(data stored in ACNUC17686 zone)

EMBL: CP001818

ID   CP001818; SV 1; circular; genomic DNA; STD; PRO; 1848474 BP.
XX
AC   CP001818; ABUW01000000-ABUW01000011;
XX
PR   Project:PRJNA29531;
XX
DT   23-NOV-2009 (Rel. 102, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Thermanaerovibrio acidaminovorans DSM 6589, complete genome.
XX
KW   .
XX
OS   Thermanaerovibrio acidaminovorans DSM 6589
OC   Bacteria; Synergistetes; Synergistia; Synergistales; Synergistaceae;
OC   Thermanaerovibrio.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-1848474
RX   PUBMED; 21304665.
RA   Chovatia M., Sikorski J., Schroder M., Lapidus A., Nolan M., Tice H.,
RA   Glavina Del Rio T., Copeland A., Cheng J.F., Lucas S., Chen F., Bruce D.,
RA   Goodwin L., Pitluck S., Ivanova N., Mavromatis K., Ovchinnikova G.,
RA   Pati A., Chen A., Palaniappan K., Land M., Hauser L., Chang Y.J.,
RA   Jeffries C.D., Chain P., Saunders E., Detter J.C., Brettin T., Rohde M.,
RA   Goker M., Spring S., Bristow J., Markowitz V., Hugenholtz P.,
RA   Kyrpides N.C., Klenk H.P., Eisen J.A.;
RT   "Complete genome sequence of Thermanaerovibrio acidaminovorans type strain
RT   (Su883)";
RL   Stand Genomic Sci 1(3):254-261(2009).
XX
RN   [2]
RP   1-1848474
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N.M., Chertkov O., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Schroeder M., Schneider S., Spring S., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Thermanaerovibrio acidaminovorans DSM 6589";
RL   Unpublished.
XX
RN   [3]
RP   1-1848474
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N.M., Chertkov O., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Schroeder M., Schneider S., Spring S., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (12-NOV-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; d4854e9f35a3494cfa8bb8fe03f799a8.
DR   BioSample; SAMN00002595.
DR   CABRI; DSM 6589.
DR   EnsemblGenomes-Gn; EBG00001184301.
DR   EnsemblGenomes-Gn; EBG00001184302.
DR   EnsemblGenomes-Gn; EBG00001184303.
DR   EnsemblGenomes-Gn; EBG00001184304.
DR   EnsemblGenomes-Gn; EBG00001184305.
DR   EnsemblGenomes-Gn; EBG00001184306.
DR   EnsemblGenomes-Gn; EBG00001184307.
DR   EnsemblGenomes-Gn; EBG00001184308.
DR   EnsemblGenomes-Gn; EBG00001184309.
DR   EnsemblGenomes-Gn; EBG00001184310.
DR   EnsemblGenomes-Gn; EBG00001184311.
DR   EnsemblGenomes-Gn; EBG00001184312.
DR   EnsemblGenomes-Gn; EBG00001184313.
DR   EnsemblGenomes-Gn; EBG00001184314.
DR   EnsemblGenomes-Gn; EBG00001184315.
DR   EnsemblGenomes-Gn; EBG00001184316.
DR   EnsemblGenomes-Gn; EBG00001184317.
DR   EnsemblGenomes-Gn; EBG00001184318.
DR   EnsemblGenomes-Gn; EBG00001184319.
DR   EnsemblGenomes-Gn; EBG00001184320.
DR   EnsemblGenomes-Gn; EBG00001184321.
DR   EnsemblGenomes-Gn; EBG00001184322.
DR   EnsemblGenomes-Gn; EBG00001184323.
DR   EnsemblGenomes-Gn; EBG00001184324.
DR   EnsemblGenomes-Gn; EBG00001184325.
DR   EnsemblGenomes-Gn; EBG00001184326.
DR   EnsemblGenomes-Gn; EBG00001184327.
DR   EnsemblGenomes-Gn; EBG00001184328.
DR   EnsemblGenomes-Gn; EBG00001184329.
DR   EnsemblGenomes-Gn; EBG00001184330.
DR   EnsemblGenomes-Gn; EBG00001184331.
DR   EnsemblGenomes-Gn; EBG00001184332.
DR   EnsemblGenomes-Gn; EBG00001184333.
DR   EnsemblGenomes-Gn; EBG00001184334.
DR   EnsemblGenomes-Gn; EBG00001184335.
DR   EnsemblGenomes-Gn; EBG00001184336.
DR   EnsemblGenomes-Gn; EBG00001184337.
DR   EnsemblGenomes-Gn; EBG00001184338.
DR   EnsemblGenomes-Gn; EBG00001184339.
DR   EnsemblGenomes-Gn; EBG00001184340.
DR   EnsemblGenomes-Gn; EBG00001184341.
DR   EnsemblGenomes-Gn; EBG00001184342.
DR   EnsemblGenomes-Gn; EBG00001184343.
DR   EnsemblGenomes-Gn; EBG00001184344.
DR   EnsemblGenomes-Gn; EBG00001184345.
DR   EnsemblGenomes-Gn; EBG00001184346.
DR   EnsemblGenomes-Gn; EBG00001184347.
DR   EnsemblGenomes-Gn; EBG00001184348.
DR   EnsemblGenomes-Gn; EBG00001184349.
DR   EnsemblGenomes-Gn; EBG00001184350.
DR   EnsemblGenomes-Gn; EBG00001184351.
DR   EnsemblGenomes-Gn; EBG00001184352.
DR   EnsemblGenomes-Gn; EBG00001184353.
DR   EnsemblGenomes-Gn; EBG00001184354.
DR   EnsemblGenomes-Gn; EBG00001184355.
DR   EnsemblGenomes-Gn; EBG00001184356.
DR   EnsemblGenomes-Gn; EBG00001184357.
DR   EnsemblGenomes-Gn; EBG00001184358.
DR   EnsemblGenomes-Gn; EBG00001184359.
DR   EnsemblGenomes-Gn; EBG00001184360.
DR   EnsemblGenomes-Gn; EBG00001184361.
DR   EnsemblGenomes-Gn; EBG00001184362.
DR   EnsemblGenomes-Gn; EBG00001184364.
DR   EnsemblGenomes-Gn; EBG00001184365.
DR   EnsemblGenomes-Gn; EBG00001184367.
DR   EnsemblGenomes-Gn; EBG00001184368.
DR   EnsemblGenomes-Gn; EBG00001184369.
DR   EnsemblGenomes-Gn; EBG00001184370.
DR   EnsemblGenomes-Gn; EBG00001184371.
DR   EnsemblGenomes-Gn; EBG00001184372.
DR   EnsemblGenomes-Gn; EBG00001184373.
DR   EnsemblGenomes-Gn; EBG00001184374.
DR   EnsemblGenomes-Gn; EBG00001184375.
DR   EnsemblGenomes-Gn; Taci_R0001.
DR   EnsemblGenomes-Gn; Taci_R0002.
DR   EnsemblGenomes-Gn; Taci_R0003.
DR   EnsemblGenomes-Gn; Taci_R0004.
DR   EnsemblGenomes-Gn; Taci_R0005.
DR   EnsemblGenomes-Gn; Taci_R0006.
DR   EnsemblGenomes-Gn; Taci_R0007.
DR   EnsemblGenomes-Gn; Taci_R0008.
DR   EnsemblGenomes-Gn; Taci_R0009.
DR   EnsemblGenomes-Gn; Taci_R0010.
DR   EnsemblGenomes-Gn; Taci_R0011.
DR   EnsemblGenomes-Gn; Taci_R0012.
DR   EnsemblGenomes-Gn; Taci_R0013.
DR   EnsemblGenomes-Gn; Taci_R0014.
DR   EnsemblGenomes-Gn; Taci_R0015.
DR   EnsemblGenomes-Gn; Taci_R0016.
DR   EnsemblGenomes-Gn; Taci_R0017.
DR   EnsemblGenomes-Gn; Taci_R0018.
DR   EnsemblGenomes-Gn; Taci_R0019.
DR   EnsemblGenomes-Gn; Taci_R0020.
DR   EnsemblGenomes-Gn; Taci_R0021.
DR   EnsemblGenomes-Gn; Taci_R0022.
DR   EnsemblGenomes-Gn; Taci_R0023.
DR   EnsemblGenomes-Gn; Taci_R0024.
DR   EnsemblGenomes-Gn; Taci_R0025.
DR   EnsemblGenomes-Gn; Taci_R0026.
DR   EnsemblGenomes-Gn; Taci_R0027.
DR   EnsemblGenomes-Gn; Taci_R0028.
DR   EnsemblGenomes-Gn; Taci_R0029.
DR   EnsemblGenomes-Gn; Taci_R0030.
DR   EnsemblGenomes-Gn; Taci_R0031.
DR   EnsemblGenomes-Gn; Taci_R0032.
DR   EnsemblGenomes-Gn; Taci_R0033.
DR   EnsemblGenomes-Gn; Taci_R0034.
DR   EnsemblGenomes-Gn; Taci_R0035.
DR   EnsemblGenomes-Gn; Taci_R0036.
DR   EnsemblGenomes-Gn; Taci_R0037.
DR   EnsemblGenomes-Gn; Taci_R0038.
DR   EnsemblGenomes-Gn; Taci_R0039.
DR   EnsemblGenomes-Gn; Taci_R0040.
DR   EnsemblGenomes-Gn; Taci_R0041.
DR   EnsemblGenomes-Gn; Taci_R0042.
DR   EnsemblGenomes-Gn; Taci_R0043.
DR   EnsemblGenomes-Gn; Taci_R0044.
DR   EnsemblGenomes-Gn; Taci_R0045.
DR   EnsemblGenomes-Gn; Taci_R0046.
DR   EnsemblGenomes-Gn; Taci_R0047.
DR   EnsemblGenomes-Gn; Taci_R0048.
DR   EnsemblGenomes-Gn; Taci_R0049.
DR   EnsemblGenomes-Gn; Taci_R0050.
DR   EnsemblGenomes-Gn; Taci_R0051.
DR   EnsemblGenomes-Gn; Taci_R0052.
DR   EnsemblGenomes-Gn; Taci_R0053.
DR   EnsemblGenomes-Gn; Taci_R0054.
DR   EnsemblGenomes-Gn; Taci_R0055.
DR   EnsemblGenomes-Gn; Taci_R0056.
DR   EnsemblGenomes-Gn; Taci_R0057.
DR   EnsemblGenomes-Gn; Taci_R0058.
DR   EnsemblGenomes-Gn; Taci_R0059.
DR   EnsemblGenomes-Gn; Taci_R0060.
DR   EnsemblGenomes-Gn; Taci_R0061.
DR   EnsemblGenomes-Gn; Taci_R0062.
DR   EnsemblGenomes-Gn; Taci_R0063.
DR   EnsemblGenomes-Tr; EBT00001762757.
DR   EnsemblGenomes-Tr; EBT00001762758.
DR   EnsemblGenomes-Tr; EBT00001762759.
DR   EnsemblGenomes-Tr; EBT00001762760.
DR   EnsemblGenomes-Tr; EBT00001762761.
DR   EnsemblGenomes-Tr; EBT00001762762.
DR   EnsemblGenomes-Tr; EBT00001762763.
DR   EnsemblGenomes-Tr; EBT00001762764.
DR   EnsemblGenomes-Tr; EBT00001762765.
DR   EnsemblGenomes-Tr; EBT00001762766.
DR   EnsemblGenomes-Tr; EBT00001762767.
DR   EnsemblGenomes-Tr; EBT00001762768.
DR   EnsemblGenomes-Tr; EBT00001762769.
DR   EnsemblGenomes-Tr; EBT00001762770.
DR   EnsemblGenomes-Tr; EBT00001762771.
DR   EnsemblGenomes-Tr; EBT00001762772.
DR   EnsemblGenomes-Tr; EBT00001762773.
DR   EnsemblGenomes-Tr; EBT00001762774.
DR   EnsemblGenomes-Tr; EBT00001762775.
DR   EnsemblGenomes-Tr; EBT00001762776.
DR   EnsemblGenomes-Tr; EBT00001762777.
DR   EnsemblGenomes-Tr; EBT00001762778.
DR   EnsemblGenomes-Tr; EBT00001762779.
DR   EnsemblGenomes-Tr; EBT00001762780.
DR   EnsemblGenomes-Tr; EBT00001762781.
DR   EnsemblGenomes-Tr; EBT00001762782.
DR   EnsemblGenomes-Tr; EBT00001762783.
DR   EnsemblGenomes-Tr; EBT00001762784.
DR   EnsemblGenomes-Tr; EBT00001762785.
DR   EnsemblGenomes-Tr; EBT00001762786.
DR   EnsemblGenomes-Tr; EBT00001762787.
DR   EnsemblGenomes-Tr; EBT00001762788.
DR   EnsemblGenomes-Tr; EBT00001762789.
DR   EnsemblGenomes-Tr; EBT00001762790.
DR   EnsemblGenomes-Tr; EBT00001762791.
DR   EnsemblGenomes-Tr; EBT00001762792.
DR   EnsemblGenomes-Tr; EBT00001762793.
DR   EnsemblGenomes-Tr; EBT00001762794.
DR   EnsemblGenomes-Tr; EBT00001762795.
DR   EnsemblGenomes-Tr; EBT00001762796.
DR   EnsemblGenomes-Tr; EBT00001762797.
DR   EnsemblGenomes-Tr; EBT00001762798.
DR   EnsemblGenomes-Tr; EBT00001762799.
DR   EnsemblGenomes-Tr; EBT00001762800.
DR   EnsemblGenomes-Tr; EBT00001762801.
DR   EnsemblGenomes-Tr; EBