQFKTLVDTCTDTGDGTNGVLYTSAQEAFSRGKAA
FT                   MYYQEVLEFDNATAGRGLSPDDFGIFPLPVPGGAGGNPKAIEGAPEGYLVNARSPRAAL
FT                   AVDFMKFVTGSENAEKLSSPPYGQPSTVIGAVTPKTSSKAVFEGIEMVNRAPQLASWLD
FT                   MVTVPEVADAWLAGGEAVISGDTTPEKVLESVRRASASAK"
FT   sig_peptide     complement(282482..282583)
FT                   /locus_tag="Sros_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.385 at
FT                   residue 34"
FT   gene            282916..283917
FT                   /locus_tag="Sros_0297"
FT   CDS_pept        282916..283917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0297"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="KEGG: smd:Smed_2844 sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83329"
FT                   /db_xref="GOA:D2AZE4"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR024713"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZE4"
FT                   /inference="similar to AA sequence:KEGG:Smed_2844"
FT                   /protein_id="ACZ83329.1"
FT                   /translation="MLGFNEPEFLSQMASAVALRPRIEELVDRLVDEGFDNLLLVGAGG
FT                   TYAQMWPYEHLARRSSALNVRAVIAAELVASGDATLGGRSVAIFTSVTGTTDDSIRAIE
FT                   YCRSRGAYTVGFTGYPESPIARNVDIALISEPKTWPFDVQLLLFMGRLLSRRGEFDGYE
FT                   KLADELADIPRILVDVAERAEPAASAFAEAHKDTGYHFLIGGGNLWGFTYLYSMCILEE
FT                   MQWLRTTRVHSAEFFHGSLELLEPDTSVIIFQGEDETRPLTDRAESFARRVSKDVTVFD
FT                   TRDYPLIGISPEFRGLLAPLVLDTVMGRVSKHLERVRDHSLDLRRYYRVMDY"
FT   gene            284159..285070
FT                   /locus_tag="Sros_0298"
FT   CDS_pept        284159..285070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ses:SARI_04036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83330"
FT                   /db_xref="GOA:D2AZE5"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZE5"
FT                   /inference="similar to AA sequence:KEGG:SARI_04036"
FT                   /protein_id="ACZ83330.1"
FT                   /translation="MRVLGFGDNIVDRFVDRGIDYPGGNSVNVAVYAHRLGLGAAYLGV
FT                   FGDDDLGRFLGEAIAAQGVAVDRCAVRAGETGVSILRVDDGDRVFLGWNGGGVTVREPL
FT                   VLDDGLLEYVSSFDLAHSSVYSRSESELPKLAGLDTLVSFDLSSEEEFRTPSYLDRVCP
FT                   HADLVLLSCSHLDGAATRALLAEVVRRGARLALATRGVDGAIAYDGRVTVETPARRVED
FT                   PREIIDTMGCGDAFLAGFAVALLRGGWSAHTPPRRHMIERALREGAETAYGQCLVEGAF
FT                   GYGRPAGQPAVASMWRASEREK"
FT   gene            285083..286180
FT                   /locus_tag="Sros_0299"
FT   CDS_pept        285083..286180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0299"
FT                   /product="transcriptional regulator protein"
FT                   /note="KEGG: ara:Arad_9255 transcriptional regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83331"
FT                   /db_xref="GOA:D2AZE6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZE6"
FT                   /inference="similar to AA sequence:KEGG:Arad_9255"
FT                   /protein_id="ACZ83331.1"
FT                   /translation="MPADRGQAAGPPTISEVAAEAGVGRATAARTLGGYGYVSPELRER
FT                   VLAAAEKLGYRANALARSMSTGVSHTLGVIVADIGNPFFAGVVRGISDTSRARGFDTIV
FT                   LSTYEDLDEEVAATNVLIDKRVDGVIIASAAVDRGEVAHIRAAMDRGIPVVLVDRAVAS
FT                   LDLDAVVIDNREAAREAVEMLIAAGHRRVGFVWGPPASEAPATRRGLLAAASRNLWTDG
FT                   ERLRGYLDALDDARIPFDPELVMVGRKTEERATQEVARMLALPDRITAVFCTETDAVTG
FT                   ALRALRAAGLSYPRDIALIGFDDSAWAAVMEPPLTMIEQPVHRLGAKAAEVLLDTLEGA
FT                   EPRRERHTLRSRLIVRASVAPPPEA"
FT   gene            286227..287423
FT                   /locus_tag="Sros_0300"
FT   CDS_pept        286227..287423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0300"
FT                   /product="acyltransferase-like protein"
FT                   /note="KEGG: bja:blr2369 exopolysaccharide production
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83332"
FT                   /db_xref="GOA:D2AZE7"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZE7"
FT                   /inference="protein motif:COG:COG1835"
FT                   /protein_id="ACZ83332.1"
FT                   /translation="MAPNPSRLAWLDALRGPAALAVALHHAAWTFIPGLWAEVDRRIDV
FT                   GTWGVFVFFLVSGYIIPASLERRGDLRAFWIGRAFRLLPLLLAALGLALLLAYGGAFVL
FT                   HPGLSTRPLPLVVLGNVTMLQELLGVPAVIDVMWTLSYEMAFYLLAVGLFAMRQAHRSA
FT                   TTAVVLALLAVLLGLLLPGATISGRADLVAALLGVAVVAVVAVSAWARGGTRAAAAVTG
FT                   GLLGLALVILGSRIGAWQGLTVLAMMFAGTAVYRAEQGTIRWRTAIAAVLTVLACGVFA
FT                   KDDPGWAPAILLAAGFFAAAFALRHRSFPRWLAHLGVISFSLYLLHPLLLRVSPNLPLF
FT                   FLVLVPLGYLTHRLIEAPAQRLGRRLTRPPAEGRPASDGPPDEAPGLLGCAPGADHER"
FT   gene            287549..288217
FT                   /locus_tag="Sros_0301"
FT   CDS_pept        287549..288217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83333"
FT                   /db_xref="GOA:D2AZE8"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZE8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83333.1"
FT                   /translation="MAGSLVAYLASLRYAAPLHLAAPAEPATYGLGVRWTDPLLIACAI
FT                   VPAVLFALARRDAGGRARIGCLGWLLRLGTLWAGANVMAYPAGVLMYLGTAELSRHPEA
FT                   WLVTAASPFAALAMAWWFRPAFPPLRVPYLLLRAHGDHADVLKITSQDKTRLDSHIHLP
FT                   LEKWHRVLDKESWLELRVTPLAYGNFYNLRGLCRYGVWRDARKRSLPARERPGTGARTR
FT                   "
FT   gene            complement(288330..288917)
FT                   /locus_tag="Sros_0302"
FT   CDS_pept        complement(288330..288917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0302"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: rlt:Rleg2_5162 transcriptional regulator, TetR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83334"
FT                   /db_xref="GOA:D2AZE9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZE9"
FT                   /inference="similar to AA sequence:KEGG:Rleg2_5162"
FT                   /protein_id="ACZ83334.1"
FT                   /translation="MSIQERRERERTHRHRLIVKTARELAETEGWEAVTTRRLAERIEY
FT                   SQPVLYSHFAGKDAIVTAVALEGFEELAGALSRARASAATPAEALTAVARAYTGFADAN
FT                   PALYDAMFTLATDLPFGRPDSPAPLKAAFGELLAVCTSAAGDRDAETFTEVAWSAMHGL
FT                   VTLARGGRLRAGQWDQRLGLLVGQLLAAPGRP"
FT   gene            complement(289102..290382)
FT                   /locus_tag="Sros_0303"
FT   CDS_pept        complement(289102..290382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0303"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: sfu:Sfum_2006 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83335"
FT                   /db_xref="GOA:D2AZF0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZF0"
FT                   /inference="similar to AA sequence:KEGG:Sfum_2006"
FT                   /protein_id="ACZ83335.1"
FT                   /translation="MNVPRLLPRRVTLRARLTLIYGGLFLVAGTVLLGTTYALFNQQLT
FT                   RSAPKVLTLGGPGPSTVADGEAPKRQMVFFSRSGEPISRADAESLMADAESWMREQRTT
FT                   LHEAATTSLLTLGGIALVVVGGAAAGLGWLVTGRMLAPLHRVTDTARRIAAAPAAGRGL
FT                   HERIALRGPDDEVKDLADTFDIMVERLDGSFDGQRRFVANASHELRTPLTLGRALVELA
FT                   MHRKSASEDVKQLGENLLEINSRHERLINGLLLLAGSENEITERLPVDLADVVGHVVAQ
FT                   TAPEAARAGITVHEQAAEAPTTGDALLLERLVHNLVENGIRHNAGEDGWVRVACRTRND
FT                   GRVEVEVGNSGPVVPPYEIPALFEPFRRLGADRLVTAKGAGLGLSIVRSVARAHGGEVT
FT                   ARPREGGGLVVTVALPACPDEGATGHP"
FT   sig_peptide     complement(290281..290382)
FT                   /locus_tag="Sros_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.601) with cleavage site probability 0.381 at
FT                   residue 34"
FT   gene            complement(290379..291035)
FT                   /locus_tag="Sros_0304"
FT   CDS_pept        complement(290379..291035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0304"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: sus:Acid_5477 two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83336"
FT                   /db_xref="GOA:D2AZF1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZF1"
FT                   /inference="similar to AA sequence:KEGG:Acid_5477"
FT                   /protein_id="ACZ83336.1"
FT                   /translation="MRVLVVEDEPLLADAIAEWLRDERHAVDVAYDGAAALERASVNGY
FT                   DVVVLDRDLPAVHGDKVCRELVEAGSAARVLMLTAAAEVTDRVSGLSLGADDYLTKPFA
FT                   FPELAARVQALGRRSRPAAPPVLRRAGITLDPARREVFRDSRYVPLSKKEFAVLAELLR
FT                   ADGAAVSSEHLLEKAWDEHADPFTGAVRLAVLKLRRKLGTPPVVETVTGVGYRIP"
FT   gene            291261..291791
FT                   /locus_tag="Sros_0305"
FT   CDS_pept        291261..291791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0305"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GA18158 gene product from transcript GA18158-
FT                   RA ; K01290 carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83337"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZF2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83337.1"
FT                   /translation="MRLRIRSALVALPLALTLALTGCGADDGGSTVASAGGGKKGDGAA
FT                   GAAKSVSPDEMGVKFAQCMREHGVDMEDPKPGEGIRLTLKKGPESEKAMEACREYSPME
FT                   NGPKQADPEAEEKGRKFAACMRENGLEEFPDPQPGQRGIRIDRKMGEDPDFAKAQQSCQ
FT                   GIFSGGPGGGADQ"
FT   sig_peptide     291261..291338
FT                   /locus_tag="Sros_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.682 at
FT                   residue 26"
FT   gene            291788..292993
FT                   /locus_tag="Sros_0306"
FT   CDS_pept        291788..292993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0306"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gur:Gura_3473 peptidoglycan binding domain-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83338"
FT                   /db_xref="GOA:D2AZF3"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZF3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83338.1"
FT                   /translation="MTDGAAVRDQENRTDETDQVGRAGQTDQENRADRAAVEETRPRRR
FT                   RRRGGRVALTVVAAAAAGAAGVATLGLGGGGPAGDTAESALPPETAAVTRQTLIDTQSA
FT                   DGELGYGPATTATSRLSGTLTRLPGTGDRITRGKALYKVDDRPVTLLYGSLPAYRTLAQ
FT                   GVEGPDVRQLERNLKALGYGGFTVDEEYTYATAEAVMRWQEDRGLDETGTVELGHVVFA
FT                   PHAVRVESLQAGKGDLTAPGGKVLSYTGTTRAVTVELDAADQRLARKGAKVTVTLPDDT
FT                   TVKGRVDEVTTVIDPGEGQGEDAQTKVEVVVELVGGKARKAVGAYALASVDVSFTAGTR
FT                   ENVLTVPVAALLALQEGGFGVEVVRGAASTYVPVRTGLFSGGQVEVSGDGIAEGATVGM
FT                   PK"
FT   gene            292990..293682
FT                   /locus_tag="Sros_0307"
FT   CDS_pept        292990..293682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vha:VIBHAR_02834 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83339"
FT                   /db_xref="GOA:D2AZF4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZF4"
FT                   /inference="similar to AA sequence:KEGG:VIBHAR_02834"
FT                   /protein_id="ACZ83339.1"
FT                   /translation="MISLTDVTKVYPGGVTALAGVSLHIGGGELVAIVGPSGSGKSTML
FT                   NVLGTLDRPTSGSVHIGGYDVGRLSDAKLSALRASRIGFVFQQFHLAAGTAALDNVADG
FT                   LLYSGLRSGERRRRAAAALERVGLGHRMDHEPHELSGGERQRVAVARAVAGDPALLLAD
FT                   EPTGALDSASGAGVMRLMRELHATGTTVVIITHDREIAASLPRQVRMRDGRVVADSVRR
FT                   DAAVPEVS"
FT   gene            293682..294887
FT                   /locus_tag="Sros_0308"
FT   CDS_pept        293682..294887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0308"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gur:Gura_3474 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83340"
FT                   /db_xref="GOA:D2AZF5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZF5"
FT                   /inference="similar to AA sequence:KEGG:Gura_3474"
FT                   /protein_id="ACZ83340.1"
FT                   /translation="MAADALQPARMWPGDVVKVGAVGLRTRPMRAFLSALGIAIGIAAM
FT                   VAVVGISSSSRADLDRALASLGTNLLTVSPGTTMTGEQARLPVEAEAMVGRIGPVSAVS
FT                   AIGSVDGAKVYRTDKVPATETKGIAAYAARIDLRAAIGAEVRSGTWLNAATAAYPATVL
FT                   GATAAERLGIGRVKPGTQVLIGGEWFTVVGILDPAPLAPELDTAALVGWPAAESELGFD
FT                   GHPTTVYTRSEESQVESVRSVLGATANPEAPNEVEVSRPSDALAAKQAAGEAFTGLLLG
FT                   LGAVALLVGGVGVANTMVISVLERRAEIGLRRSLGATRGQIRTQFLAESLLLSALGGAG
FT                   GASLGAAVTAGYAVYQGWPAVVPPWAVVGGVAATLAIGALAGLYPAIRASRLAPTEALA
FT                   TT"
FT   gene            complement(294944..295804)
FT                   /locus_tag="Sros_0309"
FT   CDS_pept        complement(294944..295804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A0447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83341"
FT                   /db_xref="InterPro:IPR025507"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZF6"
FT                   /inference="similar to AA sequence:KEGG:Mpe_A0447"
FT                   /protein_id="ACZ83341.1"
FT                   /translation="MRRTLTVALVVLSAGAGTVVPALAESRLRLNVIGLTSDQRLVSFD
FT                   SHSADHTRDLGKISGLQEDTRIVGIDYRVQNRKLYGIGDLGGVYTLNGAAWARKVSQLT
FT                   VALSGSHFGVDFNPAANRLRVISDTGQNLRHNIDDPVGTPAAGTTAADATLTNPAIPPA
FT                   PGATALGVSGAGYTNNDLSAVTSTTLFDVDTTANRVSVQSPANAGTLAPTGSLGVAATG
FT                   GAGFDVYSSLRNEVTVSNVAFATLRVGGSYKFYLIDLLTGAATFQNAFPANRQVVDIAI
FT                   PLFRK"
FT   sig_peptide     complement(295730..295804)
FT                   /locus_tag="Sros_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            complement(296046..297284)
FT                   /locus_tag="Sros_0310"
FT   CDS_pept        complement(296046..297284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0310"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dal:Dalk_4624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83342"
FT                   /db_xref="GOA:D2AZF7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZF7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83342.1"
FT                   /translation="MIVPAAPPPVPLADGLVLRQSCPADLDQIGALLAERGEPADALDH
FT                   RLVVTDPEAGWPACAVVVDGDRVVSTATLLDEELRLADVRLPAGQVELVATDREYEGRG
FT                   LVRALMRWAHERSTARGHVLQIMIGIPYFYRLFGYEYAVDIPPAPVVRTPPAGDGTPAL
FT                   RAALPSDIPAMTALQDMAQSRFDVAVPHPATRRRWLLAHEASTTWVVERGDRVVATGRT
FT                   TPPDDDEVLLAEAAALDQEAALDLLRGVAALVPGGQVRVVERAGTVAAAAWSDLLPAER
FT                   RTEAEQYYLRVPDVTALLDRLRPVLWHRLVAAGIDRAGRDIVISTFGAHYRIPVHADGL
FT                   GAVTAGGAMQRPGVVDGAGVAPDYLPALLFGPHGIDGLSRIRPDVYPGPDSRLFHALFP
FT                   PLTADVLSYYLPY"
FT   gene            297660..297857
FT                   /locus_tag="Sros_0311"
FT   CDS_pept        297660..297857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83343"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZF8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83343.1"
FT                   /translation="MAALVRSTFLVNAVYADSARAYAATLGDREVVGAMLVAGAVTGSV
FT                   HWVPLAERAKVAGSLVDTRP"
FT   gene            297854..298261
FT                   /locus_tag="Sros_0312"
FT   CDS_pept        297854..298261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc01439 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83344"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="UniProtKB/TrEMBL:D2AZF9"
FT                   /inference="similar to AA sequence:KEGG:SMc01439"
FT                   /protein_id="ACZ83344.1"
FT                   /translation="MNSPTTQHLRIVSSVFAVEQLPHAASPGDDWVVLVRGPEGLTVVR
FT                   AVRPLESGERWIGFYSGATAHDLDVPGMLAAIVTPLAQAAIPVFVASTFHADLVLVPQQ
FT                   TEQQAVIALEEAGHHVESGDGEAGEPFWSQH"
FT   gene            complement(298258..298962)
FT                   /locus_tag="Sros_0313"
FT   CDS_pept        complement(298258..298962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0313"
FT                   /product="protein of unknown function DUF899, thioredoxin
FT                   family protein"
FT                   /note="KEGG: pmy:Pmen_1335 protein of unknown function
FT                   DUF899, thioredoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83345"
FT                   /db_xref="InterPro:IPR010296"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0T8"
FT                   /inference="similar to AA sequence:KEGG:Pmen_1335"
FT                   /protein_id="ACZ83345.1"
FT                   /translation="MDLPQVVSRDEWLTARKELLAKEKEFTRMRDVVTEERRGLPMVKV
FT                   DKDYVFDGPDGEVDLPGLFDGRRQLIVYHFMWLWDTDEGCASCSLLVDNIGHLSHLHAR
FT                   DTSLVLASRAPLAGIERFRARMGWTVPWYSSYRSDFNYDFNATMDESVAPVEYNYKDKA
FT                   TLMREGLAFFVKGDGHGMSVFLRDGDSVFHTYSTYGRGADLLVGTYNYLDLTPLGRQKY
FT                   INEFLHHDKYDV"
FT   gene            complement(299074..299940)
FT                   /locus_tag="Sros_0314"
FT   CDS_pept        complement(299074..299940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83346"
FT                   /db_xref="GOA:D2B0T9"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0T9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83346.1"
FT                   /translation="MHSRWSATRDSLRETGDRFVEMVSSSRDPRAKVTADWSVADTAAH
FT                   VATIASLYASILRPDELPHPFPALEGHILAATVDTVARLNDMVLRDFTERDPQVLGRRL
FT                   RADIDRILRAGEHLDPATPVTWLGGARVPAAGVLAHLINELMIHGWDIARATGAHWAMP
FT                   PQDAALFFDMFLIGVLRHDIGRLLDTGEPARGRRIAVEFRSRHTVPVTLVLRDGRVSVE
FT                   EPGGGTDVRLSFDPATLNLMLFGRVGKVRAALTGKVRVAGPRPWLLPAFLRAVRLPSNS
FT                   YPLSRPD"
FT   gene            300188..302962
FT                   /locus_tag="Sros_0315"
FT   CDS_pept        300188..302962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0315"
FT                   /product="WD40 repeat-domain-containing protein-like
FT                   protein"
FT                   /note="KEGG: dar:Daro_3599 WD-40 repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83347"
FT                   /db_xref="GOA:D2B0U0"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015032"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0U0"
FT                   /inference="protein motif:COG:COG2319"
FT                   /protein_id="ACZ83347.1"
FT                   /translation="MTEPSSSMEDTKAGGRETAKRYAAFISYSHAADGKLAPAVQEGLG
FT                   RLAKPWNRRRALNIFRDASGLAVTPDLWNDLRTALDSSAWLVIMASPEAAASEGVGKEI
FT                   LHWLSTRTPDRILLVVTGGTLRWDSRAGDFDREASTAVHPALYGRLRVEPRHVDMSWAR
FT                   DSDRLTLRDSVFRDQVAEIAAPLHGLTKDELDSADIREERRVRRLVRLTIGSLSILLVA
FT                   ALVATVLAVNALGTANRQLKIATARFMADRGALIGDSDPVLSQLLAVAATRVDPLNADG
FT                   RHGMMAALARPGRGELLGHTGGVMSAQFSPDGRSVVTAGLDGTVRLWDRSSRKQIGSPL
FT                   TEPAERYTSAAFSPDGGLLVTTSLSGSVRLWDLARRRPLGSPLTGHTGWVYTAAFSHDG
FT                   RRLVTAGEDGTARLWDVATHRQEGVLVRRGRVISAAFSPDDRLLATVGDAEDEGVIQLW
FT                   DTRTRRRIGGALKGRNGFVATVAFSPDGRRLATGGNDYATQLWDVTTRREVGTGLAGHG
FT                   GAVTAVRFSPDGSVLATSSADGLARLWDAASGAQIGTLTGHTGYVTSLAFSPDGRELVT
FT                   ASRDDTARLWDVSVHRQLGAALTGGSGPVGSVSFSPDGRRLATAHADGVARVWEVAATP
FT                   PRSVALTGHTGAVMVARFSPDGRTLATAGEDGTVRLWDAASREQIGTLSGHEGRTFVLA
FT                   FGADGKTLFASGGDNVVRQWDVRTGRRTGISMAGHAKEVIHMVPSPDGRTLLTSAAGTT
FT                   RLWDTGTGRQLGAALRGAEDPFVAVAFSPDGRTLAATDSHNRLVLLDVATRKQVGASML
FT                   GHTGPVYAVAFSPDGKTVATAGEDRSVRLWDVETHRQIGRPINGHDGAVQAIAFAPTGR
FT                   LVATAGVDGTARVWNVSEVVDVLSQTCAVAGRPISPEEWRLYAQDLPYQRVCP"
FT   gene            complement(303176..303811)
FT                   /locus_tag="Sros_0316"
FT   CDS_pept        complement(303176..303811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0316"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: swi:Swit_3405 TetR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83348"
FT                   /db_xref="GOA:D2B0U1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0U1"
FT                   /inference="similar to AA sequence:KEGG:Swit_3405"
FT                   /protein_id="ACZ83348.1"
FT                   /translation="MSASEPTAASRKAKAAQTEVALKEAARRVFARNGYLNTKITDITA
FT                   EAGRSAGSFYKHFASKEEVLQALLADWFAQAGEELSTHEAGDDLSKEPALRARVATYWH
FT                   TYRAHLPEIHALGQAALVDPEFAERVAQIRHAQLQTMREHLQRLQAAGFDLPGDPAVLA
FT                   SAFNALLEGFCAVWAGGGGEPIGRVLGDDEAIDTLTGLLRHGLTGPRP"
FT   gene            303920..304798
FT                   /locus_tag="Sros_0317"
FT   CDS_pept        303920..304798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0317"
FT                   /product="carboxylesterase"
FT                   /note="KEGG: gbe:GbCGDNIH1_1155 carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83349"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0U2"
FT                   /inference="similar to AA sequence:KEGG:GbCGDNIH1_1155"
FT                   /protein_id="ACZ83349.1"
FT                   /translation="MGTASHGDIELAYETFGPPDGEPLLLISGTGVQMLIFPEDLCHAL
FT                   VDLGFQVARFDNRDTGLSTHLADAPAPGWFTTMIRPSSAPYRLEDMAGDAVAVLDALGW
FT                   ESAHLVGTSLGGMIAQTLAIRHPSRVRTLTSIMSTPAARIGTMPKMATLKAILKISGMP
FT                   VTSPDQAAQEAVAMKRLIGSPRYPFDEREVGDIGRRSYERHPGTPEGDARQRAAVAVSG
FT                   DRRRALAKVRIPTLVLHGEDDPIIRLRAGRATADAIPGARLVTYPGMGHDLPRALWPSI
FT                   LDQIRSLALAR"
FT   gene            complement(304868..305374)
FT                   /locus_tag="Sros_0318"
FT   CDS_pept        complement(304868..305374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83350"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0U3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83350.1"
FT                   /translation="MEDYGITGAGVDLEITVGVPPERLWDLITAVPRIGEWSPECEEGA
FT                   WIGTGAPALREGQRFQGRNRRQGRVWTVTCMITEVERPRTFAWLVLDRDENPDRPSSRW
FT                   RYELEPGDSPGQTLVRHSFVHGPGQSGLREMIEGNPEIASVILDVRMGELRKHMTETLD
FT                   AMTRQ"
FT   gene            305784..306257
FT                   /locus_tag="Sros_0319"
FT   CDS_pept        305784..306257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0319"
FT                   /product="TIR protein"
FT                   /note="KEGG: mno:Mnod_8809 TIR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83351"
FT                   /db_xref="GOA:D2B0U4"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0U4"
FT                   /inference="similar to AA sequence:KEGG:Mnod_8809"
FT                   /protein_id="ACZ83351.1"
FT                   /translation="MAENGPVVSHTKDFFVTYNGKDEPWATWIAATLETAGYTTTIQAW
FT                   DFRPGDNFMAAMDHALTMCRHTLGVLSPDYLTSLFTRAEWTAAYRQTLLGKTRGFVPVR
FT                   VAECDVAPLLGPLVYIDLVDVEEAEARDRLLEGVAERTARPSGSPRYPGGPRP"
FT   gene            306308..309514
FT                   /locus_tag="Sros_0320"
FT   CDS_pept        306308..309514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0320"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce3803 putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83352"
FT                   /db_xref="GOA:D2B0U5"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0U5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83352.1"
FT                   /translation="MPGTEYEADFFVSHADADAQWAEWIAAELKGAGYGVIVKAWDFLP
FT                   GENLLDRLDRALATCRHTIGVLSPDYVASEMAARTAAHYQGLEGKERALIPVKVADHQV
FT                   PPSMGPIISIDLCDVGEEDEARSRLLNGVAGRVARVARGGFPNAPANRTRFPGAAQEVW
FT                   ELRGHRPDPHFVGRDDALAGLHRAFRAGRATSAVQAITGLGGLGKTQLAVEYASRHAAA
FT                   YDMVWWIRAEDPATLRGDYAELATVLGLPFDQDGQAVAALRQELRRRKDWLLVFDNAED
FT                   PGEVFPLLPDRHSGHVLITSRLREWQHAESRHIEVLPLPAAVEYLRRRGQVTDAGTARE
FT                   LAEALGRLPLALTQAAGVIADGMRATDYLGLLRRQSPELFVQGRAGAHDTTIASTWRVS
FT                   FDRLADRSPAAVALFRLAAFLGAEAIPLDRLTPVPDMPAELAEALNDPFRRRDATRALG
FT                   EYSLAETGDGLLSIHRMVQTVTRTELAGDEPFWAGLALAVTTAAFPRDVRDPRSWPACE
FT                   AALAHAIAAAEHAGRLHVDTGGTVDLLNQVALYLLARGRTDRAATAVENALTLAARLPR
FT                   DAPECLRCRNTHGLLLLAQGDRAAACQAHEEVYEARIRILGPDDVDTLRAGRDLVEALY
FT                   LQGQWARATRLQDRLVQAFTAVLGTDDLETVTSVAYQATLLRNAGQYQRARTLEEGVLE
FT                   VRRQRLGEEHPDTLNAMANLGATLHAQGKWEKARTLVEGVLEVRRWLLGEEHPDTLDAM
FT                   ANLGSILHSQGDLDGARALVERELEVCRRLLGEEHPHTLGAMANLGSILHVQGDLDGAR
FT                   ALKEGVLEVRRWLLGEEHPDTLTAMANLGATLHAQGDLDEARALEEGVLEVRRWLLGEE
FT                   HPDTLTAMANLGATLHAQGDLDEARALEEGVLEVRRRLLGEEHPHTLTAMANLGATLHA
FT                   QGDLDGARTFKERVLEGRRRLLGEEHPHTLTAMANLGATLHAQGEMAEARSLLLEALTV
FT                   SQRAFGKKNTVTSEIAWRMVSTYDRPHETARRKNLILENLSWLAKEPPSRLTGQQKSIK
FT                   DRVKGLFGGRSAKRQGKRGK"
FT   gene            309805..311268
FT                   /locus_tag="Sros_0321"
FT   CDS_pept        309805..311268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0321"
FT                   /product="Carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /note="KEGG: bsu:BSU34390 para-nitrobenzyl esterase
FT                   (intracellular esterase B)"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83353"
FT                   /db_xref="GOA:D2B0U6"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0U6"
FT                   /inference="protein motif:PRIAM:3.1.1.1"
FT                   /protein_id="ACZ83353.1"
FT                   /translation="MTSSHDPVVETAAGAVRGRRTGGVTRFGGIPYGAAPVGERRFAAP
FT                   APPPGWRGVRDAFEPGPAAPQSASRLDGIVGPMRLPRQSEDCLSVNVWTPDLRGRLPVL
FT                   VWLHGGAYITGSGGQDWYSGAQLAAHGDLVVVTVTYRLGPLGFLYPAGRIEDMGGGNAG
FT                   LLDQIAALRWVRENIASFGGDPGQVTLAGQSAGALSALAMMSTPHADGLFRRVVMQSTP
FT                   TGIAPMTAADATTVTERYLRALELSPGQAHRLRTLPVDRLLAAQGELLRASPPLRLAPP
FT                   FQLVADDDLVAADLLNASGWADGMDRLIGSTRDEAAAWTASDERLRDLDRSAAVEVARG
FT                   FLGEAAEDEYRRASEEAVHPTPLEVLKLLATGHFFERDIPRLAARSGGRSHVYRFDWSP
FT                   AGSPLGACHCIELPSVFGTLRAWNEAPMLAGADRPEQASLAVAVQHAWAAFAHTGDPDH
FT                   HGIPGWPEYRARGAVMHFDKDPHVRTAGR"
FT   gene            complement(311376..312329)
FT                   /locus_tag="Sros_0322"
FT   CDS_pept        complement(311376..312329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0322"
FT                   /product="Ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="KEGG: mxa:MXAN_7058 ornithine cyclodeaminase/mu-
FT                   crystallin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83354"
FT                   /db_xref="GOA:D2B0U7"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0U7"
FT                   /inference="protein motif:PRIAM:4.3.1.12"
FT                   /protein_id="ACZ83354.1"
FT                   /translation="MTLLLSRSDLERLLDVDACLTALEQGFAAAAPAVAPQRIRTDLPG
FT                   PGTATALIPGLIEGVPAYTVKVNAKFPGARPALRGVVCLHDLESGELLALVDSATVTAW
FT                   RTGLSAALGTHVLARPGAATVAVVGAGAQAELVMRGLAALRPLDHLVVADLDARRAADF
FT                   AERQAALSGTRCDVVSDAAVAAGSAEIVVLATWSREPLLRAGDVGAGVHVTSLGADEPG
FT                   KSELAADLLRAGRVIVDDVPLAVAMGALGNAGLTADDAAGTLAQVLRGEVPGRRGDDEI
FT                   TVYAPVGLPWQDLALAWVAYRRALDSGTGLEFEFLG"
FT   gene            complement(312374..312865)
FT                   /locus_tag="Sros_0323"
FT   CDS_pept        complement(312374..312865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0323"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mex:Mext_4563 pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83355"
FT                   /db_xref="GOA:D2B0U8"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0U8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83355.1"
FT                   /translation="MVEAFSELQREFFEFVADIKYSTMTTVDSRGRPRSRVLVPIWQVI
FT                   DGRPVGWIATYRTPVKTAHLARNPHVTTSYWSPAQNAVYVDSVASWVDDHEVKREVWEL
FT                   YRQGSPPPVGYDPQTYWKKGPSDPEYHVLRLDPWRVQVLRGRDLATGRPARVWRAEGAA
FT                   "
FT   gene            313016..313834
FT                   /locus_tag="Sros_0324"
FT   CDS_pept        313016..313834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0324"
FT                   /product="transcriptional regulator protein-like protein"
FT                   /note="KEGG: ara:Arad_0713 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83356"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0U9"
FT                   /inference="protein motif:COG:COG1733"
FT                   /protein_id="ACZ83356.1"
FT                   /translation="MEDGTSKSPSNCLGTEDDYDARQWDTREDCEVRQILDRVADKWSL
FT                   LVIALLDRRVLRFTELSRKVDGISQRMLTVTLRQLERDGLVRRTVHPVVPPRVDYELTP
FT                   LGVTLHDTIQSLVMWTERHQNEIAVARADYDARADVASAAPVAPLPVSRGAMAAGRTGG
FT                   RPAVPGRNGTLTADRNGTAAAGRNGTPPAGRDGTPGAGRNGTPAADRDGTPAAAAGGDG
FT                   SRAGATTPRCETCGAPIHLARTGRPARFCGTACRQKAHRLRSRAVARDLV"
FT   gene            complement(313985..315163)
FT                   /locus_tag="Sros_0325"
FT   CDS_pept        complement(313985..315163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0325"
FT                   /product="putative two-component system sensor kinase"
FT                   /note="KEGG: scl:sce5432 putative two-component system
FT                   sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83357"
FT                   /db_xref="GOA:D2B0V0"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0V0"
FT                   /inference="similar to AA sequence:KEGG:sce5432"
FT                   /protein_id="ACZ83357.1"
FT                   /translation="MSDLPFIARLRSRLRALPPWWVDVALTSVVMVAQLWPFLAHDNPH
FT                   PAPWHWWGYAVVITAVTPLLWRRRAPLPVLAVSLAATSMYDFVDNVPAQPVWYTGMISI
FT                   YTVAVYSPPWPRLLMLFITICGGLLLVGSSETALRGTVLFVAAYAGGRAVSVSRAYAAV
FT                   LEERAAEREREHRVEAERAAERERARIARDMHDILAHAVSIMVVQAEAGPVVIRSDPAR
FT                   AEAAFDAIAASGRDAMVQLRRMLGVLKEEEGPRAPQPTIGDLPTLAGQVTGTGLDVAYS
FT                   TRGEPRPLPPDVEVAAYRITQEALTNIVKHAGASRADIRLRWEDDALTIDITDDGLGSG
FT                   LSLPPGGNGLIGIRERAAACGGTATAGRRADGPGFQVSVRLPLTAVAARFTV"
FT   gene            complement(315325..315933)
FT                   /locus_tag="Sros_0326"
FT   CDS_pept        complement(315325..315933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83358"
FT                   /db_xref="GOA:D2B0V1"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0V1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83358.1"
FT                   /translation="MNPRFAFVAAPLLVLAYGVIRILDGLDGSRGPGLAWTTGHLAFLA
FT                   ALALFVPIFWEMRRMANRDALSTVSAVMGTVGVLAASAQFVIDIVVGFLSADHAAMGVL
FT                   FDRIQAVPGVSLAIYDGGPYLFYLGQLALVVQLAVIGRVKAWTPVLVLFDLVLPIVDRD
FT                   FIPLGAIFLLVSFISLARGIAPTAEPVAAHAARRAVTHA"
FT   sig_peptide     complement(315883..315933)
FT                   /locus_tag="Sros_0326"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.697) with cleavage site probability 0.607 at
FT                   residue 17"
FT   gene            complement(316084..317388)
FT                   /locus_tag="Sros_0327"
FT   CDS_pept        complement(316084..317388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0327"
FT                   /product="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylase-like protein"
FT                   /note="KEGG: dde:Dde_1186 M20/M25/M40 family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83359"
FT                   /db_xref="GOA:D2B0V2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0V2"
FT                   /inference="protein motif:COG:COG0624"
FT                   /protein_id="ACZ83359.1"
FT                   /translation="MPPPPYPSPDPAASQAPDPASPADPASSSAVTPSQAPAPSPDPAS
FT                   SPDPASSPDPASSSDPAALPDMASFLDRARELLAVPSTADRPGELHRALDLVLGSVGSG
FT                   FTVERFESGGKPSALVYRDAERPRFRVVLNAHLDVVPAPPHQFRPRLDGTRLYARGAQD
FT                   MKVSALVQAQVFRELAGGLPYPIALQLVTDEEVGGRDGTLHQLEQGVVGDFVVIGEQSG
FT                   LRVVTDSKGMITADLRATGRSAHGAYQWLGDNALLKLVRSLDNLLARYPAATEEVWRTT
FT                   VNVARIETPNEARNQVPSLAEAWLDIRFPARDADLDGRSAEEITAYLAAFCEPGVTPVV
FT                   HHVDPPHHADRDRPEVRGLQRAARNQGYRADFLRKHGAADGRFYYQRGVDAVIFGIGGD
FT                   GQHGPDEYADITTIAPYYRALKEFLLDLGTMPAPP"
FT   gene            complement(317439..318668)
FT                   /locus_tag="Sros_0328"
FT   CDS_pept        complement(317439..318668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0328"
FT                   /product="class-V aminotransferase"
FT                   /note="KEGG: scl:sce8911 class-V aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83360"
FT                   /db_xref="GOA:D2B0V3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027563"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0V3"
FT                   /inference="similar to AA sequence:KEGG:sce8911"
FT                   /protein_id="ACZ83360.1"
FT                   /translation="MIAESWRAARSSVPPGHLDAAGCNVPSDRTLDTVIGHLRHEREVG
FT                   GYRAVPDLHASRAALAAMVGAGADDVAFLESGTAAMAALLGGWPLPPGSRVGVTRAEYG
FT                   STVMLLYRLARLRDWKLLELPVDDDSRLDPGGLASMLAGGLDLVVLSHVSSHRGVVQPA
FT                   AAVGRLCRAAGVPLVLDVCQSLGHVDTGDAGATAYVGTSRKWLAGPRGAGFLVVPGLAG
FT                   DMDAAAPALGGHEWARRDVPTFDGPGDGPGWVRGQAPVLDGPGWARGEVSPLAGAARYE
FT                   TSEGSIAARAGFGAAVLEHQALGPAAVHARLAELGVTARRLLDGIGGWRAGEPLDEPSA
FT                   IVTLRPPPGVDPEAAVEDARSRAAEASLLIGTVPVGRAPADLPTPVLRISPSPGAYQED
FT                   LHALARVLDR"
FT   gene            complement(318665..319645)
FT                   /locus_tag="Sros_0329"
FT   CDS_pept        complement(318665..319645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_7473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83361"
FT                   /db_xref="GOA:D2B0V4"
FT                   /db_xref="InterPro:IPR017804"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032888"
FT                   /db_xref="InterPro:IPR035094"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0V4"
FT                   /inference="similar to AA sequence:KEGG:MXAN_7473"
FT                   /protein_id="ACZ83361.1"
FT                   /translation="MSVSQSAVHLVNHLGHDYLRQALENDVRTGLTSTPKWLPPKWFYD
FT                   AAGSDLFSQITRLPEYYPTRRELAILRREALDIATRSGADTLVELGSGTSEKTVLLLDA
FT                   LSSTGTLRTYTPVDVDAVTLGDAARRLAARYPGLAVQAVCADFEHHLALLPREGRRMVA
FT                   FLGGTIGNLDPAAREVFLKELRGTLRSGDTFLLGADLVKDTGRLVAAYDDAAGVTAAFN
FT                   RNVLHVVNRELDADFEPDAFDHVAIYDARQDWIEMRLRASRAMRVRVGGLGLTVPFAAG
FT                   EEMRTEISAKFRPEGLRKELAAAGFTVNHHYTDPTGDFSLVLARA"
FT   gene            complement(319744..320448)
FT                   /locus_tag="Sros_0330"
FT   CDS_pept        complement(319744..320448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_2474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83362"
FT                   /db_xref="GOA:D2B0V5"
FT                   /db_xref="InterPro:IPR017808"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR032889"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0V5"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_2474"
FT                   /protein_id="ACZ83362.1"
FT                   /translation="MCRHAAWLGAPRTLASLIHEPEYGLLQQSYAPRRQRYGTINADGF
FT                   GMGWYDAARAEPVRYRRTIPIWADANLPALAQVSRSGCLLAAVRSATVGMPIEETATAP
FT                   FTDGRWLLSHNGRVEREAVRELADGAESSCDSAWLAAAVFVRRRAGHPLGDALAEVVAH
FT                   AGAKDPGARLNLLACDGASIAATVWGDTLHLHLDDGVLVASEPLDDRSGWQAVPDRNLV
FT                   LASPDGVRVQPL"
FT   gene            complement(320449..321750)
FT                   /locus_tag="Sros_0331"
FT   CDS_pept        complement(320449..321750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_7471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83363"
FT                   /db_xref="GOA:D2B0V6"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR032890"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0V6"
FT                   /inference="similar to AA sequence:KEGG:MXAN_7471"
FT                   /protein_id="ACZ83363.1"
FT                   /translation="MNNFKERIATELIAVRNRSLAYTEAEDDLLVRQHSPLMSPLVWDL
FT                   AHVGNYEELWVLREAGGITPLRPEIDDLYDAFKHPRKDRPSLPILGPGEARRYIGGVRG
FT                   RVLDVLDAIDPDSPDPLHRNAFVFGLVIQHEHQHDETMLATLQLSREPGLVRDGDLPPG
FT                   GSGGAEEVFIPAGPFLMGTGTQPWAYDNERPAHQVDLPAYWIDRLPVGNLAYAAFIDDG
FT                   GYDDPRWWTPEGWHWRQESHAAAPLFWTRDGGTWWRTRFGRPEPVPMDEPVQHVCWYEA
FT                   DAYARWAGRRLPTEAEWEKACGWDPSAGRARKYPWGDDDPGPGRANLGHRAARPAPLGA
FT                   FPAGASAYGVEQMIGDVWEWTASLFLPYPGFRSFPYREYSEVFFGKDYRVLRGGSWAAD
FT                   PAAVRTTFRNWDHPIRRQIFSGFRCARSAGPEQA"
FT   gene            complement(321747..322973)
FT                   /locus_tag="Sros_0332"
FT   CDS_pept        complement(321747..322973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0332"
FT                   /product="glutamate/cysteine ligase"
FT                   /note="KEGG: mno:Mnod_7293 glutamate/cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83364"
FT                   /db_xref="GOA:D2B0V7"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017809"
FT                   /db_xref="InterPro:IPR035434"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0V7"
FT                   /inference="similar to AA sequence:KEGG:Mnod_7293"
FT                   /protein_id="ACZ83364.1"
FT                   /translation="MTDLAAEDMVIRDTSDVTDFARNCFHGSAGDQVGVELEFLVFDRT
FT                   SPDCHVPLARVAGALPPLPGGSRVTFEPGGQLELSGPAGPLPEAIARLAADVDAARAAL
FT                   REAGLVLAGVGLDPIRPARRQLRLPRYEAMAEFLGTPYGSLMMCSTASIQVNLDLGDRP
FT                   AVRWERAHLLGPVLTAAFANSPLSGGRPCGWMSGRQAVWENLDRTRTAPVPATGDPAAA
FT                   WAEYLLDARLMLVRENGDRCRTVRDGSTFRDWLAAPARPLTLADLAYHATTIFPPVRPR
FT                   GWLEIRYLDAQRPADWPVCVAVTHALVMDDRAAETAIAAAEPYAGMWPGAARHGLAEPR
FT                   LRKAAETCFRAALAALPRLGVSAGLIREVAAFADRHVTTGRPPAADLLDLVKGPPRRLS
FT                   AWLTEEGQG"
FT   gene            323100..323381
FT                   /locus_tag="Sros_0333"
FT   CDS_pept        323100..323381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0333"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: afw:Anae109_3621 putative transmembrane anti-
FT                   sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83365"
FT                   /db_xref="GOA:D2B0V8"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0V8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83365.1"
FT                   /translation="MRAGSRSGRSAGCREITELVTDYLEGALSAERRRCFEAHLAGCAE
FT                   CSVHLEQTQAMIRALGCLGADGIPDRVLRRLCGAFLGSGTPPVAEGGQ"
FT   gene            complement(323346..323585)
FT                   /locus_tag="Sros_0334"
FT   CDS_pept        complement(323346..323585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0334"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: afw:Anae109_3621 putative transmembrane anti-
FT                   sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83366"
FT                   /db_xref="GOA:D2B0V9"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0V9"
FT                   /inference="similar to AA sequence:KEGG:Anae109_3621"
FT                   /protein_id="ACZ83366.1"
FT                   /translation="MKRFTCDEVVELVTVYMEGELDGPTGYRFEEHLGGCEGCERYLGQ
FT                   FRTTVATLGDLRPDGPAGDTRERLLSAFRDWRRS"
FT   gene            complement(323627..324310)
FT                   /locus_tag="Sros_0335"
FT   CDS_pept        complement(323627..324310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0335"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: afw:Anae109_3622 ECF subfamily RNA polymerase
FT                   sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83367"
FT                   /db_xref="GOA:D2B0W0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0W0"
FT                   /inference="similar to AA sequence:KEGG:Anae109_3622"
FT                   /protein_id="ACZ83367.1"
FT                   /translation="MSQMSNQEETIVESFTGGRLPPDDVVVAALRAGDEAMFATLLDTW
FT                   SRGMLWLARTHVSTNDSAEEIVQDTWLAVVRGIGGFEGRSSVKTWVYRILVNTAKKRGM
FT                   RENRTVPWSSVFEQERPTVDRSRFQGVDDPLPGHWKELPAAWPTPEGEVLAAEVRGRIA
FT                   AALAELPPRQRAVITLRDVEGCTSEEVCEILEISAANQRVLLHRARASVRGQLEDYFET
FT                   ARRSA"
FT   gene            complement(324616..326085)
FT                   /locus_tag="Sros_0336"
FT   CDS_pept        complement(324616..326085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0336"
FT                   /product="transporter protein"
FT                   /note="KEGG: ara:Arad_0712 transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83368"
FT                   /db_xref="GOA:D2B0W1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0W1"
FT                   /inference="similar to AA sequence:KEGG:Arad_0712"
FT                   /protein_id="ACZ83368.1"
FT                   /translation="MSTPQPPTLDGGTDRMSGRAWAVLLVLCGAIFLEGIDVAMLNVAL
FT                   PSIRADLGMSTGAVSWVMSAYVLGYGGFMLLGGRTADLLGRRRMFLFWLVVFLAFSGLG
FT                   GVASEGWVLIVARFVTGVAAAFMAPAGLAIITTSFPEGRQRNKALLVYAGTAAAGFSLG
FT                   LVVGGLLTAIDWRWVFFAPVIMASVILLAALLLIPAESRPARSPHSFDLAGAASVTGAM
FT                   LLLVFAVVSLEDPGAGWGRAVAALVGGLALLAAFVAIERRSAAPLVRLGILRSGPIVRA
FT                   NLGAMLFAGSFFGFQFIAVFYLQELRGWSSLETSLALLAVGVDAVLAPTVTPRLVSRFG
FT                   NARVIFGGLLLAATAYAMFLPIGLDWTYAAMFPTMIILGLAFALVYGPLTIAATDGVTE
FT                   EEQGLAGGLLYTSFQFGAALGLSAVTAVNAAAAGAGGSPQAGLDGFRAALIVPLVAVLL
FT                   GAAVTASGMGRRRTAAAGAPHEALEAAEASR"
FT   gene            326922..327890
FT                   /locus_tag="Sros_0337"
FT   CDS_pept        326922..327890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0337"
FT                   /product="L-asparaginase"
FT                   /note="KEGG: scl:sce3372 L-asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83369"
FT                   /db_xref="GOA:D2B0W2"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0W2"
FT                   /inference="similar to AA sequence:KEGG:sce3372"
FT                   /protein_id="ACZ83369.1"
FT                   /translation="MVKRVLLLATGDTIAYSRHPAGVASGAGLLETIPPAALAADVVVE
FT                   DVMAEPGWDTSPSTMLGLARRARSAILDRGFDGVVITHGTDTLEDCAFLTDLLAGRAAE
FT                   CGGIVLTGAMRYLDDLSSDGPRNLASSITAAADHALRGAGAVVCLNDELHAARWVTMTD
FT                   ATSVAAFSSAPFPVLGRVVGGRVETLAEPPSRPPAAAGEPETDVALIKTYPGMDPVLLT
FT                   AVVDAGARGVVLEGTGMANVPVSLFTTISELTEWGIPVVVASRCRTREVPLEDLPLGTG
FT                   LAGKVGAIGARGLAPSKARAALMVALGTGGPRAVRDWFGRL"
FT   gene            complement(328142..328576)
FT                   /locus_tag="Sros_0338"
FT   CDS_pept        complement(328142..328576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0338"
FT                   /product="OsmC family protein"
FT                   /note="KEGG: afw:Anae109_3252 OsmC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83370"
FT                   /db_xref="GOA:D2B0W3"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0W3"
FT                   /inference="similar to AA sequence:KEGG:Anae109_3252"
FT                   /protein_id="ACZ83370.1"
FT                   /translation="MTSALYTAQAHVTGGRADGHGRTADGRLEVDLRQPKELGGDGEGT
FT                   NPEQLFAIGYAACFAASLALVGQRKQVRADDAAIDAKVMLIPAGNGGFKLGVELEIGLP
FT                   SIADATQASDLVRVAHQVCPYSNATRGNIDVALVVNGTRL"
FT   gene            328679..329623
FT                   /locus_tag="Sros_0339"
FT   CDS_pept        328679..329623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0339"
FT                   /product="Coenzyme F420-dependent N5 N10-methylene
FT                   tetrahydromethanopterin reductase-like protein"
FT                   /note="KEGG: swi:Swit_2098 luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83371"
FT                   /db_xref="GOA:D2B0W4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019921"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0W4"
FT                   /inference="protein motif:COG:COG2141"
FT                   /protein_id="ACZ83371.1"
FT                   /translation="MTPLKIGYLLPTRDQAVRGDHDPEQLIDLARRAEALGFDSVWAGD
FT                   SPVTRPRADPLLLLAAVAIATRRITLGTAVLLPALRHPILLAHQLATLDRLADGRLIVG
FT                   MGGGFPNVGTEAQFAAVGVAFSRRISRLEESIEAMRQLWTAEEVSFTGRHFDFHDVRLA
FT                   PAPTRPAGPPIWLAGGGEPALRRVARLADGWLPYPPAVQDYARDLAVIQQSAARTLTPA
FT                   LYATLCLDEDPERARRRLRTSIERYYNAPLEAVETIQAVFAGTAHQAAGWLNAYTGAGA
FT                   HHVVIRLAADDHHAGLEEFAGRVLPLIRTEGHP"
FT   gene            329620..330345
FT                   /locus_tag="Sros_0340"
FT   CDS_pept        329620..330345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0340"
FT                   /product="putative esterase"
FT                   /note="KEGG: met:M446_5919 putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83372"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0W5"
FT                   /inference="similar to AA sequence:KEGG:M446_5919"
FT                   /protein_id="ACZ83372.1"
FT                   /translation="MTTFVLVHGAWHGPWAWDRLTPFLHQAGARTITPALTLNGDIGLH
FT                   AHVQEVLTALDAVADDTLADDLRDDLVLVGHSYAGLVVRQVADLRPGLVDHVILVDGWA
FT                   GDDGASMFGLAPEAFVHAIQAAAARTGAGNQVPAPAPAMFGITDPDDAAWLAPRLRPQP
FT                   LRTFTETTRLSGAVDRIPGTGIYCRPQTYAFDQFAAAIGYRTIVLDGPHDVMLTHPQAL
FT                   ARLLLEAHTFQFNNKKLQD"
FT   gene            330355..331044
FT                   /locus_tag="Sros_0341"
FT   CDS_pept        330355..331044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0341"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: bbr:BB3851 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83373"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR029229"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0W6"
FT                   /inference="similar to AA sequence:KEGG:BB3851"
FT                   /protein_id="ACZ83373.1"
FT                   /translation="MEQRTYNQYCATARTLDLVGERWTLLLVRELLTGPKRFGDLQHSL
FT                   RGLGTGLLAARMKHLEREGLVHKVTLPPPARTAAYALTRAGEELGPAVLALARWGLKWA
FT                   MDEPREQETFHPGWAVLGLRACFDAEAATGLHALYEFRVEEEIFHARIDDGTIETVHGP
FT                   AQHPDVTITIGGEVFRDLAAGRSTLAEAINNGAASASGDQQALRRLHQLFRLPRPQTRS
FT                   AAQAPAS"
FT   gene            complement(331192..332040)
FT                   /locus_tag="Sros_0342"
FT   CDS_pept        complement(331192..332040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0342"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83374"
FT                   /db_xref="GOA:D2B0W7"
FT                   /db_xref="InterPro:IPR002918"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0W7"
FT                   /inference="similar to AA sequence:KEGG:AN8500.2"
FT                   /protein_id="ACZ83374.1"
FT                   /translation="MRSLRLRRLISIFIGTALVTTALTGTAGAETSPDGANDWNCRPSF
FT                   FHPHPVVLVHGTFENMAFNWSKLSPVLKKNGYCVFALNYGGVPDAPVQGTGDIAQSAGQ
FT                   LSAFVDRVLQATGAPEVDIVGHSQGGMMPRYYAKFLGGAAKVRKLVGIVPSNHGTTASG
FT                   LVTLGRLLGLLDPVIRACPACGQQLVDAEFLGALNSGGETLPGVEHTVIATRYDEVVTP
FT                   YTSSFLNGSGVKNILLQDKCPGDTNAHLGVNFDPVVHRIVLNELGFLTAYWPVDCSDPL
FT                   G"
FT   sig_peptide     complement(331951..332040)
FT                   /locus_tag="Sros_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 30"
FT   gene            complement(332361..332690)
FT                   /locus_tag="Sros_0343"
FT   CDS_pept        complement(332361..332690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0343"
FT                   /product="putative DNA-binding protein"
FT                   /note="KEGG: rsh:Rsph17029_3080 putative DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83375"
FT                   /db_xref="GOA:D2B0W8"
FT                   /db_xref="InterPro:IPR021487"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0W8"
FT                   /inference="similar to AA sequence:KEGG:Rsph17029_3080"
FT                   /protein_id="ACZ83375.1"
FT                   /translation="MTEDRERIATDFHQAVNMTAGELESWLDTRESKAVGDKSGRGESI
FT                   GHESGRRIMGILRKGADDLSEEDYAHMREVAGYVRRHLAQRPSGDVHDTPWRYSLMNWG
FT                   HDPLK"
FT   gene            333008..333853
FT                   /locus_tag="Sros_0344"
FT   CDS_pept        333008..333853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0344"
FT                   /product="NmrA family protein"
FT                   /note="KEGG: sus:Acid_5598 NmrA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83376"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0W9"
FT                   /inference="similar to AA sequence:KEGG:Acid_5598"
FT                   /protein_id="ACZ83376.1"
FT                   /translation="MILVTGATGNVGRQVVSQLQDAGVAVRALVRDPSSAGLPEKVDVV
FT                   RGDLSAPDTLEAALDGVESVFLVWPFLTADGAPAVLDAVGRHARRIVYLSSAGVREDVE
FT                   RQGDPINQFHADVERLIERSGLEWTFLRAGGFAANALAWAPEIRDGGVVRAPFGAATRS
FT                   LIHERDIAAVAVRVLTGDGHGGAKHHLTGPELLSTVEQVRAVGEAAGRPARFEEIPAEE
FT                   ARRQMLDSGWPASVVEGIFDAHEGMVTEPERITSTVEEITGVPARTFRQWAADHAGDFR
FT                   "
FT   gene            complement(334016..335020)
FT                   /locus_tag="Sros_0345"
FT   CDS_pept        complement(334016..335020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0345"
FT                   /product="ribonuclease BN"
FT                   /note="KEGG: mch:Mchl_2691 ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83377"
FT                   /db_xref="GOA:D2B0X0"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0X0"
FT                   /inference="similar to AA sequence:KEGG:Mchl_2691"
FT                   /protein_id="ACZ83377.1"
FT                   /translation="MSQHDIERPAGDGPPAGGPDLGPESETAPGSPAELPKRSWWDVLK
FT                   RTVKEFQEDNLTDWAAALTYYAVLSIFPALLAVISVLGLFGQSATQSLVDNLGALAPGP
FT                   ARQTIDTVLQALQSSQRAAGIAAIIGIAVALWSASSYVGAFMRAANVMYEMPEGRPVWK
FT                   TLPLRLGITAVLVILMAVGSVAVVFTGGLAEQAGKVLGVGETGLAVWGVVKWPILVIIV
FT                   ALVLALLYWAAPNVQHPGFRWITPGSMIAVVLWIAASAAFGFYVANFGSYSKTYAALAG
FT                   VVVFLIWLWITNIAVLLGVEFDAELARERAIEAGQPAGEEPYAEPRDTRKFDE"
FT   gene            335215..336123
FT                   /locus_tag="Sros_0346"
FT   CDS_pept        335215..336123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PB00017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83378"
FT                   /db_xref="GOA:D2B0X1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0X1"
FT                   /inference="similar to AA sequence:KEGG:RHE_PB00017"
FT                   /protein_id="ACZ83378.1"
FT                   /translation="MEQIIAPETRVDRRALLAAGITVVLWASAFVAIRSAAQYFSPGAL
FT                   ALGRLLAGSVVLGVIWLARREGLPPRAAWPGILGSGLLWFGLYMVVLNWGEQEVDAGTA
FT                   AMVVNVGPMLIALLGGWLLREGFPPRLLAGMAVSFAGAVVVGISMSDGGRASIVGVLLC
FT                   LLAAVTYAGGVVCQKPALKHASALQVTTFGCFVGTAACLPFAGPLVTEIAAAPLPATLN
FT                   VVYLGVFPTALAFTTWAYALARTTAGKMGATTYVVPALVVLMAWAVLGEVPGWLTLAGG
FT                   LLCLAGVAVSRGGARRASPVT"
FT   gene            336191..336811
FT                   /locus_tag="Sros_0347"
FT   CDS_pept        336191..336811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0347"
FT                   /product="formimidoyltetrahydrofolate cyclodeaminase"
FT                   /note="KEGG: mpt:Mpe_A3258 formimidoyltetrahydrofolate
FT                   cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83379"
FT                   /db_xref="GOA:D2B0X2"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="InterPro:IPR036178"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0X2"
FT                   /inference="similar to AA sequence:KEGG:Mpe_A3258"
FT                   /protein_id="ACZ83379.1"
FT                   /translation="MRDQTISDFLERLAGRVPAPGGGASAALHAAQAAALLGMVARYSD
FT                   GPGYAAHEQVISRILAETDALRDRALQLAEDDAAAFTAVTDSYRMPKATDEEKAARSAA
FT                   IAGALAAAAEPPAQTIAAARRLVELAEELLPVGNRNVITDVAAAAEAARAAATTARVNV
FT                   EVNLGGIKDEEVRAGLAGRAAGVDEIAAGAERVTAAVREEISR"
FT   gene            336808..337647
FT                   /locus_tag="Sros_0348"
FT   CDS_pept        336808..337647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0348"
FT                   /product="Methylenetetrahydrofolate dehydrogenase
FT                   (NADP(+))"
FT                   /EC_number="1.5.1.5"
FT                   /note="KEGG: aav:Aave_2459 methenyltetrahydrofolate
FT                   cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83380"
FT                   /db_xref="GOA:D2B0X3"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0X3"
FT                   /inference="protein motif:PRIAM:1.5.1.5"
FT                   /protein_id="ACZ83380.1"
FT                   /translation="MSARPLSGRDLAAAIRTDAAERAAELAAAGRPAKLAVVTATADES
FT                   SAWYVRSIVTAAGKAGIACEVVDLGPEAPVAEIRERLESLSADDQVSGIILQTPLPGGA
FT                   KLEDLASAIVPAKDVDGANPLSLGRLAAGLPAFAPATAEAVVRILEHHGVELAGRHAVV
FT                   VGRSTVVGKPAAHLLLDRHATVTVCHSRTADLPAVTSAGDILVAAVGRAGLITAEHVKP
FT                   GAVVVDVGTNPTEDGGLVGDVAPAAAERAGALTPVPGGVGPVTTALLLQHTVRAARE"
FT   gene            complement(337709..338218)
FT                   /locus_tag="Sros_0349"
FT   CDS_pept        complement(337709..338218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0349"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="KEGG: spe:Spro_1183 glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83381"
FT                   /db_xref="GOA:D2B0X4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0X4"
FT                   /inference="similar to AA sequence:KEGG:Spro_1183"
FT                   /protein_id="ACZ83381.1"
FT                   /translation="MPVQRLNHAVLYVRDVERSVAFYEEALGFRVVMGMRGAAFLQASG
FT                   SSNDHDLGLFELGSQAGASGAGRSTVGLYHLAWEVDTLAELERIAVKLSEMNALVGASD
FT                   HSTTKALYAKDPDGLEFEVSWLVPADLLTEDVLNGRSGIKPLDLAREKERYGAQTRGGL
FT                   GVSIPA"
FT   gene            338292..338741
FT                   /locus_tag="Sros_0350"
FT   CDS_pept        338292..338741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0350"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: efe:EFER_2801 putative MarR-family regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83382"
FT                   /db_xref="GOA:D2B0X5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0X5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83382.1"
FT                   /translation="MTRWLDDDEQRAWRAFLTASQLVQEELDRQLQRDSGMPHAYYAVL
FT                   VKLSEAPDRMLRMSELAAEVNSSQSRLSHAVARLEDRGWVRRERCAADRRVSWAVLTDE
FT                   GFAVLAAAAPGHVEAVRQCFFELLDPEQLHRLTEICTVLLRKAAP"
FT   gene            338819..339040
FT                   /locus_tag="Sros_0351"
FT   CDS_pept        338819..339040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83383"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0X6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83383.1"
FT                   /translation="MAETSLTSTDVEHEANRLLFRIVHEVAVGHAGADVSQVVAVLRRR
FT                   LVNVPGLDGQGLRRIAEEISVGRDPSGL"
FT   gene            complement(339218..340393)
FT                   /locus_tag="Sros_0352"
FT   CDS_pept        complement(339218..340393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0352"
FT                   /product="ROK family protein"
FT                   /note="KEGG: acr:Acry_0116 ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83384"
FT                   /db_xref="GOA:D2B0X7"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0X7"
FT                   /inference="similar to AA sequence:KEGG:Acry_0116"
FT                   /protein_id="ACZ83384.1"
FT                   /translation="MTQAVRHDSMRARNLGVVLGEVRRSGPITRAALAEITGLTKTTVS
FT                   KMVGDLLGAGMVTEAGALRDGERGRPGTAVSLSGHRVAALGLEINVDYLSACVVDLTLS
FT                   VRLRRTQAVDNRAASPVETLAHLQELAHRAVDEARSEGLAIAGSTLAVPGPVDGGLLHA
FT                   APNLGWHDVRVGDLLDFPVAVENEANLAALGELWFGSGPSDFLHVSGEIGVGAGLVVGG
FT                   ALFRGARGLAGELGHVIVSPDGPTCRCGGRGCLEQYAGQEALLRAAGLDGVPELVERLQ
FT                   AGTPGALRACERAGQALGVALTSAVHLMDPGTVVLGGIFAPLFPWIHGPARETMTARLA
FT                   RMRHAVPELTVSRLGGDAASLGAAGQVIHRIIADPGAHLAATTARPAPGPH"
FT   gene            340472..341623
FT                   /locus_tag="Sros_0353"
FT   CDS_pept        340472..341623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0353"
FT                   /product="Xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /note="KEGG: aba:Acid345_0903 xylose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83385"
FT                   /db_xref="GOA:D2B0X8"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR013453"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0X8"
FT                   /inference="protein motif:PRIAM:5.3.1.5"
FT                   /protein_id="ACZ83385.1"
FT                   /translation="MSDYTPKPEDRFTFGLWTVGWQARDQFGDASRAPLDPVESVHRLA
FT                   ELGAYGVTFHDDDLLAVEPDRDKAVERFKKALAETGLKVPMATTNLFTHPVFKDGGFTS
FT                   NDRDVRRYALRKVMRNVDLAAELGATTYVCWGGREGAESGAAKDIRAALSRYKEGMDLL
FT                   TSYVIDRGYDIRFAIEPKPNEPRGDILLPTVGHALAFINELEHSERVGLNPEVGHEEMA
FT                   GLNFAHGIAQALWHGKLFHIDLNGQHGPRFDQDLVFGHGDVKNSFFLVDLLENGGYDGP
FT                   RHFDYKPLRTEDAEDVWVSAAANMRTYLILKEKVKAFHADPEVVEARAASRVAELSEPT
FT                   LAPGETLEDLHRDDFDVDRAAARGFHFSRLNQLALEHLLGVRG"
FT   gene            341620..342996
FT                   /locus_tag="Sros_0354"
FT   CDS_pept        341620..342996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0354"
FT                   /product="xylulokinase"
FT                   /note="KEGG: ppw:PputW619_2036 xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83386"
FT                   /db_xref="GOA:D2B0X9"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0X9"
FT                   /inference="similar to AA sequence:KEGG:PputW619_2036"
FT                   /protein_id="ACZ83386.1"
FT                   /translation="MTLVAGVDSSTQSCKVVIRDAETGALVRQGRAAHPDGTEVDPAAW
FT                   WTALQEAIARAGGLDGVAAMSVGAQQHGMVCLDESGAVVRDALLWNDTRSAGAARDLVE
FT                   ELGGPLKWAEAVGSVPVASFTVTKLRWLAEHEPGSARRTARVCLPHDWLTWRLGGEFVT
FT                   DRGDASGTGYWSPATGSYRTDILAAAFGAVPGLPQVLGPRDQAGELSVPGGRGPVRLAP
FT                   GTGDNMAAALGVGALPGDVVVSLGTSGTAFAVADVPSADPSGAVAGFADATGRFLPLVC
FT                   TLNAARVLDAAARLLGVDLDRLGRLALDAPAGAGGLVCVPYLEGERTPNLPDATGSLHG
FT                   LTLGTSTPAHLARAAVEGMLCHMADAFDALGLDPARVLLIGGGARSEAVRRIAPAVFGR
FT                   PVVVPEPGEYVADGAARQAAWLLGGGAEPPVWETGGTERFEADATPDVRARYAEARDGR
FT                   "
FT   gene            343109..343759
FT                   /locus_tag="Sros_0355"
FT   CDS_pept        343109..343759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cvi:CV_3704 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83387"
FT                   /db_xref="GOA:D2B0Y0"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0Y0"
FT                   /inference="similar to AA sequence:KEGG:CV_3704"
FT                   /protein_id="ACZ83387.1"
FT                   /translation="MLALKRLYPLVACAGIVIAAVATVIGQIDPDPYLDPLNLTISEYA
FT                   ALDRGGATEFAMATLGVASFALVAGLRAAMAPIGAAAERLMLAWSAALVVIAIVPTTAP
FT                   GLAMDLTAQVHRYVSIAAFVAMPVAGALMVARLREDERWRAVARPVEWLALAGGFGLLA
FT                   ITYVALPGDRVLIGLVERVLLGAEVALIGVLAVRLAQLTWVRSAARASRAALG"
FT   sig_peptide     343109..343189
FT                   /locus_tag="Sros_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.542 at
FT                   residue 27"
FT   gene            343903..346110
FT                   /locus_tag="Sros_0356"
FT   CDS_pept        343903..346110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lch:Lcho_0275 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83388"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0Y1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83388.1"
FT                   /translation="MASSRSIRFKISVLVAIPLTSLVALWGFAATVTVGDSMSLLTVAT
FT                   MYDSFGGPGDDLSNALQREHLLSSEYLAGRSEADRATLAGQRTVTDQARARFRRATVAD
FT                   PAQSAMTPEMRVRFDELMARVNALDTLRSKIDNNRIAPVTLANEFALVPDALHRLFNSM
FT                   SLNNDLPLYRQSRGLTVIIYAKDFLSRERALAAGSLALGRRMTSSELRLFTQLSTKRIF
FT                   LMEQGLPELEQGLRKPFTDLAASRLYSRFTDLEERLLSGATVSPTDWRAATDDLEAAYQ
FT                   RSVTATGIALYDRATPSAVETFARAGIAGVLGLVAVVASLLVSYRVGRGLTRELADLRQ
FT                   AATDLAETRLPRVMGKLRRGEKVDVEAEAPPLEPLGSTAEIHDVAAAFDSVQHRAVDSA
FT                   VEQARLREAVAQSFRNLARRSQSLLQRQLKLLDGMQKQAEDPDALENLFRLDHLTTRMR
FT                   RHAEGLVILSGGAAGRKWRSSVLMEDVLRGAAAQVEDYARVRIYPMPGTTLVGSAVADM
FT                   MHLFAEIIENATVFSPPGGEVSIRGELVGRGFTIEIEDRGLGLTAEKRAAINERLASPP
FT                   EFDPAETDRLGFAVVGLLAARYGVGVTLRTSPYGGTGVVILLPESLLGDPEPVDPEPVL
FT                   REITTSVEPVLREIAKPVEPVVPVPADLWKTPLRRGNGGLPRRVRQANISPQLRQESAP
FT                   VAEAEERSPEEARALLNSFQAGWRRGRSAGEDSDDDSGMER"
FT   sig_peptide     343903..343992
FT                   /locus_tag="Sros_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.551 at
FT                   residue 30"
FT   gene            346211..346600
FT                   /locus_tag="Sros_0357"
FT   CDS_pept        346211..346600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0357"
FT                   /product="Uncharacterized distant relative of homeotic
FT                   protein bithoraxoid-like protein"
FT                   /note="KEGG: pna:Pnap_2813 roadblock/LC7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83389"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0Y2"
FT                   /inference="protein motif:COG:COG2018"
FT                   /protein_id="ACZ83389.1"
FT                   /translation="MPGELYWLLDDFVTSVADVSHALILSNDGLMVASSRGLSKEDADH
FT                   LSAVASGFQSLAKGTSLQFGGGAVRQTMVEMDSAFLFVTSAGQGSCLSVMTTGAADVGL
FT                   IAYEMARLVTRVGQHLATGPRVAGQ"
FT   gene            346597..346968
FT                   /locus_tag="Sros_0358"
FT   CDS_pept        346597..346968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83390"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0Y3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83390.1"
FT                   /translation="MSDDVEWVDEEAGPVVRPYALTGGRTSTSSAAFDLLSMVVATGSA
FT                   VSASSHLGSEHRRLLGLMRRTRPIVEIASDVGLPIGVIRVLLGDLLDQGLILVRSPLPA
FT                   ATSPAESLLKEVISGLRAL"
FT   gene            complement(347041..347616)
FT                   /locus_tag="Sros_0359"
FT   CDS_pept        complement(347041..347616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0359"
FT                   /product="protein of unknown function ATP binding protein"
FT                   /note="KEGG: dac:Daci_0776 protein of unknown function ATP
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83391"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0Y4"
FT                   /inference="similar to AA sequence:KEGG:Daci_0776"
FT                   /protein_id="ACZ83391.1"
FT                   /translation="MDFGPSDEPVALKILIAGGFGVGKTTLVGAISEIRPLRTEEVLSD
FT                   RGIGIDDVEGVEGKTTTTVAMDFGRITIREGLVVYLFGTPGQERFWFMWDELSYGALGA
FT                   VVLADTRRLTDCFPSIDYFEQRGTPFIVAVNCFDGADRYEAEDVRVALDLDPDVPVLLC
FT                   DVRRRASAKNVLVTLVEHSLKVLTASQH"
FT   gene            complement(347597..347944)
FT                   /locus_tag="Sros_0360"
FT   CDS_pept        complement(347597..347944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83392"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0Y5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83392.1"
FT                   /translation="MTQWMDEEAGPIVRPYALIGGRTRSSGDALDLIAMVTATGAVASG
FT                   GFVPGPEQERILSLVTTATSVADVASELDLPLGVVRVLLGDLQDHQLISIGRASASERI
FT                   LKEVINGLRAL"
FT   gene            complement(348009..348416)
FT                   /locus_tag="Sros_0361"
FT   CDS_pept        complement(348009..348416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0361"
FT                   /product="Uncharacterized distant relative of homeotic
FT                   protein bithoraxoid-like protein"
FT                   /note="KEGG: pna:Pnap_2813 roadblock/LC7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83393"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0Y6"
FT                   /inference="protein motif:COG:COG2018"
FT                   /protein_id="ACZ83393.1"
FT                   /translation="MTGKVTNTGELNWLLDDLTTRVGAVRQAVILSTDGLAVGFSKGLS
FT                   REDAEHLSAVAAGFQSLARGAGRHFGGGEVRQTIVEMESAFLFVTAAGQGTCLAVLSSS
FT                   DADVGHIAYEMAMLVKRVGQHISTLPRQGLS"
FT   gene            complement(348416..350846)
FT                   /pseudo
FT                   /locus_tag="Sros_0362"
FT   gene            350965..351786
FT                   /locus_tag="Sros_0363"
FT   CDS_pept        350965..351786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0363"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="KEGG: mxa:MXAN_0865 oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83394"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0Y7"
FT                   /inference="similar to AA sequence:KEGG:MXAN_0865"
FT                   /protein_id="ACZ83394.1"
FT                   /translation="MISVITGASAGIGAAAAVELAGRGQQVVLVGRDPAKTARTADRVK
FT                   AVSGTLPDTFTCDYTSLEDVRRLGAELLSRYARIDVLINNAGVMTTDRTLTRDGHETMI
FT                   QVNHLAPFLLTGLLLERVTGRVITTSSRAGKTGRLDPADLNRDRRRWSGWLQYGDSKQA
FT                   NALFTVELARRLSGTGVTATCFHPGVIKTEFAARTFMMWMVKNVPGMGQTAEQGARTMV
FT                   HLATHPDGAAHPGRYFAGSAPAAAPKGMTDPALARSLWDASAAAVAVPVGA"
FT   sig_peptide     350965..351018
FT                   /locus_tag="Sros_0363"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.890) with cleavage site probability 0.683 at
FT                   residue 18"
FT   gene            352030..353076
FT                   /locus_tag="Sros_0364"
FT   CDS_pept        352030..353076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bsu:BSU13520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83395"
FT                   /db_xref="GOA:D2B0Y8"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0Y8"
FT                   /inference="similar to AA sequence:KEGG:BSU13520"
FT                   /protein_id="ACZ83395.1"
FT                   /translation="MSVATPLRVSFRPPADRDPYFDNAKFLAITLVVSGHLVEDLRDVP
FT                   VAHAAYFYVYLFHMPLFIVLSGYLSRNFTFSSGKARKLIGTLAVPYVIFELVYALPRLV
FT                   LYGKLDVSLLDPYYLTWFLMSLFLWRLSTPVWQQLRWPLVIAVALSLLSGMSRLPDELS
FT                   MNRTLGLLPFYVLGLMLRPEHFAWLRRRRVRIAGAVTLAAGAVVALAVHTGVRTEWIRW
FT                   RHANDAIGVDDLTGSLIRLAMLAAGALLVAAFLAVTPSRRTWYSGLGMATMYAYLLHGL
FT                   VVKVAERFYGDWAATPVGVAAVAASGVGLAALLCTEPVRTVTRWAVEPRMSWAFTRLRR
FT                   PGRADPQA"
FT   gene            complement(353115..355049)
FT                   /locus_tag="Sros_0365"
FT   CDS_pept        complement(353115..355049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aba:Acid345_1633 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83396"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0Y9"
FT                   /inference="similar to AA sequence:KEGG:Acid345_1633"
FT                   /protein_id="ACZ83396.1"
FT                   /translation="MDRPISRRDFFDGVATVAGVAALGSLAGCAGPGAGRPNTIGTKNL
FT                   KVPSETNYPPVLTGMQGNTSNALSVPHALRDGRFWDHAGAPEPTGEHYDLVVVGAGISG
FT                   VAAAHRWLERAPDARILILDNHDEVGGHARRNEFHPAGRKGPLIGYGGSQSIDAPSAWT
FT                   PEGKDLLDKIGVRVRRFEEYFDQTLYTGMRMYGSVFCDRETFPREKLVVFTPGRKAPEW
FT                   IAELPVAEQAREDLLMLYGHPPDWFPGLSDGLKKERLAGLTYAEFLRDVCKVHPDVLRY
FT                   VQTMPNDEWGYGSDAFGAIDAWGSAGEHDYPGFQGLELDRATPSEYNSPSMIKGWGADD
FT                   PYVYHFPEGNQAIVRMMIGRMIPGFATSTEMEEISTATFDYGRLDLPRNQIRIRLSCPV
FT                   VSAANDGDPATATTATVGYFDGDRVRTVRAANVIMACWNMVIPYLVGELPADQKDALSK
FT                   AVKVPLLYAMVQLRGWEAWKRAGISRTRFTGAYWCGAELDYPVSIGEYLRPKTPDQPIN
FT                   VHMISTPALPGMSPASGSVAGRHELIKTPYEYLEYSIRDQLTRLLGPSGFDPARDIQAI
FT                   TVNRWGHGYAPEYATPWNLDFYPHGPFPATVARRRAGRIAIANSDSVPAAYADAAITAA
FT                   YRAVGELQA"
FT   sig_peptide     complement(354957..355049)
FT                   /locus_tag="Sros_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.672) with cleavage site probability 0.606 at
FT                   residue 31"
FT   gene            355586..355786
FT                   /locus_tag="Sros_0366"
FT   CDS_pept        355586..355786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83397"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0Z0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83397.1"
FT                   /translation="MVGKQGRVTGKIGPGLVGEVMVAVRGGVEAFYAHATLPDEEIPAG
FT                   SIVVVVDYFPPRTVYVARALA"
FT   gene            355828..357327
FT                   /locus_tag="Sros_0367"
FT   CDS_pept        355828..357327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bsu:BSU31010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83398"
FT                   /db_xref="GOA:D2B0Z1"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR031905"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0Z1"
FT                   /inference="similar to AA sequence:KEGG:BSU31010"
FT                   /protein_id="ACZ83398.1"
FT                   /translation="MPTEYFLIGGAVLVALLVLIMLFKAVWRVAEPNEALIISGLGARG
FT                   KSELADSLGFKIITGKGTSVLPGFQTARRLRLDSRAANLQVSCVTQQGIPVVVKGVVIY
FT                   KVGDDLHSIANAARRFLDQQDSMNGAIHELFTGHLRSIIGNLTVEDLILNRERLTGETR
FT                   ASAADEMIKLGLIVDSLQIQEIEDETGYITNLGKPHAARIAASARIAEAQRDQEATEAE
FT                   QIAAANKASAWRDAQIKQAAYQAEIDEAQARSRQAGPLSEASARQEVVVQETRAAELEA
FT                   ALAEQRLQAQVRKPADARAYETVTLSQAERDARIAQAEAEARETELRAAAQASQVKQAA
FT                   AAEAESVRLRGLAAAEATKATGLGEAEAAKARGLAAAEAAQAQGLAEAEAARAKGLAEA
FT                   ESIRARAQALAENQEAVIAQQLAENWPQIVESGAKAFGNVDHMVVLNGAQGIEEMLAKA
FT                   LTLGGTGLGLARSLLNGATPNGATSNGTGPETNGKAVDPAP"
FT   gene            complement(357564..359249)
FT                   /locus_tag="Sros_0368"
FT   CDS_pept        complement(357564..359249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0368"
FT                   /product="ATP-independent RNA helicase"
FT                   /note="KEGG: scl:sce0700 ATP-independent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83399"
FT                   /db_xref="GOA:D2B0Z2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0Z2"
FT                   /inference="similar to AA sequence:KEGG:sce0700"
FT                   /protein_id="ACZ83399.1"
FT                   /translation="MTLNTTDDTSSFADLTLRPELLHALSGLGYEEPTPIQREAIPPLL
FT                   EGRDLLGQAATGTGKTAAFALPVLQRMTRDGGGGEPMALVLVPTRELAVQVSEAFHHYG
FT                   RELGARVLPIYGGQPIGRQLRALQQGVDIVVATPGRALDHIGRGTLRLDDLEMVVLDEA
FT                   DEMLDMGFAEDIEAILQETPENRQTVLFSATMPPRINGIARRHLNDPVRIEMGRETTAP
FT                   GEAPLVRQTAYVVPRAHKPAALGRVLDVEAPTAAIVFCRTRDEVDQLTETLNGRGYRAE
FT                   ALHGGMGQEQRDRVMGRLRTGTADLLVATDVAARGLDIEQLTHVVNYDVPSAPESYVHR
FT                   IGRVGRAGREGVAITLAEPREHRMLKTIERVTKRRIPIEKVPTIADLRARRLELTRAAL
FT                   HESLLEDDLERFRVVVETLTDEFDIMEVALAAVKLAHEASGAADDEQEIPEVALRTERE
FT                   ERGRREPAGRQERRGRPAAGGSGMTRLFVGAGRSSGIRPQDLVGAIAGESRLTGRDIGA
FT                   IEIADRFSLVEVPDAAADEVIAVLRGSTIKGKKATVRRERYNAR"
FT   gene            complement(359698..359802)
FT                   /locus_tag="Sros_0369"
FT   CDS_pept        complement(359698..359802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83400"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0Z3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83400.1"
FT                   /translation="MILTGRLPNGAASVAAVRTISSTRAPASTAGLLR"
FT   gene            complement(359799..360428)
FT                   /locus_tag="Sros_0370"
FT   CDS_pept        complement(359799..360428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0370"
FT                   /product="isochorismatase hydrolase"
FT                   /note="KEGG: rlt:Rleg2_5191 isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83401"
FT                   /db_xref="GOA:D2B0Z4"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0Z4"
FT                   /inference="similar to AA sequence:KEGG:Rleg2_5191"
FT                   /protein_id="ACZ83401.1"
FT                   /translation="MAETYDPRRTAVLLVDPYNDFISEGGKLWPRLEPVAKKVGLLDNL
FT                   RSVVTSAREAGIQVVFVPHRRWEPGDYETWAHPNPTQRNIKERHTFARGSWGGEFHPDF
FT                   QPQAGDVVVHEHWAQSGFANTDLDFQLKQHGITHAVVVGVLANTCIESTGRFAMELGYH
FT                   VTLVRDATAAFLPEMMNAAHELNGPTYAHAIVATGELVTAFEEARS"
FT   gene            complement(360438..360584)
FT                   /locus_tag="Sros_0371"
FT   CDS_pept        complement(360438..360584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83402"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0Z5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83402.1"
FT                   /translation="MESSARTRGASMKRGVRSFAATVDGLFEAEGAEVVVTPLQAPPSI
FT                   IQI"
FT   gene            complement(360663..361691)
FT                   /locus_tag="Sros_0372"
FT   CDS_pept        complement(360663..361691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0372"
FT                   /product="alcohol dehydrogenase"
FT                   /note="KEGG: afw:Anae109_2555 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83403"
FT                   /db_xref="GOA:D2B0Z6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0Z6"
FT                   /inference="similar to AA sequence:KEGG:Anae109_2555"
FT                   /protein_id="ACZ83403.1"
FT                   /translation="MSSSAMHRAMQVAEPGGDLSLVRVDTQEPAPGQVRVTVEACGVCH
FT                   SDALITGGHIPGTTFPVTTGHEIAGRIDAIGGNVTGWSVGDRVAVGWYGGSCGHCDACR
FT                   EGDGVLCPELQVPGVAYAGGFADSVVVPAVALASVPDELTAAEAAPLACAGVTVYNALR
FT                   RSSARPGDTVAVLGLGGLGHLGVQFAAKMGFNTVAMARGPEKASLAHKLGASHYIDSAT
FT                   EKTADALQAHGGAKVVLATVTDAAAMSATVDGLGRHGELIIVGVAMEPMDITPLQLVSG
FT                   AKRVYGHASGIAVDTQNTMRFAAQSGVRSWTEEVPLEEADAAFQKMISGQARFRMVLTT
FT                   GN"
FT   gene            complement(361919..363976)
FT                   /locus_tag="Sros_0373"
FT   CDS_pept        complement(361919..363976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bar:GBAA5516 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83404"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0Z7"
FT                   /inference="protein motif:COG:COG4641"
FT                   /protein_id="ACZ83404.1"
FT                   /translation="MSEQTPEEPKYQRLGPINWLPEERKVIERFEERVRDLERRLAIAE
FT                   ARADYAQWKLESTKVQRPYRVAEAITGAKGSGVVRLPGKLRMALRPRKGPEAPRPVAEV
FT                   IEELDQRGPAVDVPQVKWPAGPINRPDLKVAVILDDFSRMAFKYEWDQIEFGLRDWPEI
FT                   FAERRPELLFVESAWHGNQGRWRYQMTGSNAPKPELRALIDWCREEGIPTVFWNKEDPP
FT                   NFDFFIDTAKLFDYVFTCDGDMVPRYREALGHDRIDVLQFAAQPRVHNPIQERRGRLHD
FT                   VVFAGMYFRDKHPERREQMETVLAPIRELGLHIFARNGTVDEKYAWPEEYVPHIVGELP
FT                   YDQMLAAYKMYKVFLNVNSVLDSPTMCARRVFELSACSTSVVSGWSRAVQETFGPLIPI
FT                   AHDELESYNQVLHLINSPELRARQGHLAMREVFDKHLFTHRVDQILGFLGRPVEQRSRS
FT                   VSVVLPTNRASQLEHAIASVAKQIHRPLQLVMVLHGLDIDPVVVADKARMAGISDVVVL
FT                   PADPSLSLGACMNLGIAAAEGDLIAKMDDDNLYGEHYLSDLVRAFDYSDAELVGKGAHY
FT                   AYFEGRNTTMLRMPGLEHRYSWLVQGGTFLGKADMFRHYGFEDVTRGEDTRLVRRLKED
FT                   RVKIYSADRFNFVYWRSGDPSMHTWQPDDHKLTRGAQFSFVGHPDAHVMI"
FT   gene            complement(364051..365220)
FT                   /locus_tag="Sros_0374"
FT   CDS_pept        complement(364051..365220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0374"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="KEGG: mxa:MXAN_1101 UDP-N-acetylglucosamine 2-
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83405"
FT                   /db_xref="GOA:D2B0Z8"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0Z8"
FT                   /inference="protein motif:PRIAM:5.1.3.14"
FT                   /protein_id="ACZ83405.1"
FT                   /translation="MRDNAPPGTTPDPDNPLVLHVLGARPNFVKAAPVVRGLAALGVRQ
FT                   GIVHTGQHYDALMSDVFFADLGLPEPIANLGVGSGSHARQTAALLTGLEDVVLAHGPAL
FT                   VVVYGDVNSTLAAILVCSKLHIPTAHVEAGLRSFDREMPEEVNRVVTDALSDILFATSP
FT                   DALSHLANEGVDPARVHLVGNPMIDSLFSALDHLDPAPVRSRLGLPERYGVATLHRPGN
FT                   VDDPASAKELVDAVLAVSERIPIAVPLHPRGRARLAEAGLVSGENLLIIDPLGYVDFLS
FT                   LVRGASLVVTDSGGVQEETTMLGVPCLTVRPNTERPITVTHGTNRLVTPALLPAAADRA
FT                   LADGAATPSGELPPLWDGKAGPRIARVIEAWLAGRNLSPAAQAVPPKSL"
FT   gene            365235..366944
FT                   /locus_tag="Sros_0375"
FT   CDS_pept        365235..366944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0375"
FT                   /product="Glycosyltransferase-like protein"
FT                   /note="KEGG: azo:azo3272 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83406"
FT                   /db_xref="GOA:D2B0Z9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D2B0Z9"
FT                   /inference="protein motif:COG:COG0438"
FT                   /protein_id="ACZ83406.1"
FT                   /translation="MRECGKRCLWYGHGVVSDASRPDSPKVSAKSARAGLRGLLKGFVQ
FT                   HPVIVSRVVATKVKSDPVRVAQAAAETLPPRLRPVVGRVAWPAARRARIVVRKLGMRLV
FT                   RGPWDEAKAHFDAGRMTEAAAVLQPYTKYPFINRRATYYTGELASIQPNPIPPKSKVIV
FT                   GERVEGRVLHCVTNALPYTQAGYTVRTHRIVTAQKAAGLDPHVVTSWGWPMMQGHVDAE
FT                   PYEEIDEIPYHRLLPSGDVPFESHGRMIRGAGEVTELVRTLRPQVLHAATDHRNGSVAL
FT                   AVRERTGTPMVYEVRGFLEETWASRDPKRVGSQRHVLQRDREAFIMRSADAVVTLAETM
FT                   ATEIVERGVPREKIFLAPNAVDDSLLTAEYDGATFRSAYGIEPGEIVMGSVSSIVAYEG
FT                   FATMINAAALLRDQGAPIRLLLVGDGAERPALLEQVEELGLGDVAILPGRVGPDEALQA
FT                   QSAIDIFVCPREDLRVCRLVTPLKPVEAMALGKPVVLSDLPALSELVGSEGAGLLVPAG
FT                   DPEALAEALAALRDDPARRAAMGEAGRAEVAAKRTWSRVAETYRDIYRSLAG"
FT   gene            367142..368404
FT                   /locus_tag="Sros_0376"
FT   CDS_pept        367142..368404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0376"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /note="KEGG: sus:Acid_4597 UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83407"
FT                   /db_xref="GOA:D2B100"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2B100"
FT                   /inference="similar to AA sequence:KEGG:Acid_4597"
FT                   /protein_id="ACZ83407.1"
FT                   /translation="MSAYDLAVIGLGYVGMPLAKEAAAAGLRVVGFEVDPRKVDALNAG
FT                   RSYIDDLTDADLEHMLAGGFSATLDESVLADSRTIVICVPTPLDDDHRPDLSAVEGATH
FT                   TVARNLSSGTLVVLESTTWPGTTDEVARPILEASGLVAGTDFHLAFSPERIDPGNPKYG
FT                   MRNTPKVVGGYTAACKDRAVGFYSQFVEQVVPVSGTREAEMAKLLENTYRHVNIALVNE
FT                   MAIFCDELGVDLWEAIEAAATKPFGFQKFLPGPGVGGHCIPVDPSYLSYTVRKLGYPFR
FT                   FVELAQEINERMPSYVVARVQRLLNRHKKAVNGSKVLLLGVTYKPDIADERETPALPVA
FT                   RALLELGAELVYADPYVRTWHVDGTPVPREEDLARAVAEADVTLLLQQHAAFDLSIVED
FT                   HGRLVLDTRGVLAEGERVERL"
FT   gene            368424..369512
FT                   /locus_tag="Sros_0377"
FT   CDS_pept        368424..369512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0377"
FT                   /product="Glycosyltransferase-like protein"
FT                   /note="KEGG: bha:BH3662 glycosyltransferase (biosynthesis
FT                   of lipopolisaccharide O antigen)"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83408"
FT                   /db_xref="GOA:D2B101"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D2B101"
FT                   /inference="protein motif:COG:COG0438"
FT                   /protein_id="ACZ83408.1"
FT                   /translation="MHVLVMTVVHHPEDARILHRQIRALVDAGHEVTYAAPYTARGVMA
FT                   RSWVNGVDLPRAAERKRLSAVRAARKVFKRMRDQVDLVVIHDPELLLAVVGVRKRPPVV
FT                   WDVHEDTPATLSLKPWLPAFLRPPVRFMARMLEGTAERHLHLLLAETAYAGRFHRAHLV
FT                   VPNETWVPDDVTPPGDDRIVYLGWLSEARGVRDAIEVARLLRPYRVAVELIGYADPQSR
FT                   PTLNEAVAEGVLEWRDFMPNDEALKRLDGALAGLSLLHDEPNYRHSMPTKIVEYMAHGI
FT                   PVITTPSPRAVELVERYNSGLVVPWEDPKAVAQAVLSLRDDVRERHAQGARGYAAARAN
FT                   HHWPNSARRFVSQLEAWAGVKS"
FT   gene            369573..371414
FT                   /locus_tag="Sros_0378"
FT   CDS_pept        369573..371414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83409"
FT                   /db_xref="UniProtKB/TrEMBL:D2B102"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83409.1"
FT                   /translation="MRWLTAFLGVAILAVVAAIVLVLPEGADAPASDRTPVASSPSTTS
FT                   SAALTPEASAFTDPCGTFDTKVASPYAVTGYWLIPTTDHCTWRRQFGAIHEVGGDTVIR
FT                   IGWGLQARRVDEDGRIMDNAGEEIDPRYEPCVEDGLPCVAAAEKDLQAANPGNRVSWTF
FT                   VYRTDEAFGPGLFRCPEFERTVTVGKTVFYRIIAPDDGSDDPGCANIKNSGRGYHVILI
FT                   AGAEQDNDSLTELLDLGDQFGVRVFPALPLAPRDPAQATRAYKDGTDTLTTLTRRILQD
FT                   YGARFQGRESLGGFYQPFELQMREMSYTGKDPDDDHATLKVYASQHQIVEQEMPGKPIL
FT                   VSPYIDARKRLKFSASPKQVAKGFEAMVRTGVGIIAPQDSRGTGKVGLFWPDQRDEQVD
FT                   ERLRPVVGETTNGTAYHGSTRDYYREMAAARDRMVAQGYNVQLWANVEAFEPSAEEPCA
FT                   ARTGTRGRTDKKRLDTAVTQVGRYVSKVVSYMWSDFFTCGSPSLAEDIARDADRPIPVD
FT                   AVRKERDIQDGMEIRGYNMPMGSKVTITWDGQEAPKVVDVAGVDLSEPLPDLPTGMRTA
FT                   WIPFDWTQVPDDTWVKIEVAAADGRAAAEALHVRMNA"
FT   sig_peptide     369573..369626
FT                   /locus_tag="Sros_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.382 at
FT                   residue 18"
FT   gene            371434..372099
FT                   /locus_tag="Sros_0379"
FT   CDS_pept        371434..372099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0379"
FT                   /product="NUDIX hydrolase"
FT                   /note="KEGG: dal:Dalk_4948 NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83410"
FT                   /db_xref="GOA:D2B103"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2B103"
FT                   /inference="similar to AA sequence:KEGG:Dalk_4948"
FT                   /protein_id="ACZ83410.1"
FT                   /translation="MVPRIPVSVDLVVLTVRCQALSALVWRRDKSPYEGRWALSGGFIQ
FT                   LDEDLPAAAARVLAERAGLPGAPVHLEQLQTYGYPDRDPRQRVLSVAYLGLAPDLPAST
FT                   EAHMSWQPVSSLREMAFDHRRIMVDGIERARGKLEYTPLGAAFCPPEFTVADLRRVYEI
FT                   VWGRTLDPRNFHRKVTKAEGFLVPTGRTTTRDGGRPAKLYRRGPALLLHPPMLRSLKE"
FT   gene            complement(372108..372782)
FT                   /locus_tag="Sros_0380"
FT   CDS_pept        complement(372108..372782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccs:CCNA_03008 putative PD-(D/E)xK nuclease
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83411"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D2B104"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83411.1"
FT                   /translation="MPDREDDMSIAPLTETERPDTEPDTGTAGAESPKLEPVPDWIIPS
FT                   SDGFTAEDLDRLRGIPSHTELIDGTLVFVSPQTRFHSLVMFLLERELRHTAPAELRVRR
FT                   EMTVTLGERQRPEPDLIVVRADGDLGMKQTTYQPADVVLAVEVVSAESEIRDRERKPQL
FT                   YAAAGIAHFWRIENVEGHPTVYVYELDPATKTYALMGIQHDRLKLTVPFDVDIDLAEID
FT                   DL"
FT   gene            372845..373906
FT                   /locus_tag="Sros_0381"
FT   CDS_pept        372845..373906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0381"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="KEGG: cti:RALTA_A0774 histidinol-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83412"
FT                   /db_xref="GOA:D2B105"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/TrEMBL:D2B105"
FT                   /inference="similar to AA sequence:KEGG:RALTA_A0774"
FT                   /protein_id="ACZ83412.1"
FT                   /translation="MPRFRAILDTMPPYKAGKAVVSADGRSYKLSSNESPYGPLPSVVE
FT                   AIAKAASEIHRYPDPAATGLTDALAERYGVPPEHVALGAGSVTVAQQLFETVSEPGAEV
FT                   IYAWRSFEAYPLLADLAGATSVRVPLLGETHHLDAMAEAITPQTRMIFVCNPNNPTGTV
FT                   VHAAELAAFLDRVPENVLVVLDEAYREYVRDADVTDGLTVYRDRPNVAVLRTFSKAYGL
FT                   AGLRVGYLIADEPVAAAVRKTIVPFAVNHLAQAAAVASLAAEAELLERVDTVVKERTRV
FT                   REALIAQGWTVPITEANFVWLRLGERTTAFAEACAADGVAVRPFAGEGARISIGSPEAN
FT                   DTFLAAAAAFRAA"
FT   gene            complement(373968..374906)
FT                   /locus_tag="Sros_0382"
FT   CDS_pept        complement(373968..374906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce5744 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83413"
FT                   /db_xref="GOA:D2B106"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D2B106"
FT                   /inference="similar to AA sequence:KEGG:sce5744"
FT                   /protein_id="ACZ83413.1"
FT                   /translation="MGHDTTDSRGSLLVWGALAIVYVVWGSTYLAIRIAIETVPPLLSG
FT                   AMRFSTAALILGTAVLLLRGWRAFRMTWKELGGAALVGLLLLNAGNGLVAVAEQHISSG
FT                   LAALLVASVPLWLVIFRIVARDMPQVLTLAGVLIGFGGVAVLSLTGGGSAADSTGIVII
FT                   LLASMSWSAGSFLSARIPMPANPFVASTVEMAAGGIGLALTSTVMGEHLDLGAVSGRSW
FT                   AALAYLVVMGSLVGFTAYVWLLGAAPISLVSTYAYVNPVVAVVLGALVLSEPVTTSMVA
FT                   AGLVIVLGVALVVSTERRRNAPTEEKEPASV"
FT   gene            complement(375037..376326)
FT                   /locus_tag="Sros_0383"
FT   CDS_pept        complement(375037..376326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0383"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83414"
FT                   /db_xref="GOA:D2B107"
FT                   /db_xref="InterPro:IPR007839"
FT                   /db_xref="UniProtKB/TrEMBL:D2B107"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83414.1"
FT                   /translation="MTPDLTIGVVGPHDLVERVMLMGHAAAPLPCRLVAAAYRDEQEAA
FT                   DKVTRLGAGVDACLFASPVPYDLARRSGVLTMPATYVQLGGAALIAALARAALDERIDP
FT                   RRVSVDVLSRADVEEAYTDLSLPVADVHSRDEPGATGTIAAFHERLARQGNTSGALTCL
FT                   PAVADRLQTAGVPVVRIRPTSAAVRTALHTAALLGAHHRLEESQLTVVLVEVPTLREPV
FT                   RRAAPRYWRDELRLSLHRLLVQEANRINASVTSIDDHSYMVTATRGSVAMATEGFRVLP
FT                   FAARVRDELGLAVEVGVGMGRTAHDAESHARAALARTQAGKQAQGFAVDREGRALIPAP
FT                   RMPPQGGGPLKPKGVEVLARLAAKLEGGDTVVDAEGAGKMLGVTPRTARRLLRTLVDEG
FT                   LAWPLPPNRTPQPGRPRQLYRLIVEKLGSR"
FT   gene            complement(376552..377820)
FT                   /locus_tag="Sros_0384"
FT   CDS_pept        complement(376552..377820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0384"
FT                   /product="UDP-N-acetylglucosamine1-carboxyvinyltransferase"
FT                   /note="KEGG: pca:Pcar_2690 UDP-N-acetylglucosamine 1-
FT                   carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83415"
FT                   /db_xref="GOA:D2B108"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D2B108"
FT                   /inference="similar to AA sequence:KEGG:Pcar_2690"
FT                   /protein_id="ACZ83415.1"
FT                   /translation="MVRYRVRGGNPLRGTAFIQGAKNAVLPMIGAALLAAKGRTVLRNV
FT                   PIIEDVRRAVELAEAIGAKVELHEAERTLVIDASRLKSPVLPAEIARRFRGSVLFVPAL
FT                   LHRLGEAIIEGVGGCNLGSRNLDFHYLGYKRLGAIVDEGDSVIHVKTAGFTGATLYLDT
FT                   PSHTGTENLIMAAALGRGTTVIENAALEPEVLDVIEMLTRMGARISGGGTGFITVEGVE
FT                   ELQAVEHTVMPDRLDAGVFAMAAAITGGEVNLVGADLDHLGVVRYKLEQMGVEFSDHGA
FT                   VLHVRRDRPLRPINVITDTYPGFATDLQSPIMTVACLADGASYIHERIFDGRFALASEL
FT                   NKMGADIEVKENSAVVRGATPLTGTEVTAHDLRSGIALVLAGLAAEGETVIESGYLIDR
FT                   GHSYLAERMQALGADVRREISSS"
FT   gene            complement(378182..379219)
FT                   /locus_tag="Sros_0385"
FT   CDS_pept        complement(378182..379219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83416"
FT                   /db_xref="GOA:D2B109"
FT                   /db_xref="UniProtKB/TrEMBL:D2B109"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83416.1"
FT                   /translation="MAFDQTASPERIGDTGVLRWPGTWRVYVATRSEEIRADAERALTM
FT                   RDGAGQLVSVGDGIGRHLERAEVYARSRHGLRRWLTGQAIEGAWSNVNSATVMLYGVLP
FT                   TAELCGRGPEVAAIGRAYLPGDDPRLTHLQTRLAAGDLGEDDRPLMQSVLRAAYTAQAM
FT                   ETGRVRSFRNLLLGGVVMLSLIVLGVVTIGAIWPDVIPMCGNQSVVQAQGLMPAQICPT
FT                   GSLRPSRGDVPLVALIGMLGAALATAASLSTRSELSTRYSLAVVQNMLKAPAGVATSVL
FT                   GLLILNSGFVPGFAGLGSQPAILVWAMAFGYGQQVVTRFVDQRADNLLLAASPLTPAGR
FT                   GTRAA"
FT   gene            complement(379325..380557)
FT                   /locus_tag="Sros_0386"
FT   CDS_pept        complement(379325..380557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0386"
FT                   /product="Phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: gbe:GbCGDNIH1_2297 phosphoribosylamine--
FT                   glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83417"
FT                   /db_xref="GOA:D2B110"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:D2B110"
FT                   /inference="protein motif:PRIAM:6.3.4.13"
FT                   /protein_id="ACZ83417.1"
FT                   /translation="MRVLVIGSGGREHALCRSLAADPQVTEVHCAPGNAGVAQVATLHP
FT                   VTPTDPAAVSRLALELGADLVVVGPEAPLVAGVADAVREAGIPCFGPSREAARIEGSKA
FT                   FAKDVMVAAGVPTARSRTCVTPEEAAAALDEFGTPYVVKDDGLAAGKGVVVTDDRDEAL
FT                   GHAAACGRVVIEEFLDGPEVSLFALCDGSTAVPLQPAQDHKRAYDGDKGPNTGGMGAYT
FT                   PLPWAPGDLTDRVMAETVIPTVTELARRGTPYTGVLFVGLALTAEGPKVIEFNARFGDP
FT                   ETQVVLDRLETPLAGLLLACADGTLGGFGPLSYRDGAAVTVVIAAENYPADPVKGDVIE
FT                   GLSDTVENAYVLHSGTALDGDRVVSNGGRVLSVVGTGPDVAAARAAAYEAVGRIRMRGS
FT                   HHRTDIAGHSA"
FT   gene            381013..382131
FT                   /locus_tag="Sros_0387"
FT   CDS_pept        381013..382131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0387"
FT                   /product="putative metal ion transporter"
FT                   /note="KEGG: bbt:BBta_0881 putative metal ion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83418"
FT                   /db_xref="GOA:D2B111"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:D2B111"
FT                   /inference="similar to AA sequence:KEGG:BBta_0881"
FT                   /protein_id="ACZ83418.1"
FT                   /translation="MRSSLLFPRIKHARAVRAPHAPAVPVRDRVNGVCVPPSDSLVEYA
FT                   AYIGGKKIDALGIPDALELVRTHNAAEEKTNAFVWVGLHEPDAPEVEWLAEVFALHPLA
FT                   VEDAVKAHQRPKVERYGDSLFVVLKTVAYLDHDVLTATSEIIGTGEIMVFVGPDFVVTV
FT                   RHGKHCPLSEVRERLEDKPKLLNRGPTGVLHAIADHVVDKYLNVADLMQAELEDVEAMV
FT                   FADVSARDIGRIYNLKREMIEMKRSVTPLQSPMSTLAQRRMIPSEMREYFRDVVDHLAR
FT                   VCEQVESSNELCNSILQAALARSNALANEDMRKISSWVAIMAVPTMIAGIYGMNFDHMP
FT                   ELKSVFGYPIVIGVMVIACSLLYRGFRRNGWM"
FT   gene            complement(382317..383243)
FT                   /locus_tag="Sros_0388"
FT   CDS_pept        complement(382317..383243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0388"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="KEGG: acr:Acry_0560 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83419"
FT                   /db_xref="GOA:D2B112"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D2B112"
FT                   /inference="similar to AA sequence:KEGG:Acry_0560"
FT                   /protein_id="ACZ83419.1"
FT                   /translation="MHAEIHGHRGARGLRPENTLPGFACALELGVDALELDVALTADRR
FT                   LVLTHDLTVSAVTSADTRPAFYGDPLFPYVGRPVGELTLAQLRTLDCGVRLPRHPEDRF
FT                   VRTQAPVPDTRMPTLGAVLGLVDAYGADGVRLHVELKSDPTRPELSADPREFTEMVVAE
FT                   LDRHHRLGGAAILSFDWRILEIARSLAPATRRYALIERATMDSVWLNGLRLEDFDGDLP
FT                   AAAVAAGGTTLSPEHVLVDQELARRAEKAELPLVPWTVNEPDRAAELLDLGVAGLVTDY
FT                   PDRMRALWADRGMPVPAPVTPVRRADR"
FT   gene            complement(383331..384614)
FT                   /locus_tag="Sros_0389"
FT   CDS_pept        complement(383331..384614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0389"
FT                   /product="Adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="KEGG: gur:Gura_0662 adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83420"
FT                   /db_xref="GOA:D2B113"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D2B113"
FT                   /inference="protein motif:PRIAM:6.3.4.4"
FT                   /protein_id="ACZ83420.1"
FT                   /translation="MPAVVLVGAQWGDEGKGKATDLLGDQVDYVVRYQGGNNAGHTVVI
FT                   GDQKYALHLLPTGVLSPNVIPVIGNGVVIDPGVLLSEIDGLEARGVSSERLLISANAHL
FT                   IMPHHKALDKVTERYLGKAKIGTTGRGIGPAYGDKIYRMGVRVQDLLDPGILQKKIEVA
FT                   LGEKNQILTKIYNRRAIDATKVLEEYLGYAERLKPHIADTSLILNKALDEDKVVLLEGG
FT                   QGNLLDIDHGTYPFVTSSSPTSGGACSGSGIPPTRLTRVIGILKAYTTRVGSGPFPTEL
FT                   EDEMGEWLRTTGGEYGVTTGRNRRCGWFDAVIARYASRINGVTDFFLTKLDVLSGLERI
FT                   PVCVAYEVDGVRYDEIPMTQTDFHHAKPVYEEFPGWQEDITGAKSFEDLPANAQAYVKA
FT                   LEQMSGARISAVGVGPGRTETIQIHSLV"
FT   gene            complement(384741..385163)
FT                   /locus_tag="Sros_0390"
FT   CDS_pept        complement(384741..385163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83421"
FT                   /db_xref="InterPro:IPR014487"
FT                   /db_xref="UniProtKB/TrEMBL:D2B114"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83421.1"
FT                   /translation="MTESHENLLAGPPPTRLPDLPEAREALESGAQASDVAARFPAYPG
FT                   AWAALADEYFAGGHAVTSYAFARTGYHRGLDQLRRAGWKGHGPIPWDHEPNRGFLRCLH
FT                   ALARAAQAIGEKEEAERCFQFLKDSSSEAAEELTGR"
FT   gene            complement(385253..386275)
FT                   /locus_tag="Sros_0391"
FT   CDS_pept        complement(385253..386275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0391"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /note="KEGG: sfu:Sfum_1469 fructose-bisphosphate aldolase,
FT                   class II"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83422"
FT                   /db_xref="GOA:D2B115"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2B115"
FT                   /inference="similar to AA sequence:KEGG:Sfum_1469"
FT                   /protein_id="ACZ83422.1"
FT                   /translation="MPIATPEVYAEMLDRAKANEFAYPAINVTSSQTLNAALRGFAEAE
FT                   SDGIVQVSTGGAEFLSGGTVKDMVTGATALAEYARVVAAKYPVTIALHTDHCPKDKLDT
FT                   FVRPLVDISLERVARGQDPLFQSHMWDGSAVPLEENLEIAQELLEKTARARIILEVEIG
FT                   VVGGEEDGVVGEMNEKLYTTTEDALATAEALGLGERGRYLLAATFGNVHGVYKPGHVKL
FT                   RPSVLKEIQEAVGAKYGKEKPFDLVFHGGSGSLLEEIHEAISYGVVKMNIDTDTQYAFT
FT                   RPIAEHMFKNYDGVLKVDGDVGNKKAYDPRSYGKAAETSMAARVVEACRHLKSAGTKIS
FT                   "
FT   gene            386443..387168
FT                   /locus_tag="Sros_0392"
FT   CDS_pept        386443..387168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0392"
FT                   /product="DedA family protein"
FT                   /note="KEGG: pfl:PFL_5476 DedA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83423"
FT                   /db_xref="GOA:D2B116"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D2B116"
FT                   /inference="similar to AA sequence:KEGG:PFL_5476"
FT                   /protein_id="ACZ83423.1"
FT                   /translation="MDLLHDLLDPKWWLGLLGPFATIGVLGIIFAETGLLLGFFLPGDS
FT                   LLVAAGVFSTPEAAAAIEGLEPLSFPLLLVLAPICAIAGAQLGHHLGATYGRRMFDRPD
FT                   SKLFKKEYVDKAEHYFQKFGPSKAVVLARFIPIVRTFLNPVAGMLGMDRKRFFLWNCVG
FT                   AVIWTDGLLVFGRLVGSAVPDIDRYILPGALVIILLSVIPIIREIMKNRKGGGPGVPLP
FT                   QGKHHRTTPTGPPNGDSPR"
FT   gene            387246..387653
FT                   /locus_tag="Sros_0393"
FT   CDS_pept        387246..387653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83424"
FT                   /db_xref="UniProtKB/TrEMBL:D2B117"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83424.1"
FT                   /translation="MGIARLALAGLAVLVAVALIVVGAFSLVGALNPDPGPAAPSTPAA
FT                   APSVPSATPEQIPTVRVQCLQEHCPKVFLKVAGGDVLLDREMARDEQAQSFDAKVDVVL
FT                   ADSAAVRVEVNGEVRPPGKAGERQEFTASRD"
FT   sig_peptide     387246..387335
FT                   /locus_tag="Sros_0393"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.602 at
FT                   residue 30"
FT   gene            complement(387702..388238)
FT                   /locus_tag="Sros_0394"
FT   CDS_pept        complement(387702..388238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0394"
FT                   /product="Orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: bra:BRADO0748 orotate
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83425"
FT                   /db_xref="GOA:D2B118"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D2B118"
FT                   /inference="protein motif:PRIAM:2.4.2.10"
FT                   /protein_id="ACZ83425.1"
FT                   /translation="MSDRESLLAEIKDKGVVHGRVVLSSGKEADFYVDLRRVTLDGQAA
FT                   PLVGRVMLDLTEDLDYDAVGGLTLGADPVATAMLHAAAARGRALDAFVVRKAQKAHGMQ
FT                   RRIEGPDVAGRRVLAVEDTSTTGGSPLTAVEALREAGAEVVAVATIVDRGAASAIAEAG
FT                   LPYRTAYSLQDLGLA"
FT   gene            388425..390830
FT                   /locus_tag="Sros_0395"
FT   CDS_pept        388425..390830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0395"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: wsu:WS1797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83426"
FT                   /db_xref="GOA:D2B119"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D2B119"
FT                   /inference="protein motif:COG:COG1595"
FT                   /protein_id="ACZ83426.1"
FT                   /translation="MSVKTVQGDAELLTETRHGNAVAYGGLRERHAPAARILARLLVDG
FT                   PAEAEEAVAETFAGILHLLRRGGGPREAFRPYLLTALRRTVHDRSQGRGGWVTDGEASG
FT                   PWVPFVDPALSGLERSPVARAFLSLPERWRLVLWHAGVEGAGPAEIAPLLGMPAGGVTA
FT                   LVHVAREGWRQACLRAHLAGTPRQECRPVLGMMGVYVRGGLARRESRPLDEHMDGCAEC
FT                   HDVFLELADVNQGLRVIVGPLVAGPALPGYLAALDRAGGTGAAGPFGRWRRAPASRRAV
FT                   AAGAAVGAVSLAAALAAVLVPVSAQGPQVPSAAAVPEPVAGAPTPAPAPVPGPQDPPSP
FT                   PLPPSPEPSPGKAEKPRRPDGPGAVAPPAQRGAVPAPRLIARIDALGALVRSEAGIVAV
FT                   RLRNVGAGGSGELVADVGLPDGVTVLAAARRGRAVAAIRPVGTVDGWACRAGSGGARCF
FT                   RRPLAAGRATAIFLRVAVSPTAAEGSAPSVRISAAGIGMTARARTGVRTAGAPARFATD
FT                   GQVSTSAIGNTLMVCASVAPACRAARSRRGDRRDNDLWEMGPLDQDRDPSTRSSSAARL
FT                   ALPRRSKVVWAGLYWSAGAPADGRIKFKAPGDGGYTRVRAERVTERELPAGVGYQAFAD
FT                   VTRLMGRLPGTYWAADASLRPGVSRHAGWSLVVIAADSRQPYSQAVVVDTATVVDREHG
FT                   PAWIPLDGLTPTAAPVRVDLVTWEGDAGLTGDRVTLGGRPLRPEAGDRDAGNAFDGSAT
FT                   GAEGTGMTFGTDVDGFRSTLGRNPVLKVSTGRDVLLFGAAVVRVRARS"
FT   gene            391261..392442
FT                   /locus_tag="Sros_0396"
FT   CDS_pept        391261..392442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0396"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Wasf2; WAS protein family, member 2 ; K05748
FT                   WAS protein family, member 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83427"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:D2B120"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83427.1"
FT                   /translation="MDRCALFVDAGYLLADGAMAVHGTRHREAVSWDYPGLLKLLGNLS
FT                   KERTGLPLLRCYWYEASVEGRRTAEHDALADLPGLKLRLSRIRPGRREGVDAQVHRDLM
FT                   TLARNSAVCDAVVVSGDEDLAQVVCDAQDLGIRVTVVHITADGSWAVSRSLRQECDDLI
FT                   EIGSSHLRPYVSLAGAMETPALSNGHQPGGNGQAPASLGNGAPPAAPVVQAPRATPPPA
FT                   PSQPALPSYPSYNHEPPQAPAPQQPQPAPAPQPLAAPNGPTGPLQPPPQAQQYASGNTG
FT                   NMPGYQPGQLGAYTGPQAAPVPVQNASNSSTTTLSDAVKAAHKEGHDFGESVAKDAPAL
FT                   WLEAVLARKPRMPSDLEARLLQGSSLPIDFLLHDEVRHALRRGFWDALERARR"
FT   gene            complement(392555..394435)
FT                   /locus_tag="Sros_0397"
FT   CDS_pept        complement(392555..394435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0397"
FT                   /product="carbohydrate ABC transporter"
FT                   /note="KEGG: scl:sce7656 carbohydrate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83428"
FT                   /db_xref="GOA:D2B121"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D2B121"
FT                   /inference="similar to AA sequence:KEGG:sce7656"
FT                   /protein_id="ACZ83428.1"
FT                   /translation="MREAEGPEGQEGRSSGAGSLFRRGQVAGELAWRAQPAAVAGSLVV
FT                   VLLMGVAPVAAAWLTKLVLDGLAGGGGRSGLLPLAAALGVAGLALIVLPHVSEYLNGQL
FT                   HRGLQRLIYDRLFRAVNADPGLSRFENPSFHDELRLAHEAGQNAPQQIVGSSLAICQGI
FT                   LTLLGFIVTLTVLSPVMVVIVIAAALPSARVQLALSRRRAGTMWGISSNTRRQIFFSAL
FT                   LTSPDAAKEVRLFGLGDFLRSRMLTELKTVNEAERDLDRRTLHSQGLLSLLGAAVAAGG
FT                   LFWAVLTAIEGGLSVGDVSVFVAAVAGVQTALTLIVGQWASAHNALLMFGYYLGVVQAD
FT                   PGLPVAAEPTALPPLREGIELRDVWFRYDDGHPWVLRGVDLFIPHGQAVALVGLNGAGK
FT                   STLVKLLCRLYDPVRGSIHWDGVDLRDVHPDDLRARVGAVFQDYMSYDLTATENIMLGD
FT                   LTAGADPELVRTAARRAGIHDTLDDLPRGYDTLLSRIFFGDNDDRQAGVTLSGGQWQRL
FT                   ALARALMRHHRDLLILDEPSSGLDAEAEHAVHLGLRRHRAGRTSVLISHRLGALRDADL
FT                   IIVLSEGKITERGSHSELMALGGEYARLFSLQASGYELAPDPSAAPSGKP"
FT   gene            complement(394449..394761)
FT                   /pseudo
FT                   /locus_tag="Sros_0398"
FT   gene            complement(394787..394987)
FT                   /locus_tag="Sros_0399"
FT   CDS_pept        complement(394787..394987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83429"
FT                   /db_xref="UniProtKB/TrEMBL:D2B122"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83429.1"
FT                   /translation="MTPYGSTEENLMIRSLNNLGDRLLAKLLPTASAAAETCWDETKWV
FT                   GYSVRRTCCIAAGRTACTPWR"
FT   gene            complement(395460..396092)
FT                   /locus_tag="Sros_0400"
FT   CDS_pept        complement(395460..396092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0400"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: mxa:MXAN_6734 response regulator/sensory box
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83430"
FT                   /db_xref="GOA:D2B123"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D2B123"
FT                   /inference="protein motif:COG:COG3437"
FT                   /protein_id="ACZ83430.1"
FT                   /translation="MPDRAKILLVDDREENLIALEAILSSLDLIPIRARSGEEALKALL
FT                   NTEFALILLDVRMPGMDGFETASHIKRRERTRNIPIIFLTVVDSAPDYAFRSYAAGAVD
FT                   YLTKPFDPWVLRAKVAVFVELYNMNRRLAEQASMLRERLSAELPPGDADDQAAVLPELS
FT                   RRLTAVEDELARVSELVRKANDPSLSGPMSDLSQRLSHLRAGFNALT"
FT   gene            complement(396096..400274)
FT                   /locus_tag="Sros_0401"
FT   CDS_pept        complement(396096..400274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0401"
FT                   /product="sensor histidine kinase/response regulator"
FT                   /note="KEGG: pzu:PHZ_c2079 sensor histidine kinase/response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83431"
FT                   /db_xref="GOA:D2B124"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2B124"
FT                   /inference="similar to AA sequence:KEGG:PHZ_c2079"
FT                   /protein_id="ACZ83431.1"
FT                   /translation="MTTANTVPDVEERRYSESDLKPILQTLITWRDGDFRRRVPHAPPG
FT                   ILSEIRLLLNEVADRREHLANELHRVRREVVKEGRFSERLTAGPGVGSWAESVDSVNSL
FT                   IDALVGPVTGAADVIDAVAKGDLSRRIDLDRRARGEVRRLGKAINGMVDQLSLFTSEVT
FT                   RVAREVGTEGRLGGRANVRGMSGSWRDLTEAVNTMSSRVSAQVRDIALVTTAVARGDLS
FT                   RKVTVDAVGEMFELKNTVNTMVDQLSAFAEEVTRVAREVGTEGELGGQAQVRGVSGVWK
FT                   DLTDNVNVMASNLTTQVRAIAAVSTAVAQGDLSKKITADAQGEILQLKDTLNTMVDQLS
FT                   MFADEVTRVAREVGTEGQLGGQARVRGVSGVWKDLTDNVNSMANNLTYQVRNIAEVTTA
FT                   VATGDLTRKIDVDAQGEILALKTTINTMVDQLSSFASEVSRVAREVGSEGQLGGQAQVR
FT                   GVSGTWKDLTDNVNVMANNLTTQVRQIAAVSTAVAQGNLSKKITADAQGEILQLKDTLN
FT                   TMVDQLSMFADEVTRVAREVGTEGQLGGQARVRGVSGVWKDLTDNVNSMANNLTYQVRN
FT                   IAEVTTAVANGNLTRKIDVNAQGEILALKTTINTMVDQLSSFASEVTRVAREVGSEGKL
FT                   GGQARVEGAEGIWKRLTENVNELAGRLTTQVRAIAEVTTAVATGDLTRSITVDAGGEIG
FT                   ELKDNINTMVSVLRDTTKANQEQDWLKSNLARISRLMQGHRDLMEVAKLIMSELTPLVS
FT                   AHYGAFYLAEPTGDHDLFMIAGYGARPGSKIRNRFAVGEGIVGQAAFEGKRIILESVPA
FT                   QYLTVDSGLSSSVPAQIVVVPILFETQVLGVVELASFSQFGEVHHDFMTQLVETIGVTM
FT                   NTIIANSRTEDLLTESQRLTTELQERSDELQRQQEELRRSNAELEDKAALLAKQNRAIE
FT                   IQNFQIEQARRTLEERAEQLAVSSRYKSEFLANMSHELRTPLNSLLVLAKLLTENAEGN
FT                   LTVQQVEFARTIHGAGSALLQLINDILDLSKVEAGRMDIHPQQISLPKLVDYFEATFAP
FT                   LAQDKGLSFAVEVDSSVPQELRTDEQRLQQVLRNLLSNAIKFTPKGEVRLRVIHAQRAV
FT                   AFVDDTLRGADGILAFEVVDTGIGIAADKLEVIFEAFRQADGTTSRKYGGTGLGLSICR
FT                   EIARLLGGEIHVVSEVGQGSTFTLYLPPSYGGPLSSRDGGAAAPNSSPRNQTLIGVLEE
FT                   PDDLPELALPEELPVSHFPQNEGPAWKGGDDPLTGAKILIVDDDIRNVFALTSVLERYG
FT                   STVVYAENGREGIEQLERNEDVALVLMDIMMPEMDGWATTSAIRRMPQFADLPIIALTA
FT                   KVMQGDREKSIASGASDYVPKPVDVDRLLERLRGWLTRGKPAGDSDEGA"
FT   gene            400396..401934
FT                   /pseudo
FT                   /locus_tag="Sros_0402"
FT   gene            complement(401980..403746)
FT                   /locus_tag="Sros_0403"
FT   CDS_pept        complement(401980..403746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0403"
FT                   /product="Dipeptidylaminopeptidase/acylaminoacyl-peptidase-like
FT                   protein"
FT                   /note="KEGG: rce:RC1_0392 prolyl oligopeptidase family
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83432"
FT                   /db_xref="GOA:D2B125"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2B125"
FT                   /inference="protein motif:COG:COG1506"
FT                   /protein_id="ACZ83432.1"
FT                   /translation="MKAEERWQARFRAPRVTLPVWARQAPARAVYRSNASGAWEVYAWD
FT                   RAAGSMRQATARPKGTSHGTIDPTGQWIWWFSDTDGDEWGRWMRQPFTGGPDEPIDLAP
FT                   GYPAGIALSATGEAAIGVARPGEGFQIHVVRPGGSTRPIYEHAEAASVAAMSLDGSLIA
FT                   ISHSEHGDSRHPALRVLRQNGDTVGDLHDGSGKGVLGLRFAPVQGDRRLLTLHERRGRR
FT                   EPLVWDPESDEQREIWLRDPGEITADWYGDGRSLLVVRANRGRTHLHRYDLAGGRLFPI
FT                   ETQHGVIDAATPRPDGSVEYSWSSGAHPPVIRSSNGHVVMNHGGPISPPSVPVEDVDVE
FT                   GPGGRIHALVSRPERGSGPFPTIFLLHGGPTSQDDDSFVPQVAAWVDLGFAVVRVNYRG
FT                   STGYGSAWRDALVGEVGHIELSDVAAVRDVMVDRGIADPERLVLSGASWGGYLTLLGLG
FT                   TQPKVWAAGIATVPIADHLATYEEETEALRAYHRALLGGSPGEQPERYANCSPITYVDQ
FT                   VEAPLLILAGENDPRCPIGQIETYVSRLAERGHEHSVYRYDAGHGSLVVSERIAQMSAQ
FT                   LEFARKHIRTEA"
FT   gene            complement(403923..404756)
FT                   /locus_tag="Sros_0404"
FT   CDS_pept        complement(403923..404756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0404"
FT                   /product="rRNA (guanine-N(1)-)-methyltransferase"
FT                   /note="KEGG: ank:AnaeK_1716 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83433"
FT                   /db_xref="GOA:D2B126"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D2B126"
FT                   /inference="protein motif:PRIAM:2.1.1.51"
FT                   /protein_id="ACZ83433.1"
FT                   /translation="MGLTDIVEYLICPVCGAGFDLGDRVLRCAQGHAFDIARQGYVSLL
FT                   TGSQAPGTADSTAMVAAREAFLGAGYFGPLAEAVAGACRTGAKVVADAGAGTGHYLAGA
FT                   LDRLPGAVGIALDVSKHAIRRAARAHPRLGAVVADVWRPLPVGDGTVDVVLNVFAPRNG
FT                   AEFARVLKDDGVLVVVTPTSRHLEPLVERLGLLSVDESKERRVAESLSGHFVETGRSVH
FT                   EFGMTLGHGAIEAVVGMGPSAWHTEPEVMRRKIMKLPETSNVTASFRMSIFQPAP"
FT   gene            complement(405056..405787)
FT                   /locus_tag="Sros_0405"
FT   CDS_pept        complement(405056..405787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0405"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC100080693"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83434"
FT                   /db_xref="UniProtKB/TrEMBL:D2B127"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83434.1"
FT                   /translation="MIRYSSVPSEGPISFLTRSRLTRSRPHTWGCVHGCGGRVPPVAGG
FT                   GSGARSPPFRPRGWPGTSPSARRRTGSKVKSAPKGGWSGLGLALSCDAVRGERSKARRE
FT                   VGGVARDQPIRAAPYRGGRSKAQRGVSGLAQGRLFRATPYGMLPAARAKERALRGFSLI
FT                   CWDWTSYSMPNPNRSRKNPDHYRLRGSSAPALPRPVHHCPLTRPSHPPIGQPLLNRPQA
FT                   TRHRPAQKKRPPATHPPSPRF"
FT   gene            405895..406386
FT                   /locus_tag="Sros_0406"
FT   CDS_pept        405895..406386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83435"
FT                   /db_xref="UniProtKB/TrEMBL:D2B128"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83435.1"
FT                   /translation="MIGGLLASVLVAGLPAAADAAVSPAAKATVTAAVSAGATAPAGAK
FT                   HHWGPVRSAAGHSGHAVADVWITDFSAETFAVSGTLRDRDPHRDHCAYIRARFHYTGGG
FT                   TGWARPRSTCGPSGAFRLSSDGEITRVDVRVCVLDRGRRTTSSCHVDVIRAEDIANWPR
FT                   "
FT   sig_peptide     405895..405957
FT                   /locus_tag="Sros_0406"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.892 at
FT                   residue 21"
FT   gene            complement(406495..407646)
FT                   /locus_tag="Sros_0407"
FT   CDS_pept        complement(406495..407646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0407"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: psa:PST_0543 transcription termination factor
FT                   Rho"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83436"
FT                   /db_xref="GOA:D2B129"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:D2B129"
FT                   /inference="similar to AA sequence:KEGG:PST_0543"
FT                   /protein_id="ACZ83436.1"
FT                   /translation="MTIETTTKKRPRAARPPRPRESDAYLETVAGLLDVRDKTGYIRTH
FT                   GYLPGVDDVRVPHAQIRQYGLRPGDHVVATTRKPYERLAEVESVNGSTDWRNRPDFADM
FT                   TPIHPRERLRLETESVTSRVIDLFAPIGKGQRGLIVAPPKAGKTMVLQDLAAAITRNHP
FT                   DCHLMVVLVGERPEEVTEMRESIHGEVAASTFDRPDRDHTALAELAVERAKRLAESGHD
FT                   VVVLLDSLTRLGRAYNNLAPGGGRTLAGGLDAAALLPPRRFFGAARNLRDGGSLTILAT
FT                   ALVETGSRMDDNLFEEFKGTGNMELRLSRALADKRLYPAVDLDASGTRREEILLDPQEH
FT                   QLTWRLRRTLGGLEKQQALELLTDRLRETPSNAAFLQQVRQTT"
FT   gene            407827..408618
FT                   /locus_tag="Sros_0408"
FT   CDS_pept        407827..408618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0408"
FT                   /product="Zn-dependent hydrolase including glyoxylase-like
FT                   protein"
FT                   /note="KEGG: sus:Acid_1471 beta-lactamase domain-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83437"
FT                   /db_xref="GOA:D2B130"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2B130"
FT                   /inference="protein motif:COG:COG0491"
FT                   /protein_id="ACZ83437.1"
FT                   /translation="MPHQSITVAGVEVFPLCDAVGPMGASIRRPLPEMFPGGCHGGSDE
FT                   WILHFHCYLLRDAAGRTVLVDTGIGPEDSPAASWAPVPGALGSELARVGVRPEEVDAVV
FT                   ITHLHSDHASGAVIGGVPVFANARHVFQRAEVDAAAEEVLAQVVRPLGERVQVVDGQAD
FT                   VLPGIRVFHTPGHTPGHQVVQVGELVLTGDVVLHPTQLADPRVTYLYDSDPELAVATRV
FT                   ELLERVRAARGMIATAHFAEPFTVLPPRDPGGPRVTSTVSA"
FT   gene            complement(408749..409945)
FT                   /locus_tag="Sros_0409"
FT   CDS_pept        complement(408749..409945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0409"
FT                   /product="major facilitator transporter"
FT                   /note="KEGG: dar:Daro_3345 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83438"
FT                   /db_xref="GOA:D2B131"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2B131"
FT                   /inference="similar to AA sequence:KEGG:Daro_3345"
FT                   /protein_id="ACZ83438.1"
FT                   /translation="MFWATGVLAYVIAIFHRQSLGVSSIEAAARLGIGAAGLSTLAMLQ
FT                   ILVYAAMQVPVGVLVDRIGSKRMLVAGAAVMACGELVFALSEGLLPGVAGRALIGCGDA
FT                   MTFISVIRLVNLHFPAHRNPVMVQLTGLIGQLGAIASAVPLIHSLHTYGWTPTFMGAAG
FT                   LGVLSVILLLTVLRDARPARTDGPPSLKAAWAEPGTRLGMWTHAATQCSAAAFLLLWGY
FT                   PFLVQGQGLDPSTAGVLLSTLTLCGMACGPLLGYLAGRFPFHRSRMVLIVIGTTTGAWT
FT                   AVLAWPGRAPLWLLVLLVVVLAANGPGSMIGFDYARTFNPAARIGAATGIVNGGGFVAS
FT                   VSVIALVGITLELIGETDLDAFRWAFAVQYPIWALGAVQVLRYRGKARRLLLSTQPGG"
FT   gene            complement(410108..410677)
FT                   /locus_tag="Sros_0410"
FT   CDS_pept        complement(410108..410677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0410"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /note="KEGG: bcs:BCAN_A1891 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83439"
FT                   /db_xref="GOA:D2B132"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D2B132"
FT                   /inference="similar to AA sequence:KEGG:BCAN_A1891"
FT                   /protein_id="ACZ83439.1"
FT                   /translation="MLHDSLMDSGTQSPRPARDIGTPDVGQRIRRLREERGISLSELAR
FT                   RAGVGKATLSGLENGTRNPTLETLWAVTAQLGVPLALAVGTGPVIRGTAVEGVLLQVFE
FT                   DEAVTYELYRLTIPAGATQVSPAHHEGVTEHITVFAGVLSAGPQDAPLRAGPGEHLTWR
FT                   SDVPHTYAAIGDQDVHASLLMRYPHR"
FT   gene            410811..412094
FT                   /locus_tag="Sros_0411"
FT   CDS_pept        410811..412094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0411"
FT                   /product="putative benzoate transporter protein"
FT                   /note="KEGG: rec:RHECIAT_CH0003225 putative benzoate
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83440"
FT                   /db_xref="GOA:D2B133"
FT                   /db_xref="InterPro:IPR004711"
FT                   /db_xref="UniProtKB/TrEMBL:D2B133"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0003225"
FT                   /protein_id="ACZ83440.1"
FT                   /translation="MTRLLQPVLAGVVTALVGFASSFAVVLAGLRAVGADQRQAASGLL
FT                   ALCLANGVVAIWLGLRQRVPITIAWSTPGAALLVATGAVEGGFPAAVGAFVVSGLLITA
FT                   AGLFPPLGRWIAAIPTPIAGAMLAGVLLNLCVAPVRALGEVPLMAGPAVLTWALLSRFA
FT                   RKWAIPGALLVAVVAIALTGPGLGTVDVRPVAELTAPSWSVAAMISIAFPLFLVTMASQ
FT                   NVPGMAVLAGYGYRPPLRGILLGTGLASTLGAPLGGHAVNLAAITAALAAGPDADPDPG
FT                   RRWIASVTAGASMIVLGVGSGLATALVLLSPPVLIEAVAGLALIGALASAITAAVAEPE
FT                   GREAAVVTFVVTASGLTLLGVGAAFWGLVAGGAMTFLLRGRKAPRTAPGRSAPEGQTPG
FT                   EPPPAETAPAEAGDREGAAGEGTRLSPR"
FT   sig_peptide     410811..410885
FT                   /locus_tag="Sros_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.812 at
FT                   residue 25"
FT   gene            complement(412268..412804)
FT                   /locus_tag="Sros_0412"
FT   CDS_pept        complement(412268..412804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0412"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: PRKCSH; protein kinase C substrate 80K-H ;
FT                   K08288 protein kinase C substrate 80K-H"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83441"
FT                   /db_xref="GOA:D2B134"
FT                   /db_xref="UniProtKB/TrEMBL:D2B134"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83441.1"
FT                   /translation="MIVLGLLLIILAGAAVVAVSWDEAATATTPASFTVFDQTIQLSQL
FT                   EFFFAGAVTGALFLLGLAVMFSGMRRSATHRRKLRSSRMEARDRVARLEEEKRALEREL
FT                   EKNPAAPATPVVDRDRDGVDDRAQTAAHPRVDRDRDGVDDRGETTAPHPRVEVPRQHST
FT                   DQLVAGRHGRPADGR"
FT   sig_peptide     complement(412742..412804)
FT                   /locus_tag="Sros_0412"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.531 at
FT                   residue 21"
FT   gene            412886..413962
FT                   /locus_tag="Sros_0413"
FT   CDS_pept        412886..413962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0413"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="KEGG: oan:Oant_2127 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83442"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2B135"
FT                   /inference="similar to AA sequence:KEGG:Oant_2127"
FT                   /protein_id="ACZ83442.1"
FT                   /translation="MAGNVAEIDVVVIGAGQAGLSSAYFLSRAGVDFVVLDRSPRPGGA
FT                   WQFRWPSLTLGAAHRVHDLPGLPMGAADTTRPSSEVVSEYFAAYERAFGLPVRRPVAVR
FT                   AVREGVGGRLLVETSAGDWSPRALINATGTWDRPFWPRYPGQETFLGRQLHTADYVTRE
FT                   EFAGRHVVVVGAGASAIQLLMEIAEVATTTWVTRRPPVFREGPFDEEAGRAAVARVDAR
FT                   VRAGLPPGSVVGATGYPVTPQVEAAMAAGVLDRLPMFDRIVPDGVAWDGAAAGHPGRVR
FT                   ADVILWATGFRPVVNHLAPLHLREPGGGIRVEDTRAVLDPRVHLVGYGPSASTIGANRA
FT                   GRAAVRHVRRLLDAPVAA"
FT   gene            414016..414984
FT                   /locus_tag="Sros_0414"
FT   CDS_pept        414016..414984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0414"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="KEGG: rpi:Rpic_4550 Mg2 transporter protein CorA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83443"
FT                   /db_xref="GOA:D2B136"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:D2B136"
FT                   /inference="similar to AA sequence:KEGG:Rpic_4550"
FT                   /protein_id="ACZ83443.1"
FT                   /translation="MDRTRLYRNGVLEAEGFPIEDVSDHIGDPSVVVWFDLCSPSPADL
FT                   EKISEELGLHRLAVEDALHSDQRPKLDTYDSHLFITVYGAKLVRKRLELTEISIFVTKN
FT                   ALVTVRESPHFDIDGVIRRWDANGEMARYGVPYLLHGLLDYVVDGYFDVLQVIDDKVEA
FT                   LEDDLFEDNDADRVHIQRQTYEMRKSLVRFRRLAVPIREVVGSLLRKGVEMLDPALTPY
FT                   YQDLYDHALRASEWTDSLRELVGNVREAHINQQGFRLNDIMKKITSWAAIIAVPTMITG
FT                   YYGQNVPYPGFGQPLGFWTSTAAILVASSILYLIFKKRGWL"
FT   gene            415135..415866
FT                   /locus_tag="Sros_0415"
FT   CDS_pept        415135..415866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83444"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:D2B137"
FT                   /inference="similar to AA sequence:KEGG:AFUA_5G01420"
FT                   /protein_id="ACZ83444.1"
FT                   /translation="MSTRGVVTVVLGAAVMFSLVSPADSKTRAAPESRARVAPLDNPHG
FT                   TRPGLAPVRLARDRIAAIRLIKKLRIRGMGPKTGYTRARFGANWADTARGVPYARNGCG
FT                   TRNDLLARDGEQVRYRRGSDCVVVAMSLRDPYTGRTIRWRKQRADQVQVDHVIPLSYEW
FT                   RMGASRWPMAKRVRIANDPLNLIPVYGDANQAKGGSGPASWLPPLRRIRCAYVVRFAQV
FT                   ALKYGLPVTRADKAVMLAQCR"
FT   sig_peptide     415135..415212
FT                   /locus_tag="Sros_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.860 at
FT                   residue 26"
FT   gene            complement(415905..416777)
FT                   /locus_tag="Sros_0416"
FT   CDS_pept        complement(415905..416777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0416"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_0436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83445"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="InterPro:IPR027860"
FT                   /db_xref="UniProtKB/TrEMBL:D2B138"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83445.1"
FT                   /translation="MVRDGTWTFDGEILRIVPSRDRGVHKLRQLLGEVAVPLAAVAGIA
FT                   YEPGKKGGRLRLRLREGADPFTQASRGRISDSACPYQLAVDAGRTGAAEYFVDEVRNAL
FT                   VIEQVPDGPSDRYLMPGPGVPLTVGGGDGTATFDGESFRIEWNWAVEGAKKSAGSQQFP
FT                   LKDLLGLEWIPSVGLENGHLRFNLRGSVHKLAPKHDPHCLVLWGLEKETRAAALFVAAV
FT                   LARLPHPSGAAEPQPALDAPAPAAPAAAGDADPDALLRRLRELGDLHRDGVLTEEEFTV
FT                   AKQALLRRF"
FT   gene            416943..418220
FT                   /locus_tag="Sros_0417"
FT   CDS_pept        416943..418220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0417"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="KEGG: mpo:Mpop_0649 putative transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83446"
FT                   /db_xref="GOA:D2B139"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024551"
FT                   /db_xref="UniProtKB/TrEMBL:D2B139"
FT                   /inference="similar to AA sequence:KEGG:Mpop_0649"
FT                   /protein_id="ACZ83446.1"
FT                   /translation="MSFSALNLDELTAQRDRALRDYEALVQRGLSLDLTRGKPSGRQLD
FT                   LASALLALPGGHTAADGTDCRNYGGLQGLPEIREMFGGLLQVPAGQLIAAGNSSLSLMH
FT                   DSIVHALLGRVPGAERRWVEEPRIAFLCPVPGYDRHFALCERFGIELIAVPMTAEGPDM
FT                   DVVERLVLEDPQVKGIWCVPKYSNPSGVSYSDETVRRLAAMPAAAPDFRIFWDNAYAVH
FT                   HLTDTPVEIADLLALCAESGNPDRAFVFGSTSKITFSGGGVAFFGSSPANVAWLLGHMA
FT                   KGTIGPDKINQLRHVEFLRDEDGVLEHMRRHRELIRPKFDAVDLILTKELGGTGLASWS
FT                   NPAGGYFIGLDVLEGCARQVVSRAAEAGIALTPAGATHPYGDDPRDSTIRIAPTYPELD
FT                   EVELAIAGLAVCVRLVGTEKLLEQAR"
FT   gene            418442..419701
FT                   /locus_tag="Sros_0418"
FT   CDS_pept        418442..419701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_4522 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83447"
FT                   /db_xref="GOA:D2B140"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2B140"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83447.1"
FT                   /translation="MSSRILPPSGPPRVLALAQLTNAFGDGAYYVCSALYFTRIVGLSP
FT                   TQVGFALTLGWALGSVAGVPLGHLADRWGARGAAALLAVATGVAAGSFLFVTSFALFVL
FT                   AACLYTCCQCGLGAARQALLAGLVDKARRTEVRAHLQATVNAGLAIGAALGGLALHLDT
FT                   RQAYLAVFAMDALSFLASALVLLRLPAVPPSPPAPAGEPVLAVLRDRPYALISLLNMIM
FT                   LLHMPLLSLVIPLWIVQRTEAPSWTVSALLVLNTLSVVLFQVRVARRVTGLGTASRSVR
FT                   QAGLVMLASCAVFALSAAGSSAWAAGAALLVAACLQVLGEMMHASGAWEVGFDLAPQDR
FT                   QGQYQGFFGAGTAVARMLGPLLLTTLIITWGPPGWLLLGGLFLLAGSAMGPAVRWAERT
FT                   RAAGSPRPAVAPPLPQESAS"
FT   gene            419798..420502
FT                   /locus_tag="Sros_0419"
FT   CDS_pept        419798..420502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0419"
FT                   /product="ThiJ/PfpI"
FT                   /note="KEGG: nmu:Nmul_A1134 ThiJ/PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83448"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2B141"
FT                   /inference="similar to AA sequence:KEGG:Nmul_A1134"
FT                   /protein_id="ACZ83448.1"
FT                   /translation="MAATKKILVIVTNVGEYEKVGMRTGLWLGELTHFWDVAEQAGIPM
FT                   DIASPLGGKIPLDPESLSHEVLAELGTEKRYRDRKFMDLLEDTKKISEVNLEDYDAIYL
FT                   TGGHGVMFDFPQSRDLEDLMAGFYESDRIVSTVCHGGTGLLNVTLGNGDPLVKGKRVTG
FT                   FSWPEEELADRADAVPYNLQEELQKLGADYRMADRPFEPYVVEDGRLITGQNPGSARGV
FT                   AEAVVRRLTAVA"
FT   gene            complement(420429..421217)
FT                   /locus_tag="Sros_0420"
FT   CDS_pept        complement(420429..421217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0420"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GF24314 gene product from transcript GF24314-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83449"
FT                   /db_xref="UniProtKB/TrEMBL:D2B142"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83449.1"
FT                   /translation="MRRHDRAHDRVSREGGWMSAFTELQAPPGGRMWTCCAAFRRSRAR
FT                   QARQGRVWRPWRAPAGDAGDDLGRIPAPLVAIECGGQRRMHPGEARRREDPRGAAPARG
FT                   AVMRQRRGPYRQPDVEPSAIPTKVFIGCHRHLHSARPGTEPCVPGSPAGGTTDPRRIGS
FT                   TIPDYLKPTGLSRPERGGRPDPPARMPERRTAGQTCFPATPSAPGPARPAPPVTPRRTA
FT                   VVVIAAAPARGVPIPWSTPPRSTSGRPPRRRPWRCPGSVP"
FT   gene            421280..421927
FT                   /locus_tag="Sros_0421"
FT   CDS_pept        421280..421927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0421"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bar:GBAA5698 transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83450"
FT                   /db_xref="GOA:D2B143"
FT                   /db_xref="InterPro:IPR003211"
FT                   /db_xref="InterPro:IPR038523"
FT                   /db_xref="UniProtKB/TrEMBL:D2B143"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83450.1"
FT                   /translation="MGAVGLLYVGAVLFINGLMLLGKVDPRAAGIFNLFVGALQVITPI
FT                   VLIITANGRPDVILGASGIFLFGFTYLYVGIGLLGGFDTTGIGYFSLFVAIMALGYAFA
FT                   NFQVLNDRPFAVIWLYWAFLWLLFFLLLGLKRDHLTTYTGWVTAIEGWVTGAIPAFLIL
FT                   IGYWQRWNQNVIATLLLVFGVVVFGALWPLTRKRGALSSRAGPAGGETITAH"
FT   gene            422027..423274
FT                   /locus_tag="Sros_0422"
FT   CDS_pept        422027..423274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0422"
FT                   /product="Formamidase"
FT                   /EC_number="3.5.1.49"
FT                   /note="KEGG: bbr:BB1405 formamidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83451"
FT                   /db_xref="GOA:D2B144"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:D2B144"
FT                   /inference="protein motif:PRIAM:3.5.1.49"
FT                   /protein_id="ACZ83451.1"
FT                   /translation="MPEVVFSVDQSKSMRDQAVPGHNRWHPDIPAVAMVRPGDEFRVEC
FT                   REWTDAQLHNDDSANDVRDVDLTLAHMLSGPIGVEGAEPGDLLVVDILDLGPVPQQTGD
FT                   APGQGWGYTGVFAKVNGGGFLTDYFPDAYKAIWDFHGIYATSRHLPGIRYAGITHPGLF
FT                   GTAPSAELLASWNQREQALIDTDPDRVPALGLPPLRDNALAGTATGDVADRIAREGART
FT                   VPARENGGNHDIKNFTRGARVFYPVHVKDAKLSGGDLHFSQGDGEITFCGAIEMGGFID
FT                   FHVDLIKGGMEKYGVTTNPIFMPGNVEPRYSEFMSFIGISVDHDTNTNYYLDATVAYRR
FT                   ACLNAIEYLKKWGYTGEQAYLLLGSAPIEGRISGIVDIPNACCSLYLPTEIFDFDVRPN
FT                   AEGPVKKDRGQCAVTS"
FT   gene            complement(423483..423680)
FT                   /locus_tag="Sros_0423"
FT   CDS_pept        complement(423483..423680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83452"
FT                   /db_xref="UniProtKB/TrEMBL:D2B145"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83452.1"
FT                   /translation="MVSDDPTEHRQNPAVSADRLRGHGGSDRMAVAIATVAAITPCSAV
FT                   GGPLGIHGAADVPDGVLRGH"
FT   gene            423705..425588
FT                   /locus_tag="Sros_0424"
FT   CDS_pept        423705..425588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0424"
FT                   /product="lipid A ABC exporter, fused ATPase and inner
FT                   membrane subunits MsbA"
FT                   /note="KEGG: sfu:Sfum_2616 lipid A ABC exporter, fused
FT                   ATPase and inner membrane subunits MsbA"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83453"
FT                   /db_xref="GOA:D2B146"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D2B146"
FT                   /inference="similar to AA sequence:KEGG:Sfum_2616"
FT                   /protein_id="ACZ83453.1"
FT                   /translation="MDMEVTAWTSLYHAMNAQEERRPFSMAALRRIAVFARPHRRLLIW
FT                   FLLLSVVTAALAVATPVLAGQVINAIDQGAAVDVVVGLAALIAVIAVAEAGLGLVTRWL
FT                   SASIGEGLILALRAAVFDHVQRMPIAFFTRTRTGALVSRLNNDVIGAQRAFSDTLSGVV
FT                   GNLVTLVLTLVVMIGTSWQITLLALVLLPVFVLPARRMGTRLARLERESANHNAAMSTQ
FT                   MTERFSAPGATLVKLFGRPADESAEFFTRARRVRDIGVRTAMVQSVFVTALMLVSALAL
FT                   AVVYGLGGFYALRGQLEPGAVVAMALLLTRLYAPLTALASARVEMMSALVSFERVFEVL
FT                   DLKPLITEKPDARRVPEGPVSVEFDAVRFGYPSADKVSLASLEEVATLDTRGGVEVLHG
FT                   VSFRAEPGRMVALVGSSGAGKSTIAQLVTRLYDADEGAVRLSGVDVRDLSADSIRETLG
FT                   MVTQDGHLFHESIRANLLLARPEAPEEELWEVLRRARLADLVEALPDGLDTVVGERGYR
FT                   LSGGERQRLTIARLLLARPRVVILDEATAHLDSTSEAAVQEALGEALAGRTSVVIAHRL
FT                   STVRAADLILVIEDGRIVERGTHTDLLAAGGRYEELYRTQFDQPSVREAVH"
FT   gene            complement(425848..427266)
FT                   /locus_tag="Sros_0425"
FT   CDS_pept        complement(425848..427266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0425"
FT                   /product="carbohydrate kinase, FGGY"
FT                   /note="KEGG: sus:Acid_3424 carbohydrate kinase, FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83454"
FT                   /db_xref="GOA:D2B147"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR013449"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D2B147"
FT                   /inference="similar to AA sequence:KEGG:Acid_3424"
FT                   /protein_id="ACZ83454.1"
FT                   /translation="MNVYAAVDLGASSGRVMTARIDSGRVRLTEVHRFANRPVRVGGTL
FT                   HWDILALHRGVLDGLREAGPVDSVGIDSWAVDYGLLDGAGRLIGNPVHYRDERTAGIME
FT                   RVTAEVGADALYQAGGLQFLPFNTVYQLLAERDLGRAETLLMIPDLLTHWLTGSVGAEA
FT                   TNASTTGLYDVRTGGWARDLTERLGLPSRILPELRQPGAAAGTLRAEVAAETGLPASTP
FT                   VTAVASHDTASAVAAVPADTDRFAYISSGTWSLVGLELPRPVLTPESRLANFTNEGGLD
FT                   GTIRYLRNVMGLWILQECMRAWGDSGLSELLAAAAQAPPFQAVFDPDDPAFLPPGDMPA
FT                   RIAAFCERTGQRPPAGRAQVVRCVMESLALAYRRAVRDAVRLSGQEVEVVHVVGGGARN
FT                   TLLCQMTADATGLPVVAGPVEAAALGNALVQARAQGAVSDIRALVRQGERLVTYRPKDE
FT                   EEAWARAEARLPGR"
FT   gene            complement(427263..428363)
FT                   /locus_tag="Sros_0426"
FT   CDS_pept        complement(427263..428363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0426"
FT                   /product="transcriptional regulatory DNA-binding repressor
FT                   transcription regulator protein"
FT                   /note="KEGG: rso:RSc1014 transcriptional regulatory DNA-
FT                   binding repressor transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83455"
FT                   /db_xref="GOA:D2B148"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2B148"
FT                   /inference="similar to AA sequence:KEGG:RSc1014"
FT                   /protein_id="ACZ83455.1"
FT                   /translation="MGTVSIKEVARLARVSPATVSNVLNRPERVAPTTRERVRRVIHEL
FT                   GFVRHGSASTLRAGHSRTIGLSVMDIGNPFFTDVAAGAEDVASDLGYAVILGNSAGSRS
FT                   KEEHNLLVFAEQRVRGVLITPSDEDPGPLDGLRERGISVVLVGHPAHRPDLCSVTVDDV
FT                   AGGRLAVAHLLDLGSRRIGYLTGPRTIRQCLDRGRGAGQALAAAGLDPETVLETVEAPA
FT                   MTARAGQEAAERLIVSGWLPEAIFCANDLLALGVLRGLLQAGVEVPGDVALIGYDDIDF
FT                   AAASAVSLSSVRQPTYRLGQIAAELLLEECGDPGAHAHRQIMFQPELVVRESTGGPGRT
FT                   AATIRRRATTSSPGLKPEVSTLKEIR"
FT   gene            428580..428891
FT                   /pseudo
FT                   /locus_tag="Sros_0427"
FT   gene            428954..430126
FT                   /locus_tag="Sros_0428"
FT   CDS_pept        428954..430126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0428"
FT                   /product="L-rhamnose isomerase"
FT                   /note="KEGG: acr:Acry_2987 L-rhamnose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83456"
FT                   /db_xref="GOA:D2B149"
FT                   /db_xref="InterPro:IPR013457"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D2B149"
FT                   /inference="similar to AA sequence:KEGG:Acry_2987"
FT                   /protein_id="ACZ83456.1"
FT                   /translation="MSDIRATLRAQAIETPSWAYGNSGTRFKVFAQRGVPRDPYEKLAD
FT                   AAQVHAFTGVAPTVALHIPWDRVDDYADLARHASEVGVRIGAINSNVFQDDDYRLGSVT
FT                   NPDPAVRRKALDHLLACVDVMDATGSDTLKLWFSDGTNYPGQDDIRSRQDRLAEALSAV
FT                   YGRLGEGQRFLLEYKLFEPAFYVTDVPDWGTAYAHCLRLGDKAQVVVDTGHHAPGTNIE
FT                   FIVAFLLREGKLGGFDFNSRFYADDDLMVGAADPFQLFRIMYEVIRGGALSGRHGGPEQ
FT                   GVAFMLDQCHNIEPKIPGQIRSVMNIQEATAKALRVDADALAAAQAEGDVLAANAVLMD
FT                   AYNTDVRPLLAELRQEMGLDPDPMAAYARSGYFEKIAAERVGGTQAGWGA"
FT   gene            430215..432257
FT                   /locus_tag="Sros_0429"
FT   CDS_pept        430215..432257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0429"
FT                   /product="short chain dehydrogenase"
FT                   /note="KEGG: rde:RD1_3083 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83457"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013454"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D2B150"
FT                   /inference="similar to AA sequence:KEGG:RD1_3083"
FT                   /protein_id="ACZ83457.1"
FT                   /translation="MTSPVEKLLQRSHALGSDPRNTNFAGGNTSAKGVAVDPVTGSDVD
FT                   LMWVKGSGGDLGTLAEGGLAVLRLDRLRALTEVYPGVEREDEMVAAFDFCAFGKGGAAP
FT                   SIDTAMHGLVEAAHVDHLHPDAGIAIATAADGRELTTRIFGDRVVWVPWRRPGFQLGLD
FT                   IAAIKDANPQAIGCVLGGHGITAWGETSAECEANSLDIIRTAEAYLAEHGRPEPFGPVI
FT                   REPLAEAARRERAAALFPLLRGLASTDLPQVGHYTATPEVLDFLSRERHPELAALGTSC
FT                   PDHFLRTKVAPLVIDLPGDAPLEEVAVRLRELHAAYREDYAAYYRRHATADSPPMRGAD
FT                   PAIVLVPGVGMFSFGKDKQTARVAGEFYVNAINVMRGAEAVSSYAPIEESEKFRIEYWE
FT                   LEEAKLRRMPAPKPLATRVALVTGGGSGIGAATARRLAAEGACVVVADRDLAAAEKVAA
FT                   ELGAKAYRPEDVATAVQVDVTDEEQVVAALRQAVLAFGGVDLIVNNAGLSLSRSLLETS
FT                   VADWDLQHDVMARGSFLVSRESARVMIDQGMGGDIVYISSKNAVFAGPNNVAYGAAKAD
FT                   QAHQVRLLAAELGGFGIRVNGVNPDGVVRGSGIFASGWGANRAAVYGVPEDKLGEFYAQ
FT                   RTLLKREVLPEHIAAAVFALTGGELSLTTGLHIPVDAGVAAAFLR"
FT   gene            432297..433724
FT                   /locus_tag="Sros_0430"
FT   CDS_pept        432297..433724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0430"
FT                   /product="putative L-arabinose isomerase protein"
FT                   /note="KEGG: sme:SM_b21420 putative L-arabinose isomerase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83458"
FT                   /db_xref="GOA:D2B151"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/TrEMBL:D2B151"
FT                   /inference="similar to AA sequence:KEGG:SM_b21420"
FT                   /protein_id="ACZ83458.1"
FT                   /translation="MRAELSRITAPRTKVGLVAGGLGAYWPQFPDLLPQLRHSSERVSE
FT                   RMRALGCEVVDVGFISDAQEGAVAAEKLRAAGCDIIVGFLTTYMTATMLLPVAQRSGAP
FT                   VLLINLQPTESMDHATFDTGQWLAYCGACPLPEMANTFIRCGIPFRSVSGYLEDERAWA
FT                   KIGRWVKAAGVRAALRRGRHGLMGHLYPGMLDVATDLTLVPANLGGHVEVLEFDDLRVR
FT                   VEKVTDAEVTERMDLARDVFELADTVNGDDFSWAARVSVGLDRLVEDFALDSLAYYHRG
FT                   LDGEIHERLGAGMILGASLLTARGVPSAGEYELRTSLAMLIMDRLGGGGSFTELQALDF
FT                   ARGHVEMGHDGPAHLAISSKRPLLRGLGVYHGKRGWGVSVEFDVTHGPVTAFGLLHRPD
FT                   GRFGFVVSEGEVVDGPLLRIGNTTSRVDFGCDPGEWTDAWSATGISHHWALGTGHRAAE
FT                   LRAVADLLGADLIEVKP"
FT   gene            434310..435125
FT                   /locus_tag="Sros_0431"
FT   CDS_pept        434310..435125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0431"
FT                   /product="alpha/beta hydrolase fold-1 protein"
FT                   /note="KEGG: ade:Adeh_3125 alpha/beta hydrolase fold-1"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83459"
FT                   /db_xref="GOA:D2B152"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2B152"
FT                   /inference="similar to AA sequence:KEGG:Adeh_3125"
FT                   /protein_id="ACZ83459.1"
FT                   /translation="MTEVTSSKGMAVSKILSSDGVAIAYDRVGQGPPLILVGGAFSYRA
FT                   FPGLVELAELLSQHFTVINYDRRGRGDSGDTTPYAVEREVDDLDALIRHVGGAASVWGL
FT                   SSGAVLALRAAAHGLAINRLALYEPPFVVGDSRRPPADHQAQLTRLVAAGRRSAAAKYF
FT                   MRRVSGVPAVFMVGLPFLPLWSRFKAVAHTLPYDAAVMGDYSLPAGQLSLVTVPTLVIA
FT                   GERSSTVLRQAAQEVANAVPNARHRSLEGQNHNVSMKALAPVLVEYFKV"
FT   gene            435331..435552
FT                   /pseudo
FT                   /locus_tag="Sros_0432"
FT   gene            435552..437213
FT                   /locus_tag="Sros_0433"
FT   CDS_pept        435552..437213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0433"
FT                   /product="Potassium-transporting ATPase"
FT                   /EC_number="3.6.3.12"
FT                   /note="KEGG: scl:sce1352 potassium-transporting ATPase A
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83460"
FT                   /db_xref="GOA:D2B153"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:D2B153"
FT                   /inference="protein motif:PRIAM:3.6.3.12"
FT                   /protein_id="ACZ83460.1"
FT                   /translation="MSPTLAGILFIGSLVLALVLTHRPLGDYMYRVYTGTKHTAVERVV
FT                   YRAIGVRPDTEQRWSVYARGVLAFSLISVLFLYGLQRLQDKLFLSLGVPPVTDHVAWNT
FT                   AISFVTNTNWQAYSGESTMGHLVQMAGLAVQNFVSASVGMAVAVALVRGFARSRTENLG
FT                   NFWVDLVRGTVRILLPIAFVGAIVLVAGGLIQNFAEPHTVTTLTGGRQAITGGPVASQE
FT                   VIKVLGTNGGGFYNANSAHPFENAAPWTDWVEIFLILLIPFAMPRTFGRMVGQVRQGYA
FT                   IVAVMATLALASVALTNVFELSGGATVPQAVGAAMEGKEMRFGVSNSATFAAATTLTST
FT                   GAVNSFHDSYTPLGGMMTMFNMMLGEVAPGGVGAGLYGMLVLAVITVFVAGLMVGRTPE
FT                   YLGKKISAREIKLASMYFLVTPVLVLIGTALAMGSAEQRASMLNGGPHGLSEVLYAFTS
FT                   ASNNNGSAFGGITVNTPWYDTALGLCMASGRFLPIIFVLALAGSLARQAPVPESAGTLP
FT                   THRPQFVGMVVGVTIVLVALTFLPALALGPLAEGIH"
FT   sig_peptide     435552..435605
FT                   /locus_tag="Sros_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.659) with cleavage site probability 0.519 at
FT                   residue 18"
FT   gene            437213..439345
FT                   /locus_tag="Sros_0434"
FT   CDS_pept        437213..439345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0434"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /note="KEGG: sus:Acid_0074 K+-transporting ATPase, B
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83461"
FT                   /db_xref="GOA:D2B154"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2B154"
FT                   /inference="similar to AA sequence:KEGG:Acid_0074"
FT                   /protein_id="ACZ83461.1"
FT                   /translation="MSTPVIEAPGRTPAPRKKVGGGLLDPAQLVRSLPAALAKLNPVHM
FT                   WRNPVMLIVEIGAVFSTVLAVADPSFFAWAIVVWLWLTVVFANLAEAVAEGRGKAQAAT
FT                   LRAAKRDTTARRLPDRGDPGRWDDVGASELRQGDFVVVEAGEIIPGDGDVVEGIASVDE
FT                   SAITGESAPVIRESGGDRSAVTGGTKVLSDRIIVQITQKPGESFIDRMIALVEGANRQK
FT                   TPNEIALNILLAALTIIFLVATVTMQPLAVYSKAVNPGIPDSLALTGDGVTGIVLVSLL
FT                   VCLIPTTIGALLSAIGIAGMDRLVQRNVLAMSGRAVEAAGDVSTLLLDKTGTITLGNRQ
FT                   ASEFVPAPGVSVDELATAAQLASLSDETPEGRSIVVYAKQAYGLREREAGELAHAEWVQ
FT                   FTAQTRMSGVNVDGRQVRKGAATAVMKWVRENGGHPTDEVGAIVDAISGSGGTPLVVGQ
FT                   VVDGKARVLGVIHLKDVVKQGMRERFDEMRRMGIRTVMITGDNPLTAKAIADEAGVDDF
FT                   LAEATPEDKLALIKREQEGGRLVAMTGDGTNDAPALAQADVGVAMNTGTSAAKEAGNMV
FT                   DLDSNPTKLIEIVEIGKQLLITRGALTTFSIANDIAKYFAIIPAMFAAVYPGLDALNIM
FT                   RLTSPQSAILAAVIFNALVIVALIPLALRGVRYRPSSASKLLGRNLYLYGLGGIVVPFA
FT                   GIKIIDLLIQFLPGMS"
FT   gene            439346..440218
FT                   /locus_tag="Sros_0435"
FT   CDS_pept        439346..440218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0435"
FT                   /product="K+-transporting ATPase c chain-like protein"
FT                   /note="KEGG: reh:H16_B0896 potassium transport system
FT                   ATPase chain C"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83462"
FT                   /db_xref="GOA:D2B155"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:D2B155"
FT                   /inference="protein motif:COG:COG2156"
FT                   /protein_id="ACZ83462.1"
FT                   /translation="MERLPSWIRQHLAALRALLVLTLILGAAYPLLVTGVAQAVFGGNA
FT                   NGSIVQKDGKDVGSALVGQKFTDADGNPVGKYFQSRPSAAGDGYDMLSTSASNLGPEDV
FT                   VDVLPVPGAKDDEGGPDEGKQSLLTQVCARSKAVGELEGVSGARPYCTPDGVGAVLKVF
FT                   PAVGAPVRAVSVNQACPAVPFTAEYQGVKVECGKPGEDYAAGRTVPVRGSQRAVVPADA
FT                   VTASGSGLDPHISPAYAELQAARVARERGLPVEKVRQLVEENTDGRSLGFMGEPGVNVL
FT                   RLNLALDKG"
FT   sig_peptide     439346..439465
FT                   /locus_tag="Sros_0435"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.884) with cleavage site probability 0.439 at
FT                   residue 40"
FT   gene            440224..442779
FT                   /locus_tag="Sros_0436"
FT   CDS_pept        440224..442779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0436"
FT                   /product="osmosensitive K+ channel signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: mrd:Mrad2831_0205 osmosensitive K+ channel
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83463"
FT                   /db_xref="GOA:D2B156"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:D2B156"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_0205"
FT                   /protein_id="ACZ83463.1"
FT                   /translation="MPRGRLRVYLGAAPGVGKTFAMLGEGHRRLARGRDVVVGLVETHG
FT                   RPRTAELIDGMEVVPRRTVIHREAAFTELDVDAVIARAPRIALIDELAHTNVPGSRNAK
FT                   RWQDVEEILDAGIDVVSTVNIQHLESLNDVVRQITGVPQRETVPDEVVRRADQVELVDM
FT                   SPEALRRRLAHGNVYAPEKVDAALSNYFRVGNLTALRELALLWVAGKVDEQLDRYRAEH
FT                   GIEGTWEARERVVVALTGGPEGDTLIRRAARIAARSKGADLLAVHVTRADGLAGGDPVN
FT                   LARQRVLAESLGGTYHQVVGDDVPRALLDFARGVNATQLVLGASRRGRFAQILSRGVGV
FT                   TTTALSGSIDVHMITHGEAQKGRRPPPSRAALTRTRRLAGWAVAGAGLPTLTGVLLPFR
FT                   ETLTLPSEILFFLLVVVGVALIGGMWPAVTAAVGGSLLLNYFFTPPVHTLTIYDPENLF
FT                   ALVVFVLVAIMVSGIVDVAARRTREAARASADAEVLSTLAGHVLRGESALPSLLARLRE
FT                   TFALTSVTLLERIDGPVPDDQSDPEAWRIVATAGATPCTCPGTADADVVIDEQLVLAVR
FT                   GRLLEASDRRVLEAFAAEAAVALRQERLRREADLAGPLAETDRMRTALLAAVSHDLRTP
FT                   LASARLAVESLRGTEIEWSAEDREELLATADESLVKLDRLVANLLDMSRLQAGVLGLAL
FT                   QPVALEEVIPRSIDDLGPLRDRVEGDVSVDLPEVVADPVLLERILVNVMSNAVRYSPAG
FT                   RKALVAGSRHGDYVEIRVVDRGPGIPAEAHDRVFMPFQRLGDRDNHTGVGLGLALSRGL
FT                   AEAMGGTLTPEETPGGGLTMILTLPVSSRADGLPAVERA"
FT   gene            442776..443444
FT                   /locus_tag="Sros_0437"
FT   CDS_pept        442776..443444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0437"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: mpt:Mpe_A2502 two-component response regulator
FT                   of kdp operon"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83464"
FT                   /db_xref="GOA:D2B157"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2B157"
FT                   /inference="similar to AA sequence:KEGG:Mpe_A2502"
FT                   /protein_id="ACZ83464.1"
FT                   /translation="MTRVLVVDDEPQILRALRINLLARHYEVAVAADGGAALREAADWR
FT                   PDLVILDLGLPDIDGVDVIHGLRGWTSIPIVVLSGRAGGADKVDALDAGADDYVTKPFN
FT                   IDELLARIRAVTRRTALHDSELARIRIGDHVVDLVGKTVSGGVRLTPTEWHLLEILLRN
FT                   PGKLISQRRLLTEVWGAKYLKETHYLRQYMTQMRKKLERDPAHPVHLLTEPGMGYRFHP
FT                   "
FT   gene            443637..443936
FT                   /locus_tag="Sros_0438"
FT   CDS_pept        443637..443936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83465"
FT                   /db_xref="UniProtKB/TrEMBL:D2B158"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83465.1"
FT                   /translation="MSAVLTPAPAPAPAAAEPPDTGDRRRLTVTVGLAALAVVVPVRAV
FT                   NRLAREALIAALSLGDRGVAVDVARPEGGPDARRIDTVVCRMRFRGGTRTAGAA"
FT   sig_peptide     443637..443687
FT                   /locus_tag="Sros_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.662) with cleavage site probability 0.644 at
FT                   residue 17"
FT   gene            443933..444493
FT                   /locus_tag="Sros_0439"
FT   CDS_pept        443933..444493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83466"
FT                   /db_xref="GOA:D2B159"
FT                   /db_xref="InterPro:IPR039708"
FT                   /db_xref="UniProtKB/TrEMBL:D2B159"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83466.1"
FT                   /translation="MTLRSTGQWFWASGAGGGRGLPARRRDRTLAAMVVFASVVGCAVA
FT                   LTAYRALTSDADAYFASHRQITAQVLSIDDRSPAISRRAGTRAEVAWVDGSGVRHTGTT
FT                   RLRGDQTEEARVRIWIDGGGRPAPPPLGPAGFIVSPLLLGLFAAGATWSVMLLAESGRR
FT                   VWIARHAMAGWDREWRAQTDLER"
FT   gene            complement(444696..445526)
FT                   /locus_tag="Sros_0440"
FT   CDS_pept        complement(444696..445526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0440"
FT                   /product="Diaminopimelate decarboxylase-like protein"
FT                   /note="KEGG: bar:GBAA1438 diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83467"
FT                   /db_xref="GOA:D2B160"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D2B160"
FT                   /inference="protein motif:COG:COG0019"
FT                   /protein_id="ACZ83467.1"
FT                   /translation="MCVLEQSLESQMPSVTVTARGPWSATTRFEADGDATAGGVSLVEI
FT                   STRFGTPAYVLDETDVRERCRAYRAALPDAEIAYAAKAFLCRAMAGWVREEGLGLDVCS
FT                   GGELTFACSIGFPADRIIFHGNAKTPQELRGAVAAGVGRIVVDNLAEINRLAALIPAGR
FT                   RQKVLLRVIPDIEGGAHEATRTGGEDQKFGLSVATGAAGQAVTRVLGQPSLKLAGLHCE
FT                   AGDTIAEDVELPADIRPGDVIVVAATGAYHHSMASTYNMTARPSSPSPAGRQGW"
FT   gene            complement(445526..445783)
FT                   /locus_tag="Sros_0441"
FT   CDS_pept        complement(445526..445783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83468"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="UniProtKB/TrEMBL:D2B161"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83468.1"
FT                   /translation="MSEAPLYVPVREGAFISLRLFKTASGKPAAVAFSSPARLARVLGA
FT                   DQRWIRLSEPALRSMIGDLTGVGVAIDPAGTMTRLSSQVA"
FT   gene            complement(445985..446644)
FT                   /locus_tag="Sros_0442"
FT   CDS_pept        complement(445985..446644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pzu:PHZ_c0624 SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83469"
FT                   /db_xref="GOA:D2B162"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2B162"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83469.1"
FT                   /translation="MAVRIRDHGDPSDTRNRLGSGMEQFHHPRPVCTGVGNGLRPTPQR
FT                   VRLLAGLTGRVLEIGAGDGIKLTCFPTGLDEIVLVEPDPFLRAAAQTPAAGVSTPVRIL
FT                   DGTPTRLPVPDASCDAVICSLVLCCVVRPEATLSEVRRVLRPGGELRFYEHQRSGSPVV
FT                   SLIEVMAGPLWARVCGGCRPASDVVTAIGRAGFGIERLDRVPFRRVSHVLGVARPA"
FT   gene            complement(446883..447320)
FT                   /locus_tag="Sros_0443"
FT   CDS_pept        complement(446883..447320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83470"
FT                   /db_xref="GOA:D2B163"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D2B163"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83470.1"
FT                   /translation="MEDFKRALGFDPEKTARDAHRFFDRVQELHRAAGDLTARAESDDR
FT                   RVSVEYSSSGGLRRIDIDPRAMRMPSGELAETILELVHRAQRDVEVQAGERAAEVLEAD
FT                   NRLITDRQTAGDRLRDATGTLQENLRAATETIERLRGMIRR"
FT   gene            complement(447323..448234)
FT                   /locus_tag="Sros_0444"
FT   CDS_pept        complement(447323..448234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83471"
FT                   /db_xref="GOA:D2B2J4"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2J4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83471.1"
FT                   /translation="MFDGGAELAKLSLQVGTGAALTLSALGAPGAWPFVAKMYVHQYSP
FT                   DAFWEGAEVWSGVAADVRAARERIGDLVAGVSGNGWRSQDGRAFQRRMDAFLDELLSIE
FT                   IRASLVAAVLYMSAVALAAMIMFVWLVAAAMAAIAAWVLLAAVSPLSVASARILALNVL
FT                   MKMFSGFEAVESGLDTLLHTCAGLLGATIAGDVFVEAVNGDHSAVTDFAQATVSQGPLL
FT                   IWGTANRAERDLTAHGIDGRFPGGGFWGDRAGSRAGLPLPPGLTQFAGVKGVSDVSGGR
FT                   QTVTGPHVPEQDPDGSYDYPWE"
FT   gene            complement(448274..448747)
FT                   /locus_tag="Sros_0445"
FT   CDS_pept        complement(448274..448747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83472"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2J5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83472.1"
FT                   /translation="MGETGNATSHAHPSEPAWNGGTSPWAGAPFRERGEGADRPRGHTP
FT                   SPWQGDPFTPPPPAAPHEVEIERERLRAIMESLSEAAGPVDKVIQGIVGLTVAESAFTS
FT                   FTYSLAVAYSEVEAFTLQELRRKTEDTVEMAEMVGVSAGNWTGAEHAGTVKAV"
FT   gene            449137..449877
FT                   /locus_tag="Sros_0446"
FT   CDS_pept        449137..449877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0446"
FT                   /product="Osmosensitive K+ channel histidine kinase-like
FT                   protein"
FT                   /note="KEGG: bur:Bcep18194_B2380 periplasmic sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83473"
FT                   /db_xref="GOA:D2B2J6"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2J6"
FT                   /inference="protein motif:COG:COG2205"
FT                   /protein_id="ACZ83473.1"
FT                   /translation="MPRYLDRDRIAIVAAVVVPLVVSAILVPFRESFSNTNVALVLVVT
FT                   VVAVAANGHRLAGALAAVSAAVWFDFFFTRPYQRFTITKSADVQTAVLLLVVGLAVSQL
FT                   AARARRLHLVAITDAGYLARLHDTAELAQSTKSPDTVVDHVAAQLTDLLGLRGCRFEYG
FT                   SLIGHPPRLEQDGTVIWDRRRWDVERLGLPDREVELRTFGNGHFYGRFMLDPTPGTIPS
FT                   LQARLVAVTLADQVGAALDTAGNG"
FT   gene            complement(450039..450719)
FT                   /locus_tag="Sros_0447"
FT   CDS_pept        complement(450039..450719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0447"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: mmr:Mmar10_0702 TetR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83474"
FT                   /db_xref="GOA:D2B2J7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2J7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83474.1"
FT                   /translation="MGRPSQHDIDRLLDVAAELVAAGGPSTVTVSAVARAARAPSGSIY
FT                   HRFPGRSAMLAALWLRTTERFQEGFLAALATDPPARAVLDAARHVVTWSRAHPDETQIL
FT                   LYGPADFDGPNWPAEARERLAQGNGRVTSALRDLARRLGRDEPHDVERLLLATVDLPYA
FT                   TVRRHHRSGEPIPPYAEDLVTGCAAALIADLPEPAAPASGRRPQKDPGEYAVAQGAAMP
FT                   LQPE"
FT   gene            complement(450888..451418)
FT                   /locus_tag="Sros_0448"
FT   CDS_pept        complement(450888..451418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0448"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bac:BamMC406_2782 ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83475"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2J8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83475.1"
FT                   /translation="MSRSLKITRVLLVAAFAAGLTACSGEGDPSAPPTTPAASASAAGA
FT                   ETASTPTAPAASASSSGPATPAASAEPTAAAPGDGAGDTGPALDLIGALSASPTQPGWI
FT                   TVQLDAGDSQPVMLSPEAVVLDLRGAICDKGAVPHKCTAAQLEKALKKGGVPYAKVTLK
FT                   NGVAVRIEELVQK"
FT   sig_peptide     complement(451344..451418)
FT                   /locus_tag="Sros_0448"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.643 at
FT                   residue 25"
FT   gene            451633..452127
FT                   /locus_tag="Sros_0449"
FT   CDS_pept        451633..452127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83476"
FT                   /db_xref="GOA:D2B2J9"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2J9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83476.1"
FT                   /translation="MSTQHAPQSAIRPSAVPAAVRTASALWFTAVGAGAFEAALAVAGV
FT                   LADGSASPADLAPGLGLRLAVFAAAIFMAVRLRQGRPWSRIALALTLGVFGTVSLVIEP
FT                   VRWLLDGHSIGQAVADADAMAFVFAGSRIVHLVAVLSAMAMMFSPEANACFRGASRSPR
FT                   G"
FT   gene            452200..452811
FT                   /locus_tag="Sros_0450"
FT   CDS_pept        452200..452811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: atc:AGR_L_1193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83477"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2K0"
FT                   /inference="similar to AA sequence:KEGG:AGR_L_1193"
FT                   /protein_id="ACZ83477.1"
FT                   /translation="MPRTETPWGPWEPAPLAEVVELFTGLAAPWWVSGGYAIELAVSRA
FT                   YREHADVDISVLRRDHRTVRRLLAGWDCWAADPPGTLRPWPVDEPLPPGVHDVWVREGE
FT                   GGPWRFQLMLDESDGDQWVYRRDPRIRRPLESCTATAGGGFPRIAPEIQLLYKAEDPRP
FT                   KDEIDFTQVLPRLAEAQKRWLDEALATEHGAHPWRDRLRS"
FT   gene            complement(453125..454261)
FT                   /locus_tag="Sros_0451"
FT   CDS_pept        complement(453125..454261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0451"
FT                   /product="Microsomal epoxide hydrolase"
FT                   /EC_number="3.3.2.9"
FT                   /note="KEGG: bja:bll7368 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83478"
FT                   /db_xref="GOA:D2B2K1"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2K1"
FT                   /inference="protein motif:PRIAM:3.3.2.9"
FT                   /protein_id="ACZ83478.1"
FT                   /translation="MTPFRIDIPQADLDDLRDRLSRTRWPRQLPGDGWSRGVPVDYLRD
FT                   LVDHWAGGYDWRAQEARLNRFPQFVTGIDGLDVHFLHVRSPEPDALPLILTHGWPNSFV
FT                   EFVDLIGPLTDPRAYGADPAHAFHVVVPSVPGFGFSQAPPRTGFTVDRVARMWAELMAR
FT                   LGYDRYGTQGGDLGAYIAPAVAAADPEHVVGVHIDGGFGFPTEADVPDMNDAERAEWQM
FT                   MQQWMSGGVDHHALLRAAPQTFAYAWNDSPVGLLAWLINKFKEFSITVDTPEQAIDRDL
FT                   MLTNASLYWFTGTSGSSSWPMYDRVTLAEDGGFAWPKGQNRVPSGVYGGGSALMRRLAE
FT                   RDNKIVHWPEGNSGGHFVAMEVPQDHAADIRAFFGMLR"
FT   gene            complement(454407..455381)
FT                   /locus_tag="Sros_0452"
FT   CDS_pept        complement(454407..455381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0452"
FT                   /product="helix-turn-helix type 11 domain protein"
FT                   /note="KEGG: bpy:Bphyt_3694 helix-turn-helix type 11 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83479"
FT                   /db_xref="GOA:D2B2K2"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2K2"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_3694"
FT                   /protein_id="ACZ83479.1"
FT                   /translation="MRADRLVSLVLLLRRHGRLSAAALARELEVSTRTVLRDIEALSAA
FT                   GVPVYAERGRHGGFALLPGFRTELTGLNPDEALALLVAGSRRGAQAFGLGSALASAMLK
FT                   VVDALPESYRDTAAGAAERLLIDPEADLLSRRLVDEEVPDAMVAEVLRAVFAGHKLRIH
FT                   YAAADQAPQWRTVDPIGLVTVRDRGYLLATRSGADRTYRLSRVLAAEELAEPAQRPDRV
FT                   DLGRAWQERSTRFRSGGDQVTVLVRMDPARREELVGTALAVLAEEADSDGRLRLEVTFQ
FT                   DPRHAEWALWQLTTDAEALAPQWLRNSLRDRAAAIATRYGVSS"
FT   gene            455517..455912
FT                   /locus_tag="Sros_0453"
FT   CDS_pept        455517..455912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0453"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="KEGG: mch:Mchl_5535 endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83480"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2K3"
FT                   /inference="similar to AA sequence:KEGG:Mchl_5535"
FT                   /protein_id="ACZ83480.1"
FT                   /translation="MERTAVNPWAWSVEMGYNQGEIISGHTRTLYCAGQTAMSGDGKPQ
FT                   HADDMAAQLALSLDNLEAVLGEAGMSLANLVRLNVYTTDADRLFEHYGVLASRLGAAGV
FT                   APSTTMLGVTRLAIPDLMVELEGTAVA"
FT   gene            complement(456113..456925)
FT                   /locus_tag="Sros_0454"
FT   CDS_pept        complement(456113..456925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0454"
FT                   /product="aminoglycoside 3'-phosphotransferase"
FT                   /note="KEGG: bcj:BCAM0928 aminoglycoside 3'-
FT                   phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83481"
FT                   /db_xref="GOA:D2B2K4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR024165"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2K4"
FT                   /inference="similar to AA sequence:KEGG:BCAM0928"
FT                   /protein_id="ACZ83481.1"
FT                   /translation="MSRPVIAEIPTGPVTVPDVVAALAGGDTVTPVWRNELGGLTFRLE
FT                   DGRGGTRYAKWIAAGTPEIDLPAEAERLAWAQRWATVPRVIEHGTDADGAWLVTEAVPG
FT                   RSAVDPRWIADPATAAAAIGRGLRLLHDVLPVEQCPFDWSIDRRLARADERIADGEEPA
FT                   GWSPEHRHLDLAKARARIGEPPAIDRLVVCHGDACVPNTLLHDDGTFAAHVDLGSLGVA
FT                   DRWADLAVTAWSTEWNYGPGYDGILYDAYGITPDPERIAYYRLLWDMA"
FT   gene            complement(457099..457416)
FT                   /locus_tag="Sros_0455"
FT   CDS_pept        complement(457099..457416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0455"
FT                   /product="multidrug resistance protein SugE, putative"
FT                   /note="KEGG: rce:RC1_2954 multidrug resistance protein
FT                   SugE, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83482"
FT                   /db_xref="GOA:D2B2K5"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2K5"
FT                   /inference="similar to AA sequence:KEGG:RC1_2954"
FT                   /protein_id="ACZ83482.1"
FT                   /translation="MAWALLFVAAVLEIVWATALERSDGFTRPWPTFIGVTTAVLSFVM
FT                   LTFALKTLPMGTAYAVWVGLGALGVAVVGIAALGESAAPARLACLALILIGVIGLKLLD
FT                   G"
FT   gene            complement(457422..458153)
FT                   /locus_tag="Sros_0456"
FT   CDS_pept        complement(457422..458153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0456"
FT                   /product="short-chain dehydrogenase"
FT                   /note="KEGG: scl:sce8812 short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83483"
FT                   /db_xref="GOA:D2B2K6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2K6"
FT                   /inference="similar to AA sequence:KEGG:sce8812"
FT                   /protein_id="ACZ83483.1"
FT                   /translation="MTRRVALVTGGSRGIGAAIAVRLAAEGADVVITYARSADRAAEVV
FT                   GQIEAAGARGLAMAADSADAGALVAAVERTVAEFGRIDIVVSSAGIAPFGPLEEVTLAE
FT                   VDNTLAIHARASFVLAQAAARHMGPGGRIICIGSSFVERVPYPGWTLYAMSKSALIGLT
FT                   KGLARDLGPRGITANLVHPGSTDTEMNPADSPEAAEERRYTALDRYCSPDDIAATVAHL
FT                   AGEGGRNITGAAITVDAGTTA"
FT   sig_peptide     complement(458079..458153)
FT                   /locus_tag="Sros_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.838) with cleavage site probability 0.569 at
FT                   residue 25"
FT   gene            458248..458691
FT                   /pseudo
FT                   /locus_tag="Sros_0457"
FT   gene            complement(458979..459052)
FT                   /locus_tag="Sros_R0007"
FT                   /note="tRNA-Pro3"
FT   tRNA            complement(458979..459052)
FT                   /locus_tag="Sros_R0007"
FT                   /product="tRNA-Pro"
FT   gene            complement(459086..460009)
FT                   /locus_tag="Sros_0458"
FT   CDS_pept        complement(459086..460009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0458"
FT                   /product="metallophosphoesterase"
FT                   /note="KEGG: msl:Msil_1866 metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83484"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2K7"
FT                   /inference="similar to AA sequence:KEGG:Msil_1866"
FT                   /protein_id="ACZ83484.1"
FT                   /translation="MRKAAAVPLSLLGVGMAGLAYASVVERNAFRLRRFDVPVLEPGQR
FT                   PVRILHLSDLHLTPGRRMLIDWVRSLGDLKPDLVVNTGDTIAHPDAVGPLLHALEPLLS
FT                   RPGLFVYGSNDLYAPRPKNPVRYLWRTSKGDHGQTIPSLPWQELGAGMAVEGWLDMNNT
FT                   TARIKVGDLDVAVGGIHDSHINLDRYDMIAGPAPEEADLRLGVMHSPEPRNMTRFASDG
FT                   YQLLLAGHTHGGQLCIPFYGALVTNCGIDRARVKGLSRHDSAYLHVSAGLGTSPYAPAR
FT                   FACFPEASLLTLVPRRRSDASTREVR"
FT   sig_peptide     complement(459941..460009)
FT                   /locus_tag="Sros_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            460081..460545
FT                   /locus_tag="Sros_0459"
FT   CDS_pept        460081..460545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0459"
FT                   /product="GatB/YqeY domain protein"
FT                   /note="KEGG: vfm:VFMJ11_2362 GatB/YqeY domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83485"
FT                   /db_xref="GOA:D2B2K8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2K8"
FT                   /inference="similar to AA sequence:KEGG:VFMJ11_2362"
FT                   /protein_id="ACZ83485.1"
FT                   /translation="MDRMSTLKDKLKTDLTASMKSRDEVRTRTIRMALAAVNVEEVAGK
FT                   TARELSDDEIIKVLTKEAKKRREAAEAFSGAGRTEQAQAEVDEQAVLEEYLPAQLSDEE
FT                   LGKLVDEAVAETGAAGPQAMGQVMKVLNPKVAGRAEGGRVAQAVRARLSA"
FT   gene            complement(460950..463184)
FT                   /locus_tag="Sros_0460"
FT   CDS_pept        complement(460950..463184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0460"
FT                   /product="multimodular transpeptidase-transglycosylase"
FT                   /note="KEGG: sat:SYN_00304 multimodular transpeptidase-
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83486"
FT                   /db_xref="GOA:D2B2K9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2K9"
FT                   /inference="similar to AA sequence:KEGG:SYN_00304"
FT                   /protein_id="ACZ83486.1"
FT                   /translation="MQAQGKDQKSAFGNVLRLVAASAATGVLVAAIALPAVGGAGMTVK
FT                   SATEELHLLPEELSEPPLAEKTTLLDADGKQFAQFYYENRESVALDEVADIMKTAIVSI
FT                   EDFRFYEHGAIDLEGTFRAAVKNTTGGGDIQGGSSITQQYVKQVLVNSAETKEEQKAAI
FT                   APTFSRKLNELRYAMAIEEKYTKPEILERYLNISYFGAGAHGIQAASKRFFGKPASKLN
FT                   LWEAATLAGAVQNPSGTDPNAGKASRQRLLDRRNTVLDRMKELGKITEQEATEAKAKKL
FT                   GFKDTPVPGGCDESAYPYFCLYAQYEMLNNEQFGKTASLRKKQLQRGGLTIKTTLDLQA
FT                   QKASEKAIKEYVKTSDHPVAAQAMVVPGTGAIKAMAASRKFGQNKKKNEMSYNLAADVM
FT                   HGGGAGFQAGSTFKPFTLLTALDKGMKLNDGNTTGAGYRAPSTSSFRDCEGNRVGDPGH
FT                   EVRNSSEGGGGFKSLTTGTLGSVNTFFLKLEEQVGLCDVVKMAKKLGIKRADGAKLKEF
FT                   ETFTLGINEMDPVTVSAAYATIAARGTYCKPMAITEIRDRNGKATPYKPKCSQVLDEEV
FT                   ADAATHIMSGVFTKGTMTEVGGIGRPAAGKTGTTDGYTAAWFAGFTPDLASAVSLGDPR
FT                   GAFKHDLVNVTIGGRGYSYVYGASISGRIWKYSMLGALKGIDPSSFTPVNMSRFGGCSG
FT                   LCAPPPTRKPGTTDGNGPGTDDGNIVITGDGNGGFMNEGDIGDNSIPVVP"
FT   sig_peptide     complement(463068..463184)
FT                   /locus_tag="Sros_0460"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.698) with cleavage site probability 0.472 at
FT                   residue 39"
FT   gene            463450..463746
FT                   /locus_tag="Sros_0461"
FT   CDS_pept        463450..463746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0461"
FT                   /product="transcription factor WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83487"
FT                   /db_xref="GOA:D2B2L0"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2L0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83487.1"
FT                   /translation="MWITDWTSRAACKGADPDALFVQGAAQNRAKLICRGCPVRTECLA
FT                   DALDNRIEFGVWGGMTERERRALLRRRPDVDSWRDLLELAKEEYERTNELIAG"
FT   gene            complement(463934..465103)
FT                   /locus_tag="Sros_0462"
FT   CDS_pept        complement(463934..465103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0462"
FT                   /product="anion-transporting ATPase"
FT                   /note="KEGG: mxa:MXAN_5818 anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83488"
FT                   /db_xref="GOA:D2B2L1"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2L1"
FT                   /inference="similar to AA sequence:KEGG:MXAN_5818"
FT                   /protein_id="ACZ83488.1"
FT                   /translation="MTERSERSGRQRTVPVLDLDAIIDDPGTRIIVCCGSGGVGKTTTA
FT                   AALGLRAAERGRSAVVLTVDPARRLAQSMGLTELDNTPRPVAGVEGEGRLHAMMLDMKR
FT                   TFDEIIEAHADPERARQILTNPFYQSLSSSFSGTQEYMAMEKLGQLRRSGDWDLIIVDT
FT                   PPSRSALDFLDAPERLGRFLDGRLIRLLMAPAKAGGRSAFKLLNAGFGIVAGAMTKLLG
FT                   AQVLKDLQTFVSALDAVFGGFRVRAEQTYRLLQAPGTAFVVVAAPERDAMREASYFVER
FT                   LAEERMPLAGLVVNRVHLAPAAMLSAARSTAAAEDLESRGEHELTAAVLRLHAGRMQLA
FT                   AREHREQEHFLSAHPTVPVAQVPAMPEDVHDLEGLRRVGELLAAQRDLG"
FT   gene            complement(465100..466182)
FT                   /locus_tag="Sros_0463"
FT   CDS_pept        complement(465100..466182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0463"
FT                   /product="chromosome partitioning-like ATPase"
FT                   /note="KEGG: afw:Anae109_0972 chromosome partitioning-like
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83489"
FT                   /db_xref="GOA:D2B2L2"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2L2"
FT                   /inference="similar to AA sequence:KEGG:Anae109_0972"
FT                   /protein_id="ACZ83489.1"
FT                   /translation="MTIHTCSPVSAQPRRIVRWLLGSLRNVRARDTDWDGVRLHVVTGK
FT                   GGTGKTTVAAALALALAADGRKVLLVEVEGRQGIAQVFDLPPLPYEERKIAVAPGGGDV
FT                   YALAIDPEEAMLDYLEMFYGMRRAGKALTKMGVVDFATTIAPGFRDVLVTGKTSEAVRR
FT                   KGKDGRRIYDAVVLDAPPTGRITRFLGVTNEVAGLARVGPIKNHADLVNGVVASPETAV
FT                   HFVTLLEEMPVQETLDGLDELRTAGLPPGGIFTNMVRESLLPASVLDDVGKDRFDPAEL
FT                   ALGLKASGLADGSSDAAAVAEALAEEIAEHAHRTELERRERLSLSRAGRPRYELPLLAD
FT                   GVDLAGLYELAESIHTQGAA"
FT   gene            466362..466517
FT                   /locus_tag="Sros_0464"
FT   CDS_pept        466362..466517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83490"
FT                   /db_xref="InterPro:IPR025234"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2L3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83490.1"
FT                   /translation="MTKWEYSTVPLLVHATKQILDNWGQDGWELVQVVPGPNPEQLVAY
FT                   LKRPKQ"
FT   gene            466514..466972
FT                   /locus_tag="Sros_0465"
FT   CDS_pept        466514..466972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhe:BH06200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83491"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2L4"
FT                   /inference="similar to AA sequence:KEGG:BH06200"
FT                   /protein_id="ACZ83491.1"
FT                   /translation="MSAEERLAELGLTLPEVVAPLAAYVPSVRSGDYVYTSGQLPVVDG
FT                   KLAATGKVGAEVSPEEARELARICALNALAAAASAAGGLSNIVRIVKVVGFVASDPAFS
FT                   GQPQVVNGASELLVEVLGEAGKHARSAVGVAVLPLDAPVEVELIAEVR"
FT   gene            467045..467872
FT                   /locus_tag="Sros_0466"
FT   CDS_pept        467045..467872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0466"
FT                   /product="NUDIX hydrolase"
FT                   /note="KEGG: rpa:RPA3189 NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83492"
FT                   /db_xref="GOA:D2B2L5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2L5"
FT                   /inference="similar to AA sequence:KEGG:RPA3189"
FT                   /protein_id="ACZ83492.1"
FT                   /translation="MGGIPLPGEFGERARDILAGRLVPVPARDAATVVILREGVEVYLL
FT                   RRKASMAFAAGAYVFPGGSVDPRDADHAIAWAGPSPAEWGAVFRADERIARGLVCAAVR
FT                   ETFEESGVLLAGPSPESVVADTTGDDWEADRLALIDRSLSFADFLDGRGLVLRSDLLRP
FT                   WAHWITPEVEHRRFDTRFFVAALPPGQRTRDVGGEADQVAWARPADAVDQAKNGQIFLM
FT                   PPTYRTLGELRDYRTVAEVLAAEREIVSLMPGIAEVDGEMCIVLDDDYGFGPS"
FT   gene            467943..468731
FT                   /locus_tag="Sros_0467"
FT   CDS_pept        467943..468731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0467"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="KEGG: pzu:PHZ_c2735 metallo-beta-lactamase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83493"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2L6"
FT                   /inference="similar to AA sequence:KEGG:PHZ_c2735"
FT                   /protein_id="ACZ83493.1"
FT                   /translation="MSGLRIPLDGPDGSGTDHALSLLAPNPSPMTLDGTNTWVIGRGEE
FT                   VLVVDPGPDDGPHLRRVADRLRGRRVTTILLTHGHHDHSGGAKGFAELVRAPVRALDPG
FT                   HRLGDEGLADGDVLTVGGLELHVVGTPGHSFDSLCFWLPEDRAMLTGDTVLGRGTTVIA
FT                   PDGDLADYLRSLDRLRATAERVGAEALLPGHGPVLPDPIGALDGYIAHRRQRLDQIRSA
FT                   REQGARTPAEIVEIVYADVDRSLWPAAEMSVRAQLAYLDG"
FT   gene            complement(468760..469440)
FT                   /locus_tag="Sros_0468"
FT   CDS_pept        complement(468760..469440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0468"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="KEGG: bra:BRADO5298 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83494"
FT                   /db_xref="GOA:D2B2L7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2L7"
FT                   /inference="similar to AA sequence:KEGG:BRADO5298"
FT                   /protein_id="ACZ83494.1"
FT                   /translation="MNTDDVLGKAPLFSALDREGAAALRTSVSEVELSKGQTLFSENET
FT                   GDRLYVVLEGKIKLSRTAPDGRENLLSVLGPGEMFGELSLFDPRPRTASATALTDVRLA
FT                   GLGHDDLRPWLTGRPEVALHLLRALAQRLRRTNDVLADLVFTDVPGRVAKALLDLAERF
FT                   GQRIDDGVRVHHDLTQEELAQLVGASRETVNKALADFAQRGWLRIEAKAVVIMDLERLH
FT                   NRSR"
FT   gene            469522..470247
FT                   /locus_tag="Sros_0469"
FT   CDS_pept        469522..470247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0469"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: pca:Pcar_0009 endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83495"
FT                   /db_xref="GOA:D2B2L8"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2L8"
FT                   /inference="protein motif:PRIAM:4.2.99.18"
FT                   /protein_id="ACZ83495.1"
FT                   /translation="MQVPRNVGRAGESPLALVRRARRMDRILAETYPDAHCELDFRNPL
FT                   ELLVATILSAQCTDKRVNMVTPTLFAKYRTAEDYAGADRAEVEDIIRSTGFFRAKTNSI
FT                   VGMAQALCDRYGGEVPGKLKDLVTLPGVGRKTANVVLGNAFGVPGITVDTHFQRLVHRF
FT                   HWTEETDPVKIEHIVAGLIPKRDWTMMSHRLIWHGRRMCHARTPACGVCPLAALCPSYG
FT                   IGPVAPAQAAKLVRPGPFS"
FT   gene            470312..470953
FT                   /locus_tag="Sros_0470"
FT   CDS_pept        470312..470953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0470"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_2177 NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83496"
FT                   /db_xref="GOA:D2B2L9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2L9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83496.1"
FT                   /translation="MEVPGWLETLAERVARTPVPPPLRPPGSGGRPAAVLMLFGEGPLG
FT                   PDVLLIQRSSRGRRHAGQPAFPGGGVDPEDGGPIPAALREAREETGLDPAGVQVVGTMP
FT                   ELYVWRSDNRVTPVLGWWHTPSVVHAASPDEVEAVERVPISELVDPANRLRLRHPKGPS
FT                   GPAFRVRGLLVWGFTAGVLDGVLTASGFELPWDRSRIEDLPPDVLNLASR"
FT   gene            complement(470903..471454)
FT                   /locus_tag="Sros_0471"
FT   CDS_pept        complement(470903..471454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0471"
FT                   /product="conserved hypothetical protein, PBS lyase
FT                   heat-like repeat protein"
FT                   /note="KEGG: cti:RALTA_B2024 conserved hypothetical
FT                   protein, PBS lyase heat-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83497"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2M0"
FT                   /inference="similar to AA sequence:KEGG:RALTA_B2024"
FT                   /protein_id="ACZ83497.1"
FT                   /translation="MATIGGSAAVESLIETALRDQDHDGTIRWQAIAVLHARGDLETFT
FT                   AARRLCAGETASERMLGVDILGRLGFTDRSLPVLRYLATSEDDCMVLYSVLIAFGHLRD
FT                   RRALPSVIALGEHADPRVRYGAAYALPNIMGNPPDPMGLAALRRLSRDPDHDVADWARL
FT                   GLALSTGGEVEDVRRQILDP"
FT   gene            471527..472726
FT                   /locus_tag="Sros_0472"
FT   CDS_pept        471527..472726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0472"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsk:RSKD131_1684 protease Do precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83498"
FT                   /db_xref="GOA:D2B2M1"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2M1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83498.1"
FT                   /translation="MSGDLLDLILIALMVAFAVSGYRQGFIIGALSFVGFVGGGLLGIF
FT                   IAPPIAGAFVDGETERALLAIVIVFLTATIGQFASSTIGAVVRSHVTWEPAKVVDAVGG
FT                   TFASAFSVLIIAWLIGSLISSSQFTLLSEQVNKSLLISTVDQAMPKAAKDFQKPFKDFI
FT                   DTSGFPKVFDAIGAGQLVEVEPPDKSVPKGAQLSRARRGIVKVQGVASSCRRHIEGTGF
FT                   VYSQNKIMTNAHVVAGVDQELQVTDYLNNAHAAKVVLYNPDRDIAILHVPGLNMPILRF
FT                   DGTAKKGDDAIVAGFPHGEGFTMNAARIRVQQKARGLNIYERKTVVRDVYAIRGLVRQG
FT                   NSGGPLLTPDGRVYGVVFAAALDQQETGYVLTAAEVSPDAEDGSKLFNRVDTQECDQNS
FT                   "
FT   gene            complement(472723..473172)
FT                   /locus_tag="Sros_0473"
FT   CDS_pept        complement(472723..473172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0473"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dvm:DvMF_2231 protein of unknown function
FT                   DUF309"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83499"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2M2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83499.1"
FT                   /translation="MTARDRDPDGRPRNQRPRDAFGRPLPHGAEGVERVPDDYAPSAEE
FT                   ALAEARRLLGESRPFHAHEVLEGRWKTAPEEERELWQGLAQICVGLTHLQRGNRRGAAA
FT                   LFARGAGRISRYGPPYEEIALTARELGGAGDPDPGAAIAAIRGLL"
FT   gene            complement(473301..474224)
FT                   /locus_tag="Sros_0474"
FT   CDS_pept        complement(473301..474224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0474"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="KEGG: ank:AnaeK_0555 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83500"
FT                   /db_xref="GOA:D2B2M3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2M3"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0555"
FT                   /protein_id="ACZ83500.1"
FT                   /translation="MSRPDESLVRIEGPWTHRAVHAGGTRFHIVEAGKGPLVLLLHGFP
FT                   QFWWSWRNQLVSLPAAGYRAVAVDLRGYGASDKPPRGYDLPTLAGDAAGLIRALGETGA
FT                   IVVGHDWGGLLAWTMSVLDPKAVLRLVPVSAPHPLRLRSALFGDPFGQLRASSYALGFQ
FT                   LPFLPERRLTANDGAMVGRLLDRWSGPSWPEEEVAKTYRDVFRIPTVSHCALEYHRWFA
FT                   RSQLRPDGLRYARRMRSEIDAPTLQLHGALDRHVLPRTAQGSGRYVAAPYRWRLIEGAG
FT                   HFPHEERPEEFDAELIGWLSDPEPDR"
FT   gene            complement(474221..474694)
FT                   /locus_tag="Sros_0475"
FT   CDS_pept        complement(474221..474694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0475"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: jan:Jann_2210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83501"
FT                   /db_xref="GOA:D2B2M4"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2M4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83501.1"
FT                   /translation="MTLNPPTEPQEESLGALVAAASDQISTLVRAEIELAKSELKFDAK
FT                   RAGVAAGLFGAAAFMAHLCLILASFAIAYALVGLGVWTWLAFTIVTVFYLIVAGLLAFL
FT                   GVRRLKGLTGMKRTLRSLRTIKSGESELSLAAPPAPPGAGQVGSHREPVSPGQ"
FT   gene            complement(474721..475947)
FT                   /locus_tag="Sros_0476"
FT   CDS_pept        complement(474721..475947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0476"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="KEGG: rfr:Rfer_2582 Na+/H+ antiporter NhaA"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83502"
FT                   /db_xref="GOA:D2B2M5"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2M5"
FT                   /inference="similar to AA sequence:KEGG:Rfer_2582"
FT                   /protein_id="ACZ83502.1"
FT                   /translation="MRRAVEIWPFRPSLRYARQLAEALRAETVGGVVMLLATVAALVWA
FT                   NVSTDSYEALRNARFGPDFLHLDMELYKWVQNGLLTVFFFIAGIEVKEEFVHGELAQLR
FT                   KAALPIVASIAGMVVPALIYLVVSWGVPGAGRGWAIPTATDIAFALAVLAVTASALPAA
FT                   LRAFLLTSAVVDDLGAITVIAVFFTRNLNLLALLAGVAVIALYGLLQARRVRGLWIYLP
FT                   LALLAWYLVEISGVHATVAGVALGLMTRVHSGPGEESSPAELADHYIRPFSAGFAVPVF
FT                   AFVSAGVVLSAGSLGAMATDRVVLGVIAGLVVGKFLGVFGGAWLAVRLGLAKLSDELHW
FT                   RDMAAVSILAGIGFTVSLLIGDLAYGDDPGRVDAVTTGVLLASLTASVVAAVLLRVRVR
FT                   NHLSAQDDV"
FT   gene            complement(476184..478169)
FT                   /locus_tag="Sros_0477"
FT   CDS_pept        complement(476184..478169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0477"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /note="KEGG: aba:Acid345_3520 acetyl-coenzyme A synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83503"
FT                   /db_xref="GOA:D2B2M6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2M6"
FT                   /inference="similar to AA sequence:KEGG:Acid345_3520"
FT                   /protein_id="ACZ83503.1"
FT                   /translation="MAPETPGSESRETQETLSNLLHETRRFAPPADLAAAANVTADAYA
FT                   EAEQDRLAFWEKQADRLTWSKRWDTTLEWNPPFAKWFVGGELNIAYNCVDRHVEAGRGD
FT                   KVAYHWEGEPEGDSRTLTYSDLQREVAKAANALQELGVGKGDRVAIYMPMIPELPITML
FT                   ACARIGAIHSVVFGGFSAAALSGRIQDADAKVVVTADGGYRRGAPSALKPTVDEALKEC
FT                   PSIEHVLVVRRTGQEVSQTEKDVWWHDIVDRQADVHEAQPNDAEDPLYILYTSGTTGRP
FT                   KGILHTTGGYLTQVAYTHHAVFDLKPDTDVYWCTADIGWVTGHSYIVYGPLANGATSVI
FT                   YEGTPDTPHRGRFWEIVQKYKVTILYTAPTAIRTFMKWGDDIPAKYDMSSLRILGSVGE
FT                   PINPEAYVWYREHIGKDRAPVVDTWWQTETGGIMISPLPGVTSGKPGAAMRPLPGISAD
FT                   VVDDQGNTVGNGGGGFLVLREPWPSMLRTIWGDDQRYIDTYWSRFEGMYFAGDGAKKDE
FT                   DGDLWLLGRVDDVMLVSGHNISTTEVESALVSHPKVAEAAVVGATDPVTGQAIVAFVIL
FT                   RGNAEEGADIAAELRNHVAKSLGPIAKPRQILVVPELPKTRSGKIMRRLLRDVAENRSV
FT                   GDVTTLADSTVMNLISEKLPSTKSDD"
FT   gene            478487..479260
FT                   /locus_tag="Sros_0478"
FT   CDS_pept        478487..479260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0478"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acp:A2cp1_0593 filamentation induced by cAMP
FT                   protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83504"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2M7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83504.1"
FT                   /translation="MSDPLAVIAELPGVPEAVTDARKAVDRLYGHRVLRRKSPEVSARS
FT                   ALRGARASAALDGVDVPLEAIPEVTDPVVQGALRVSAELGRLGPTWRAAPRQVLARLHT
FT                   LAAAGLTEHLGRPRGAAEAPDLLGLGAAPGPEETVARVDGLVELVTGTSKAPALVLAAI
FT                   VHAELAVLRPFGSADGVVARAAERLTLVEFGLDPKSLAAVELGHLELGAAYPESLKAYL
FT                   SGTPDGVAVWVRHCASAVTLGVREATAICEAMQRG"
FT   gene            480519..481565
FT                   /locus_tag="Sros_0479"
FT   CDS_pept        480519..481565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0479"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pzu:PHZ_c2999 pilus assembly protein CpaE"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83505"
FT                   /db_xref="InterPro:IPR017746"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2M8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83505.1"
FT                   /translation="MDRPLVITEDHDLLDDLLRVAAAAGAELDVAHVPAHARPHWNRAP
FT                   LVVVGSDMADALAATGPPPRHRVILVTRTPDDPDTWRKCVTVGAQAVLELPSAERQLVD
FT                   EFADVVEPEARAGLVVCVAGGRGGAGASVLATSLALSASRRHLRTLLVDADPLGGGLDL
FT                   LLGQEEADGARWSDLVAREGRVSFTALQAALPTFAELTLLSFHRGEVEPIPAEAMRSVL
FT                   EAGRRGFDLVVVDLPRHPDQAAVEALSRASTTLLVVTADVRGVLAAAQVLAGLRKHTGE
FT                   VHAVVRGGVLDDEVVTASLRVPYAGSLPDQPRLAVALNRGDVPPLGRRTSLGRFCASFL
FT                   DSLLGVES"
FT   gene            481562..482875
FT                   /locus_tag="Sros_0480"
FT   CDS_pept        481562..482875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0480"
FT                   /product="type II secretion system protein E"
FT                   /note="KEGG: bam:Bamb_3424 type II secretion system protein
FT                   E"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83506"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2M9"
FT                   /inference="similar to AA sequence:KEGG:Bamb_3424"
FT                   /protein_id="ACZ83506.1"
FT                   /translation="MNRGGVATAVSPELVEAVRVRLARSGVEPSAAHVAVALRAERAVL
FT                   GDAEILAVARVLCADLIGAGPLEPLLAEPEVTDVLVNGPREVWVDDGRGLRRTSVVFPD
FT                   EDAVRRLAQRLASAAGRRLDDACPYVDARLAGGVRLHAVLPPVAAGGTCLSLRLPPRRT
FT                   FTLPDLVGAGTIRADAVPVLTAVIESRLAFLVTGGTGTGKTTLLSALLSLADPGDRLLL
FT                   VEDSAELRPLHPHVVRLESRPANLEGAGGVCLRDLVRQALRMRPDRLVVGEVRGAEVVD
FT                   LLAALNTGHEGGCGTLHANTAADVPPRLEALACAAGLSREAVHSQIAAALDVVIHLVRD
FT                   HAGGCRRVAEICMMIRRPSGLVDAEPALTFSPDGRVTAGPGLPALTARAPGLSTFPGVA
FT                   RRPYGPARLDRYRGPPEGRAVTRRSSEGSAPDALGALP"
FT   gene            482872..483576
FT                   /locus_tag="Sros_0481"
FT   CDS_pept        482872..483576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0481"
FT                   /product="Flp pilus assembly protein TadB-like protein"
FT                   /note="KEGG: bch:Bcen2424_1524 type II secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83507"
FT                   /db_xref="GOA:D2B2N0"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2N0"
FT                   /inference="protein motif:COG:COG4965"
FT                   /protein_id="ACZ83507.1"
FT                   /translation="MTALAVLFAALAVWLWTGPAPGTARLCRIEHRPRSGPGSLYARFA
FT                   GRSRPSKRTAAWRIASIELCQGLAAELAAGRTAGEALARAVSTVEFPDPVALRPLIAAA
FT                   RDGGDVPAALLAAAPEQGGEAFSRLAACWKVSVTAGAGLSVLVDRVAGSLREAQAHRQD
FT                   VAAQLAGPRATARLLAGLPALGLLMAMGLGMRPLHFLFGSPAGVGCLALGLVLDGCGLW
FT                   WTHRLVAHAQQA"
FT   gene            483980..484561
FT                   /locus_tag="Sros_0482"
FT   CDS_pept        483980..484561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0482"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsh:Dshi_1125 type II secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83508"
FT                   /db_xref="GOA:D2B2N1"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2N1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83508.1"
FT                   /translation="MLSAAIGLMVFLVVGGAPGIVIGVAGSAVALVAVQRRESPRARRE
FT                   RDRVVADLPLAADLMVACLRAGQPITGAIDVTVEAVGGPLGERLAWVSGQLRLGAAPES
FT                   AWQALAAEPPLAPLARMMSRAALSGAPVADVLTRLSDDSRHALRAASAAAARRVGVQAV
FT                   APLGLCFLPAFVFLGIVPVVAGLAGEVLLP"
FT   sig_peptide     483980..484072
FT                   /locus_tag="Sros_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.738 at
FT                   residue 31"
FT   gene            486612..486938
FT                   /locus_tag="Sros_0483"
FT   CDS_pept        486612..486938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0483"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="KEGG: hpa:HPAG1_0422 putative heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83509"
FT                   /db_xref="GOA:D2B2N2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2N2"
FT                   /inference="similar to AA sequence:KEGG:HPAG1_0422"
FT                   /protein_id="ACZ83509.1"
FT                   /translation="MAPGPAASADKFDDDDYPAYSMGRAAEILGVTPAFLRSLGVAKLI
FT                   EPQRSSGGHRRYSRYQLRLAARARELVDQGVGLESACRIIILEDQLAEALRLNDELTKR
FT                   NESA"
FT   gene            487815..488234
FT                   /locus_tag="Sros_0484"
FT   CDS_pept        487815..488234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83510"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2N3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83510.1"
FT                   /translation="MLKNKKIRVAVWAGAAVSLVVGAAWTGVAGAAIQAVTKATAPYAQ
FT                   AAAVVNSDGSINRAKGIVAVTKPAVGKYCVELEDKELDVTRLVPSATLQYTSFEYGIRV
FT                   SMWPDPVCGTRKDTFLVITGMPNKWEDRAFSIVVP"
FT   sig_peptide     487815..487910
FT                   /locus_tag="Sros_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.671 at
FT                   residue 32"
FT   gene            489099..489365
FT                   /locus_tag="Sros_0485"
FT   CDS_pept        489099..489365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83511"
FT                   /db_xref="GOA:D2B2N4"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2N4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83511.1"
FT                   /translation="MCATGAVLLWVFLISAVQVALLGLLAVNPRSRRTWVRWAGIVFEV
FT                   LMVLLRVQSLFAGEVLPALVGLVLAIVVIACLARGEARYRFSG"
FT   gene            489880..490212
FT                   /locus_tag="Sros_0486"
FT   CDS_pept        489880..490212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83512"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2N5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83512.1"
FT                   /translation="MKRNLRRWGALGAAAVSLAGTMVVTGGATSAHADARCSASSIYIN
FT                   DSPGGDPKTAARGHSHDTGNHYVTDSKWSFQPWGYYWYWYADNDGGSDGDTADTFYGSI
FT                   LCDKPL"
FT   sig_peptide     489880..489981
FT                   /locus_tag="Sros_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.865 at
FT                   residue 34"
FT   gene            490711..491391
FT                   /pseudo
FT                   /locus_tag="Sros_0487"
FT   gene            491620..491856
FT                   /locus_tag="Sros_0488"
FT   CDS_pept        491620..491856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83513"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2N6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83513.1"
FT                   /translation="MARSIAGGVRGHWSRGLRARWTLLIVGPGRDRGMSTAEYAVGTIA
FT                   ACAFAALLFKVVTSSEVQQMLSGLINRALNVAG"
FT   gene            491853..492233
FT                   /locus_tag="Sros_0489"
FT   CDS_pept        491853..492233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0489"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK21128 gene product from transcript GK21128-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83514"
FT                   /db_xref="GOA:D2B2N7"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2N7"
FT                   /inference="similar to AA sequence:KEGG:Dwil_GK21128"
FT                   /protein_id="ACZ83514.1"
FT                   /translation="MTPGGTVASVRPSKGSVTAETAVVLPAVVVMLAAALWAVAAVGAQ
FT                   LECVDAARAGARAASRGESLERVRGGVLAAAPAGAHVVVTRSVEVTRVEVSASIRPHWG
FT                   ASLPAVTVRATAVSATEPGAER"
FT   gene            492386..492751
FT                   /locus_tag="Sros_0490"
FT   CDS_pept        492386..492751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83515"
FT                   /db_xref="GOA:D2B2N8"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2N8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83515.1"
FT                   /translation="MGRDRGAATIWVAGLMALVFAVTAVIVFAGTARVARHRAQSAADL
FT                   SALAAARLAFADPERGCAEASSLAEGNGAMITRCFIDGEGIADVQVAVGLSLPVLGDRM
FT                   IMADARAGPVHIAGSVG"
FT   sig_peptide     492386..492475
FT                   /locus_tag="Sros_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.593 at
FT                   residue 30"
FT   gene            493216..495213
FT                   /locus_tag="Sros_0491"
FT   CDS_pept        493216..495213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0491"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83516"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2N9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83516.1"
FT                   /translation="MTTVRRLVAVTAIAPIVSMSALLAVASPAQAVARLDIPSRVTSNG
FT                   VVTLSGTVDPLFDAVLSVNGRQVAKGDRKVSYSWDPRARPNGSYKIKVEQRGKVLGAKW
FT                   HQVSKILTQAVPPATPSGVAVRLQGNKAVVTWRKGSEPDLRSYQVSTSQTGKVGSVRVG
FT                   TACSGGSCRATLSVPAKAAGRRIGFTVRALRGNGNGGTLSSGDSAVASVRIPAPRAPRT
FT                   TQDTRTTQDTERQNAGTDKAAEKTTGSRNSTARQDTGRSTDSRQSGKTDGKQRSGIQDL
FT                   PRLPAKKPATTPTRPPRTAAAPTKAPRPDAVKDDGEVAQPPAKRDKKSDAASGKSKDGE
FT                   ESTPDSATTGAAVPPATKTGIAARSSELPTDGIGQYGIFIAGALILLLLGAHGGAWVRR
FT                   KLLAADAGAGAAATPPTSGGDGTPTAAAKATGNAGTAAATAAPRRPTVILAVVKTRQVQ
FT                   PVRPNSSSAQPPSARQGPGPSPERQAPARRFPAHVEEALSGQAPVHRFPAHEEQVPGRR
FT                   FSAHEEQALSGQAPVHRFSAHEEQASSERSPSEQAPAHHLSAHEQRVLAEQVPGRADSG
FT                   SESVPAPRAEPVHRELPAAAPIPEVAAVTPVAVRIGDRWDDYLPPAPRSMEDSGFWERP
FT                   QPGATDFWAADDKEEDDPSYSGGRRVLGDG"
FT   sig_peptide     493216..493311
FT                   /locus_tag="Sros_0491"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.712 at
FT                   residue 32"
FT   gene            495210..495956
FT                   /locus_tag="Sros_0492"
FT   CDS_pept        495210..495956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to Zinc finger protein 219"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83517"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2P0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83517.1"
FT                   /translation="MIFRWTRHSVATSHMATSFRPVLAAWFLLPSSFRAVLAVRSLPSG
FT                   PFVRPLPGGPFCPIPSVRPLPCGPCRPVLSVRPLPGGPFRAVLAVRPLPGGPFLAAPSV
FT                   RPFPCGPFCLVPSGRSFRKPDGVPLDPMGAEGRVMPSGASEGPSAGASGKPFKPLRGIL
FT                   CGCFKGLFAGASRILCGGSRVLCGGRWVLSPGFSRAGLRRVTGRGGDGLRSGALRVGGE
FT                   QDGEETEGSRLVQGFVAVAALGRLDA"
FT   sig_peptide     495210..495284
FT                   /locus_tag="Sros_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.715 at
FT                   residue 25"
FT   gene            complement(495849..498296)
FT                   /locus_tag="Sros_0493"
FT   CDS_pept        complement(495849..498296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0493"
FT                   /product="DEAD/DEAH box helicase domain-containing protein"
FT                   /note="KEGG: dvl:Dvul_2723 DEAD/DEAH box helicase domain-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83518"
FT                   /db_xref="GOA:D2B2P1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2P1"
FT                   /inference="similar to AA sequence:KEGG:Dvul_2723"
FT                   /protein_id="ACZ83518.1"
FT                   /translation="MAPRRQAPTRGIQPCVRSVSIRNHDSRRLCPQMPDWKPVTPPSSS
FT                   SLRAGSALRHLLGVPARRDRVTHVEHVPARQAGQARWPDWVHESLVTRWANHGISGLWS
FT                   HQAEAAELVHRGQNVIIATGTASGKSLSYLVPALSSVLDGGTILYLTPTKALAADQLRA
FT                   LNELDVPELRAATFDGDTSFEERAWVRKHANYVLTNPDMLHRTLLPRHANWSSFWRRLR
FT                   MVVVDECHGYRGVFGSHVAQILRRLRRVCTRYGSAPAFVLSSATASEPGAFAMRLTGLQ
FT                   MAEVTTDASPRGATTFALWEPPLTDLRGEGGAPLRRPATAESADLLADLVIADVRTLAF
FT                   VRSRRAAESVALTTRAKLQDLVFDVGAPGDLPDKVAAYRAGYLAEDRRGLEKAFRSGDL
FT                   LGLATTNALELGVDVSGLDAVLIAGWPGTRASLWQQAGRAGRAGQDALAVLIARDDPLD
FT                   TYLVHHPEALFGRPVEAIVLDPDNPYVLGPHLCAAAAEIPLTPDELQIFGPTAKEVLAD
FT                   LVTEGLLRERATGWFWTRRERATDLADIRGAGGAPVQVVEASTGRLLGTVDEPSAHTTV
FT                   HTGAVYVHQGETYLVVELDLEAGVALVEAGTPDYTTFARDVTEISVLESLRSHPLGPGE
FT                   LHFGSVEVTRQVVSYLKRRAQSGELLGDEPLDLPPRTLRTRAVWWTLPTSAVVSLAEDG
FT                   LDLGGAAHAAEHASIGLLPLFATCDRWDIGGVSTELHPDTGLLTVFVYDGHEGGAGFAE
FT                   RGYARALDWLTATREAIASCECERGCPSCIQSPKCGNGNEPLDKAGALRLLAVLLSADP
FT                   QRT"
FT   gene            498355..498705
FT                   /locus_tag="Sros_0494"
FT   CDS_pept        498355..498705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0494"
FT                   /product="putative anti-anti-sigma regulatory factor"
FT                   /note="KEGG: dat:HRM2_43530 putative anti-anti-sigma
FT                   regulatory factor"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83519"
FT                   /db_xref="GOA:D2B2P2"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2P2"
FT                   /inference="similar to AA sequence:KEGG:HRM2_43530"
FT                   /protein_id="ACZ83519.1"
FT                   /translation="MDLKLDHHSEDRLTIVEVEGEIDVYTAPRLRELLIDLVNKGNFHL
FT                   LVNMEKVDFLDSTGLGVLVGGLKRVRAHDGSLELVCTQERILKIFRITGLTKVFGIYAS
FT                   VEEAKEAHGRDK"
FT   gene            498708..499154
FT                   /locus_tag="Sros_0495"
FT   CDS_pept        498708..499154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0495"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: bsu:BSU04720 serine-protein kinase RsbW"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83520"
FT                   /db_xref="GOA:D2B2P3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2P3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83520.1"
FT                   /translation="MATVELTFSALPAHVRTARLVATAIARRTGVEESLLDEVRLAVGE
FT                   ACSRAVEAHRLHCPGEPIRIELRDDLGRFEVTVTDSAPSDELEQERELLRFDDPLGQLP
FT                   DTLMTGFGIAVIVGLADDVQVYPSQKGMRIRMSWPAATNGLSPV"
FT   gene            499607..501940
FT                   /locus_tag="Sros_0496"
FT   CDS_pept        499607..501940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0496"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: mch:Mchl_3408 V-type H(+)-translocating
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83521"
FT                   /db_xref="GOA:D2B2P4"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2P4"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ACZ83521.1"
FT                   /translation="MSVLHLAVAEEPAVSLSGSHFNIVIVVAVVALLALAVAGVLVREV
FT                   LAAGQGTERMQNIARAVQEGASAYLARQFRTLAVFVILIPFLLYLLPAESTGVAIGRSV
FT                   FFVVGAVFSALTGFIGMWLAVRGNVRVAAAARESGEKVAMRIAFRTGGVAGMITVGLGL
FT                   LGAAIVVIVYGGDAPAVLEGFGFGAALLAMFMRVGGGIFTKAADVGADLVGKVEQGIPE
FT                   DDPRNAATIADNVGDNVGDCAGMAADLFESYAVMLVASLILGKVAFGTEGLVFPLIVPM
FT                   VGVITAIIGIFTTSPRKGDRNGMAAINRGFFISAVISAVLVGVAVFLYLPSSFAGLTGV
FT                   SPEIAAITSDPRLIAIGAVLIGLVLASAIQILTGYFTETNRRPVKDIGESARTGPATVI
FT                   LSGISVGLESAVYSALIIGAAVYGAFLLGFGNVTIALFAVALAGTGLLTTVGVIVSMDT
FT                   FGPVSDNAQGIAEMSGDVDGEGARVLTSLDAVGNTTKAITKGIAIATAVLAATALFGAF
FT                   RTAIETQLANASQGVKDVLGSFGTFSLSVDSPNVLVGLIIGAAVVFMFSGLAIMAVGRA
FT                   AGRVVFEVREQFRTKPGIMAGTELPDYGRVVDICTRDSLRELATPGLLAVLTPIAVGFA
FT                   LGYAPLGAFLAGAIACGTLMAVFLANSGGAWDNAKKLVEDGHHGGKGSSAHEATIIGDT
FT                   VGDPFKDTAGPAINPLLKVMNLVALLIAPAVVTYADNVALRIGVTVVAAGIVVAAVVVS
FT                   KRRSASIAPTEENNVKREREPISG"
FT   gene            502089..502193
FT                   /locus_tag="Sros_0497"
FT   CDS_pept        502089..502193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83522"
FT                   /db_xref="GOA:D2B2P5"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2P5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83522.1"
FT                   /translation="MEQQPSGGKSLVFILLAMAAVFAVIVGIAMWAAR"
FT   sig_peptide     502089..502160
FT                   /locus_tag="Sros_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.749) with cleavage site probability 0.723 at
FT                   residue 24"
FT   gene            502178..502663
FT                   /locus_tag="Sros_0498"
FT   CDS_pept        502178..502663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0498"
FT                   /product="putative phosphohistidine phosphatase, SixA"
FT                   /note="KEGG: azc:AZC_1661 phosphohistidine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83523"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2P6"
FT                   /inference="similar to AA sequence:KEGG:AZC_1661"
FT                   /protein_id="ACZ83523.1"
FT                   /translation="MGGEVTTRTLIVLRHAKAAHVHGLADRERPLTGRGERDARRVGET
FT                   LTGMDLHPDLVLCSPSERTRQTARLALPDADITFDPAIYEAYSDELLTLIRRSDPEVRT
FT                   LMLVGHNPGVHELVLDLTAREDDPGFPPGAFAVIETEGEWAEFEAGRGVAHWSPKEH"
FT   gene            502968..505055
FT                   /locus_tag="Sros_0499"
FT   CDS_pept        502968..505055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0499"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: mxa:MXAN_1396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83524"
FT                   /db_xref="GOA:D2B2P7"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2P7"
FT                   /inference="protein motif:COG:COG1289"
FT                   /protein_id="ACZ83524.1"
FT                   /translation="MRRIAEALRGDFVLSGRPSWGYSLLCALGICLPLVAGVMLGHVPQ
FT                   GAAMALGGYLTVFGDAPGLPYGERARKLLVATLMVTLGSGLGALIQPYPWVAAVVVGLV
FT                   AMAGGYWPVISISSVLSVALTYFAPPGMSVPAHMAITAAGGLLMTLLLLGLWPVRRLQP
FT                   LRTAFEEAGTALADLLEAAGRAPLSDESWEVLRRCAVTALDDAAKAFSLYRVSEEDDRA
FT                   LQRLLATLTRILHETVALRVLRAAAAQTGVGTDWTEELHEAAGALAGALREAVTLGGSA
FT                   GVPAALGAVGRFADRVEEIRRAAHTGGAPLPAAALLGQVRRCLDRIGMAVRSVAQQAVE
FT                   GVEVGPRLPRFGRLRKPVFSTGHHPLRLGLAVTLAMVLMLVTHEHYAKWFVVTVIVSLR
FT                   PAYRDTVERVVLRTAGTAVGAAGAAVVLAVAPGHFYLIVFIAVCAVLGFALRGASYGYW
FT                   TIFATPLSLMLSDFSLPLDWGAAAVRVALTIAGGALALLFARLLWPRGQRAKLTGRAVD
FT                   MLGEHAALVRSLIDQDPDEVRARLSSASDAADRFSDSLDRLDKEPGGSAPQRLRDAVTA
FT                   ARRLRDNALALFAVPPSGEASGPTAAVLDMVADRLENVAEAVGTERPEAPADDLDGVLD
FT                   ELGAHVDVLAARRLDEVAEGAADQMTEVRRGIMHAAAAQPALKGLSAEALRLAALTAPR
FT                   R"
FT   gene            complement(505036..506259)
FT                   /locus_tag="Sros_0500"
FT   CDS_pept        complement(505036..506259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0500"
FT                   /product="Phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /note="KEGG: scl:sce0663 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83525"
FT                   /db_xref="GOA:D2B2P8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2P8"
FT                   /inference="protein motif:PRIAM:3.1.3.3"
FT                   /protein_id="ACZ83525.1"
FT                   /translation="MNQRTLLITLTGPDRPGVTSRLFSVLAGFPVVVADIEQVVIRGRL
FT                   TLGVLVAYAGDTPTGTGSTIGALWTAVERAAEDMGLQVELSTGSDPQEKRRRGRLHVTV
FT                   LGSPLQPSAMAGIAGRIAAAGANIDRIERLSNYPVTCIELAVSGADPDTLRAELAIEAH
FT                   AQRVDVAVQRTGLHRRAKRLIVMDVDSTLIQAEVIELLAAHAGCLDEVARVTEEAMRGE
FT                   LDFAESLRRRVALLEGLPQEIFEKVRKELVLTPGARTLVRTLKRLDYRFAIVSGGFTQL
FT                   TDALVDDLGIDYSAANTLEVVDGVLTGRVVGEIVDRPGKARALERFARQAGIPISQTVA
FT                   IGDGANDLDMIAAAGLGIAFNAKPVVRQAADTAVNVPYLDSILYLLGIPRAEVEAADAE
FT                   DGVIVAER"
FT   gene            506375..507078
FT                   /pseudo
FT                   /locus_tag="Sros_0501"
FT   gene            507075..507938
FT                   /locus_tag="Sros_0502"
FT   CDS_pept        507075..507938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0502"
FT                   /product="lyso-ornithine lipid acyltransferase"
FT                   /note="KEGG: mfa:Mfla_0468 lyso-ornithine lipid
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83526"
FT                   /db_xref="GOA:D2B2P9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2P9"
FT                   /inference="similar to AA sequence:KEGG:Mfla_0468"
FT                   /protein_id="ACZ83526.1"
FT                   /translation="MNPWLPVAPCMPATCLTPAGPRASWPRRTLRLVAVTLAVLAGAAL
FT                   ALVARGLGTADRVRLAGAWSRLALRALGVRVEVRQGFTFMAGSAAGLRVVPVPETAPLI
FT                   VANHVSWLDPLVMSAVLPSRPLAKDEVRGWPVIGGLAVGAGALFIDRDRLSALPEAVGR
FT                   VAGALGEGHPVAVFPEGTTWCGREMGAFRPAVFQAALDAGAPVRPVAIRYLGPDGAQAT
FT                   VASYVGDDTLPASIRRVAAFRRLTVEVTLLPPVRARNRRSLAWAAESSIASVLVAPPVH
FT                   GVRAAA"
FT   gene            complement(508023..508703)
FT                   /locus_tag="Sros_0503"
FT   CDS_pept        complement(508023..508703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0503"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: gur:Gura_0759 two component LuxR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83527"
FT                   /db_xref="GOA:D2B2Q0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2Q0"
FT                   /inference="similar to AA sequence:KEGG:Gura_0759"
FT                   /protein_id="ACZ83527.1"
FT                   /translation="MTELRVVLAEDHYLVREGTRRLLETSGEIRVVAAVGTADELLDAA
FT                   RRLRPDVVVTDIRMPGSAGLVRAGMEGIDAAHRIREASRDIGVVVLSQFSDAMFALDLF
FT                   RDGTEGRAYLLKDRVGDIDELLGAIRSVAVGGSVIDPKVVEGLLAKRGVSDRPPPAELT
FT                   PRELDVLREMAHGLSNGGIARALHLSVSAVEKHVNSIFLKLALENSPDTHRRVAAVIAY
FT                   LGPR"
FT   gene            complement(509022..509579)
FT                   /locus_tag="Sros_0504"
FT   CDS_pept        complement(509022..509579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83528"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2Q1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83528.1"
FT                   /translation="MRHPIYKIAALALVAPLAGTMLLAAPASAAPTKAPAATVKTADDP
FT                   YSSFDVRISAPGRVRAGGTISYTIKATNTGPHEADSYYLGGVLPKGSKIVRVHATKGSE
FT                   CDWYEDGYWCWSPLALAVGEYESIKIVVKLGKKSKGTATAILGVDTYDLPTGAETLNRD
FT                   EFERMGFKSWYFVKKIKTRIAR"
FT   sig_peptide     complement(509490..509579)
FT                   /locus_tag="Sros_0504"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 30"
FT   gene            complement(509802..510329)
FT                   /locus_tag="Sros_0505"
FT   CDS_pept        complement(509802..510329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0505"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_0807 conserved repeat domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83529"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2Q2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83529.1"
FT                   /translation="MRRHLTAFAAIALAGGMLLTPGGANAAAAAPTAAHVAPPLSPLKL
FT                   TAYYPRRVYAGDTITYTLRTRNTGDWATDIAYVGGYVPRQARKVRITGPSGSICEADGR
FT                   EVGCLLDTLKPGRSVTIKVKVWLRSSARGTAAAEFASASIDVPAGGLDTLDIHGIDVGT
FT                   DLKYVRVKTRIL"
FT   sig_peptide     complement(510249..510329)
FT                   /locus_tag="Sros_0505"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.828 at
FT                   residue 27"
FT   gene            complement(510421..511536)
FT                   /locus_tag="Sros_0506"
FT   CDS_pept        complement(510421..511536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0506"
FT                   /product="S-adenosylmethionine tRNA ribosyltransferase"
FT                   /note="KEGG: bha:BH2211 S-adenosylmethionine tRNA
FT                   ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83530"
FT                   /db_xref="GOA:D2B2Q3"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2Q3"
FT                   /inference="similar to AA sequence:KEGG:BH2211"
FT                   /protein_id="ACZ83530.1"
FT                   /translation="MSTPVTDAMAPGFVLPHDLEAHEPPEARGLTRDGVRLLVSHGATG
FT                   EITHHGFAELPGLLHPGDLLVVNNSATLPAAVRLDRLAVHFSTEREDGTWLVELRRRME
FT                   RRSGPGGGGAGQDARDRRRPGTAPAAGTEMASEPYPGGAAGEWLPLPGGATLRLLDRET
FT                   PRLWRARLDREVPAYLRRYGVPIRYSYVERDWPLEDYQTVFGIRPGSAEMPSAGRPFTA
FT                   ELVTGLVSRGIGVAPITLHTGVTSPSTDEPPCPEWFEVSEATARQAELTRESGGRVIAV
FT                   GTTVVRALETAALACGRVRAARGWTSHLVTPSAGVRAVNGLITGLHGPRSSHLPMLSAI
FT                   AGGELLSRSYAEALGEGYLWHEFGDVHLILQ"
FT   gene            511860..512981
FT                   /locus_tag="Sros_0507"
FT   CDS_pept        511860..512981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0507"
FT                   /product="Histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: scl:sce2236 putative two-component system
FT                   sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83531"
FT                   /db_xref="GOA:D2B2Q4"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2Q4"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACZ83531.1"
FT                   /translation="MTEDRDAVLQAVSSAVLAVTRHLSVREVLQVIVRSAQQLLDARYA
FT                   ALGVPDDQGAFAEFVAEGISDEEWDAIGPMPRQHGMLGAMLRDGAPVRLPDIRRDPRFE
FT                   YWPRAHPVLKDFLGVPIRDGDQVLGIVFLSNKRAPGGFTEADQRLLTMFAAHAAIALTN
FT                   ARLYERGRELALVEERTRMARELHDAVTQKLFSLRLTTQAAASLVTRDPARALEELERV
FT                   ERLAGEALAELRAVIVELRPAELDRHGLAETLRKHVRLLDRLHPASFTFDEAPVCSLEP
FT                   ATEVAVLRVAQEALHNASRHSAARAVGVRLGCEAGRVILEVRDDGAGFDVAAAAGRGLG
FT                   IASMEDRAQALGGSVRVTSEPGHGTLVRMEVPV"
FT   gene            512978..513616
FT                   /locus_tag="Sros_0508"
FT   CDS_pept        512978..513616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0508"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: baa:BA_0519 REC, CheY-homologous receiver
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83532"
FT                   /db_xref="GOA:D2B2Q5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2Q5"
FT                   /inference="similar to AA sequence:KEGG:BA_0519"
FT                   /protein_id="ACZ83532.1"
FT                   /translation="MIRVLIVDDHPVVRQGLRTFLGLQDDLDVVGEAADGAEAVALVES
FT                   LAPDVLLLDLKMPVLDGLGTLVRLAEHGLSPRVLVLTSVGDREDVAPAMRAGASGFLYK
FT                   DVDPAALVQAIRAVHGGQVLLAPEAAEAMLSVPAPAPAPAEGRYVAPLTDREREVLTLI
FT                   ASGRSNREIARELAVAEKTVKTHVSNVLMKLGVQDRTQAALYAVRNGLA"
FT   gene            complement(513711..514430)
FT                   /locus_tag="Sros_0509"
FT   CDS_pept        complement(513711..514430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0509"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0326 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83533"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2Q6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83533.1"
FT                   /translation="MHPDSQISATLVCWGNAWLTGQVGLDEAADRVERQAGPQLVAGEN
FT                   GDLLLRAFLADLRVEGMKSLRLALPVAGDPLGLTGPPPFNSAAIEAGQAAIAVLPGRCL
FT                   GLVPMQDRRGSSYAGVRWSVLEASANVPDIPSLSEAEHTLTLAMRTATDALLGVEGPAQ
FT                   GHRRVESVDDGLAPGYPARAHRVAALAARLAAVLQVADDRGLTSGQIVTRGNALRDLDR
FT                   AVRRARVAAHHAITELV"
FT   gene            514497..515291
FT                   /locus_tag="Sros_0510"
FT   CDS_pept        514497..515291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0510"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sfu:Sfum_3281 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83534"
FT                   /db_xref="GOA:D2B2Q7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2Q7"
FT                   /inference="similar to AA sequence:KEGG:Sfum_3281"
FT                   /protein_id="ACZ83534.1"
FT                   /translation="MGGQVLRLQDVTVRRDGAALLRDIDWTVHEDERWVVIGPNGAGKT
FT                   TLLQVVGAMLFPTEGIVEILGERLGQSDVFDLRPRIGLASAALAEKVPPEEKVIDLVLT
FT                   ASYAILGRWTEEYDSNDVTRAVELIDQLGCAHLIRRRFNTLSEGERKRVQIARALMPDP
FT                   ELLLLDEPAAGLDLGGREDLVRRLATFAHDPKAPTMVLVTHHVEEVPSGFTHALLLRHG
FT                   SVVAQGPIDQVMTAENLSRTFSVPLNLERGLDGRWYARAHHF"
FT   gene            515459..516214
FT                   /locus_tag="Sros_0511"
FT   CDS_pept        515459..516214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_3839 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83535"
FT                   /db_xref="GOA:D2B2Q8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2Q8"
FT                   /inference="similar to AA sequence:KEGG:Pmen_3839"
FT                   /protein_id="ACZ83535.1"
FT                   /translation="MTPWEAIAILAAGIGAGGINAVVGSGSLITFPTMVAVGLPPIVAN
FT                   VSNNIGLVPGSLTGALGYRAELAGQRERLIRLGAASIAGSLIGGVLLLFLPADTFNVVV
FT                   PILIGLACVLVVVQPRLNRWLSARREDPHPHGGPWLWIGVLAAGIYGGYFGAAQGVLLI
FT                   GLLGSFLDDDLQRVNAAKNVLSLLVNATAAVLFVIVAEVDWRAVALVAAGATIGGFLGA
FT                   KVGRKLPAPILRGFIVCIGILAIIKLVYG"
FT   sig_peptide     515459..515524
FT                   /locus_tag="Sros_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.829) with cleavage site probability 0.740 at
FT                   residue 22"
FT   gene            516244..516471
FT                   /locus_tag="Sros_0512"
FT   CDS_pept        516244..516471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83536"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2Q9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83536.1"
FT                   /translation="MKGDKVEIVIDAGDSSRTYEVVATKAGRRVEVSNRRGGVVEVSEV
FT                   TRSGTAVRTARFMSSRILALVEHPADGKPD"
FT   gene            complement(516468..517379)
FT                   /locus_tag="Sros_0513"
FT   CDS_pept        complement(516468..517379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0513"
FT                   /product="Ferredoxin subunits of nitrite reductase and
FT                   ring-hydroxylating dioxygenase-like protein"
FT                   /note="KEGG: scl:sce7049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83537"
FT                   /db_xref="GOA:D2B2R0"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2R0"
FT                   /inference="protein motif:COG:COG2146"
FT                   /protein_id="ACZ83537.1"
FT                   /translation="MKETVKTKRRSFKHLVPPVDLTGRIERSTRMDRTIHAVAKAVRRR
FT                   LGPGRLRDLLHGVPTGKPLHPPLVTVSLGCWVATAVLDLTHADPRAARAVLTTGIATAL
FT                   PAAAAGITDWSSLHREQQRVGFVHAVANLTAVGLYAGSLALRLAGDDRRGRLLSFAALG
FT                   AAGLGGQLGGHLAYRQAAGANHAESVAHLVPLGWHDLCELKDLPDGRPVARRLGYIDLF
FT                   VLRVGEGVTVLADGCSHLAGPLHQGRLVSEDGSACVVCPWHGSTFRLSDGTVAHGPATA
FT                   PQPSFETRIRRDGVLQVRPAPL"
FT   gene            complement(517424..518029)
FT                   /locus_tag="Sros_0514"
FT   CDS_pept        complement(517424..518029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0514"
FT                   /product="HD superfamily hydrolase"
FT                   /note="KEGG: mag:amb4350 HD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83538"
FT                   /db_xref="GOA:D2B2R1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2R1"
FT                   /inference="similar to AA sequence:KEGG:amb4350"
FT                   /protein_id="ACZ83538.1"
FT                   /translation="MTTPPEQDRLHAQLAFAMEIDKLRRIVRRNTLMDGSRRENDAEHS
FT                   WYVGMLAMVLAEHAPPGTDLDKVVAMLLVHDIVEIDAGDTFIYDAHAVEAQLGIERKAA
FT                   DRIFGLLPEDQAKRLRALWDEFEERKTPEARFAKALDRIAPIMANHHNEGGTWSLYKVT
FT                   AGQVLEKVKIIEEGSATLGAYATEIIELSVSRGHLARA"
FT   gene            complement(518080..520245)
FT                   /locus_tag="Sros_0515"
FT   CDS_pept        complement(518080..520245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0515"
FT                   /product="molybdopterin dinucleotide-binding region"
FT                   /note="KEGG: dal:Dalk_0693 molydopterin dinucleotide-
FT                   binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83539"
FT                   /db_xref="GOA:D2B2R2"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2R2"
FT                   /inference="similar to AA sequence:KEGG:Dalk_0693"
FT                   /protein_id="ACZ83539.1"
FT                   /translation="MRTAHRTCPLCEAVCGLRLTLDDTGHVTSVKGDPDDPFSKGFICP
FT                   KGASLGRLDEDPDRLRVPMTRKGGEWREATWEEAFQAVDQGLKDVVDTHGRQALAVYLG
FT                   NPNAHSMAGALYGPPLIRALGTRNVFSASTADQMPKHVSCGLMLGDPMAIAVPDLDRTD
FT                   YLLILGANPLESNGSLCTAPDFPGRLKALRGRGGKLVVVDPRRTRTAALADEHLFVRPG
FT                   TDAYLLLGIVHTLLAEDLTKIDVEVNGLEELRRLAMEFAPETVAQACGVPAGEIARLAR
FT                   ELAAAPTAAVYARIGTCTAEFGTVAQWLVDVVNILTGNFDRPGGVMFAKTAVENGRRRR
FT                   PYTTGRWHSRVRALPEANGELPVATLADEIETPGEGQVRALITVAGNPVLSAPNGPRLD
FT                   RAFRDLDFMVCVDPYLNETTRHANVILPPPPVMRTPHYDLSLLFVAVRNYARFSPPVLP
FT                   PEPGRPSEAGILARLTMIASGQGADADPDLLDEMILDRMLRKAVETPGSPVEGCEVAEL
FT                   RASLDGTTGAERRLDAMLRLGPYGLSLAKLLANPHGVDLGPLEPRLAEVLCTTSGRVEL
FT                   APPPLVEDLARLRGRLAVPPAEMVLIGRRHLRSNNSWLHNVGPLVGGSNRCTLQINPDD
FT                   VTRLGLGGHALVRSAGGELVVPLEPTETIMPGVVSLPHGWGHAGTAQLVAAEHPGVSAN
FT                   TLTDDSVVDIPSGNAVFNGVPVTLSPV"
FT   gene            complement(520493..521416)
FT                   /locus_tag="Sros_0516"
FT   CDS_pept        complement(520493..521416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0516"
FT                   /product="naphthoate synthase"
FT                   /note="KEGG: scl:sce5310 naphthoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83540"
FT                   /db_xref="GOA:D2B2R3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2R3"
FT                   /inference="similar to AA sequence:KEGG:sce5310"
FT                   /protein_id="ACZ83540.1"
FT                   /translation="MPDADVSELFDPAAWTEIEGFDFTDITYHRSSETRSGKRVVRVAF
FT                   HRPEVRNAFRPHTVDELYRALDHARMSSDVGCVLLTGNGPSPKDGGWAFCSGGDQRIRG
FT                   RSGYQYADGDTSDTVDPARAGRLHILEVQRLIRFMPKVVVAVVPGWAAGGGHSLHVVCD
FT                   LTLASAEHARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGEEYSADQMHAMGA
FT                   VNAVVPHAELEATALEWAWKINGKSPTAQRMLKYAFNMIDDGLVGQQLFAGETTRLAYM
FT                   QDEAVEGRDSFLEKRAPDWSRFPYYF"
FT   gene            complement(521546..522997)
FT                   /locus_tag="Sros_0517"
FT   CDS_pept        complement(521546..522997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0517"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="KEGG: csa:Csal_0803 catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83541"
FT                   /db_xref="GOA:D2B2R4"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2R4"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ACZ83541.1"
FT                   /translation="MSTRPITTTDAGIPAPSDEHSQSVGPNGPLLLQDHYLIQKMAHFN
FT                   RERVPERVVHAKGGGAHGILQITEDVSQFTKAGLFQKGKETPLFLRFSSVAGELGSPDT
FT                   QRDPRGFAIKFYTEEGNYDIVGNNTPIFFIRDPQKFSDFIHSQKRRADTNLRDHNMQWD
FT                   FWTLSPETAHQVTFLMTDRGTPASWRHVHGFGSHTFLWYNAAGEKFWIKYHFKTDQGIK
FT                   NFTDAEAGAVIAQDADYHIRDLHTAIKNGDHPSWTVNVQVMPFEDAADYRFNPFDLTKV
FT                   WPHSDYPEITIGKFVLNRNPDNYFAEVEQSSFEPANLVPGIGPSPDKMLQGRLFSYPDA
FT                   HRYRIGANYLQLPINRPLSPVHSYNKDGQMAFVNPSDPVYAPNTVGGPAADPALFEGEN
FT                   YQVSGEIIRSAYTLHREDDDYVQPRALWENVLSDTDRSHLVSNVVGHASAPEVTAEMKK
FT                   RVVEYWTNIHKDLGQGVAQGLGVAG"
FT   gene            complement(523021..523440)
FT                   /locus_tag="Sros_0518"
FT   CDS_pept        complement(523021..523440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0518"
FT                   /product="ferric ion uptake regulator"
FT                   /note="KEGG: bav:BAV2724 ferric ion uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83542"
FT                   /db_xref="GOA:D2B2R5"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2R5"
FT                   /inference="similar to AA sequence:KEGG:BAV2724"
FT                   /protein_id="ACZ83542.1"
FT                   /translation="MGDEDRLRKAGLRVTAARLAIMQTVREGDHLDVDAVHRGVRDRVG
FT                   QVSLQAVYDSLHALQRGGLLRRIEPAGSPARYETRVGDNHHHLVCRQCGKVTDVDCAVG
FT                   HAPCLAPASDAGYLVDEADVIYWGMCPDCRSEDAR"
FT   gene            523566..524666
FT                   /locus_tag="Sros_0519"
FT   CDS_pept        523566..524666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bar:GBAA1855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83543"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2R6"
FT                   /inference="similar to AA sequence:KEGG:GBAA1855"
FT                   /protein_id="ACZ83543.1"
FT                   /translation="MDTYIPRRLGVATAIALSCLLVTACSTTAESSSPSSTPDVAEKPT
FT                   ASGEAAPTPERRPYTISFGGDVHFEGVLRSRLDANPRTALGPIAKVLSRSDLAMVNLET
FT                   AITTGGTKAPGKQYTFRAPASALTALKAAGVDVASMANNHGMDYMESGLTDSLAAIRRS
FT                   KFPIVGVGRNEAEAYRPWRTTVNGNRVAVIGATQVLDSEFIQAWTAAGDKGGLASAKDE
FT                   PRLIQEVRRARKNSDTVIVHLHWGTELQKCPNEAQRGLAPKLVAAGADVVVGGHAHILL
FT                   GGGYLKNGYVNYGMGNFAFYNSGPETGRTGVLTLTINGRKVLKDQWTPATIQGGVPVPL
FT                   TGANRQQAVTGWKALRGCTGLAAKPG"
FT   sig_peptide     523566..523655
FT                   /locus_tag="Sros_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.475 at
FT                   residue 30"
FT   gene            524723..526531
FT                   /locus_tag="Sros_0520"
FT   CDS_pept        524723..526531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0520"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="KEGG: rpi:Rpic_1295 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83544"
FT                   /db_xref="GOA:D2B2R7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2R7"
FT                   /inference="similar to AA sequence:KEGG:Rpic_1295"
FT                   /protein_id="ACZ83544.1"
FT                   /translation="MRWVRSGDVRLALFEEGDPAAPTVLLLHGYPDTHRVWDEVAGLLR
FT                   DRFHVVRYDVRGAGRSGAPRDGGDYTYDHLAADMAAVLDAVGKPGVHLVGHDWGSIQGW
FT                   ELIGRPEIKGRVTSFTSFGGPGLDQAAHFMRHGRRAEVAGQLLRSWYIGVFQAPVAPEL
FT                   AWRTVMPRVLERTMRISEGIAPRPGHPADTLREDGVNGLGLYRANMSTVRRTPRAEPVV
FT                   ETPVQLIETTRDPFVSPALLASLRPWVPRMWHRRIAAGHWAQRSHPEVIARMIAEFAEH
FT                   VELAEGAGPAEGVGGAEGVRGVRPSRELRRARTGAGERGPYEDRLVVVTGAGGGIGRAT
FT                   ARAFASHGAEVICSDIDLAAARRTADGISATWRTAHAYRVDVADVAEMERFARLVRDEH
FT                   GVPDIVVNNAGIAVAGPFLDHSVEDWRRTLDVNLWGVIHGCRLFAAQMVERGEGGHIVN
FT                   IASLAAFAPSRALPAYSTSKAAVKMLSDCLRAELAGQGIGVTAICPGFVSTGIAGSATY
FT                   LGGDAAPRAREDAAARADRALTRRGYPPERVAAHILRAVHRNRPVVAVNAEGKIGYALS
FT                   RISPAVMRRLARLSGAGEISRLADRD"
FT   gene            526563..527210
FT                   /locus_tag="Sros_0521"
FT   CDS_pept        526563..527210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0521"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: scl:sce5559 HTH-type transcriptional regulator
FT                   BetI"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83545"
FT                   /db_xref="GOA:D2B2R8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2R8"
FT                   /inference="similar to AA sequence:KEGG:sce5559"
FT                   /protein_id="ACZ83545.1"
FT                   /translation="MSPLPVEEPDEAPLRRQPTQRRSARRVERMLDACADLLDEVGYDA
FT                   LSTTRIAERAGVAIGSVYQFFPDKRAITQAVTRRHVERFVSRVGRRFLWEDYAGWWDAV
FT                   DAIIDEYVEMHRTVPGFRSLHFGDVVDLNLLDGVADNNTVIAGRLRGLLLQEYGLTDSE
FT                   ELDLAILVAVEAGDAVLKLAFRRDPAGAPEIVAEAKRLIRGYLNRQFAGASA"
FT   gene            complement(527186..527773)
FT                   /locus_tag="Sros_0522"
FT   CDS_pept        complement(527186..527773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0522"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83546"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2R9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83546.1"
FT                   /translation="MGMSKQTTFTLTFLVGLSVLVPGSAGYLSAKMDAVQRAYSDLVSL
FT                   ESRLREEQLLAPVQEAPQIQTIAVPAMPCEIPPLSQPKRKRAPAPPALIPVPVEALPSE
FT                   PLPEESEPAEGLRIEPLPDEPGESRIGNRRPFAGRGDAVGREIGRPEPRDQIVISERNM
FT                   VEEEAPPPSVPLRRIPSGTGYPGPDQAEAPAN"
FT   sig_peptide     complement(527681..527773)
FT                   /locus_tag="Sros_0522"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.869 at
FT                   residue 31"
FT   gene            527937..528476
FT                   /locus_tag="Sros_0523"
FT   CDS_pept        527937..528476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83547"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2S0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83547.1"
FT                   /translation="MAHVTHEQLDRLLEQALLADDHEDLARRLEALVGAYISGDISRAA
FT                   ILVLAAEEWRQAGQPARALDCFQRAVDDGGEVGVDPRAGIADTLFELEQPDEGREVIEA
FT                   IRVDGEVTPATALTVAETLVAYGDLREAHRWATEGAQGAVEGSGEYTALLRTRYRIRVD
FT                   LGLPEDELDALLDASH"
FT   gene            complement(528650..529402)
FT                   /locus_tag="Sros_0524"
FT   CDS_pept        complement(528650..529402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0524"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to CG10625 CG10625-PE"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83548"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2S1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83548.1"
FT                   /translation="MSNTSRHIRGLLAVAALTAGVSWLVAAPASAGGVPCQGRDMVELL
FT                   ETPESVAAVCDEVGDVRAAATAGRTTVPARGEGPASMERLARIAGLPGLSQASAVVSFA
FT                   DTAGVAAGTGVPALPALPSGMPGFPGHASAGTLAAAPDLPGLPGTPGTDLIRFPVSEVP
FT                   SVPRLTDPTGALSDSGTALPLQLQDPVSVKAVTEDLPAAIEPEVPQVPAVPVTSPADAA
FT                   PSKVTSEVREETAELPVLDQVLPQLGLD"
FT   sig_peptide     complement(529307..529402)
FT                   /locus_tag="Sros_0524"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 32"
FT   gene            complement(529514..532096)
FT                   /locus_tag="Sros_0525"
FT   CDS_pept        complement(529514..532096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0525"
FT                   /product="ATPase AAA-2"
FT                   /note="KEGG: aba:Acid345_4765 ATPase AAA-2"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83549"
FT                   /db_xref="GOA:D2B2S2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2S2"
FT                   /inference="similar to AA sequence:KEGG:Acid345_4765"
FT                   /protein_id="ACZ83549.1"
FT                   /translation="MDYKLTQKSQEAVSSAIRRAAAEGNPEVAPAHLFTSLLGQTGGTA
FT                   VPLLEAVGADWKQLRTEAERQLAALPKAQGATVGAPSSSRQLLTVLNTAAQRARQLEDE
FT                   YVSTEHLLVGLAADGGPVAELLKSRGATPNTLLDAFEKVRGHARVTSETPEDTYQALEK
FT                   YGVDLTERARAGKLDPVIGRDSEIRRVIQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQR
FT                   IVAGDVPSSLRNKRLVALDLGAMVAGAKYRGEFEERLKAVLSEIKESDGQVVTFIDELH
FT                   TMVGAGAAEGAMDAGNMLKPMLARGELRMIGATTLDEYRERIEKDPALERRFQQVYVGE
FT                   PTVEDTIAILRGLKGRYEAHHQVQIADSALVAAASLSDRYITSRFLPDKAIDLIDEAAS
FT                   RLRMEIDSRPVEIDQLQRNVDRMKMEELALAKETDEGSIQRLERLRKELADRQEELNGL
FT                   VGRWEREKAGLNRVGDLKKKLDEVRGAAERAQRDGDFEAASRLMYAEVPKLEAELAEAS
FT                   AAAQPDDPMVKEEVGPDDIAQVISSWTGIPSGRLLEGESAKLLRMEEELGRRLIGQKEA
FT                   VQAVSDAVRRARAGISDPDRPTGSFLFLGPTGVGKTELAKSLADFLFDDERAMVRIDMS
FT                   EYGEKHSVARLVGAPPGYIGYEEGGQLTEAVRRRPYTVVLLDEVEKAHPEVFDILLQVL
FT                   DDGRLTDGQGRTVDFRNVILILTSNIGSQFLVDPKLDKDAQQKAVMDAVRNSFKPEFLN
FT                   RLDDVILFEALGVEELSRIVDLQVTHLARRLADRRLTLTVTPAARDWLALTGYDPMYGA
FT                   RPLRRLVQSSIGDKLAKEVLSGEVQDGDEVLVDLDKTSDTLEIGPVRA"
FT   gene            complement(532264..532611)
FT                   /locus_tag="Sros_0526"
FT   CDS_pept        complement(532264..532611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0526"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="KEGG: nis:NIS_0956 MerR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83550"
FT                   /db_xref="GOA:D2B2S3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2S3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83550.1"
FT                   /translation="MEANYFDLSDDTPVYVISVAAQLSGLHPQTLRQYDRIGLVSPGRT
FT                   SGRGRLYSTRDIVMLREVQRLSQEEGINLAGIKRILALENEALRLRDENHRLRAEMTMI
FT                   RALIQYQLPPA"
FT   gene            complement(532614..533804)
FT                   /locus_tag="Sros_0527"
FT   CDS_pept        complement(532614..533804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0527"
FT                   /product="chaperone protein DnaJ"
FT                   /note="KEGG: glo:Glov_2828 chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83551"
FT                   /db_xref="GOA:D2B2S4"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2S4"
FT                   /inference="similar to AA sequence:KEGG:Glov_2828"
FT                   /protein_id="ACZ83551.1"
FT                   /translation="MSTKDYLEKDYYAVLGVPKTATAEEIKKAYRKLARQYHPDANQGS
FT                   TETEAKFKEVSEAYDVLSDTKRRKEYDEARTLFGSGLGGYAGGGGASRGGGFPFDLGDL
FT                   FGGTNQPQGGAGERIGDLFGGIFNRGGTTRAGGTTTTRARRGQDIESEVTLSFGEAVDG
FT                   ATVSLRLTSSSACTACSGTGAKAGTTPRVCPTCEGTGAASRNLGNFAFSEPCRDCKGRG
FT                   LLVDNPCPVCEGSGRGKSTRTIQARIPAGVGDGQRIKLKGKGAPGENGGPAGDLYVQIH
FT                   VKSHPVFGRTGENLTITVPVTFTEAALGAEIKVPILKGLPVTLRIPEGTPNGRTFRVRG
FT                   RGVPRKDGTKGDLLATVEVLVPQQLEDKARNALEEFRDATAGGDPRADLIQQARSE"
FT   gene            complement(533833..534414)
FT                   /locus_tag="Sros_0528"
FT   CDS_pept        complement(533833..534414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0528"
FT                   /product="co-chaperone GrpE"
FT                   /note="KEGG: bmn:BMA10247_2208 co-chaperone GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83552"
FT                   /db_xref="GOA:D2B2S5"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2S5"
FT                   /inference="similar to AA sequence:KEGG:BMA10247_2208"
FT                   /protein_id="ACZ83552.1"
FT                   /translation="MNTRENGSGEEPVIRDNRKIDPETGEVRETVKEQADQPAPAADLA
FT                   SIELATQLAERTADLQRLQAEYSNYRKRVERDRTVVKEQAVAGVLAELLPVLDDIGRAR
FT                   DHGELTGGFAKVSESLETATGKLGLSAFGTKGEPFDPTVHEALMHSYSPDVAEPTCVEI
FT                   LQSGYRIGERVLRPARVAVAEPEEPASNDN"
FT   gene            complement(534443..536314)
FT                   /locus_tag="Sros_0529"
FT   CDS_pept        complement(534443..536314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0529"
FT                   /product="class I heat-shock protein (chaperonin)"
FT                   /note="KEGG: bha:BH1346 class I heat-shock protein
FT                   (chaperonin)"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83553"
FT                   /db_xref="GOA:D2B2S6"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2S6"
FT                   /inference="similar to AA sequence:KEGG:BH1346"
FT                   /protein_id="ACZ83553.1"
FT                   /translation="MARAVGIDLGTTNSVVSILEGGEPTVIANAQGSRTTPSVVAFAKN
FT                   GEVLVGEVAKRQAVTNVDRTIRSVKREMGTNWSVEIDGKKFSPQQISAFVLQKLKQDAE
FT                   AYLGEKITDAVITVPAYFNDAQRQATQEAGTIAGLNVLRIINEPTAAALAYGLDKEKDE
FT                   TILVFDLGGGTFDVSLLDVGQEDGHGFVEVKATSGDNHLGGDDWDQRVVDELATRFKNA
FT                   HGVDLTKDKMALQRLREAAEKAKIELSSQSETSVNLPYITASAEGPLHLEEKLTRAEFQ
FT                   RITADLLERCKGPFNQVVKDAGIKISDIAHVVLVGGSTRMPAVAELVKELTGGQEPNKG
FT                   VNPDEVVAIGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGIFTKIIERNTTIPTKRS
FT                   EVFTTAEDNQPSVQIQVYQGEREIAAYNKKLATFELTGIAPAPRGIPQIEVTFDIDANG
FT                   IVNVSAKDLGTGKEQTMTITGGSALPKDDIERMMREAESYAEEDKKRREDAETRNNADS
FT                   LVYQTEKFLGENAEKVPDDIKNEVNEALAELKKTLEGTDSAEIRTAAEKLATVSQKMGS
FT                   AIYAQSQGSEAPAGAPGAENTAGQESDDNVVDAEIVDDEPKREDGKK"
FT   gene            536520..537098
FT                   /locus_tag="Sros_0530"
FT   CDS_pept        536520..537098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0530"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: rpb:RPB_1210 sigma-24 (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83554"
FT                   /db_xref="GOA:D2B2S7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2S7"
FT                   /inference="similar to AA sequence:KEGG:RPB_1210"
FT                   /protein_id="ACZ83554.1"
FT                   /translation="MIGSPDLGLGPGTGEWSPRDDFDRVFDAHFAEIHRYVARRLDTDA
FT                   ADDLAAETFLVAFRERERFDAARGGVRPWLYGIATNLLARHRRSEVRRWKALSRTEATG
FT                   QVDSHENAVAARVAAGQVTGRLAGALAGLAKRDRDVVLLIALGGLAHAEVAAALGIPYG
FT                   TVASRLNRARKQLRKALGDVNPLKEAGDG"
FT   gene            537091..538221
FT                   /locus_tag="Sros_0531"
FT   CDS_pept        537091..538221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0531"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0231 Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83555"
FT                   /db_xref="GOA:D2B2S8"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2S8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83555.1"
FT                   /translation="MDEITLLGAALPDAPPPTPEAVARARARLTAHGVRRRRHPTWTLI
FT                   IGASMATAAVITAVALAATLLAPAPPSVLETPKTGEHLLRELADRVEKLSPGTGAYWRV
FT                   QGTRVNRYAVGTGPTRYWIASRGEVRQWTPRKPGALYVQETELSGIRPDTPRDEKIWRK
FT                   QGSPDRWRLPKCESSSPPCAPTALADKRSRREYRIMGDVPDPGLGGLTIAELDALPTDP
FT                   ARLRERLEGYRKAEQKRGLKRSWEEFLKAAVRDMTVTPVSPGLRAALLRLYVEQPGAEV
FT                   AREDSDPLGRPAIAIDLETKGYFQLGTRMVPITKEILLDPRTGEGMAERSVTTDAEGGF
FT                   PKGTVAHYVVVEKMGWTDERPKLPSGCRLKAGVTCR"
FT   gene            complement(538272..538730)
FT                   /locus_tag="Sros_0532"
FT   CDS_pept        complement(538272..538730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83556"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2S9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83556.1"
FT                   /translation="MIASSILAGSLLLTAGCGAGHSTVTTGTATADSPSRPVSHTVAPR
FT                   EEPTQGPKPTKPQGHTDNPRKVRWLTAKPSKDGRSLRVTWWSGVEPCTVLDRVTVRETS
FT                   KRVTVTLWEGPSAKAKNMACIAIAIQKVTTVKLKAPLGNRKVVDGAKP"
FT   sig_peptide     complement(538635..538730)
FT                   /locus_tag="Sros_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.704 at
FT                   residue 32"
FT   gene            538994..539788
FT                   /locus_tag="Sros_0533"
FT   CDS_pept        538994..539788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0533"
FT                   /product="Pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="KEGG: afw:Anae109_1387 pyrroline-5-carboxylate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83557"
FT                   /db_xref="GOA:D2B2T0"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2T0"
FT                   /inference="protein motif:PRIAM:1.5.1.2"
FT                   /protein_id="ACZ83557.1"
FT                   /translation="MIAILGTGKMGEALLSGLLRAGFKPGDVLVTARRAERAEALRERY
FT                   GVQVVSNAEAAKSADTIILAVKPQDMASLLTEIATHVPADRLVISAAAGITTSFVESRL
FT                   GADIPVVRVMSNTPVLVDEAMSVISAGAHASEEHLRRTEDLLRPVGKVLRIPETQQDAA
FT                   TALSGSGPAYFFYLVEAMVDAGILLGMPRAAALDMVTQSIVGAAIMLRDSGEHPVILRE
FT                   AVTSPGGTTIAAIAELERHSVRAAFLAAIEAARDRSRQLAGG"
FT   gene            539863..541101
FT                   /locus_tag="Sros_0534"
FT   CDS_pept        539863..541101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0534"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yen:YE2035 putative membrane transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83558"
FT                   /db_xref="GOA:D2B2T1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2T1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83558.1"
FT                   /translation="MAQAVQAGDQRGQAGPAVWSRSFGLFFTARSVSMLGAAMVPFATA
FT                   VGVGGLGYGATGVGLALAAWMGPFAVLILFGGVFADRFTPRRMMIGADTVRVVTQGAGA
FT                   ALFVFDRPQLWQILVISAVNGVAAAMYQPGVSSTVPRVAADVQRANATLRVSESIMLLA
FT                   GPGVAGAIVGFAGVGVVFAIDAVGFAISAACLLLLRLPVVAAPAAEASMWRNLRGGWQE
FT                   FRSRTWMWSVILIWAVFGVTLFGPMIPLGSVLITGRLDEAAYGLVMSASGAGTIVGGLV
FT                   AMRVRPVRPLMAGAIGLFGFGLEPLSIATEAPLAIMMAAHVVGGAGWAFWSVMWATSVQ
FT                   TQVPPEALNRVTAYEVAGSTLFVPLGQVLAGPVAGVVGARELLAVSSVVAVAGCVALLL
FT                   VPAIRGLRRVAPA"
FT   gene            541373..542536
FT                   /locus_tag="Sros_0535"
FT   CDS_pept        541373..542536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0535"
FT                   /product="Histone deacetylase"
FT                   /note="KEGG: bsu:BSU29710 acetoin dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83559"
FT                   /db_xref="GOA:D2B2T2"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003085"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2T2"
FT                   /inference="protein motif:PRIAM:3.5.1.98"
FT                   /protein_id="ACZ83559.1"
FT                   /translation="MSRSVRVVWDDALIAYDFGPGHPLAPVRVELTMALARELGVLDAV
FT                   EVTGCAPATDDELALVHKRDYIEAVKRVSATGRPDLAHGLGTDDNPAFAGVHEASALIT
FT                   GASLAAARAVWTGEAEHAVNVAGGLHHAMAAAASGFCVYNDPAVAIGWLLAQGASRIAY
FT                   VDVDVHHGDGVQALFYDDPRVLTISLHESPRTLFPGTGFPEERGAEGTAVNVALPAGCG
FT                   DSGWLRAFHAVVPPLLREFAPEILVTQHGCDSHALDPLAHLMLSLDGQRAAYAALHELA
FT                   HETAGGRWVVTGGGGYELVQVVPRAWTHLIAEVSGHPLAPATATPEAWRRLVRERTRQT
FT                   PPLSLTDGRDPEFSDFSAGYDPADPIDRAIMATRKAVFPFHGLDPLP"
FT   gene            542604..543419
FT                   /locus_tag="Sros_0536"
FT   CDS_pept        542604..543419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83560"
FT                   /db_xref="InterPro:IPR031423"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2T3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83560.1"
FT                   /translation="MTASELRRPASPPTRDDLREHLVRTRIAGDVATSRENNLDHYRSL
FT                   SNRDPHHMFGLTLEGHWAYRDVLALMAKSAGVVADPEHREGQDVIDPDRTIDAVEAMGD
FT                   TIAGVLRTGGPRILFATGHPTGLLTIHMALARLVREHGAILMGPAEGWSYWSAGFGRKR
FT                   QIRYMDDVAMLADRGTFVHTHDPAPMRAMIDELGDDRPDLVIADHGWAGAAGEAGILTV
FT                   GFADSNDPALFVGEAEGKIAVTVPLDDNVLPRYYDPLTRHLVERVVRAL"
FT   gene            543742..543945
FT                   /locus_tag="Sros_0537"
FT   CDS_pept        543742..543945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bsu:BSU33370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83561"
FT                   /db_xref="GOA:D2B2T4"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2T4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83561.1"
FT                   /translation="MGAGERPLSEVKFLTVAEVATVMRVSKMTVYRLVHSGELPAIRVG
FT                   RSFRVPEQAVHDYLRDAYIEAG"
FT   gene            544178..544330
FT                   /locus_tag="Sros_0538"
FT   CDS_pept        544178..544330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0538"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dat:HRM2_30640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83562"
FT                   /db_xref="InterPro:IPR013177"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2T5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83562.1"
FT                   /translation="MLFAHRFDNLGYQLPGGPVGSVIKKRRKRMAKKKHRKLLKKTRIQ
FT                   RRNKK"
FT   gene            544354..545379
FT                   /locus_tag="Sros_0539"
FT   CDS_pept        544354..545379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0539"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="KEGG: dal:Dalk_1814 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83563"
FT                   /db_xref="GOA:D2B2T6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2T6"
FT                   /inference="similar to AA sequence:KEGG:Dalk_1814"
FT                   /protein_id="ACZ83563.1"
FT                   /translation="MTHTVLVTGVSRHIGARVASVLAADPDIDRVIGVDTVPPPSLSRD
FT                   GGVPLGRTEFVRVDLRSPDIAQVIAAADIDTVVHMSLVSAPPRSGGRMLMKEHNVIGTM
FT                   QLLGACQRSATVRRVVVRSTTAVYGSSPHDPAVFTEDAEPGESPTHGYAKDASEVEGYV
FT                   RGFARRRGDVTVSMLRFANFMGPGVDSPLTRYFTQPVLPTVFGFDPRLQFVHEDDAVEV
FT                   LRRMAMEDHPGTFNVAGDGVLLLSQCARRAGLLSLPVPSPAFRLLGDLARGAGLVDFSP
FT                   EQLRLMCHGRVVDTARLAARLGWKPKFSTSAAFEDFVRARDLAGGLPAAMMELISQAVT
FT                   R"
FT   gene            545385..546380
FT                   /locus_tag="Sros_0540"
FT   CDS_pept        545385..546380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0540"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="KEGG: dal:Dalk_1813 phospholipid/glycerol
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83564"
FT                   /db_xref="GOA:D2B2T7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016676"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2T7"
FT                   /inference="similar to AA sequence:KEGG:Dalk_1813"
FT                   /protein_id="ACZ83564.1"
FT                   /translation="MAGESAETDDAQVIPITRARSSHGSPSSEDEPPSSEGEPSGRGPA
FT                   PDEDGDRDRGLAELLAFLRRRVTGEYEVDEFGFDPELTDKVLLELIRPLYRHWFRVETV
FT                   GMHNVPGDSGALVVANHSGTLPLDGLMLQVALHDDHPERRAVRLLGADLVYQLPLLGHL
FT                   SRKTGHTLACRDDADRLLRKGELVGVFPEGFKGVGKPFSERYKLQRFGRGGFVASAIRA
FT                   GVPIVPCSIVGAEEIYPKVGDLRFLARALGLPYLPITPLFPWLGPLGLVPLPSKWMIGF
FT                   GEPIRTDQFDPADADDPMLVFNLTDQVREVIQQQLNELRLQRGHAFPPFF"
FT   gene            546528..547562
FT                   /locus_tag="Sros_0541"
FT   CDS_pept        546528..547562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0541"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="KEGG: ank:AnaeK_2103 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83565"
FT                   /db_xref="GOA:D2B2T8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2T8"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_2103"
FT                   /protein_id="ACZ83565.1"
FT                   /translation="MGARRTAGRALVAGLALGAALGIATRRRGAHAETALGGHRGRPVT
FT                   VVTDDGVRLAVDVEEAESPEFAVVLAHGWVMNRHCWHFQREALAGRATLIFYDQRGHGA
FT                   SSAGALDACTVDRLGDDLAAVIEQAVPEGLPVVLVGHSMGGMTIMAFAGRHPAAFASRV
FT                   AGVALLSTSSGRLADSTFGLPGPIGRLAPRVTPVVFDRMLTRAAAIDRSSALKSRTNLP
FT                   VTRYIAFGPRAPRAHVHFVNGMAAATPTEVMVGFFRDFLVHDKLAALAALGSVETLVMV
FT                   GDRDRLTPPVHSRRIARSIPGAGLTVLPGAGHMIGLERPEAVNQALSDLLDRVARRVGG
FT                   HRER"
FT   sig_peptide     546528..546626
FT                   /locus_tag="Sros_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.866 at
FT                   residue 33"
FT   gene            complement(547708..548577)
FT                   /locus_tag="Sros_0542"
FT   CDS_pept        complement(547708..548577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0542"
FT                   /product="Phosphoserine phosphatase-like protein"
FT                   /note="KEGG: afw:Anae109_1214 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83566"
FT                   /db_xref="GOA:D2B2T9"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2T9"
FT                   /inference="protein motif:COG:COG0560"
FT                   /protein_id="ACZ83566.1"
FT                   /translation="MKRLRRRQDDGPEIAGEVAAAAAVAMPMADPDPTAAAFFDVDNTM
FT                   MRGASIYHFARGLASRGLFTTKDLLKFALGQAVFRVRGDENPEHIAQARETALAFVAGS
FT                   RVEEIVRLGEEIFDEAMADRIWPGTRALAQSHLDAGQRVWLVTATPVELARVIAQRLGL
FT                   TGALGTVSETVDGVYTGRLVGDLLHGPAKAEAVRALARREGLDLSRCSAYSDSANDLPL
FT                   LSLVGHATAINPDGELREHARENKWDIKDFRTGRKATMIALPIAAGAGAVAGGVAAAVA
FT                   LRRLYRSK"
FT   gene            complement(548729..549400)
FT                   /locus_tag="Sros_0543"
FT   CDS_pept        complement(548729..549400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83567"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2U0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83567.1"
FT                   /translation="MGKWLPGISRRSQARIQNRVSRLGARMGGGPRPEFRSELRTRLVN
FT                   TSGPEDPPAERAAPVRPRPRPGLLVQFLSLSLAATVVMAGLATYRSMPGDTLYPLKRAA
FT                   ESTLFHLSTDDAERAGRSFDYAETRAHEVEELLGSSRRPNRLIKETLQDMEDTTRSAIT
FT                   SLTRVRRRDAKSEAKSTGQLKRFVQKQRNQIEGMLPRMDVEERRRAHGYLNYIEGLAPP
FT                   E"
FT   gene            complement(549508..550152)
FT                   /locus_tag="Sros_0544"
FT   CDS_pept        complement(549508..550152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0544"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: aba:Acid345_3132 sigma-24, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83568"
FT                   /db_xref="GOA:D2B2U1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2U1"
FT                   /inference="similar to AA sequence:KEGG:Acid345_3132"
FT                   /protein_id="ACZ83568.1"
FT                   /translation="MPDTWPFAGPLPTVSGVAQPVRRNELAVREDASEDLRRLVLRAKT
FT                   GDADAFGTLYDRYLDLVYRYIYFRVGSHPLAEDLTSETFLRALRRIADFTWQGRDFGAW
FT                   LVTIARNLITDHFKSGRYRLEVSTAEVIDIPLDGPHIPENAVVTAMINDRVLSAVRDLG
FT                   PEQQECVVLRFLHGMSLAETALIMGKKSGAIKALQFRAIRALARALPSDLS"
FT   gene            550356..552152
FT                   /locus_tag="Sros_0545"
FT   CDS_pept        550356..552152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK17443 gene product from transcript GK17443-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83569"
FT                   /db_xref="GOA:D2B2U2"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2U2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83569.1"
FT                   /translation="MEVLVAVIAFAGALLAAIATVALIGRLRAEPKGWLIAWSITTAAL
FT                   CLSLGVIATGHLVGFGATTFRVYQLTGSLLAPLWLAIGTVQLLARKSGAGFASWLVGIA
FT                   LTIIASVIMMVDPILQDTTFTKSLPPGGRHWGLLPGYLLGAAHVGVALVLLGGVVLAVL
FT                   RWRGGDDYDADNMHALLALGPTGLALIGAVSFTVPGLFTALLLFVTAAAVWYVVLRPLA
FT                   PYEDEDEDDQPEDDWEDRRPVGRRAASEPRDVQVAGRRALPEESPRRSGLGDLVAEYRA
FT                   GEQDVDYAARMQRQPPVQGDPFGGPATGTFMAGEYGMPSPGQPAGGGEYTRQPPMTGQF
FT                   GMPPGNQATGEYDVPVNEYGRPTAPAAGGPAGPGRPTGPSTGEFARPDPLHGAQPGGSL
FT                   QPMPADQAFGAPTGYGQSAAPGYGGAPGYGQGSDQGLGGAPGYGQAPDRGLGGPTGYGQ
FT                   SAAPGLGGQPAAGSAYPGAAADQPGGSSRPSPGIFGLLTVFTLIDGTGEAFDRLAEETL
FT                   EAVRRSEPDTLVYVCHSVKSAPLQRIVYELYRDEVAYTEHQRQPHVERFVSERQNMVLA
FT                   TNVIELNVNAAKVMPLPMAFRL"
FT   sig_peptide     550356..550445
FT                   /locus_tag="Sros_0545"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.460 at
FT                   residue 30"
FT   gene            complement(552142..552390)
FT                   /locus_tag="Sros_0546"
FT   CDS_pept        complement(552142..552390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0546"
FT                   /product="glutaredoxin 2"
FT                   /note="KEGG: bph:Bphy_0838 glutaredoxin 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83570"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2U3"
FT                   /inference="similar to AA sequence:KEGG:Bphy_0838"
FT                   /protein_id="ACZ83570.1"
FT                   /translation="MAPQDHRITLLGKPGCHLCDDARTVIERVATELGVPWEERDITAS
FT                   EEDQDKYWEMIPVTLVDGVQHDFWRVDENRLRAALRA"
FT   gene            552681..553388
FT                   /locus_tag="Sros_0547"
FT   CDS_pept        552681..553388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0547"
FT                   /product="redox-sensing transcriptional repressor REX"
FT                   /note="KEGG: sfu:Sfum_1603 redox-sensing transcriptional
FT                   repressor REX"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83571"
FT                   /db_xref="GOA:D2B2U4"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2U4"
FT                   /inference="similar to AA sequence:KEGG:Sfum_1603"
FT                   /protein_id="ACZ83571.1"
FT                   /translation="MIRRLSQARERGIPEATVARLPLYLRALNGMAERGLATVSSEDLA
FT                   VAAGVNSAKLRKDLSHLGSYGTRGVGYDVEYLIYQISRELGLTQDWAVAIVGVGNLGRA
FT                   LANYGGFVSRGFRVAALLDADPEVVGDHIAGLNVEHIDELEAVIKRRGVSIVVLATPAA
FT                   AAQQVADRVIAAGVTSILNFAPVVLAVPEGVDIRKVDLSIELQILAFHEQRKTDRMTGG
FT                   PAMAEEWPEAVDL"
FT   gene            553483..554805
FT                   /locus_tag="Sros_0548"
FT   CDS_pept        553483..554805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0548"
FT                   /product="Glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="KEGG: gsu:GSU3284 glutamyl-tRNA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83572"
FT                   /db_xref="GOA:D2B2U5"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2U5"
FT                   /inference="protein motif:PRIAM:1.2.1.70"
FT                   /protein_id="ACZ83572.1"
FT                   /translation="MSVLVVGLSHRTAPVALLERVSVSGDALVKLLHAVQQDACVAEVM
FT                   AVSTCNRVEVYAEVDRFHAAVTAISELLSIHSGVPMEQLSNHLYVHYEDRAVEHLFSVG
FT                   SGLDSMVLGEGQILGQVRSALKLAQEQGTLGPTLNELVQQALRVGKRSHTETGIDRAGA
FT                   SLVGVGLTLAERVLGPIQGKRALVVGAGSMSALSAATLQRAGVTDIVVVNRTHDRAVRL
FT                   AQTVGGRAAELGDLARELAQADLVISCTGATDVVITADMVVAREMFLLDLALPHDVDPA
FT                   VRRLPGVTLVDLESMQDGAADAETDDGGRAEAVVAVRGIVADEVAAYLSAERAARVTPT
FT                   VVALRSKAADVVEAELGRLVARVPELDGRVRDEVTQTIRRVVDKLLHEPTVRVKQLAES
FT                   PAGDHYAEALRELFDLDPKVPRAVRSIERIDAETSKKEVGR"
FT   gene            554802..555722
FT                   /locus_tag="Sros_0549"
FT   CDS_pept        554802..555722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0549"
FT                   /product="Hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: sat:SYN_02273 porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83573"
FT                   /db_xref="GOA:D2B2U6"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2U6"
FT                   /inference="protein motif:PRIAM:2.5.1.61"
FT                   /protein_id="ACZ83573.1"
FT                   /translation="MSSVSSPLRLGTRRSLMATTQSGLVAARLTELTGRAVELVGVTTF
FT                   GDVTKANLTQLGGTGVFVSALRDKLIDGEIDFAVHSLKDLPTTQDPRVVIAAIPPRDDP
FT                   RDALVSTAKLADLPAGSKVGTGSPRRIAQLRVLRPDLEYVPIRGNADTRIGKVTSGELQ
FT                   GVVLAAAGLGRLGREAEISQVFEVEEMLPAPGQGALAVECRADRTDLIEFLSVLDDART
FT                   RAAVTAERAVLNALEAGCAAPVGAYSADDGQNLILTAAVVAVDGKRAVRKSTAGTLSAP
FT                   MDLGRDLAAEMIAEGAGTLIGEQAH"
FT   gene            555719..557299
FT                   /locus_tag="Sros_0550"
FT   CDS_pept        555719..557299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0550"
FT                   /product="uroporphyrinogen-III synthase /
FT                   uroporphyrinogen-III C-methyltransferase"
FT                   /note="KEGG: gme:Gmet_3235 uroporphyrinogen-III synthase /
FT                   uroporphyrinogen-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83574"
FT                   /db_xref="GOA:D2B2U7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2U7"
FT                   /inference="similar to AA sequence:KEGG:Gmet_3235"
FT                   /protein_id="ACZ83574.1"
FT                   /translation="MSSGSTTFERPAGFVAFVGAGPGDEGLLTLRGADLLSKADVVVLD
FT                   QEAYGTLLRHCREGVEVVEAADEDAVSLRTVTAAKGGRVVVRLCAGDPMFFSSITEEVA
FT                   ACAKAEVDFEIVPGVPPATAVLTYAGIPAAVAVPEFRVVDATQVDDWSAHATGAGTLVI
FT                   YNGVSGAVAIGKALIAAGRPDSTPVAISSAGTTTEQYTVVTTLGRIAPDLKHAGMTEPA
FT                   LIVVGEAVGMRDQLSWFETKPLFGWRVLVPRTKEQSAGLVEQLRSYGAVPEEVPTISVE
FT                   PPRTPQQMDRAIKGLVTGRYEWVAFTSSNAVKAVREKFEEYGLDARAFAGLKVAAVGEA
FT                   TARALVQFGVKPDLMPSGEQSSDGLLAEWPPYDSMLDPINRVLLPRADIATETLVAGLT
FT                   ELGWECDDVTAYRTVRAAPPPAPIREAIKGGGFDAVLFTSSSTVRNLVGIAGKPHNVTV
FT                   IAVIGPQTAKTAEEFGLRVDVMADRPSASALAAALAEYGAKQRQAALAAGDVPRRPSQT
FT                   RRGARRRAK"
FT   gene            557690..558676
FT                   /locus_tag="Sros_0551"
FT   CDS_pept        557690..558676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0551"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="KEGG: sfu:Sfum_3057 delta-aminolevulinic acid
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83575"
FT                   /db_xref="GOA:D2B2U8"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2U8"
FT                   /inference="protein motif:PRIAM:4.2.1.24"
FT                   /protein_id="ACZ83575.1"
FT                   /translation="MSAQFPIARPRRLRRMAAMRRMVAGTRLHPAELVLPLFVKEGIGE
FT                   PNPIGSMPGVFQHTRDSLRKAAHEAAEAGVGGLILFGIPAVKDARGSAADDPDGIVQQA
FT                   VADVVADVGDALVVMTDTCLDEFTDHGHCGILTPGGEVDNDATLERYAAAAVSQARAGS
FT                   QVIAPSGMMDGQVAAIRAGLDADGFEQIPILAYAVKYASAFYGPFREAAECAPQFGDRN
FT                   AYQQDAAGPVGEALREVRLDLDEGADWVMVKPALAYLDILRQVRDAVDVPVAAYQVSGE
FT                   YAMIEAAAANGWIDRDRAIMESLVAIRRAGADMILTYWATEVAKKLQ"
FT   gene            558869..559510
FT                   /locus_tag="Sros_0552"
FT   CDS_pept        558869..559510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0552"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_5166 bifunctional DNA
FT                   primase/polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83576"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2U9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83576.1"
FT                   /translation="MVGVPLTRRGRRRAHPKQTISSVLEYAALGWASCPGARPLQSGSR
FT                   ACSCDRVGCPDPGAHPLSVAWQMQATTDPTLLTHWWQREPEANVILPTGRVFDVFDVPA
FT                   AAGLTALAGMDSAGSATGPVAANGDRVLFYVATRNVAEDEDEWWSCPLDFGPATIDEMP
FT                   GLRWHCRDSYVLAPPSALPSGRTGSWLRPPDGRPLPDPLRVLDWLADLCD"
FT   gene            complement(559550..560191)
FT                   /locus_tag="Sros_0553"
FT   CDS_pept        complement(559550..560191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0553"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: gur:Gura_0759 two component LuxR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83577"
FT                   /db_xref="GOA:D2B2V0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2V0"
FT                   /inference="similar to AA sequence:KEGG:Gura_0759"
FT                   /protein_id="ACZ83577.1"
FT                   /translation="MITVLIVDDHPVFRQGLRGLLSAMEIEVVGEASGGQEAVALAAEL
FT                   QPDVVVMDLQMPGGNGVEATRTIVRTSPRIGVLVLTMFRDDDSVFTAMRAGARGYLLKE
FT                   AGAEEIGRAVHAVAAGEAIYGPEIARRVLTYFAGMPDPSRTAFPELTEREREVLELVAQ
FT                   GRGNNEIAGILFLSGKTVRNHVSNIFMKLQVADRAQAIVRAREAGLGGSG"
FT   gene            complement(560188..562251)
FT                   /locus_tag="Sros_0554"
FT   CDS_pept        complement(560188..562251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0554"
FT                   /product="Histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: xac:XAC1994 HrpX related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83578"
FT                   /db_xref="GOA:D2B2V1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2V1"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACZ83578.1"
FT                   /translation="MDGDATPSPPYEDATPSPTYGDTTTSPVDGDAAGGRWRRALAVLV
FT                   WTGAVLAPVCNLLAVRLRELSASTWADPFVTMDPTVVLFPAAGAFLVTRRPRLLVPWLL
FT                   WGSGVIGGLYYLVYSGAHWLYLTDPGGLTPYLAWLGLWLWLWHVPVYISLLPLLFPDGR
FT                   LPSWRWRPVLYANLILMAGHSLFLGLAPDPEFESQLPVANPFGVEALREISPAVESYIG
FT                   APMMALTALGVLSLAFRYRAGDTELRRQIGWYVAALVVVLVSWVLRVMTGSWLLIALEA
FT                   VVIVVLPLSIIAAVLRYRLYGIDIVINRTLVYGSLVAVTGGVYFGLIWLANALASDLGS
FT                   VAGAVAALAVGGVFHPARLRLQRVVDRMFAVERDPYRLADLLGRTGQGAQDPAAALGEV
FT                   VAVIRGALGATGVGVEVRTGWGGPARVFRDGELRLGTQEVPLLWHAERVGTLLVAGAWP
FT                   GREPLAVLARHLAELAHAVRLTADLHRSRERIRTTRDEERRRLGRELHDGLGPALTSVT
FT                   LTLDEARRRLDTDPRAVEKLLVRVREEMTATIASVRELVYGLRPPALDDLGLEGALRAS
FT                   AGETAVTVDGALDDLPAAVEVAAYRIAQEALTNARRHAGPATVLIRLRRLPGELRVEVA
FT                   DDGVGLPESPAAGVGLTSMRERAAEVGGSCVIGRRPGGGTEVTARLPTEEAT"
FT   gene            complement(562368..563753)
FT                   /locus_tag="Sros_0555"
FT   CDS_pept        complement(562368..563753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0555"
FT                   /product="Signal transduction histidine kinase-like
FT                   protein"
FT                   /note="KEGG: tmz:Tmz1t_0179 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83579"
FT                   /db_xref="GOA:D2B2V2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2V2"
FT                   /inference="protein motif:COG:COG4585"
FT                   /protein_id="ACZ83579.1"
FT                   /translation="MAVTTPPARGPGARPSGVHLVLNRTLVYGGLAVVTGGIYSGLTWL
FT                   VTMLAGSQDAVAGLVAALSAGAVFHPARLRLQRGVDRLLRVERDPYRVADRLSRTLQEA
FT                   VDPAEGLVTAAALVRQALRADGVAVEVHDGHTGVVVDGELGDRPVETPLVWHGEPVGRL
FT                   LSSGSGTSPDLLDALARHLAELAHAVRLTADVRRSRERILTTREEERRRLRRDLHDGLG
FT                   PTLASLAMTVDEARLRLERDPEAVEGLLIRVRDQMGTAIIDVRDLVYGLRPPALDDLGL
FT                   VGSLRALADAPGPRVDIAVVGPLGDVPAAVEVAAYRIAQEALTNVRRHAQATTALVRVE
FT                   LVRAGTDHAGVEQTGPPAAGGGSDRSGGAEDGGGGSDRSGGAEDGGAAGRRAAGTGAAA
FT                   RGELRLSVADDGIGLPERVRGGVGLVSMRERAAEAGGSCMVGPRPGGGTEVIVRLPLET
FT                   EKP"
FT   gene            564151..565464
FT                   /locus_tag="Sros_0556"
FT   CDS_pept        564151..565464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0556"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /note="KEGG: aeh:Mlg_0806 glutamate-1-semialdehyde 2,1-
FT                   aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83580"
FT                   /db_xref="GOA:D2B2V3"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2V3"
FT                   /inference="similar to AA sequence:KEGG:Mlg_0806"
FT                   /protein_id="ACZ83580.1"
FT                   /translation="MTTLEGVSRTENSEDLFARAREIVPGGVNSPVRAFGAVGGTPRFM
FT                   ASGQGPYITDVDGNRYVDLVCSWGPMILGHRHPAVVEALQNALAAGTSFGTATPGEVEL
FT                   AEEIVARVEPVEKVRLVSSGTEATMSAVRLARGFTGRSKVVKFAGCYHGHVDALLASAG
FT                   SGLVTFGLPDTPGVTGASAADTVVLPYNSVEAVTEAFRAFGAEIACVITEACPANMGVV
FT                   PPLDGFNATLRELCTAHGALLIIDEVLTGFRVSEAGWYGLDPVDADLMTFGKVMGGGLP
FT                   AAAFGGRADVMAHLAPEGPVYQAGTLSGNPLACAAGLATLRACDDEVYDRVDASALVIG
FT                   RAAADALAAAGVPHRLQRAGSLFSVFFTEDQVTDFDGAQKQNTAAYRAFFHAMLDQGVY
FT                   LPPSAYEAWFLSAAHDDEALSRVADALPVAAKAAAQAS"
FT   gene            complement(565461..566066)
FT                   /locus_tag="Sros_0557"
FT   CDS_pept        complement(565461..566066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cak:Caul_4310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83581"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2V4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83581.1"
FT                   /translation="MTDVSSALDYWPSPPPWGWTADDLDRLPAEGPNGEPDFFKHVELI
FT                   DGALVFMSPQKRFHERMLFGLRVALNAQAPDHVAAIIEMDVKLGHRMRPCPDVLVIDAQ
FT                   AADDDDRTFYTPDEVHLVAEVVSPESEDRDRKTKPFRYAEAGIAHFWRVENNDGGPVVY
FT                   VYELDPATGAYGLTGIHHGRLTVPVPFPIDIDLDKLPR"
FT   gene            566259..566738
FT                   /locus_tag="Sros_0558"
FT   CDS_pept        566259..566738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83582"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2V5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83582.1"
FT                   /translation="MNAESDQTSDPFAPPNPAQARAHRVYASLFRIAERHAATEAQRSR
FT                   QVHPDVLGPHEAIRIVSVLAGGAAEREEGEPEVDNADITAALTLIPLARAEMDQLEAGL
FT                   LLMARGRGLTWQEIAFGLGLGTSQAARQRYERLAGRVTADGGGDGAGAETDDTDR"
FT   gene            complement(566951..568336)
FT                   /locus_tag="Sros_0559"
FT   CDS_pept        complement(566951..568336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0559"
FT                   /product="Amidase"
FT                   /EC_number="3.5.1.4"
FT                   /note="KEGG: bja:bll7917 putative glutamyl-tRNA(Gln)
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83583"
FT                   /db_xref="GOA:D2B2V6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2V6"
FT                   /inference="protein motif:PRIAM:3.5.1.4"
FT                   /protein_id="ACZ83583.1"
FT                   /translation="MSDLHFLGISELGPMLAARELSPVELCQALLARCASLDPLLNAFV
FT                   SLPSERILADARVAEEELRRGDVRGPLHGVPIAVKDNIDVEGERTTAGSRVLADARATG
FT                   DAVIVARLRAAGAIVFGKTNLPEFAYGPLDTYHYGPTRNPWDLHRYAGGSSMGSGSAVA
FT                   AGLVPGAIGTDTTGSIRNPAAWCGVVGLKPTFGRVPTTGVVPLARTLDHAGPMARSAED
FT                   CAVLFDAVADRDPGRAGASHRKGAGRATPLRRSVRGLRAGVLRGFLWEPLSADTAAALT
FT                   VALVALQDMGLEVVDVEVPAWKAAVEAGSTILACEASAEYRRFLRERPGDLIPQIRERL
FT                   EGGLAVPAPDYVDALRATQRLRAELDELFTRVDVLVLPSRERTAPRMEATGRLTEPIGG
FT                   PLYAVPLNGTGLPAVSIPCGFGSDGLPIGVQLAGPAWGEATLLALAHAYQKVTDWHARR
FT                   PRP"
FT   gene            complement(568445..569290)
FT                   /locus_tag="Sros_0560"
FT   CDS_pept        complement(568445..569290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0560"
FT                   /product="5-carboxymethyl-2-hydroxymuconateDelta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="KEGG: bxe:Bxe_C0991 putative fumarylacetoacetate
FT                   (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83584"
FT                   /db_xref="GOA:D2B2V7"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2V7"
FT                   /inference="protein motif:PRIAM:5.3.3.10"
FT                   /protein_id="ACZ83584.1"
FT                   /translation="MRLTTFQTPQGATTYGAVTDRGLVDLGARLGTRYPDLKSLIGDDA
FT                   TVVASEHLDKVDYAASDVTWLPVIPNPNKIICVGLNYEDHRAETGNSVSAQPAVFLRVP
FT                   ESQTGHDSPLLRPRESDTLDYEAEVAVVIGRSGRRITPDTAWRHVAGLSCYNDGSVREF
FT                   QRHTHQYTPGKNFPRTGAFGPWMVTMDEIPADSALTLSCRLNGKIMQHATTSEMIFSIP
FT                   RIISYVSTFTTLAPGDVIATGTPGGVGARRSPQVFMRPGDTVEVEIDKIGVLRNTISDD
FT                   "
FT   gene            complement(569295..569696)
FT                   /locus_tag="Sros_0561"
FT   CDS_pept        complement(569295..569696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0561"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="KEGG: bur:Bcep18194_B0915 endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83585"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2V8"
FT                   /inference="similar to AA sequence:KEGG:Bcep18194_B0915"
FT                   /protein_id="ACZ83585.1"
FT                   /translation="MAKQQVTSEAVSSPSGHFSQAIATQARGRLLFLSGMTARLPDGTV
FT                   TGAGDIDAQTRRVCDNMKNLVEAAGGAMEDIVRVDVFVRNIEHFAAIHRVRREYFPSPP
FT                   PASTLLEVSKMVHPDMLIEINAIAVIQDM"
FT   gene            complement(569812..570564)
FT                   /locus_tag="Sros_0562"
FT   CDS_pept        complement(569812..570564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0562"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpb:RPB_0146 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83586"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2V9"
FT                   /inference="similar to AA sequence:KEGG:RPB_0146"
FT                   /protein_id="ACZ83586.1"
FT                   /translation="MELLDFHPGGYRFIKVEGVFQFSSGVAAAPGFALERVRFARPVPL
FT                   AEGFAAAERYLAAIGRPTTAFAACELRSSAPFTEQGFVDFNRVYVKTLERWGLYADGVN
FT                   PVARTNVCPAYDKPEVPSLHAFSYTVESDSPHPTFVLAGNAECAQGPGEYRDSIVRRGE
FT                   TSIDAMRDKLRFVRAEQEERLRVLGLQWSHVLSTQAYTLHEVGPLLREEIFAYGAGTGA
FT                   VTWHLASPPVVDCEFEMDARTVLREILL"
FT   gene            complement(570800..571531)
FT                   /locus_tag="Sros_0563"
FT   CDS_pept        complement(570800..571531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0563"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="KEGG: rpi:Rpic_4094 transcriptional regulator, GntR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83587"
FT                   /db_xref="GOA:D2B2W0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2W0"
FT                   /inference="protein motif:COG:COG2188"
FT                   /protein_id="ACZ83587.1"
FT                   /translation="MAIQPFNKAPLVDQVRGTILKAILDKQFVDKLPNEDDLAGMLNVS
FT                   RTTVRGALASLEREGIITRRRALGTTINQHVHPSALALQRLVGFTDLLREKGHDVHVEA
FT                   DRSRVERLPKDLVAAFGDSLPDGETFLTDTRFYADGHLAICIRDAVPWSLLQDPSGLPQ
FT                   QGPPTQFDFARAYLVEPIDHAVVEILATVSRSGETRLQMPEGEAFTRLLERHYTREGRM
FT                   MAVSLVDVDNGYVVFEVVRRM"
FT   gene            complement(571599..573062)
FT                   /locus_tag="Sros_0564"
FT   CDS_pept        complement(571599..573062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll3347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83588"
FT                   /db_xref="GOA:D2B2W1"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2W1"
FT                   /inference="similar to AA sequence:KEGG:bll3347"
FT                   /protein_id="ACZ83588.1"
FT                   /translation="MSAGDNERRELEEALHVDEIGIRPVPPEGRDATALQQFWIWAGAN
FT                   LAPISWIVGTVGIALGLSLLETILIAVIGQAVGALIFGLFALMGHRTGVNQMVLARATF
FT                   GRRGAYLPALLQTLMATGWIGINTYVVLDLCLGIAHQMGLQPGDTVKYGLAVAIMIVQV
FT                   VIGVLGFYAIRTFEKYTVPVVTVVMVIMTVVVLTRLEDISWTESSLAGGERFTAATQLL
FT                   TAVGVGWGMGWITWASDYSRFTRPGVSPRRLYAASAMGIFAPLSWLSILGALSGTASQA
FT                   GDPAEIVASLFGIMTVPVLFVILHGPVGTNIVNIYTASLGLLSLDMKLKRTTASLLTGV
FT                   VGFLPLFVFIESESFAAGFTNFMSSVVIWLSPWAGVTLVDWYVIRRRQVECDALYADPR
FT                   TSRYGDVNMRAVSAFLAGLASAWAFQYGAIEAFQGPVARAMGNVDLSWAAGMGVSAVLY
FT                   FLLTRGRADVAAAPPARRVGSAGENVVSS"
FT   gene            573347..573814
FT                   /locus_tag="Sros_0565"
FT   CDS_pept        573347..573814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0565"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PA0000356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83589"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2W2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83589.1"
FT                   /translation="MLRGIVVRGSEGKAYETGPALFKVGGRDTEGRIDFMIMDLEFHTG
FT                   PKLHVHERQEDTFYILSGVLTIQMGEEVYDLEPGDFATVPPGLPHTFDNLREDQGPVRV
FT                   INIMTPGGYEELFGEFDELPEGAGQEEIEAIYAKYEAKLVGPALHERLRRA"
FT   gene            573839..575002
FT                   /locus_tag="Sros_0566"
FT   CDS_pept        573839..575002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0566"
FT                   /product="formyl-CoA transferase"
FT                   /note="KEGG: bam:Bamb_6417 formyl-CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83590"
FT                   /db_xref="GOA:D2B2W3"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2W3"
FT                   /inference="similar to AA sequence:KEGG:Bamb_6417"
FT                   /protein_id="ACZ83590.1"
FT                   /translation="MTGPLSDVVVLDLSRALAGPHAAMMLGDMGARVIKVEQPGSGDDT
FT                   RSWGPPFVGPEDRRESTYFLSCNRNKESIALDLKSETGRDVLGRLVGRADVLVENFRPG
FT                   VLARLGFSTERLHELNPALVILSISGFGHDGPEGGRAGYDQIAQGEAGLMMLTGPSAGE
FT                   PTRVGVPIGDLLAGMYGAYGVVSALHERARTGRGRVVRTSLLAAIVGVHAFQGTRWTVA
FT                   GEVPRPTGNHHPSICPYGLFHTADAPIQVAVGSDGLWRAFAPLVGLDPADPRFAVNGDR
FT                   VAHRRQLIDTIEAAFAAEPAEVWLARLDRAGIPAGRVRTLDEVYEWPQTRSQGLLIDVE
FT                   HPTLGVVTLPGPPLRLDDAPYAGGRDGHLPPPTLGEHTDTILAWLET"
FT   gene            575046..576569
FT                   /locus_tag="Sros_0567"
FT   CDS_pept        575046..576569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0567"
FT                   /product="acetyl-coA carboxylase ; K01959 pyruvate
FT                   carboxylase subunit A"
FT                   /note="KEGG: acetyl-coA carboxylase ; K01959 pyruvate
FT                   carboxylase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83591"
FT                   /db_xref="GOA:D2B2W4"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2W4"
FT                   /inference="similar to AA sequence:KEGG:EHI_082530"
FT                   /protein_id="ACZ83591.1"
FT                   /translation="MTVQAGLGSVSLIEAVVDPGSWRSWDEPVSSVPADPAYRADLARA
FT                   RERTNLDEAVVTGEGTIGGHRVAVMTCEFAFLGGSIGIEAGERLVRAVERATREGLALL
FT                   ASPSSGGTRMQEGTLAFVQMVKVTAAIADHRKAGLPYLVYLRHPTTGGVLASWGSLGHV
FT                   SAAEPGALVGFLGPRVYEAIHGAPFPDGVQTAENLFAHGLLDAVFPPSRLAETVARVLN
FT                   VLHAPRELPAAGLPVHDASSGSVTASVGSLPALPAAESIGRSRRADRPGVRALLARAAS
FT                   DVTPLSGTASGERDPALLLALARFGTAPCVVLGHDRDLPDGHPALGPAGLRAARRGMHL
FT                   AAELGLPLVSIIDTGGAALSREAEEGGLAGEIARCLADLVVLPSPTVCLLMGEGVGGGA
FT                   LALLPADRVIAARHAWLSPLPPEGASAILYRTTDRAAEIAQRQGVRSTDLLRNGVVDRI
FT                   VAELPDAADEPEMFLARMGVVLEEELAALARRDPAERIAARRERYRRIG"
FT   gene            complement(577935..578870)
FT                   /locus_tag="Sros_0568"
FT   CDS_pept        complement(577935..578870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0568"
FT                   /product="DMT superfamily drug/metabolite efflux pump"
FT                   /note="KEGG: bxe:Bxe_A0745 DMT superfamily drug/metabolite
FT                   efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83592"
FT                   /db_xref="GOA:D2B2W5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2W5"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A0745"
FT                   /protein_id="ACZ83592.1"
FT                   /translation="MRTRHLFLAIGLAAVWGFNFVVMEVGLRHFPPLLYVALRFTLAAF
FT                   PAVLFIGGPRVPWRWVLTAGATLGVTQYGLLLLGMRAGMPAGLTSLVVQVQAVFTVILA
FT                   VTLLKERITTRRVAGMGIAFAGLALIALDLGNGGPIGAFVLVVGAALGWGAGNIAVRKA
FT                   APPDSLRFMVWLSAVAAVPMLGLSLLVEGVPRLEFSTEGTLSVLYVALISTLGGFGVWG
FT                   FLLKRYDASVVAPYSLLVPVFGMSSAALFTGEPVSPVKLAAAALIISGVLFAGTRPASR
FT                   TASAGKTSRRSPEPGPPDPSGSHREASTRA"
FT   sig_peptide     complement(578796..578870)
FT                   /locus_tag="Sros_0568"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.783) with cleavage site probability 0.675 at
FT                   residue 25"
FT   gene            578945..579919
FT                   /locus_tag="Sros_0569"
FT   CDS_pept        578945..579919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0569"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="KEGG: pol:Bpro_4368 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83593"
FT                   /db_xref="GOA:D2B2W6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2W6"
FT                   /inference="similar to AA sequence:KEGG:Bpro_4368"
FT                   /protein_id="ACZ83593.1"
FT                   /translation="MLDLNRLKALHAVSVYGSVGAAADALMVTPSAVSQQLAKLERETG
FT                   ATLLERNGRGVRLTDAAGLLADHAERILALVETAEADFEALRGEVVGRLSIGAFPTAAR
FT                   GLLPGALVHLRERHPDLRLQLIEREPERQVREVARGELDLAVIQDWVNRPMAIPDGLSR
FT                   AMLFDDIADVILPESHPLAARSEIELAELSEDRWISSSPGTICHDWLVYTLRSAGLEPD
FT                   IACMADEYPTQLALVAAGQGCALIPRLGRDRVPSGVRAIPILPRPIRKIYALWRSDAAR
FT                   RPAIRAAVEALRTVSVAHRPVEPFEEQAAGAAPGDVRPGEHLS"
FT   gene            580135..581247
FT                   /locus_tag="Sros_0570"
FT   CDS_pept        580135..581247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0570"
FT                   /product="alkaline D-peptidase"
FT                   /note="KEGG: bar:GBAA3033 alkaline D-peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83594"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D2B2W7"
FT                   /inference="similar to AA sequence:KEGG:GBAA3033"
FT                   /protein_id="ACZ83594.1"
FT                   /translation="MMILRKAAWNKLAWTTALVTTVLSAGPAMADSGDTLRRMVADKAA
FT                   TAALLQADEGGRAKASVAGVRDLRTGRPAVADGYFRIGSVTKTFVATVVLQLADEGRLK
FT                   LDDPIQRHLPGLVPNGAAITVRHLLNHTSGLHDYMSEEGYSTNRWRGEDRFRSYTPQQL
FT                   LKVAFAKPPYFKDPGSSWRYSNTNYIVAGMLIEKLTGRPYGKEVERRILRPLKLIRTSV
FT                   PGNAYGLREPHAHGYEALPTGRIVDATRMNPSLDWAAGEMISTTGDLNAFFDGLLGGKL
FT                   TSKAALREMRTTVDTGAGFAYGLGLQKYAVPCGETVWGHSGELIGYMTFAFRADDGRSM
FT                   TLSINPHTRQPSTAEIFAIASDVYCTGKKG"
FT   sig_peptide     580135..580227
FT                   /locus_tag="Sros_0570"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 31"
FT   gene            581509..582147
FT                   /locus_tag="Sros_0571"
FT   CDS_pept        581509..582147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0571"
FT                   /product="Fructose-2 6-bisphosphatase-like protein"
FT                   /note="KEGG: mex:Mext_0502 phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83595"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4A9"
FT                   /inference="protein motif:COG:COG0406"
FT                   /protein_id="ACZ83595.1"
FT                   /translation="MAETTVVHLLRHGEVHNPANVLYGRLPGYHLSETGRQMAETVAKS
FT                   VAGRDVVALFSSPLERARETAAPLAAAFGLEVTVDDRLIEAENIFEGVPVGNGDGVFRS
FT                   PRHYRHLWNPLRPSWGERYTDVVQRMKGAIDTAREAARGHEAIMVSHQLPIWIIRLAAE
FT                   RRRLPHDPRRRQCGLASLTSFSFEGDRLISVGYSEPAGALVKRPTVPGA"
FT   gene            582204..582773
FT                   /locus_tag="Sros_0572"
FT   CDS_pept        582204..582773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0572"
FT                   /product="thiol-disulfide isomerase and thioredoxins-like
FT                   protein"
FT                   /note="KEGG: sse:Ssed_3951 thiol-disulfide isomerase and
FT                   thioredoxins-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83596"
FT                   /db_xref="GOA:D2B4B0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4B0"
FT                   /inference="similar to AA sequence:KEGG:Ssed_3951"
FT                   /protein_id="ACZ83596.1"
FT                   /translation="MRAQSFAAAVLLLTVAGCAGNQGNQPQSGDTRFVAGDGKITVFEA
FT                   ADRKPAPAVEGETLDGGSVTLATHKGKVVVLNFWASWCAPCRAEAPVLKDIAAKTKAGG
FT                   VEFIGIDFKDRKADAIAFERTQQSGYPSIFDQPGKVALSFQGTVPPAAIPSTLIIDRQG
FT                   RIAARALGAVKYNDLLSAVNKVGDEK"
FT   sig_peptide     582204..582263
FT                   /locus_tag="Sros_0572"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.325 at
FT                   residue 20"
FT   gene            582797..583531
FT                   /locus_tag="Sros_0573"
FT   CDS_pept        582797..583531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0573"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /note="KEGG: sit:TM1040_1457 cytochrome c biogenesis
FT                   protein, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83597"
FT                   /db_xref="GOA:D2B4B1"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4B1"
FT                   /inference="similar to AA sequence:KEGG:TM1040_1457"
FT                   /protein_id="ACZ83597.1"
FT                   /translation="MSADLASTVAGGSLALALPIALAAGLVSFLSPCVLPLVPGYLSYV
FT                   TGMSADPKRGRMVAGIALFVLGFAAVFVAGGALFGGLGAALLGNADVITRVLGALTVVL
FT                   GLAFMGVIPGLQRDFRIHRLPAAGLAGAPLLGVVFGLGWTPCIGPTLGVVLTLGLTEGS
FT                   AGRGALLAFAYALGLGLPFLAAGLAYRKALHTFKALRRHSQLITRVGGVMLVAVGLLLV
FT                   TGLWGELIMTMQGWIGGFEPVI"
FT   sig_peptide     582797..582868
FT                   /locus_tag="Sros_0573"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.990 at
FT                   residue 24"
FT   gene            583531..585213
FT                   /locus_tag="Sros_0574"
FT   CDS_pept        583531..585213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0574"
FT                   /product="ResB protein required for cytochrome c
FT                   biosynthesis-like protein"
FT                   /note="KEGG: geo:Geob_1427 ResB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83598"
FT                   /db_xref="GOA:D2B4B2"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4B2"
FT                   /inference="protein motif:COG:COG1333"
FT                   /protein_id="ACZ83598.1"
FT                   /translation="MEEVEQAAGERTASGTSPDSTSSRVSASVNTTLTEKKPEARPAEL
FT                   GLVGWARWFWRTLTSMKTALILLFLFALASIPGSIWPQRGVSDAMVVKYFDDSPQLAEW
FT                   LDRFWLFDVFKAPWFAAIYLLLFLSLIGCVLPRTKAHLRELRRKPPAPPRNLARLPQHA
FT                   SFDGDLTVETAAARLRARRFRVTTGPDWVAGEKGYLRETGNLVFHVALLGLLVAVGMGA
FT                   LYGYRGNVLVVEGEGFANTVAAYDRYMPGQQVSAESLEPFSFALDDFQATYIAQGERRG
FT                   QPLDYEAKLKVTDAPGAPERDYALKVNDPLEVNGTQTYLIDHGYAPTFKITDGKGQVAF
FT                   DGPVPCLVAQPANFTSECVIKVPDAQPEQLGLLVAFRPTTVPVNDDWVSVFPGAANPTA
FT                   QVYGAFAGDLGLKNGRPQSVYELDPASLKKMKPLVMKADPLAVGKRLDLPNGAGSIEFT
FT                   GVKEWIALQIAYDPGRMPAFVASALAVLGLVLSLTVRRRRVWVRLKDAPAEEAGGSGQP
FT                   AQGHEHDRKHVEVGGLTRTEGSDFSEEFAEIVSVLNPGVKDAR"
FT   gene            585203..586165
FT                   /locus_tag="Sros_0575"
FT   CDS_pept        585203..586165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0575"
FT                   /product="ABC-type transport system involved in cytochrome
FT                   c biogenesis permease component-like protein"
FT                   /note="KEGG: pca:Pcar_3065 cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83599"
FT                   /db_xref="GOA:D2B4B3"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4B3"
FT                   /inference="protein motif:COG:COG0755"
FT                   /protein_id="ACZ83599.1"
FT                   /translation="MPAEVDAGLALLSDQLILATVLLYVFAMIGYALDLGFGRSKVKAR
FT                   AVAEPALVTVGGGTAAAPPVSEESPAPAVKAPPAWATWAGPVAVGLSWLGWAANLGSIL
FT                   TRGLAVGRWPWGNMYEFVVAMCFAAVSAFLFMNLRYRIRFLGAFVTVAATLGLGFSVRY
FT                   LQVQAGPVVPALNSYWVAIHVSAAIIASGLFIMAGVSGILYLVRKDTAVRLPSLADLDR
FT                   VAHRAIVIAFPIWTFAVIAGALWADKAWGRYWGWDPKEIWAFITWIAYAAYLHARATAG
FT                   FKGRAAMIVQLIAFACLLFNLVGVNIFLGGLHSYAEVPG"
FT   gene            complement(586257..586574)
FT                   /locus_tag="Sros_0576"
FT   CDS_pept        complement(586257..586574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83600"
FT                   /db_xref="GOA:D2B4B4"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4B4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83600.1"
FT                   /translation="MAYSSGMPLLVALALLAFWLYCLFDAITTPDEEARNLPKLLWVIV
FT                   IVLLPPVGGLFWLLLGRPIGPRAPRMPLPKDRPARPEAPKGPDDDPDFLKDLDRRLRDE
FT                   D"
FT   gene            586669..587505
FT                   /locus_tag="Sros_0577"
FT   CDS_pept        586669..587505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83601"
FT                   /db_xref="GOA:D2B4B5"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4B5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83601.1"
FT                   /translation="MANSADKGRHRRRWWQRGPSQRTESAVREAPREIPPSPERRVGAV
FT                   TAPVVDRPQYTWRDFELEDERPRAQPNAPDVPAMGDGLRHCGRLERILHRQWDSWQGPP
FT                   SPEVVRAVESLARLPDGLKAKLADGLKGIYVGAGGVPDLDDMGYLRGAPLPSGRATWDI
FT                   CAGAYGDRKIVVGDRPSPTPDVMMHEVGHALDDVDAPHGDWVSDSPEFAALYAQCVPVL
FT                   ASGFHRQSGDLGRREFFADAFAAIASRQRPALVDMLGGDTRMALNVMLFFNRRYGI"
FT   gene            587516..587755
FT                   /locus_tag="Sros_0578"
FT   CDS_pept        587516..587755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83602"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4B6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83602.1"
FT                   /translation="MYVIRLADGTLRVPQSLSSDDGRLIGNAYVELSPGDPDYDRWLPE
FT                   ALTEEESAQRRRRWLEENDELEREFLAFKAEQDS"
FT   gene            complement(587895..588134)
FT                   /locus_tag="Sros_0579"
FT   CDS_pept        complement(587895..588134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0579"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cps:CPS_4926 MerR family DNA-binding response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83603"
FT                   /db_xref="GOA:D2B4B7"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4B7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83603.1"
FT                   /translation="MRGGEIVESSSERLLTPGEVAALFRVDPKTVTRWAAAGRISSIRT
FT                   PGGHRRFRESEVHALLRGEDVLTAERPAGESPRV"
FT   gene            588397..588594
FT                   /locus_tag="Sros_0580"
FT   CDS_pept        588397..588594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83604"
FT                   /db_xref="GOA:D2B4B8"
FT                   /db_xref="InterPro:IPR025323"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4B8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83604.1"
FT                   /translation="MHPVFVYTASRLGLLIVTIGVLYLLGLRQPLILLIAAFLVSGVAS
FT                   YVLLSKQRDAVSERITKNRE"
FT   gene            complement(588595..589806)
FT                   /locus_tag="Sros_0581"
FT   CDS_pept        complement(588595..589806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0581"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cja:CJA_0343 rhs repeat family"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83605"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4B9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83605.1"
FT                   /translation="MLLPAGVAAAGTTKHGKVVSADPVNTTPHVLDGIVNAIALVGGTV
FT                   VVGGSFGQVRDAGSAEILERDNIFAYDLATGRILPGFAPYLDRPVHALAAGVGGTVYAG
FT                   GEFAMTGDARTRGLALLRLSDGSPAAGFDAQVYGGTVTGLARSGSRLYVGGDFTGVGHV
FT                   FRAALARLDATTGAVDPDFAVQPGRPRGGRTKVQSIALSGDRLAVDGNFTTLDGLSRPQ
FT                   LGLIDVGTLPATVADWRTDAYAGRCLDVFPSYVRGLDFAPDGSYFAVVTTGGPAGTGKM
FT                   CDTAARFETYSRGEVRATWVNHTGGDSLYSVAVTGAAVYVGGHQRWLDNPLGRDSAGPG
FT                   AVRRPGIGAIHPRTGKALKWNPTRDRGIGVKAFLAHRGGLLVGSDTTRLGHEYHARVGM
FT                   FPLP"
FT   gene            589924..590649
FT                   /locus_tag="Sros_0582"
FT   CDS_pept        589924..590649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0582"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="KEGG: vha:VIBHAR_00562 ubiquinone/menaquinone
FT                   biosynthesis methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83606"
FT                   /db_xref="GOA:D2B4C0"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4C0"
FT                   /inference="similar to AA sequence:KEGG:VIBHAR_00562"
FT                   /protein_id="ACZ83606.1"
FT                   /translation="MTRASLDKQPHEVAAMFDRTARRYDLVNDVISLGQVRLWRKATAA
FT                   AVDAGPGELVLDLGAGTGTSTDTFTALGARAIASDFSLGMLRTGVRRRGGSGLSGGGVR
FT                   GVTFVAGDALRLPFADEVFDAVTISTALRNVQDTGQALREMFRVAKPGARLVILEFSHP
FT                   TVKSFDLVYTQYLMKLMPQAAKLVGSNDDSYEYLAESIRAWPDQAALAKIIQGAGWERV
FT                   AWRNLAMGIVALHRAYKPA"
FT   gene            590798..592075
FT                   /locus_tag="Sros_0583"
FT   CDS_pept        590798..592075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0583"
FT                   /product="geranylgeranyl reductase"
FT                   /note="KEGG: pna:Pnap_1343 geranylgeranyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83607"
FT                   /db_xref="GOA:D2B4C1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4C1"
FT                   /inference="similar to AA sequence:KEGG:Pnap_1343"
FT                   /protein_id="ACZ83607.1"
FT                   /translation="MTVPAAMQRNVAEADADVIVVGAGPAGSTTAFHLAQAGLDVLLLE
FT                   KTTFPREKVCGDGLTPRAVKQLIAMGIDIDAPGWVRNKGLRVVGGGLRFELDWPELSSY
FT                   PDFGLVRTRQDFDEILAANAVRGGVRLLQGVNVTAPILDDRSGHIVGVVAKKDGEEVSY
FT                   RSRLVVAADGNSTRISLAMGLHKREDRPMGVAVRTYFESPRHDDDYLETWLELWDGDTL
FT                   LPGYGWIFGVGDGTSNVGLGLLNTSESFKGMDYRDLLRRWVKNMPPEWGYVEENMTTPI
FT                   RGAALPMAFNRQPHYTRGLVLVGDAGGMINPFNGEGIAYAMETGQIAAETIVQALARTT
FT                   PAQRERVLRAYPQTLKDAYGGYFTLGRGFVELIGHRGVMDFFTRHALPHPHLMRFALKL
FT                   LANLTDRRGDASDRIINALSKVAPPA"
FT   gene            592196..592555
FT                   /locus_tag="Sros_0584"
FT   CDS_pept        592196..592555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0584"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3"
FT                   /note="KEGG: geo:Geob_0462 NADH-ubiquinone/plastoquinone
FT                   oxidoreductase chain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83608"
FT                   /db_xref="GOA:D2B4C2"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4C2"
FT                   /inference="similar to AA sequence:KEGG:Geob_0462"
FT                   /protein_id="ACZ83608.1"
FT                   /translation="MELYAPILVLAVLAAGFAVFSVTIAPFTGPRRWNRAKLDAYECGI
FT                   EPTPQPVGGGRFPLKYMITAMLFIVFDIEIIFLYPWAVAFDQLGMFGLVEMVLFIVTVL
FT                   VAYAYVWRRKGLDWD"
FT   sig_peptide     592196..592261
FT                   /locus_tag="Sros_0584"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.899 at
FT                   residue 22"
FT   gene            592558..593109
FT                   /locus_tag="Sros_0585"
FT   CDS_pept        592558..593109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0585"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: aca:ACP_0918 NADH dehydrogenase I, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83609"
FT                   /db_xref="GOA:D2B4C3"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4C3"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ACZ83609.1"
FT                   /translation="MGLEEKLPSGFMLSTVEQVAGWARKNSVWPATFGLACCAIELMST
FT                   GGPKHDLARFGMERASASPRQADLMIVAGRLSQKMAPVLRQIYDQMAEPKWVIAMGVCA
FT                   SSGGMFNNYAIVQGVDHVVPVDIYLPGCPPRPEMLIDAIVKLHDKIQNTKFGAHRAKQI
FT                   DELELQALRTLPLIDQGTVK"
FT   gene            593197..593874
FT                   /locus_tag="Sros_0586"
FT   CDS_pept        593197..593874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0586"
FT                   /product="NADH:ubiquinone oxidoreductase 27 kD subunit-like
FT                   protein"
FT                   /note="KEGG: reu:Reut_A0963 NADH dehydrogenase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83610"
FT                   /db_xref="GOA:D2B4C4"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4C4"
FT                   /inference="protein motif:COG:COG0852"
FT                   /protein_id="ACZ83610.1"
FT                   /translation="MSTDNLPEVPEEPIAHLGMFGASGSGDTSGYGGLVVRRQAQLSTP
FT                   RPYGGYFDTVADELERALGGDLGDAVERVVVDRGELTFHVKRERLLEVARTLRDDAALR
FT                   FELSLGVSGVHYPHLEGEELRAVIHLCSITHNRRLRLEVSCPDADPHIPSTVSVYPTHD
FT                   WHERETWDFFGIVFDGHPALTRIMMPDDWDGHPQRKDYPLGGIPVEYRGAEIPAPDQRR
FT                   SYK"
FT   gene            593939..595264
FT                   /locus_tag="Sros_0587"
FT   CDS_pept        593939..595264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0587"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: aca:ACP_0294 NADH dehydrogenase I, D subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83611"
FT                   /db_xref="GOA:D2B4C5"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4C5"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ACZ83611.1"
FT                   /translation="MSAPYEEATEGKVYTVSGNDWTELVETLSGQQDEQLVINMGPQHP
FT                   STHGVLRLVLNLDGETVTEARTVIGYLHTGIEKNIEYRTWTQGTTFVTRMDYLAPIFNE
FT                   TAYCMGVEKLLGITDRIPERAQAIRVMMMELTRISSHMVAIGTFGMELGATTPFLFGSR
FT                   EREMVLDVMEYITGLRMNMAYVRPGGVSVDLPAGAVDKVGELLKVMPGRIKDMRKMLDA
FT                   NPVYLARTKDVAYLDLTGCMALGVTGPMLRAAGLPWDLRKSQPYCGYETYEFDVPTEKT
FT                   ADVYGRYLVRVAEMEESLKIIEQALDRLSGPLKGGRVMVDDKKIGWPAQLALGPDGLGN
FT                   SPDHIAHIMSGSMEALIHHFKLVTEGFRVPAGQAFASVESPRGELGAHVVSDGGTRPYR
FT                   VHFRDPSFTNLQAMPATCEGGMVADVISAVASIDPVMGGVDR"
FT   gene            595261..595920
FT                   /locus_tag="Sros_0588"
FT   CDS_pept        595261..595920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0588"
FT                   /product="NADH:ubiquinone oxidoreductase 24 kD subunit-like
FT                   protein"
FT                   /note="KEGG: aca:ACP_0292 NADH dehydrogenase I, E subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83612"
FT                   /db_xref="GOA:D2B4C6"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4C6"
FT                   /inference="protein motif:COG:COG1905"
FT                   /protein_id="ACZ83612.1"
FT                   /translation="MTYTPEVRERLEQDAKEIIGRYPKTRSALLPLLHLVQSEDGYVSD
FT                   DGQEFCAEMLGLSKAEVVGVSTFYTMYKRKPMGDYHVGVCINTLCAVMGGDQIWDELSE
FT                   HAGVGHDETTPDGKVSLERLECNAACDFAPVMMVNWEFFDNQTPASAKQLVDDLRDGKE
FT                   ISPTRGPKKLCTFKEASRVLSGLPDGLAADGPSASGPSLEGLKIAKANGWKAPEAP"
FT   gene            595917..597203
FT                   /locus_tag="Sros_0589"
FT   CDS_pept        595917..597203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0589"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: sme:SMa1525 NuoF2 NADH I chain F"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83613"
FT                   /db_xref="GOA:D2B4C7"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4C7"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ACZ83613.1"
FT                   /translation="MTTLTPVLTANWDQPNSFTLEGYGDYSAARKALGMDPDAVIQAVK
FT                   DSGLRGRGGAGFPTGMKWGFIPQGDGKPHYLVVNADESEPGTCKDIPLMMANPHSLVEG
FT                   IIITSYAIRANHAFIYVRGEVLHVIRRLQAAVAEAYDKGLLGKDLFGSGFDLELVVHSG
FT                   AGAYICGEETALLDSLEGYRGQPRLKPPFPAVAGLYASPTVVNNVESVASVPSIISNGA
FT                   EWFAGMGTEKSKGFGIFSLSGHVTRPGQYEAPLGITLRELLDMAGGIREGHQIKFWTPG
FT                   GSSTPIFTDEHLDVPLDFESVGAKGSMLGTRALQIFDETTCVVRAVLRWTEFYAHESCG
FT                   KCTPCREGTYWLKQVLKRLEKGQGTEEDLTTITDIADNILGRSFCALGDGATSPIHSSV
FT                   KYFRDEYLKHFEIGGCPFDHAPSTVWGTK"
FT   gene            597271..599694
FT                   /locus_tag="Sros_0590"
FT   CDS_pept        597271..599694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0590"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="KEGG: smd:Smed_3617 molybdopterin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83614"
FT                   /db_xref="GOA:D2B4C8"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4C8"
FT                   /inference="similar to AA sequence:KEGG:Smed_3617"
FT                   /protein_id="ACZ83614.1"
FT                   /translation="MTVEATTPAQAPVDLVTVTIDGFQVSVPKGTMIIRAAELLGIQIP
FT                   RFCDHPLLEPAANCRQCLVDIPDAGNGRGFPKPQPSCAIEVAPGMVIQTQLTSPVAEKA
FT                   QRGVMELLLLNHPLDCPVCDKGGECPLQNQAMSNGQGESRFEEKKRTFDKPVALSTEVL
FT                   LDRERCVQCARCIRFSDEIAGDPLIDFFERGAKEQVGAANGEPFESYFSGNTIQICPVG
FT                   ALTGAAYRFQARPFDLVSTPSACEHCASGCSLRTDHRRGKVTRRLAGDDPEVNEEWNCD
FT                   KGRWAFTYATQPDRLKTPLVRDEEGRLVPASWPEALAAAAQGLAAARGSAGVLVGGRVT
FT                   VEEAYGYAKFARIALGTNDVDFRSRPHSAEEAQFLAHAVAGKGIEIRYRDLEKAPAVLL
FT                   VGFEPEDESPIVFLRLRKAWRKKGLKVFSIAPFAGEGLAKMGGTLVRTLPGAEAAAVED
FT                   LISGVSPIAEAVKQPGVIILAGERLATAPGALSALVRLAEAGGARLGWVPRRAGERGAI
FT                   EAGALPNLLPIGRPVDDASARAEVARVWNVASLPDTPGRDTSAILAAALNGELDALVVA
FT                   GVDPDDLADPEAALAALENTPFIVSLEQRASAVTDRADVVLPVATVSEKSGTFVNWEGR
FT                   GRTFEEALPVPGIMSDLRTIAAIADHMDIHLGLPDPAAARRELGSIGAWRGSRAAAPAV
FT                   SARTAAAPKAGEAFLATWHLLLDDGRLQDGEPYLAGTARTGEALVSAATAAESGVADGD
FT                   KIIVTTEQGSLSLPVRIADLPDRVVWLPSNSAGRSVTRDLCATAGDIVKIGSAS"
FT   gene            599691..601037
FT                   /locus_tag="Sros_0591"
FT   CDS_pept        599691..601037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0591"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: aba:Acid345_1308 respiratory-chain NADH
FT                   dehydrogenase, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83615"
FT                   /db_xref="GOA:D2B4C9"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4C9"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ACZ83615.1"
FT                   /translation="MRTLLVAADPTLADFGKDPLWISIIKAAVIFIVLMLGVLFGVWFE
FT                   RKLISRMQNRYGPNRAGKFGLLQSVADGLKMGLKEDLMPRTVDKVIYFIAPVVLAVPAF
FT                   LAFSVIPMGPMVSMFGVTTPLQLTDLPVAVLLVLAMASISVYGIVLAGWGSRSPYTILG
FT                   GLRASAQVVSYEIAMGLSFVGVFLFAGTLSTSEIVSAQASGGTFPLGGLDIPMPSWYMI
FT                   LLIPSFLIYIVTMLGETNRVPFDLPEGEGELVGGFQTEYSNSLKFAVIMLAEYVNVFVV
FT                   SAVSITLFMGGWRAPFPISMWDGANAGWWPLLWFFLKMVLVFSFFIWCRASLPRVRYDQ
FT                   LMALGWKILIPINLGWILLVATVRAMQMETVDKSLVLILAAIVLVGCITIWWRFDSVLQ
FT                   KRKEEKAAQVQAEFEHLEAEPTAGGFPVPPLDLPHYHGVERKEVPSGTN"
FT   gene            601024..601539
FT                   /locus_tag="Sros_0592"
FT   CDS_pept        601024..601539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0592"
FT                   /product="Formate hydrogenlyase subunit 6/NADH:ubiquinone
FT                   oxidoreductase 23 kD subunit (chain I)-like protein"
FT                   /note="KEGG: aca:ACP_3456 NADH dehydrogenase I, I subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83616"
FT                   /db_xref="GOA:D2B4D0"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4D0"
FT                   /inference="protein motif:COG:COG1143"
FT                   /protein_id="ACZ83616.1"
FT                   /translation="MGLTDWLNPVKGFGVTFHTMFKKVETVNYPEEKKPTAPRFHGRHQ
FT                   LNRWPDGLEKCVGCELCAWACPADAIFVEGADNTDEERFSPGERYGRTYQINYLRCILC
FT                   GLCIEACPTRALTMTNEYELADSSRESLIYTKEMLLAPLGPGMELPPHPMRLGETEEDY
FT                   YRLGRNNG"
FT   gene            601532..602344
FT                   /locus_tag="Sros_0593"
FT   CDS_pept        601532..602344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0593"
FT                   /product="NADH:ubiquinone oxidoreductase subunit 6 (chain
FT                   J)-like protein"
FT                   /note="KEGG: ank:AnaeK_4330 NADH-ubiquinone/plastoquinone
FT                   oxidoreductase chain 6"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83617"
FT                   /db_xref="GOA:D2B4D1"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4D1"
FT                   /inference="protein motif:COG:COG0839"
FT                   /protein_id="ACZ83617.1"
FT                   /translation="MGETITFWVLAVVSVSAALGLVFSRKAVYSALMLGVVMLSLAVLY
FT                   AVQDAPFLAAVQIIVYTGAVMMLFLFVLMLVGVDSADSLVETIKGQRFWATIAGLGFAA
FT                   LLALGAGNMVFAPAKGVGGAVQEAGGNVPALAQLIFTRHVFAFEVTSALLITAALGAMV
FT                   LAHRERVRPKATQRDLARARFTGPQPSPLPGPGTYALHNAIDMPALLPDGSVSPKSINR
FT                   VLARHDQEDGVRPTDPAKAALVKQVIDKDVAVEEDVAATEAAHQEDAK"
FT   gene            602341..602637
FT                   /locus_tag="Sros_0594"
FT   CDS_pept        602341..602637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0594"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="KEGG: glo:Glov_3128 NADH-ubiquinone oxidoreductase
FT                   chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83618"
FT                   /db_xref="GOA:D2B4D2"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4D2"
FT                   /inference="similar to AA sequence:KEGG:Glov_3128"
FT                   /protein_id="ACZ83618.1"
FT                   /translation="MTTHYLVLSALLFAIGGAGVLVRRNAIVVFMCVELMLNACNLAFV
FT                   TFARQHGNLDGQLIAFFVMVVAAAEVVIGLAIIVMIFRTRRSASVDDANLLKY"
FT   gene            602648..604570
FT                   /locus_tag="Sros_0595"
FT   CDS_pept        602648..604570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0595"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: ank:AnaeK_0441 proton-translocating NADH-
FT                   quinone oxidoreductase, chain L"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83619"
FT                   /db_xref="GOA:D2B4D3"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4D3"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ACZ83619.1"
FT                   /translation="MQSPVEIVQHSGGVIGVSWLMIALPLLGAAILLLGGRRTDRWGHL
FT                   LGVAMSLAAFVVAVVSFVEILGLPESERRRGIELYQFIPGIADMGLLIDPLSISFALLI
FT                   TGVGSLIHIYSVGYMSHDPDRRRFFAYLNLFVAAMLLLVLADNYVALFIGWEGVGLASY
FT                   LLIGFWQFKPTAAAAAKKAFIVNRVGDFGLLIAIFTVWTTFGSVAFGDLSGATVSGAID
FT                   SGATSQGTITAIGLLLLLGACGKSAQLPLQSWLLDAMEGPTPVSALIHAATMVTAGVYL
FT                   VVRSGAFFEAAPTAQLVVTIVGVATLLAGAIIGCAKDDIKKGLAGSTMSQIGYMMLGAG
FT                   LGPVGYAFAIAHLITHGFFKANMFLGAGSVMHAMNDEVDMRRYGGLFSVMKVTAVTFII
FT                   GYLAIIGFPLLSGYFTKDGIIETAMEHNQILGWLAVVGAGITGFYMSRMIFMTFFGKKR
FT                   WADDAHPHESPSVMTVPLVILSIGSIFLGAFLILDNRFMKFLVPAVGAPEEMPTFHFVS
FT                   TAGLATLALVAAGAAFAWFRYGAAEVPQVAPRGSFLTTFARRDLYGDALNETLFMRPGQ
FT                   WLARIAVFVDNRGIDGLVNGLAATIGGTSGRLRRIQTGYVRSYALSILFGAAVVVGALL
FT                   YVGNM"
FT   gene            604570..606099
FT                   /locus_tag="Sros_0596"
FT   CDS_pept        604570..606099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0596"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: mgm:Mmc1_3623 proton-translocating NADH-
FT                   quinone oxidoreductase, chain M"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83620"
FT                   /db_xref="GOA:D2B4D4"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4D4"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ACZ83620.1"
FT                   /translation="MPWLSILMAVPVLGAVGVSLTKSDKLAKQLALAVSLVVLALTGVM
FT                   AAQFNPSSATRFQFAEVYDWIPRFGVHYGVGVDGIALVLIALSAVLVPIVILASWHDAD
FT                   GTGAAAPPKRSVKTYFALLLVLEAMMIGVFAATDVFLFYVFFEAMLIPMYFMIGSYGGA
FT                   QRSYAAVKFLLYSLFGGLLMLVAVIALYVIADKGTFMFPELVGVIQDPNTQKWLFLGFF
FT                   IAFAVKAPLWPFHTWLPDAAAQAPAGAAVLLVGVLDKVGTYGMLRFCLELFPDAAKFFT
FT                   PLVIVLSVVGIVYGAIVAIGQTDIKRLIAYTSISHFGFIALGVFAMTAHGGAGATLYMV
FT                   NHGFSTGALFLIAGFLIYRRGSSQIADYGGVQKVAPLLAGTFLIAGLSGLSLPGLSSFV
FT                   SEFMVLMGTYERYAVPAIIATSGVILAAIYILWMYQRTMTGPTAESVKGFTDLNIRERW
FT                   VVAPLIAVIIALGFFPKPVLDVINPAVDQTLSNVHVDQFTPAVADKKGAGQ"
FT   sig_peptide     604570..604635
FT                   /locus_tag="Sros_0596"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.697) with cleavage site probability 0.344 at
FT                   residue 22"
FT   gene            606096..607646
FT                   /locus_tag="Sros_0597"
FT   CDS_pept        606096..607646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0597"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain N"
FT                   /note="KEGG: gbm:Gbem_3913 proton-translocating NADH-
FT                   quinone oxidoreductase, chain N"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83621"
FT                   /db_xref="GOA:D2B4D5"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4D5"
FT                   /inference="similar to AA sequence:KEGG:Gbem_3913"
FT                   /protein_id="ACZ83621.1"
FT                   /translation="MNGTIQAPTIEYALLSPMLIVLGAAVIGVLVEAFAPRYLRKSIHV
FT                   PLTLLALVGAFITTILTALNGLPDKAAAMGAIAVDGPSLFIWGIILVLAFVSVLLINDD
FT                   EQFVAQASAVPGSADEEEAVRSGFAQTEVYPLVLFAVGGMLLFPASNDLLVMFVALEVM
FT                   SLPLYLLCGLARRRRLLSQEASVKYFLLGAFSSAFFLYGMALVYGYAGSIELKAIAASL
FT                   STVTGQDTLLYIGTAMLGVGLLFKIGAAPFQAWKPDVYQGAPTAITALMASTVLVAAFG
FT                   ALLRVFWVALGGLEWNWQPVMWGVAILTMIVGAVLAITQTDIKRMLAYSSVAHGGFLLT
FT                   GVIAIGTFAQNTQALSAILFYLAAYGFTTVGAFAVVTMVRDAGGEAGHLSRWAGLGKRS
FT                   PVLAAIFAFFLLAFAGIPLTSGFFGKYAVFAAAVSGGALPLVIVGVVSSAIAAFFYVRV
FT                   IVLMFFSEPAADGPTIATPTLGTSAVVALAAAATVVLGIFPQPVLDLADQAASALFIR"
FT   gene            607661..608656
FT                   /locus_tag="Sros_0598"
FT   CDS_pept        607661..608656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0598"
FT                   /product="Trans-hexaprenyltranstransferase"
FT                   /EC_number="2.5.1.30"
FT                   /note="KEGG: pde:Pden_2031 trans-
FT                   hexaprenyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83622"
FT                   /db_xref="GOA:D2B4D6"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4D6"
FT                   /inference="protein motif:PRIAM:2.5.1.30"
FT                   /protein_id="ACZ83622.1"
FT                   /translation="MAAPPVVDLPFVDERLAQDLASGLAEVEKLLRSSVESEDAFVTEA
FT                   SKHLIEAGGKRFRAMLVLLAAQFGSPEAPGVVPGAVVIELTHLATLYHDDVMDEAPVRR
FT                   GSPSANARWDNTVAILTGDYLFAQASEILADLGADVIRIQAQTFSRLVRGQIRETIGPR
FT                   PGEDHVAHYIDVLADKTGSLIATSGRFGALLSGASPEIVDRLTRACEAIGVGWQLGDDL
FT                   LDVASDSVESGKTPGTDLREGIRTLPVLYVLSSDAPEDARLRELLAGPVAEDDVAETLR
FT                   LLRANPAMVRARAELVAWVDRARADLSGLPDIPARAAYLALCDYVVERSG"
FT   gene            complement(608716..609624)
FT                   /locus_tag="Sros_0599"
FT   CDS_pept        complement(608716..609624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0599"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="KEGG: smt:Smal_0249 RarD protein, DMT superfamily
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83623"
FT                   /db_xref="GOA:D2B4D7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4D7"
FT                   /inference="similar to AA sequence:KEGG:Smal_0249"
FT                   /protein_id="ACZ83623.1"
FT                   /translation="MPESRRGVLYGIAAYTMWGLFPLYWPLLKPSGAVEILAHRVAWSL
FT                   VAVVAILAVRRHWSWFRELMRTPKKVGLLALGAAIITVNWGVYIYAVNTGHVVESALGY
FT                   FINPLVSVLFGVFLLKERLRPWQWGAVGLGTLAVVVLTLDYGRLPWIALVLAVSFGTYG
FT                   LVKKIAQVNAAESLTIETLVLLLPALGYMVYLEGQGGATFGSLGAGHALLLAGGGVITA
FT                   VPLLFFTSAAIRVPLTTLGLLQYIAPVLQFLVGVFVVHEVMPPSRWAGFAIVWLALSVF
FT                   TWDSLRAAREARRTTLETVTV"
FT   gene            609759..610448
FT                   /locus_tag="Sros_0600"
FT   CDS_pept        609759..610448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0600"
FT                   /product="Peptide-methionine (S)-S-oxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="KEGG: mxa:MXAN_7060 methionine-S-sulfoxide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83624"
FT                   /db_xref="GOA:D2B4D8"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4D8"
FT                   /inference="protein motif:PRIAM:1.8.4.11"
FT                   /protein_id="ACZ83624.1"
FT                   /translation="MGWLFGKDKTSMVSPENALPGRDTGMAVPARHAVLDAPLAPPYPE
FT                   GSEIADFGLGCFWGAERKFWQTPGVVSTSVGYAGGYTRNPTYEEVCSGQTGHTEVVRVV
FT                   FDPSKVSYEELLRVFWEAHDPTQGMRQGNDVGTQYRSAVHFHSPEQEKSALTSRDAYQK
FT                   VLTESGYGKITTEIVPAGDYFFAEDYHQQYLFKNPGGYCGIGGTNVKLGDPSEWAACQT
FT                   GLVPTEE"
FT   gene            610892..611857
FT                   /locus_tag="Sros_0601"
FT   CDS_pept        610892..611857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0601"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: GL25530 gene product from transcript GL25530-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83625"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4D9"
FT                   /inference="protein motif:COG:COG3177"
FT                   /protein_id="ACZ83625.1"
FT                   /translation="MYQRLDEAVRELRDRLGGLPSPAEAEDIWSDIWHQEAHNSTAIEG
FT                   NTLVLQEVEKLLEEGRAVGAKPLRDYMEVRGYGDAAKWVYGQALEPGDWQNGDLTTLQE
FT                   IRQIHHSAMSLVWAVDPHPHATPAEGPGNFRQHEIAKFPGGMKPPSWPEVDSKMRDWVK
FT                   IVDGLRSESEEPLPERLAHVHNRFEQIHPFLDGNGRTGRLVLNLILGRIGYPPAIIYKR
FT                   DRDKYLQAMRRADNDEFGPLGELIARSVTTNLYRFVMPAVAGPVKLVPLPALATRDVTE
FT                   NALRMAAARGRLRAVKGDDGMWRSSKKWVNDYLRSRHRRS"
FT   gene            611887..611991
FT                   /pseudo
FT                   /locus_tag="Sros_0602"
FT   gene            complement(612206..613048)
FT                   /locus_tag="Sros_0603"
FT   CDS_pept        complement(612206..613048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83626"
FT                   /db_xref="InterPro:IPR022550"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4E0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83626.1"
FT                   /translation="MNLPGVASGDILSRSRSALLDALGALDAHRDAVIVIGAQAIYLRT
FT                   ARSPVALAETTKDSDLALDPRLLADDPRVEESMSRAGFYRDPLDGQPGAWLNAEGIPVD
FT                   LMVPEALAGPGTKNTRGARIPPHDRRATRRARGLEATLIDNTIVDVAALDKSDTRTYQV
FT                   RVAGPAALLIAKLHKIAERAVLPHRLNDKDAHDAYRILIDTDTADLASTFSVLRREPVS
FT                   SEITNQAFEYLVTLFATGPDALGASMAGRAEEGIGEPETVALSTSLLAADLVTALESR"
FT   gene            complement(613026..614105)
FT                   /locus_tag="Sros_0604"
FT   CDS_pept        complement(613026..614105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0604"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vei:Veis_3722 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83627"
FT                   /db_xref="InterPro:IPR019238"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4E1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83627.1"
FT                   /translation="MEVPWAPQNETTVLQAGMAVLSDRLPTGWSVRSLSDKTVDARHDA
FT                   LWEVAAPDGTTVTLVVEAKRLVERRDIATLHEQLKDFTLTTSRNRGVVVARYLSPPVRK
FT                   QLSDSGLSYIDTTGNIHLNVSRPGLYVTDRGAERDPWRGPGRPRGTLKGAPAAKVVRAL
FT                   LDHDRSWTIRQLVDFADVSTGSTYRVIEFLESEDLATRNSAGAVAIPDWVALLRRWSED
FT                   YGFVRNSRVTRWIAPRGLSNLMERGAGSAVQYAVTGTLAAVEWAPYAPARSAMIYTANA
FT                   EQVAQLWDLRPADAGANVMLAEPQIDVVFTRTLQAASGLTIAAPAQVAVDLMTGPGRSP
FT                   SEAEALIEWMTRNESSWRS"
FT   gene            615082..615210
FT                   /locus_tag="Sros_0605"
FT   CDS_pept        615082..615210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83628"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4E2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83628.1"
FT                   /translation="MSPKRGDRVTAPLPADEWDVRFGAGDAVRGDVRFGTGDAVRG"
FT   gene            complement(615468..616784)
FT                   /locus_tag="Sros_0606"
FT   CDS_pept        complement(615468..616784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0606"
FT                   /product="serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /note="KEGG: slo:Shew_3053 serine-type D-Ala-D-Ala
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83629"
FT                   /db_xref="GOA:D2B4E3"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4E3"
FT                   /inference="similar to AA sequence:KEGG:Shew_3053"
FT                   /protein_id="ACZ83629.1"
FT                   /translation="MGAGFGASRTARRMALLAPGAALLIASCTLPSGASLTALSDASAT
FT                   PAPTASASGLTPPALKPIDPAVFQSAVERAAKKLMVPGALVLLRTPQGTFRATVGTTEL
FT                   GTARPPTTGDHFRIASNTKTMTSALIMLSAQDGRLRLSDPVSAYVPGVPNGEHITIAEL
FT                   LKMRSGLYNYTNAPELAATMDADPGKAVTPQAMLDIAFRRPPNFAPDASYEYSNTDYAL
FT                   LGLVAEKAGGRPLAQQFRDRLFAPLGLAGTSLPAADDLSLPTPYSHGYMYGGSAYALVD
FT                   RPYPADVQAAARSGKLRPMDYTHQNPSYATAAGGVISTADDLATWIRALVTGKVLNPAF
FT                   QQQWLHSPQAEDPAAPGGKKYGYGIAYQRFGPNASMYYHGGELPGFNSFIGHDPDNEVT
FT                   LVIWTNLTLSPDGKTTAQALLPTALNQVYAGLSLPTGTD"
FT   sig_peptide     complement(616662..616784)
FT                   /locus_tag="Sros_0606"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.481 at
FT                   residue 41"
FT   gene            complement(616999..617985)
FT                   /locus_tag="Sros_0607"
FT   CDS_pept        complement(616999..617985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0607"
FT                   /product="alcohol dehydrogenase"
FT                   /note="KEGG: scl:sce1535 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83630"
FT                   /db_xref="GOA:D2B4E4"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4E4"
FT                   /inference="similar to AA sequence:KEGG:sce1535"
FT                   /protein_id="ACZ83630.1"
FT                   /translation="MKAFVLRSYGSPDVLDLTDIDKPVPGDDEVLVRVRATSVQPYDWH
FT                   LMRGEPRIARLMGGGPGLRKPKINILGADIAGQVEAVGKDVTEFRPGDEVFAMPKQGGF
FT                   AEYACVRESELAPKPKNLSFEQAAAVPMAAGTALLGLRDGGRIQPGQKVLINGASGGVG
FT                   TFAVQIAKAFGAEVTGVCSARNVDLVRSIGADEVIDYTKEDFTRHGQRYDLLLDIAGSR
FT                   SGPACRRVLTPKGTYVVVGGPGSRWIQPVGHVVSALAMSLFVSQRTVIADVVRCVKNRQ
FT                   NLMTLTDFIEDGRVTPVIDRCYPFEEIPAAIRYTEEGHVPGKVVIAV"
FT   gene            618264..619013
FT                   /locus_tag="Sros_0608"
FT   CDS_pept        618264..619013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0608"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce5430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83631"
FT                   /db_xref="GOA:D2B4E5"
FT                   /db_xref="InterPro:IPR018750"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4E5"
FT                   /inference="similar to AA sequence:KEGG:sce5430"
FT                   /protein_id="ACZ83631.1"
FT                   /translation="MTDESLTGHPRSPRSPRSGRPADDRNTAGSSAAASSTRADWLVPA
FT                   ALIVLGAVPVIAGAVRLTELTGGAEITPENARFFAVPLPVVLHILSAVLYGVLGAFQFA
FT                   PGFRRRRPGWHRVAGRVLVPCGLVVALSGLWMTLLYPRPAGDGDLLAGFRLLFGSAMVL
FT                   CIVLGFSAIRRRDIARHRAWMIRGYAIGLGAGTQALTHLPWFLIFGTPGEFPRALLVGA
FT                   GWVINLAVAEWIIRGRSAVRPRTRLSS"
FT   gene            complement(619003..619659)
FT                   /locus_tag="Sros_0609"
FT   CDS_pept        complement(619003..619659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0609"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: scl:sce5431 two-component system response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83632"
FT                   /db_xref="GOA:D2B4E6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4E6"
FT                   /inference="similar to AA sequence:KEGG:sce5431"
FT                   /protein_id="ACZ83632.1"
FT                   /translation="MSIRVIVADDQEIARTGLVMILDAQPGIEVVGEAADGRRAVELAR
FT                   RLRPDVCLFDIRMPGLDGIEATRSLAGPNVADPLAVVVITTFDLDDYVYAALRAGARGF
FT                   LLKNAGAEMLSQAIHAAANGDALIAPSITARLLSAFAGSGPVSPPAKPVETLTDREEQI
FT                   LATVARGRTNSEIADEFYISLSTVKSHIASLMAKLGARNRVEIAMWAYETNRVKN"
FT   gene            complement(619656..620774)
FT                   /locus_tag="Sros_0610"
FT   CDS_pept        complement(619656..620774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0610"
FT                   /product="putative two-component system sensor kinase"
FT                   /note="KEGG: scl:sce5432 putative two-component system
FT                   sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83633"
FT                   /db_xref="GOA:D2B4E7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4E7"
FT                   /inference="similar to AA sequence:KEGG:sce5432"
FT                   /protein_id="ACZ83633.1"
FT                   /translation="MWDEPSPPNPPPRVWRDWVLVGVLVPVAVLEGLLRPDLPWRAVSV
FT                   IVTVGLVPTLLWRRTRPLPMVAIAFATTSLAPLLTGGDSAETYTMTYLLILVYSLFRWG
FT                   SGRGVTLGLTIMIVAVSLSLLFGRLTPGDMVGAFAVMFSAIALGGALRYRARARTRELD
FT                   QIKLLEREQLARDLHDTVAHHVSAMAIRAQAGLATSESRPNAATDALRVIEVEAARALD
FT                   EMRAMVRILRRDQPADLAPGRRVTDLEQLASRGRSGPAVDVEISGDLDSLPPSVEAAIY
FT                   RLAQESVTNAQRHARHATRIEVRVTADDTSVHLRVSDDGDGSPIRPAAPPGYGLIGMIE
FT                   RADLLGGTCEAGPNPDRGWTVTAVLPRSGAAT"
FT   gene            621202..621468
FT                   /locus_tag="Sros_0611"
FT   CDS_pept        621202..621468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83634"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4E8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83634.1"
FT                   /translation="MESDPIGAYQLLSDAARKALCAVLENQGDERLRYRGESDHGGGVP
FT                   LVGCSRAGSQDAGGSARHSFGTSPFSTGQTMPVAAGSRPRALS"
FT   gene            621715..622755
FT                   /locus_tag="Sros_0612"
FT   CDS_pept        621715..622755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83635"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4E9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83635.1"
FT                   /translation="MQAEFPSTGHILEIACDESGSEGGKLIGGNTDVFAHAGVRLSAES
FT                   AAECIRETRDRIRSPATEYKANHLLREKHRPVLEWLLGPLGPIYGNAHVYLIDKTFFAV
FT                   GKVVDLLVGEVVYAADTAPRRDRQAEAMAVTLYREGRRAFGRERWNAFLESFNDLMRAR
FT                   TSADAFFRTVDVLGLAGAGGRVGEIMELLRRARPHADSFRARLLDDPKMMPALDPLIPA
FT                   IVQAVVRWGEGGNPVSIVHDEHNALTDKRIAQLKEMFGASHPNGLRHAPTGRLTGLRLV
FT                   DSRSDPRVQVADFLAGVARKIASDELNDRGDADLVALLRPYVDPSSVWGDDRSWSLLGP
FT                   PPGARS"
FT   gene            complement(622869..624539)
FT                   /locus_tag="Sros_0613"
FT   CDS_pept        complement(622869..624539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0613"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_3241 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83636"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4F0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83636.1"
FT                   /translation="MRGLETGAAMGVFRHVTDRRDGLPVLVLLVAGLVTGGGQASQWGL
FT                   TDQAGRGAHWAPAGQSGQGAHWALAGQTGRASPRAVTAAGLSTIAVAGMTSTAGTGTTA
FT                   TVTATATATAEPTFADYVAGLKADVAKAWPRTGTLFPGADFSTLVLLVSDGRQAAAITA
FT                   EGVTPTSVAEMERRGVAVPELIAPAEWDGRYAVAINTALGRLHFEPGPAGQRIGSVLTV
FT                   FGKTTHEAFRFYVQGFALGPDRIWPSLRAEGRRATEYPLRATPRLYRAMIYNELREAYR
FT                   VPDTRPARLAAAAYWAERWAREFPAERERIAVVDIDAGTAEYVGKSAVAMAAATPPGDR
FT                   REQRAFLLDELMKPATGGTDSVDLESYPIGLAAGLVADDLGLDWKAAVVNGPDTPLDLV
FT                   VRGVTPSARPEPAGLRRTIDEQVARANTEIAMDLDPAIAAFRDPRTALLLVPPPPEGTQ
FT                   PEPRSLSGEYIVDRVPGTVYRRFTQKLRVSSGVLEAKELSVFSDQVDGVDYTIIPFDPT
FT                   GGDSPLSGDRVRFTSANLTGDLQVRAGPMLAGKKTFVAQ"
FT   gene            complement(624657..625499)
FT                   /locus_tag="Sros_0614"
FT   CDS_pept        complement(624657..625499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0614"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="KEGG: afw:Anae109_1583 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83637"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4F1"
FT                   /inference="similar to AA sequence:KEGG:Anae109_1583"
FT                   /protein_id="ACZ83637.1"
FT                   /translation="MSKIIVIAGATNGIGRGIALDRLRRGDVVVAVGSSAERGARLRAD
FT                   AEQAGAGDRLDFLRADLSSIAENDRVIDHVTARHPAIDALVLTANRQSAERRETAEGLE
FT                   FTFALYYLSRYLLGYGLRGALEASPSPVILNVAGAGITAGAVMWDDLQLERRYGMLRAQ
FT                   LQGGRANDLLGVSFTEETGGTVRYVMYHPGFTDNGDFSHLPRPLSALVKLLARFAARSI
FT                   DQVVPPLSGLLDTPPLQPLTAVDRGRTVPLTLRTFDPADARRLARLTEELLASRRTPR"
FT   gene            625577..626083
FT                   /locus_tag="Sros_0615"
FT   CDS_pept        625577..626083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0615"
FT                   /product="transcriptional regulator protein-like protein"
FT                   /note="KEGG: avi:Avi_1242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83638"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4F2"
FT                   /inference="protein motif:COG:COG1733"
FT                   /protein_id="ACZ83638.1"
FT                   /translation="MSGTHTDVPSVIAFDLPLPVSVREYESCALTDVLRRVGDKWSVLL
FT                   VVLLGRGPRRFNELHRVIDGISQRMLTRTLRGLERDGLVARTVHPTVPPSVEYALTDLG
FT                   AALLVPLSAVADWAVDHHAGIESARDDYDTAGGAPVPAPPGEGAAVPGRRSPVPGGGGP
FT                   EGHPR"
FT   gene            626118..627518
FT                   /locus_tag="Sros_0616"
FT   CDS_pept        626118..627518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0616"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="KEGG: nwi:Nwi_1813 dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83639"
FT                   /db_xref="GOA:D2B4F3"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4F3"
FT                   /inference="similar to AA sequence:KEGG:Nwi_1813"
FT                   /protein_id="ACZ83639.1"
FT                   /translation="MSTHYDVVVLGAGPGGYVAAIRAAQLGLSVAVVEERYWGGVCLNV
FT                   GCIPSKALLRNAELAHIFTHEAKTYGIRVEGQVTFDYGEAFKRSRKVADGRVKGVHYLM
FT                   KKNGITEYDGRGTFVDANTLQVAGRDGGAETVTFDHCIIATGATTKLLPGTSVTERVVT
FT                   YEEQILSDKLPESIVIAGAGAIGVEFAYVLHNYGVKVTIVEFLDRVVPLEDEEVSAELA
FT                   RRYKRLGIEVLTSTRVESIDDSGEQVRVTVSREGQQQVIEADKVMQAIGFQPRVEGYGL
FT                   ERTGVALTERGAIDIDGRGRTSVPHIFAIGDVTAKLMLAHAAESMGIIAAETIADEETM
FT                   ELDYVMIPRATYCQPQIASFGFTEAQARELGYDVKVAKFPFTANGKAHGLGDVTGFVKL
FT                   LSDGEHGELIGAHLIGPEVTELLPELTLAQQWDLTVHEVARNVHAHPTLGEAVKEAVHG
FT                   LAGHMINM"
FT   gene            627536..627937
FT                   /locus_tag="Sros_0617"
FT   CDS_pept        627536..627937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0617"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppr:PBPRB0736 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83640"
FT                   /db_xref="GOA:D2B4F4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4F4"
FT                   /inference="similar to AA sequence:KEGG:PBPRB0736"
FT                   /protein_id="ACZ83640.1"
FT                   /translation="MADPIDKVAWIRIEGGRILGARSRGKDVCYLPGGKREAGETDLDT
FT                   LVREIGEELSVAIVRESGRFAGVFEARAHGHAEGLSVRMSCYEADYRGDLAPGGEVEEV
FT                   VWLAYGDRHRVSPVVRLIFDSLRAEGRLA"
FT   gene            628090..628881
FT                   /locus_tag="Sros_0618"
FT   CDS_pept        628090..628881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0618"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="KEGG: mes:Meso_4078 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83641"
FT                   /db_xref="GOA:D2B4F5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4F5"
FT                   /inference="similar to AA sequence:KEGG:Meso_4078"
FT                   /protein_id="ACZ83641.1"
FT                   /translation="MDIVARNNVKVAGRRGGRPMIFSHGFGCDQSMWRYVAPAFEDEYE
FT                   TVLFDYVGAGRSELSAYSAERYASLDGYAQDVLDVCEELDLTGAVFVGHSVSAMVGVLA
FT                   AVREPRRLGTLILVAPSPRYIDDGDYVGGFSGADIEELVDSLDSNYLGWSSQMAPVVMG
FT                   NPDRPELGEELTNSFCRTDPEIAKQFARTTFLSDNRDDLGKVAVPALILQCSHDALAPP
FT                   QVGHYVHRAIPGSELTLMRATGHCPNLSAPEETIAAIKAFL"
FT   gene            628893..630068
FT                   /locus_tag="Sros_0619"
FT   CDS_pept        628893..630068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0619"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: gme:Gmet_2818 putative PAS/PAC sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83642"
FT                   /db_xref="GOA:D2B4F6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4F6"
FT                   /inference="similar to AA sequence:KEGG:Gmet_2818"
FT                   /protein_id="ACZ83642.1"
FT                   /translation="MTAHDDAQVTGDALGVLEDLYEDAPCGYLSTRGDGMIIKVNRTML
FT                   ALTGYRRQELVGRIRIHDLLAVGDRILYETHFAPLLALQAGVKEIAVDLRRADGSRVPV
FT                   LLNAVMKEQTPARPEEIWIGVVAASDRRGYERELLQARQRAEESQRRAVELARTLQESF
FT                   IPPELPRVPGMDVAGMYRPAGQGDEVGGDFYDMYEIVDGWALTLGDVCGKGVQAAVVTS
FT                   LARYTLRAAPLRESRPSAILATLNEVLVNERTDRFLTAVYAQVHRDARDRFRLTLALGG
FT                   HPPAFHLSKEGRVSMIGHPGTVLGILDSVELHDVTVDLAPGDVVVFYTDGVVEGRGRTG
FT                   FFGEERMRQVLSASRDADAADIAGHLMDEVVAFQSGMPSDDIAIVVLKIPD"
FT   gene            complement(630144..630371)
FT                   /locus_tag="Sros_0620"
FT   CDS_pept        complement(630144..630371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83643"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4F7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83643.1"
FT                   /translation="MNLAVSEALANHGHHALVNAHETAADNHEIMARAGVGDVDEHLDL
FT                   ARWHRWCAIVEDQIADEADHRTPARRDRSS"
FT   gene            630647..631321
FT                   /locus_tag="Sros_0621"
FT   CDS_pept        630647..631321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0621"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83644"
FT                   /db_xref="GOA:D2B4F8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4F8"
FT                   /inference="similar to AA sequence:KEGG:BTH_II0273"
FT                   /protein_id="ACZ83644.1"
FT                   /translation="MPDGVPGVDVPDRRGRTGLDRAGRDLDGNPRVRVREVELLSSSWY
FT                   ILRRTTFDYLRTDGSWSAQERETYDRGNGATVLLYDAERATVLLTRQFRYPVYVNGHPD
FT                   GLLLETAAGLLDDDDPETAIRREAAEETGYDIGEVRHVFDVYMSPGSVTERLHFFAAPY
FT                   TADRRTSEGGGLADDGEDIEVVELPFAKALAMIGSGEIADAKTVMLLQWAALSGPFAGR
FT                   DR"
FT   gene            complement(631266..631898)
FT                   /locus_tag="Sros_0622"
FT   CDS_pept        complement(631266..631898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0622"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="KEGG: pla:Plav_0958 GCN5-related N-
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83645"
FT                   /db_xref="GOA:D2B4F9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4F9"
FT                   /inference="similar to AA sequence:KEGG:Plav_0958"
FT                   /protein_id="ACZ83645.1"
FT                   /translation="MTTVRPYRPDDRAALHDICVRTAHDGGDSRHIYSDLELMPSIFAA
FT                   PYAFLEPELTFVLDDGDRAVGYVLGTADTVAFTEAFRSSWLPLMKERFPALGGPPTTPS
FT                   ETMIDLMYRPERMILPELAVYPAHLHIDLLPDHQRKGHGRALMNAFLDALHDRGVPAVH
FT                   LGMVTANTPARAFYDRLGFHEIPVADPGPLTYLGRRTDRTAPPTAAA"
FT   gene            632014..632505
FT                   /locus_tag="Sros_0623"
FT   CDS_pept        632014..632505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0623"
FT                   /product="Acetyltransferase including N-acetylase of
FT                   ribosomal protein-like protein"
FT                   /note="KEGG: aav:Aave_2197 GCN5-related N-
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83646"
FT                   /db_xref="GOA:D2B4G0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4G0"
FT                   /inference="protein motif:COG:COG1670"
FT                   /protein_id="ACZ83646.1"
FT                   /translation="MIEVELRGWRPDDAPALIRAFSSPDMAQQAARPIDTPEAALEWMG
FT                   TWGFRDDAQAFAVVLDGQVVGNVAVSNIDAHANGWVSYWTSPQARGRGVAAAAARKLAD
FT                   WAFRERGLFRLELGHRLNNPASCAVATRAGFLPEGIERAKLSYEGMRYDVERHARLATD
FT                   "
FT   gene            complement(632679..633035)
FT                   /locus_tag="Sros_0624"
FT   CDS_pept        complement(632679..633035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83647"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4G1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83647.1"
FT                   /translation="MTERWLDQDAGPIVRPYTLTRGRTRAAGARFDLIAIVVAIRTPPQ
FT                   DLPPEHARIMQACRLPVSVAEMASETGMPIGVIRVLLGDLRESGLITVRLPVNDVALPR
FT                   ESVLRDVLAGLKAL"
FT   gene            complement(633032..635083)
FT                   /locus_tag="Sros_0625"
FT   CDS_pept        complement(633032..635083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0625"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: glo:Glov_1041 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83648"
FT                   /db_xref="GOA:D2B4G2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010910"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4G2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83648.1"
FT                   /translation="MVGRNHSIRVKIFTLLLVPIVSLVAIWAFAATLTFQSGQELLRAS
FT                   EGYERGVLPTRTVTTAIQHERLLSLSVLGGSTIARTELDAQRIRTNTARTELERLAPAL
FT                   REGTSPAVRDRLVKLLSSMERLTEIRSEVDTRTAGQTQTLDAYNAIVGAAFEVYDKIRV
FT                   SSDIDMNDQTRAVVLMGRSREMLSQQAALIAGAVAEGSMSTDERAKFNDLAIGRKLLYS
FT                   MGFNQFDEEFQELYRSLQNSGAYASFERIEKAVTTAGKPAPSWATVAAKVSDTFDDLGG
FT                   EVSKGISDRSGPLATGILLQIGVAAGLGLVAVALSIFVSVRFGRRIGTELVGLQQAALD
FT                   LAHSRLPDVVERLRRGEDVCSEAQELNHGTTTEIVNVGKAFSSVQRTAVEAAAGQAQMR
FT                   KSVNKVFVNLARRSQSLLHRQLSMLEAMEQRASDPETLDDLFGLDHLTTRMRRHSEGLI
FT                   ILSGAVPGRGWRTPVTIYDVVRAAVEEVEDYQRVTVNVPQGPSVVGTVVTDVIHLVAEL
FT                   VENAAIFSPPHTMVSIQGEMVARGYAIEVEDRGLGITPDEMAQLNRRLADPPEFDLADS
FT                   DRLGLFVVTQLAARHGIRVSLRPSPFGGTTAIVLLPGELVVAVPDRQAAYSAEVEWVTT
FT                   GSGLPKRVRQAVPERRTAPAEASERAPSSVMTSFRDGWRRAEQEGGAE"
FT   sig_peptide     complement(634991..635083)
FT                   /locus_tag="Sros_0625"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.959 at
FT                   residue 31"
FT   gene            635257..635598
FT                   /locus_tag="Sros_0626"
FT   CDS_pept        635257..635598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0626"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xom:XOO_3944 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83649"
FT                   /db_xref="GOA:D2B4G3"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4G3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83649.1"
FT                   /translation="MKQIAELIGLEADRAAEATLVRGGELERSGAVQLVRFSPSLVTAE
FT                   VDDGAAYVEFRVVDGVLRWYCTCAEGRSGALCAHCVATAQSVRRRTGGKASPGGSSTAA
FT                   SASTARIAL"
FT   gene            635799..636671
FT                   /locus_tag="Sros_0627"
FT   CDS_pept        635799..636671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0627"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83650"
FT                   /db_xref="GOA:D2B4G4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4G4"
FT                   /inference="similar to AA sequence:KEGG:GSU2676"
FT                   /protein_id="ACZ83650.1"
FT                   /translation="MKLAVVGAAVLWGTAGTAGLLVAGVDPISLAAARLVVGGLVLAVA
FT                   VGPAIRSLPRPALLLPAAVAVAAYQLCFFAAVSRTGVAIGTVVAIGSGPVFTGLLSWAL
FT                   DRVRPTRRWAGATAVAIAGCAVLTGGGGEVRLDGVLIALLGGLLYAFYAVTAARVISAG
FT                   ASSDAVMGAMFGGAAVVMLPVLLWTGTAWLTEPRGLLTALYLGCATTALAYILYGRGLR
FT                   TTPVATAATLALAEPAVAALLGVVVLGEQLTLTSAAGLLLLGGSLAVVALPERWSGRRG
FT                   RAAAIESSA"
FT   sig_peptide     635799..635870
FT                   /locus_tag="Sros_0627"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.883 at
FT                   residue 24"
FT   gene            636668..637291
FT                   /locus_tag="Sros_0628"
FT   CDS_pept        636668..637291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0628"
FT                   /product="transcriptional regulator protein"
FT                   /note="KEGG: ara:Arad_9943 transcriptional regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83651"
FT                   /db_xref="GOA:D2B4G5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4G5"
FT                   /inference="similar to AA sequence:KEGG:Arad_9943"
FT                   /protein_id="ACZ83651.1"
FT                   /translation="MTIPLRPVSAVSALADALRRRVLSGEMAPGTTLPEQELSAQYGVA
FT                   RPTVREALAVLVHEGLLRRERHRSAQVAEVTLADLDDLMFVRRPLEDLMATSLAGRRVA
FT                   EADGALARMAGLPGDAPWSDVVAEHMALHQALIVAVGSPRLERLYATLAAETRLGLVRL
FT                   RAVYADRDVLVAEHRDLLDAIGRGPAETARRAVAAHLDHGWGMD"
FT   gene            637545..637889
FT                   /locus_tag="Sros_0629"
FT   CDS_pept        637545..637889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0629"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cti:RALTA_A0461 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83652"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4G6"
FT                   /inference="similar to AA sequence:KEGG:RALTA_A0461"
FT                   /protein_id="ACZ83652.1"
FT                   /translation="MHGNSVPDSYVYVTEEGVTRHYADGSVDALAWEDVVEVRVVGDPD
FT                   ILYILLDRDGQGCVVPQSATDTAFLARLRYLPDFDLDRLGEAVDAARDDYVVVWRSPEP
FT                   PSPLPDFEYD"
FT   gene            638132..639586
FT                   /locus_tag="Sros_0630"
FT   CDS_pept        638132..639586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0630"
FT                   /product="Undecaprenyl-phosphate galactose
FT                   phosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="KEGG: acp:A2cp1_1500 exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83653"
FT                   /db_xref="GOA:D2B4G7"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4G7"
FT                   /inference="protein motif:PRIAM:2.7.8.6"
FT                   /protein_id="ACZ83653.1"
FT                   /translation="MRVGIQEPAVALLGSSVRAAPSIWTRSYARILLAGDLACAVVACE
FT                   AVLGVRLWFGAYIPGTEALLGLGLALAWPFSLAVGGAYRKRAHGEGTEEFRAVFDGGVG
FT                   LTAAVAIGAYATQTTIARSFVMAMFPLALILTIIFRYRMRKRLHRRRSFGEYMRQVVAV
FT                   GHRESVLDLVMQLRRQPHHGMTVVAACLPSGSEGLDIDGVPVLGGFGDVPDVVAEVNAD
FT                   TVAILACPELDGAALRRLAWGLEDARTDLFVAPALMDVAGPRISIRPVAGMPLLHVEHP
FT                   EFDGAKHLAKNLFDRVGAGLALLVLSVPMLVITLLIRATSTGPALFRQVRVGRGGREFD
FT                   VVKFRTMVNDAERLKTDLQRHNEFDGVLFKMRNDPRITRVGAFLRRYSLDELPQLLNVL
FT                   RGEMSLVGPRPPLPEEVKQYGEDVRRRLVVKPGMTGLWQVSGRSDLTWEESVRLDLRYV
FT                   ENWSLFLDLQILWKTWSAVTGGEGAY"
FT   gene            639589..640656
FT                   /locus_tag="Sros_0631"
FT   CDS_pept        639589..640656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0631"
FT                   /product="dTDP-glucose pyrophosphorylase-like protein"
FT                   /note="KEGG: dol:Dole_1011 glucose-1-phosphate
FT                   thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83654"
FT                   /db_xref="GOA:D2B4G8"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005908"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4G8"
FT                   /inference="protein motif:COG:COG1209"
FT                   /protein_id="ACZ83654.1"
FT                   /translation="MKALVLAGGSGTRLRPITHTSAKQLVPVANKPVLFYGLEAIAAAG
FT                   IREIGIVVGDTQAEIEAAVGDGSALGLQVTYIRQHAPLGLAHAVLIARDYLDDDDFVMY
FT                   LGDNFILGGINGIVDRFVHDRPSAQIMLTRVGDPRQFGVAELDAGGRVIGLEEKPADPK
FT                   SDLALVGVYLFTSAIHEAVAELKPSWRGELEITDAIQWLIQEGHEVESTVISGYWKDTG
FT                   NVTDMLEVNRLVLESLDGRVDGRVDGASELIGRVVVEPGAVVERSRIVGPAIIGAGARV
FT                   LDSYVGPFTSIAADCVVSGSEIEYSIVLPRSSISGVSRIEASLIGHDVEVTPAPNTPRA
FT                   HRLVLGDHSKVQISS"
FT   gene            640921..641943
FT                   /locus_tag="Sros_0632"
FT   CDS_pept        640921..641943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0632"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="KEGG: dvm:DvMF_0141 dTDP-glucose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83655"
FT                   /db_xref="GOA:D2B4G9"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4G9"
FT                   /inference="similar to AA sequence:KEGG:DvMF_0141"
FT                   /protein_id="ACZ83655.1"
FT                   /translation="MKILIIGGAGFIGSHYVRTLSADGVAVTVLDKLTYAGNPANLEGA
FT                   AHEFVHGDICDAGLLAEVVPGHEVVVNFAAESHVDRSIDGAGEFVRTNVLGTQTLMQAC
FT                   LDAGTRRVVQVSTDEVYGSIDTGSWKEDAPVRPRSPYSAAKAGGDMIALAYAVTHGLPV
FT                   SITRCGNNYGPHQYPEKVIPLFVTNLLRGRKVPLYGDGGNVRDWIHVDDHCAGIRLVAE
FT                   RGEPGEVYHIAGTAELTNTELTARLLAACGAGWDMVEHVEDRKGHDRRYSLDDSRLRAL
FT                   GYRPNIPFDQGLAETVRWYADNPDWWEAATDRRGGDGAGAGRRAGLAAVGAEQTGGTIA
FT                   "
FT   gene            641940..642797
FT                   /locus_tag="Sros_0633"
FT   CDS_pept        641940..642797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0633"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="KEGG: glo:Glov_1659 dTDP-4-dehydrorhamnose
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83656"
FT                   /db_xref="GOA:D2B4H0"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4H0"
FT                   /inference="protein motif:PRIAM:1.1.1.133"
FT                   /protein_id="ACZ83656.1"
FT                   /translation="MSRWLITGASGMLATELLGRLQAAGESVLALRRDELDLRDGPAVR
FT                   HLVSACRPDTVVNCAAWTAVDDAETREAEALAVNGHGVRALAEACERLGARMIQPSTDY
FT                   VFDGTALDPYREDARTCPVNAYGRTKLAGEHAVLEVLPETGYVVRTAWLYGATGKNFVR
FT                   TMAELERTRPSLEVVDDQVGPPTWAGDLAAGIIELGRTGPPPGVYHATGSGQTSWYGFA
FT                   REIFKLVGADPDRITPVSTKEFARPAPRPAYSVLGHERWSLAGLPPMRDWREALRGSDV
FT                   LLRD"
FT   gene            complement(642787..643437)
FT                   /locus_tag="Sros_0634"
FT   CDS_pept        complement(642787..643437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0634"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="KEGG: lpf:lpl0793 dTDP-4-dehydrorhamnose 3,5-
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83657"
FT                   /db_xref="GOA:D2B4H1"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4H1"
FT                   /inference="protein motif:PRIAM:5.1.3.13"
FT                   /protein_id="ACZ83657.1"
FT                   /translation="MEPLSIDGTWCHTPRIHADPRGSFLESYRAADLEESVGHRLDLAQ
FT                   VNCSVSRRGVLRGIHFADVPPGQAKYVTCVSGAVLDVVVDIRVGSPTFGRWETVLLDDE
FT                   SRRGLYVAEGLGHGFLTLSEQATVVYLCSRPFTPGREHGIHPLDPALGIDWPAGVEPLL
FT                   SDKDAAAPTLKEALDAGLLPDHGACAAYYAGLAAAGRDRDPATRGPDLAAPSL"
FT   gene            643569..644804
FT                   /locus_tag="Sros_0635"
FT   CDS_pept        643569..644804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0635"
FT                   /product="methyltransferase, putative"
FT                   /note="KEGG: rce:RC1_3997 methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83658"
FT                   /db_xref="GOA:D2B4H2"
FT                   /db_xref="InterPro:IPR013630"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038576"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4H2"
FT                   /inference="similar to AA sequence:KEGG:RC1_3997"
FT                   /protein_id="ACZ83658.1"
FT                   /translation="MTTCRLCGSTSLASVVDLGATPPCERFLTAEQLDEPEVTYPLHLR
FT                   VCTGCWLAQIPPLITPEDTFTEYAYFSSYSTSWVEHAREYVNGAVERLGLDEGSFVVEV
FT                   ASNDGYLLQHVVERGIRCLGVEPSKNVGEAARERGVPTVTAFLGPETGAAVRAEHGPAD
FT                   LVAANNVYAHIPDVIGFTKGLRALVADDGWVSIEVQHLLTLMEHNQYDTIYHEHFQYYT
FT                   VASAQRALASGGLSLVDVELLPTHGGSIRLWARPQEAAGEPGERVDQVLAAEKAAGLHE
FT                   LAGYTEFAARVAGVRRDLLRFLVEAAEQGRTVVGYGAPGKGNTLLNHCGIRADLLQYTV
FT                   DRNPYKHGRFTPGARIPILPPERIAEDRPDYVLVLPWNLREELTAQLSFVHAWGGRLVF
FT                   PIPRLEIVEVNP"
FT   sig_peptide     643569..643628
FT                   /locus_tag="Sros_0635"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.639) with cleavage site probability 0.628 at
FT                   residue 20"
FT   gene            644801..645595
FT                   /locus_tag="Sros_0636"
FT   CDS_pept        644801..645595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0636"
FT                   /product="Glucose-1-phosphate cytidylyltransferase"
FT                   /EC_number="2.7.7.33"
FT                   /note="KEGG: rce:RC1_3996 glucose-1-phosphate
FT                   cytidylyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83659"
FT                   /db_xref="GOA:D2B4H3"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4H3"
FT                   /inference="protein motif:PRIAM:2.7.7.33"
FT                   /protein_id="ACZ83659.1"
FT                   /translation="MKVVLFCGGYGTRMRTGTPGDAPKPMQLVGPRPLIWHVMRYYAHF
FT                   GHTEFILCLGYGAHHIKDFFLNYQETTSNDFVLRGGRIELLSADISEWSISFVQTGIES
FT                   PIGERLRRVRDHLDGEEMFLANYADVLTDAPLPEIIDRFAASDAGASMMVVPPSDTFHC
FT                   VELGEHGMVGGITPVSEMPLWVNGGYFVLRQEVFDHIPPGGDLVADGCAELAKRGRMLA
FT                   YPHRGYWRPTDTVKERVALDEAYSRGERPWALWERGPAVRTA"
FT   gene            645592..646269
FT                   /locus_tag="Sros_0637"
FT   CDS_pept        645592..646269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0637"
FT                   /product="putative deacetylase"
FT                   /note="KEGG: bra:BRADO4834 putative deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83660"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4H4"
FT                   /inference="similar to AA sequence:KEGG:BRADO4834"
FT                   /protein_id="ACZ83660.1"
FT                   /translation="MIGFRPAGADGTTGNRGVGSVALLAAHCDDIAIGAGGSLLTVCSA
FT                   RPGLRVDALVLSGGGTEREDEEHAALAAFCPGADLRLTVLKLPDGRLPAHWDEAKAAVE
FT                   ELRARADPDLLFAPHPGDAHQDHRGLARLVPTAFRDHQVLGYEIVKWDGDLGRPQVYQP
FT                   LTPEVAEAKVTLLQQHYPSQRRRPWYDREAFLGLARIRGIECHARYAEAFHVNKLTLDL
FT                   AGG"
FT   gene            646275..647318
FT                   /locus_tag="Sros_0638"
FT   CDS_pept        646275..647318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0638"
FT                   /product="nucleoside-diphosphate-sugar epimerase"
FT                   /note="KEGG: mag:amb0123 nucleoside-diphosphate-sugar
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83661"
FT                   /db_xref="GOA:D2B4H5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4H5"
FT                   /inference="similar to AA sequence:KEGG:amb0123"
FT                   /protein_id="ACZ83661.1"
FT                   /translation="MRVLLTGHQGYLGSVMAPMLAEAGHEVIGLDSGLFADCVLGPVPD
FT                   DPRGHSVDLRDVTAAELAGMDAVVHLAALSNDPLGSLAPQLTYDINHHASAHLARLARE
FT                   AGVRRFLYASTCSVYGASGGEDLVDEDAPLRPVTPYAESKVRVEDDLAKLADDDFTPVF
FT                   LRNATAFGFSPRPRADIVLNNLVGHALLTGEVRVLSDGTPWRPLVHAQDIARAFVLALA
FT                   APRDAVHARAFNVGTEQNNVTVAEIAAEVVEAVPGSELVITGEAGADPRSYRVDFSRIR
FT                   AALPDYEARWTVKEGAVELVEAYRRFGLTEQDFQHRFTRLARLSARRAEGSVDDALRPH
FT                   EVAAGDD"
FT   gene            647308..648597
FT                   /locus_tag="Sros_0639"
FT   CDS_pept        647308..648597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0639"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4986 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83662"
FT                   /db_xref="GOA:D2B4H6"
FT                   /db_xref="InterPro:IPR012353"
FT                   /db_xref="InterPro:IPR032589"
FT                   /db_xref="InterPro:IPR032610"
FT                   /db_xref="InterPro:IPR032622"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4H6"
FT                   /inference="similar to AA sequence:KEGG:M446_4986"
FT                   /protein_id="ACZ83662.1"
FT                   /translation="MTIETVGREMHALVERLYPLCRSITGDGVRRTLEIVGESVPLQIR
FT                   EVPTGTEVLDWTVPREWNIRDAYIKDASGARVVDFAESNLHVVGYSVPVSATMSLAELR
FT                   GHLHTLPDQPDLIPYRTSYYAETWGFCLRESTLAGLPEGDYEVRIDSTLADGHLTYGEH
FT                   VVPGRVSDEVLVSCHVCHPSLANDNLAGIAVATRLARRLAESDPWYTYRFLFMPGTIGA
FT                   ITWLARNQERVGRVKHGLVLACAGDSGALTYKRSRRGDAEIDRVVRHVLRTSGRDHEIV
FT                   DFSPYGYDERQFCSPGFDMPVGSLTRTPYAGYPEYHTSADNPDFVSPEAMTDTLETCWE
FT                   ITQVLERNHRYLNLSPYGEPQLGRRGLYGSLGGRSDTKQAQMAMLWVLNLSDGEHSLLD
FT                   IAERSDLPFATVADAAQALRGAGLVKEKGK"
FT   gene            648594..649655
FT                   /locus_tag="Sros_0640"
FT   CDS_pept        648594..649655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0640"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bra:BRADO4833 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83663"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4H7"
FT                   /inference="similar to AA sequence:KEGG:BRADO4833"
FT                   /protein_id="ACZ83663.1"
FT                   /translation="MTQVQTVMGSGVLNLRVGEVVEVLSEAEIMATLDERGELDELPFM
FT                   PEMLAFCGRRLTVHKVAYKLCDTISRTGMRRMERAVHLTGARCGGQAHGGCQTACLMYW
FT                   KEAWLKRVDPGAPGTPGPAASGGRETAAPEGAGGLAAGRRLLPILEVAARKEPGPEGEE
FT                   RFSCQATELLRAAPTCLPLKDLRQYVMDVRTGNAGTFFALRALLVGLFNRFQDRSGRVL
FT                   PSWLQIKGGLRWGFVKGRLVGATPSVTLDLQPGELVRIKSKEEIVATLNQDLLNRGMGF
FT                   EEEMSRYCGQTARVLSRVDRCIDEKSGRMLQMKTPCIVLEGVVCAGAYTVSCPREFIPF
FT                   WREIWLERIEEPA"
FT   gene            649717..651243
FT                   /locus_tag="Sros_0641"
FT   CDS_pept        649717..651243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0641"
FT                   /product="polysaccharide biosynthesis protein, putative"
FT                   /note="KEGG: rce:RC1_3989 polysaccharide biosynthesis
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83664"
FT                   /db_xref="GOA:D2B4H8"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4H8"
FT                   /inference="similar to AA sequence:KEGG:RC1_3989"
FT                   /protein_id="ACZ83664.1"
FT                   /translation="MEDRQGAEPARADAEPAAPGAATSQVGEIGRQAGRGLRWSLLGNL
FT                   VMKVGSFGMSLVLARLLVPEDFGVFAIALAASQMVIHINDAGIIAATVQWRGRLEEMAP
FT                   TATVVAIVSSGLLYGIFWMIAPYFAQLSGSEEATWVIRVLAATNVVYGLTAVRSAALLR
FT                   RFEQDKLTKANLVGFLVNATVSISLAAGGAGAFSFAWGQLAGASVTGVLVVAFARLRIR
FT                   FGLDRAVARRLLVFGLPLCVSLGIEGVLLNADSVIVGNALGPTLLGLYLLAFNISSWVP
FT                   GLIGTAVRYVALPSFSRLAEEDPKSLSLGVQRAVPLLLSIVLPIAVVMGTLAPALVVFL
FT                   YGERWAPSAEVLRFLAIVMTVRMLTALAFDVLASLGATKATVWLNLGWAVVLVPALMTG
FT                   ARVDGIRGAAIGHAVVAVLVALPLATLALHRAGVVLAPIAPALVRPLLGGVLAAAVMTW
FT                   LAQVVHGVPLVQLCVAGGTGLLAFILVVVPQAVLRQLGGRVTELIPARSR"
FT   gene            651261..652181
FT                   /locus_tag="Sros_0642"
FT   CDS_pept        651261..652181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0642"
FT                   /product="Glycosyltransferase involved in cell wall
FT                   biogenesis-like protein"
FT                   /note="KEGG: dol:Dole_1967 glycosyl transferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83665"
FT                   /db_xref="GOA:D2B4H9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4H9"
FT                   /inference="protein motif:COG:COG0463"
FT                   /protein_id="ACZ83665.1"
FT                   /translation="MLGTDTLVSVGLPVRNGAARLEGVARSVLAQDHENIELVICDNAS
FT                   TDDTEEFCRELARSDSRITYHRQPENVGLLNNFIHAGRIARGTFFRWVGDDDWLAPECV
FT                   SRSLRAFAEDERLILVTTQVSYSDPDGMARTGVYEGTGLLSDDPVERFAEMLRMLNESH
FT                   LLIDPLYGLMRRASVVGIPRRNMLREDEVFAAKLALAGPWGHVPEVLARRNWKHERIGA
FT                   VGRRLGVPAWQARFSSTLQYREILRWLREADLTGEQRGRARAAAHRMYARRQWRTVSHR
FT                   GRKLARLGTGLILPGRSSGRSAAGS"
FT   gene            652240..653136
FT                   /locus_tag="Sros_0643"
FT   CDS_pept        652240..653136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0643"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppw:PputW619_3747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83666"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4I0"
FT                   /inference="similar to AA sequence:KEGG:PputW619_3747"
FT                   /protein_id="ACZ83666.1"
FT                   /translation="MTTVFSNSVVDDDTRRGLLYEGKVFTYSATPASKELIGLAQQLIA
FT                   EAFGDHDPQTAQFDMPVEEFAALLAGLKPRFIHHPRCKELLPAVLEELGCSLDRTYFDV
FT                   PRLRTSTSNDYLTSGISYAFHPHRDCWYSAPFNQLNWWIPIYPVVPENVMAFHPRYFDR
FT                   PVRNGSARYDYAEWNRTSRLSAAQHVRSDTREQPRPEEPVELDPQVRVVPEPGGVMLFS
FT                   GAQLHSTVPNTSGRTRFSIDFRTVNIDDVRARRGAANVDAACTGTTLRDFVRCSDLDPM
FT                   PEQLALEYEAEALARVG"
FT   gene            complement(653160..654353)
FT                   /locus_tag="Sros_0644"
FT   CDS_pept        complement(653160..654353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0644"
FT                   /product="acyltransferase 3"
FT                   /note="KEGG: gdj:Gdia_0731 acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83667"
FT                   /db_xref="GOA:D2B4I1"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4I1"
FT                   /inference="similar to AA sequence:KEGG:Gdia_0731"
FT                   /protein_id="ACZ83667.1"
FT                   /translation="MKSPERDVQPGPADGAERAAGGRGRLAGLDGIRGVAALFVMVHHC
FT                   WLMAFPGYPANTGPSWLGWLLYGHFAVVVFIVLSGFSLAVSPARSQWRLGGMGRFAQRR
FT                   AWRILPPYWAALAFSLVIAWTLVAQPGEGPPAAKSVAVYGLLLQDLFGAPSPNGAFWSI
FT                   AIEAQLYLVFPLLLLILRRAGAAVMLGVVTVLVAAIGLLAPGVPAVGMLMRLTPQFAVL
FT                   FAVGVVAAGVIAADGRVRRLPWHWLALLAAVPVLVVIVVRGSVWTVERYFWVDIALGPA
FT                   VGLLLAGVATGRPAALVRLLDLRPIRSLGSFSYTLYLIHAPIVVAIYQLIVAPRVPGGL
FT                   PAFLAALVLAVPVALLTARAFAAVFELPFQRHRSWPALREAARARLSRMRAAIRPAR"
FT   gene            654581..655507
FT                   /locus_tag="Sros_0645"
FT   CDS_pept        654581..655507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83668"
FT                   /db_xref="GOA:D2B4I2"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4I2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83668.1"
FT                   /translation="MDFWKAIFGLVKRRLIGPPLAALALAAATLVFFLMPTTYVSTASM
FT                   VLTTPATGGTLPSDPTKPLGLTNPLLQFSDGLRVTAGILILSMNAPEVAAELGVLPNST
FT                   TEITINDGRTNPNLLGISTNGPFVYVEVQSRSAATAQDVVVKAKQRVRRELINRQQALK
FT                   APRSTFISIVDVVPSSTPEAKLSGKLTAAGGTLFLVFLVGIGIAYGMTQMRQGGRSADP
FT                   ARPSDGGGGPKDDHPEAAALSAGGAVAAPLTAYPRMDTREPAEGPFQDDSEPLVVVIEN
FT                   EPFMHRDDDAGDTIVFMRASGRDDHEK"
FT   sig_peptide     654581..654709
FT                   /locus_tag="Sros_0645"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.380 at
FT                   residue 43"
FT   gene            complement(655570..656442)
FT                   /locus_tag="Sros_0646"
FT   CDS_pept        complement(655570..656442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0646"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: smd:Smed_4797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83669"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4I3"
FT                   /inference="similar to AA sequence:KEGG:Smed_4797"
FT                   /protein_id="ACZ83669.1"
FT                   /translation="MTELAVITPSHGPDAELFADLHRSVLEYTSDETVHHVIISPVWTD
FT                   VFAKYAGPRCRIWTYKELLPKYYFRLAPYPLWVNSRRPWPPVRGWVMQQTLKITLAARL
FT                   DVDAVMIADSDVVLVRPTTLESFTADGRLCLHREEKGVTADMERHVLWHQVSRELLGLP
FT                   PAPPPPLTDYVTALNFWAPGTVRAMQQRVSETTGRHWMDAFNSRLHISEFMLYGVFVDE
FT                   VLGGSEEPPPSNTTICHKNWQRTPLDREGAIAFADRLGPEAVAMMISAKSETPQDVRRA
FT                   AIERCAQIT"
FT   gene            656653..657414
FT                   /locus_tag="Sros_0647"
FT   CDS_pept        656653..657414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83670"
FT                   /db_xref="GOA:D2B4I4"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4I4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83670.1"
FT                   /translation="MDFWGTVLVVFRRWYIFLPIFALSLAAAGGVYSTVMTTYTSSAVL
FT                   ILTTPTTGGSLPTNPDIPNGLTNPMLNFDHGLSVSASILIAAMGTPDMAAELGVTDGGD
FT                   FAFKVTNGGNNLESLATGPFLFIEGEASSAAAAQDIVKRVIVRAKAELDHRQKAVRAPM
FT                   ATYITTYEAVPPTTPMAQRGRKLRAVAAALGVGVVASLCASFMAESFFQRRKARRQAGA
FT                   PDPADAAGERSLPDRAALNGRAHADGPVARH"
FT   gene            657419..658807
FT                   /locus_tag="Sros_0648"
FT   CDS_pept        657419..658807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0648"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nar:Saro_3228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83671"
FT                   /db_xref="GOA:D2B4I5"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4I5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83671.1"
FT                   /translation="MAAKLTLPVRRRADGATLASLFAVALLIVPARMVFRALPLSITPA
FT                   SLIALAAALLWLCAHFTLTLGMAKGRNPVRTALFVYLTAIVATYGYASYGYMPSDELNL
FT                   ADHALILLVANAGLALMMCDGVRGAARLDFVLQAVVVAASVIAVIGAFQFLFDLDLTQY
FT                   MQIPGLRYTSEDGFITERSDFRRVAATTGHPIEFGVVCAMLLPIAVHYGFQAGERAEPA
FT                   LRWWVCSGLIGMGLMFSVSRSAVLGLAGVGVVLFLGWPARRRLHAMGVVLVFLILMRIM
FT                   VPGLLGTFYGLFANFGNDDSIRYRTHDYEVAAHEIAKHLWLGRGAGTWYAPKHQVFDNQ
FT                   YILSTVETGLIGIGAIVGMFACAIYAGLRARYLSSDPGTRDLGLTLAACMVVPLIGAAT
FT                   FDLLSFATVTGLSFLLIGAAGSLLRSATETAALHPRDTGTFWRVRTPKDLFRGSGGRSD
FT                   QVVS"
FT   gene            complement(658832..660760)
FT                   /locus_tag="Sros_0649"
FT   CDS_pept        complement(658832..660760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0649"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpd:BURPS668_A0166 rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83672"
FT                   /db_xref="GOA:D2B4I6"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR025141"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4I6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83672.1"
FT                   /translation="MTSARPPRRGGNSEGRPPRRRRSQPGLVAVLIVAVVAVSVPAVWF
FT                   ITRDGVTVEQAAAAQPAPAAAPQEPKETSFWSTSTKVKATPRADRAPVELGMRFTAARS
FT                   GWVAGVRFYKAPGDRGKHTGSLWSAGGKRLARVTFAGESASGWQEARFASPVQLKAKQL
FT                   YTVSYHSAAGNYVGSKGFDSARSGPLATTSRNAGVFGYGRSTFPDRWNPKGYNYWVDVI
FT                   FRWRDRSPAPAPTRSPQPSQPPQVPGETPVPSLTPSTDATPGTSPNPSETGASPDPSPS
FT                   RTGTGPSPSQTTGTGPSPSQTGASPSSSSSQTAGPGPGTSASPSATTTGTPRPTPTSRP
FT                   TLTPRPTPTVRPTPPPQPTPTSRPTLTPKPTLSPRPTLTPIPDDGGSSCAGHPTPACTG
FT                   VPAGTRLSRSTLNEDGAAYRVTKSGAVLDGVHIPGDLLIHADGVTVRNSQIDGSVINAD
FT                   GPRTYRFTITDSTVGPAQGCKTLPGIGQDKYTALRVHVRNHGDGFRASGDDVVIRDSYA
FT                   NLCSNPGDHSDGIQTYNTGRGLTFDHNTIDQRHAKDVTAPIFLVDKQIVDAVVTDNLVM
FT                   GGTYSIQLKNARGKLVVRDNMLVDDSWIYGPVEADCKAIDWAGNSLVKIDQNYRITSVV
FT                   GPLECDG"
FT   gene            complement(660987..661889)
FT                   /locus_tag="Sros_0650"
FT   CDS_pept        complement(660987..661889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0650"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_3027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83673"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4I7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83673.1"
FT                   /translation="MRWVSLLAAVSAVTMMSLTGCTSSSAGSPTSRPTGTPGEPTGATG
FT                   RCPGHPTPACTGVPPGTKLTVKALNEDGAAYRVKTPGTVLDGVHIRGNLLIHAEDVTVR
FT                   NSQIDGHVINADGPRSYRFTITDSTVGPAQGCQTLPGIGQDKYTALRVHVRGHGDGFRA
FT                   SGDDVVVKDSYANLCSNPGDHSDGIQTYNTGRGLVFDHNTIDQRQAKDVTAPIFLVDKQ
FT                   IVDAVITNNLIMGGTYSIQLRNGRGKLIMRGNKLVDKSWVYGPVDSECKTIDWADNSLV
FT                   TIDENYRVTSTVGPLTCVG"
FT   sig_peptide     complement(661809..661889)
FT                   /locus_tag="Sros_0650"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.974 at
FT                   residue 27"
FT   gene            complement(661896..662459)
FT                   /locus_tag="Sros_0651"
FT   CDS_pept        complement(661896..662459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0651"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="KEGG: bch:Bcen2424_6650 dTDP-4-dehydrorhamnose 3,5-
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83674"
FT                   /db_xref="GOA:D2B4I8"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4I8"
FT                   /inference="protein motif:PRIAM:5.1.3.13"
FT                   /protein_id="ACZ83674.1"
FT                   /translation="MRVERTKIDGVLLFVPTPHRDDRGLFTRTFDKAVAEGAGLDFSAF
FT                   VQDSQSRSRQGTVRGMHGRSGRGEAKLVRCARGAVHDVLVDARPGSPTFGEQTSVLLDD
FT                   ETFVTLYVPPGLLHGFQALTGQTDVCYRIDREHDPAEDLSVRYDDPDLRIDWPLPVSAI
FT                   SGRDLSAGSWTQLRDRLCGPDTTE"
FT   gene            662500..663405
FT                   /locus_tag="Sros_0652"
FT   CDS_pept        662500..663405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0652"
FT                   /product="Glycosyltransferase involved in cell wall
FT                   biogenesis-like protein"
FT                   /note="KEGG: sit:TM1040_2406 glycosyl transferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83675"
FT                   /db_xref="GOA:D2B4I9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4I9"
FT                   /inference="protein motif:COG:COG0463"
FT                   /protein_id="ACZ83675.1"
FT                   /translation="MNDAVDEDTAPDRGRPGGRQPVVSVVVPAHNEEAVVANGLRRLLA
FT                   GTSPGEFDVVVVANACSDRTAEVARQAGVRVIETPVPGKAGALRLGDETCRTFPRVYLD
FT                   ADVELDAESVRALVAAAGRPGVLACAPVPAWDLAGVGWFTRRMHKVHDQLIAPFRALAG
FT                   VGVYVLTEQGHARVFPLPDVISDDGWVHGAFAPHERAVVSEARSLVRPARTVSAHLNRR
FT                   VRVRLGNRQLAELGRSAAEGRLRLSSLAALVAGRKVSPLDAGCYLTVLLMDRTLTRMRA
FT                   SRGSGIQWGTDTGSRSPAGG"
FT   gene            complement(663548..664306)
FT                   /locus_tag="Sros_0653"
FT   CDS_pept        complement(663548..664306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0653"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr1181 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83676"
FT                   /db_xref="GOA:D2B4J0"
FT                   /db_xref="InterPro:IPR025789"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4J0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ83676.1"
FT                   /translation="MSVLIESVAATELAVLMESCVDTGAAAAAGAMEGLRRSYRWLRRN
FT                   SVQLLFERRYGVRTSDVVGLEEFGLARQDRVYYSAANWQTLRRTLPRRDVGEHDVFIDL
FT                   GSGMGRMVLEAASRYPFGKVIGVELSEQLNDIARQNIANTRLRLRCKDVDLVRSDVLDY
FT                   DIPDDVSVVFLNNPFRGETFATVMERLIASVDRNPRPVTVIYFNPVEEAFLLSTGRFRC
FT                   LRTVTRGRRSVEDSPFGSVRVYAITERAGA"
FT   gene            complement(664334..665512)
FT                   /locus_tag="Sros_0654"
FT   CDS_pept        complement(664334..665512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0654"
FT                   /product="glycosyl transferase group 1"
FT                   /note="KEGG: mno:Mnod_5881 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83677"
FT                   /db_xref="GOA:D2B4J1"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4J1"
FT                   /inference="similar to AA sequence:KEGG:Mnod_5881"
FT                   /protein_id="ACZ83677.1"
FT                   /translation="MAGKALILVENLSVPFDRRVWQESTTLRDAGWDVHVICPQGTKRD
FT                   TEPRVEIDGVKIYRYPLRAATGGPLGYVQEYGSALWHTFRLARRIGPVDVVHACNPPDL
FT                   LFLVARMLKRRGARFVFDQHDLVPELYLSRFDRGEDFLYRAVCRLERLTYRAADVVIAT
FT                   NESYREVAIGRGGKKPEEVFVVRSAPAVERFHQVPPEESIKRGKPHLLCYLGVMGPQDG
FT                   VDYALRSLARLRDDLGRTDWHAVFVGGGDTFEDMVAFSCELGLSDSVEFTGRIPDEDLL
FT                   RYLSAADVCLAPDPLNPLNDVSTMNKIMEYMAMARPIVSFDLREARVSAGDAAVYAPAN
FT                   DEPEFAKLIARLLDDPQERQRMGEAGKARVTGPLSWERSRTALLAAYEAACS"
FT   gene            complement(665502..666818)
FT                   /locus_tag="Sros_0655"
FT   CDS_pept        complement(665502..666818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0655"
FT                   /product="GDP-mannose 6-dehydrogenase"
FT                   /EC_number="1.1.1.132"
FT                   /note="KEGG: mno:Mnod_5882 nucleotide sugar dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83678"
FT                   /db_xref="GOA:D2B4J2"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4J2"
FT                   /inference="protein motif:PRIAM:1.1.1.132"
FT                   /protein_id="ACZ83678.1"
FT                   /translation="MRISVFGLGYVGCVSAACLAASGHEVIGVDVNPTKIELIGRGQAP
FT                   VVEERIGELTAEVVRAGALRATTDVAEAINETEISLICVGTPSAPNGSLSTAYLERVAE
FT                   QIGQVLAGKSERHTIVFRSTMLPGTCTDLLIPILERTSGLRAGTGFGVAVNPEFLREGT
FT                   SVRDFFEPPKTVIGQLDPASGDAVASLYEGLPGEVFRVPMAVAEMTKYADNAFHGLKIS
FT                   FANEIGAVCQALGLDSHQVMDVFLADRKLNISPAYLRPGFAFGGSCLPKDLRGLVYAAR
FT                   RADVSVPLLSHVLPSNEDHLRRAFELVAAAGSRRVGLFGLSFKPGTDDLRESPLVELAE
FT                   RLLGKGYDLRIYDANVSLSRLMGANRDYIESRLPHLGDLLSNSADDVLAHADVCVVGCK
FT                   DPAVLSALDGAGDRTIIDLVRLPDAAERRAHPGYVGLGW"
FT   sig_peptide     complement(666756..666818)
FT                   /locus_tag="Sros_0655"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.683 at
FT                   residue 21"
FT   gene            complement(666960..668009)
FT                   /locus_tag="Sros_0656"
FT   CDS_pept        complement(666960..668009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0656"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cak:Caul_4871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83679"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4J3"
FT                   /inference="similar to AA sequence:KEGG:Caul_4871"
FT                   /protein_id="ACZ83679.1"
FT                   /translation="MRTVGFDALTAEELDAWHLLRAANPLLDSPYFHPGFAAAVHASGR
FT                   EVRVAVGRDRAGEVRALLPHHRERSLIRPAGWPAADFQGPVLAPGSSFPPLALLAGGVR
FT                   GFEFDHLVESCADFEPWVESRRPSPFLDVSGGLEGYLGRASRSGKDNMGQARRRTAKAD
FT                   RTYGPVRFAADAVDPEVLDRVVELKRAQYAATGARDYFAEPDRHDLLTRLLHTRDSSFG
FT                   GVLSTLHAGPHLVAAHFGIRSENVLHWWFPVYDPAFSALAPGWMLLRELVAAAPALGIT
FT                   RIDLGRGDDEYKRRAKTGETPVCQGIVTRSSARQALRRARDSMVTSAKSSALGPGLRHI
FT                   VHKLRDLRR"
FT   gene            complement(668147..669070)
FT                   /locus_tag="Sros_0657"
FT   CDS_pept        complement(668147..669070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0657"
FT                   /product="glycosyl transferase family 2"
FT                   /note="KEGG: smd:Smed_4788 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83680"
FT                   /db_xref="GOA:D2B4J4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4J4"
FT                   /inference="similar to AA sequence:KEGG:Smed_4788"
FT                   /protein_id="ACZ83680.1"
FT                   /translation="MTPGTPRIAVVIVTYNSAEVLEGCLRSLVEGSRGVRLTDVVVADN
FT                   ASKDGSLKIAAGVTGLPLQTVQLGRNAGYAAAINAGIEALDLRDIDAVYVINPDCRLRP
FT                   GSLLPLADALRPPGRGIAVPRMINPDGSLQPSLRRTPTLRRALAEALIGGDLAGRIGTL
FT                   GELVTDPREYERPGVAAWATGAAMLISTDVIREIGPWDESFLLYSEETEFALRAGDRGW
FT                   ALWYEPASVIEHIGGDSGVNPTLAALLTVNKVKLFRRRRSAPASFAYYLAVVFGEGVRA
FT                   LAGRRTSRASVVALLRPSRRLQKLAD"
FT   gene            complement(669161..669826)
FT                   /locus_tag="Sros_0658"
FT   CDS_pept        complement(669161..669826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0658"
FT                   /product="xylanase/chitin deacetylase-like protein"
FT                   /note="KEGG: gme:Gmet_2023 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83681"
FT                   /db_xref="GOA:D2B4J5"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4J5"
FT                   /inference="protein motif:COG:COG0726"
FT                   /protein_id="ACZ83681.1"
FT                   /translation="MDSVVNLTVHGIGPTSRELDPGEDTTWVSVEQFEQVLDAAVGRPD
FT                   VRITFDDGNASDVEIALPRLLDRGLTAEFFVLAGLLGEPGRLDADGVRELVAAGMRVGS
FT                   HGWAHRDWRRLDGEQAEEEIADANRLLGELTGRRVSRVAIPFGSYDRRVLGRLRRAAVT
FT                   RAYTSDGGRARPGSWLQPRNSLRHDIDGTWAPRIIDGTPPLPLRVRRVAARAFKRARG"
FT   gene            complement(669924..670844)
FT                   /locus_tag="Sros_0659"
FT   CDS_pept        complement(669924..670844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0659"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="KEGG: rce:RC1_3991 UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83682"
FT                   /db_xref="GOA:D2B4J6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4J6"
FT                   /inference="similar to AA sequence:KEGG:RC1_3991"
FT                   /protein_id="ACZ83682.1"
FT                   /translation="MLVTGATGFIGAHLVRRLGSLGAQVHAVSRRPQERSASGATWHVA
FT                   DVSDAEAIEDLVRSTRPGVVFHLASEVAGARDPRLVRTMLDSNLASVVNLLTAVADSPG
FT                   TRVVLAGSLEEPRPGEGEAAPSSPYAVAKWAASGYARMFHHLWDVPVTTLRIGMVYGPD
FT                   QPDTSKLVPYATLSLLRGEAPSLSSGTRHLDWVYVDDVVDAFLAAGRTAEAAGRSFDIG
FT                   TGTRTSIRDTVELLGRIVGSSLRPHYGALSDRPLDSARIADIAPAAEVLRWRPATGLEE
FT                   GLRLTAAWYAERLRQDDVPRRGGTL"
FT   gene            complement(671095..672141)
FT                   /locus_tag="Sros_0660"
FT   CDS_pept        complement(671095..672141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0660"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase subunit
FT                   beta"
FT                   /note="KEGG: eba:ebA3150 2-oxoglutarate ferredoxin
FT                   oxidoreductase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83683"
FT                   /db_xref="GOA:D2B4J7"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4J7"
FT                   /inference="similar to AA sequence:KEGG:ebA3150"
FT                   /protein_id="ACZ83683.1"
FT                   /translation="MSEIQNGRGLSLVPKSDVKLGMKDFKSDQEVRWCPGCGDYAILAA
FT                   VQSFVPELGLKRENMVFVSGIGCSSRFPYYMNTYGFHSIHGRAPAIATGLATSRPDLSV
FT                   WVITGDGDALSIGGNHLIHALRRNVNLNILLFNNRIYGLTKGQYSPTSEIGKITKSTPM
FT                   GSLDKPFNPVSLAIGAEASFVARTIDSDRKHLQSVLREAAEHRGTSLVEIYQNCNIFND
FT                   NAFEQLKDPEQRDDITLRLEHGRPIVSASKAVRRAADGGIEVVPRAEVSEAEILVHDAH
FT                   RADPSLAFALSRLDEPAFEHVPIGVFRSVERPSYDELMAGQLEEAVGDRGRGDLDDLLL
FT                   AGDTWRIG"
FT   gene            complement(672134..673987)
FT                   /locus_tag="Sros_0661"
FT   CDS_pept        complement(672134..673987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0661"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain-containing protein"
FT                   /note="KEGG: afw:Anae109_1891 pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83684"
FT                   /db_xref="GOA:D2B4J8"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4J8"
FT                   /inference="similar to AA sequence:KEGG:Anae109_1891"
FT                   /protein_id="ACZ83684.1"
FT                   /translation="MTKQVQQLDRVIIRFAGDSGDGMQLTGDRFTAGTAEFGNDLSTLP
FT                   NFPAEIRAPAGTLPGVSSFQLHFADHDILTPGDAPNVLVAMNPAALKANLGDLPRGADI
FT                   IANTDEFTKRNLQKVGYDGNPLEDDSLAEWRLHPVPLTSLTVKALEGFTLSKKDAERSK
FT                   NMFALGLLSWLYHRPTEATIQFLENKFAKKPDIAKANIAAFQAGWNYGETTESFSVSYE
FT                   VKPAKLPPGVYRNISGNQALAYGLIAASVQSRLPLFLGSYPITPASDILHELSKHKRFG
FT                   IRTFQAEDEIAGVGAALGAAFGGALGVTTTSGPGVALKAETVGLAVTTELPLLVVDVQR
FT                   AGPSTGMPTKTEQTDLLMAMFGRNGESPLPIVAPATPSDCFDAAIEAARLAVKYRTPVM
FT                   LLSDGYLANGSEPWKVPSAAELPDIATEFATGPNGEDGVTFLPFKRDAETLARPWAIPG
FT                   TAGLEHRIGGIEKAENTGNISYDPNNHDKMVRLRQAKIDGIARDIPPLEVDDPDGDARV
FT                   LVLGWGSTYGPIAAAVRRIRKSGGKVAQAHLRHLNPLPANTGEVLRAYDKVLLPEINLG
FT                   QLALLLRARFLVDIISYNRVRGLPFKAEELAGVIQDVIDSE"
FT   gene            complement(674387..675793)
FT                   /locus_tag="Sros_0662"
FT   CDS_pept        complement(674387..675793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0662"
FT                   /product="xylanase/chitin deacetylase-like protein"
FT                   /note="KEGG: xau:Xaut_3117 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83685"
FT                   /db_xref="GOA:D2B4J9"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D2B4J9"
FT                   /inference="protein motif:COG:COG0726"
FT                   /protein_id="ACZ83685.1"
FT                   /translation="MINYVDPSRVQGLSVRTMNGGDTGDRRVHVTYPSIDDAPRLSEKI
FT                   RRTVTERLDRFIRDTSMNTALPHPEFNVDWQLAAASDQVVGVRLRTGESLGAGWSESRT
FT                   TVWYDRVDRRALDSTALLRDGSALAELARIVRESLNDRGSPVDPRAVRPDAELFDSLSF
FT                   NPHGELVVEFDDYQVSGGPLGRVAVAVPAAEVAPLLSATGLRAQRAAAGTARTSPPMGS
FT                   DESIEAASTVKLPARSSKAGSVDCARVKCVALTYDDGPGPDTGRLLDILAGADARATFF
FT                   SVGSNAAARPELLRRMRQEGHLVANHTWSHRDLTSLSTSRIADQIDRTQYTITQTIWQV
FT                   PTLVRPPYGASSVQVASVARRLGLSVVRWSVDTEDRRDRDPGAIADRAVSRARPGAIVL
FT                   MHDVHGATVDAAPEILRRLKEKGYTFVTVPELYGSRGMEPGRTYDSAASGGSSGKSGSV
FT                   TRALEKQALP"
FT   gene            676076..676447
FT                   /locus_tag="Sros_0663"
FT   CDS_pept        676076..676447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sros_0663"
FT                   /product="oxidored_q4, NADH-ubiquinone/plastoquinone
FT                   oxidoreductase, chain 3"
FT                   /note="KEGG: baa:BA_0396 oxidored_q4, NADH-
FT                   ubiquinone/plastoquinone oxidoreductase, chain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sros_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ83686"
FT                   /db_xref="GOA:D2B4K0"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPr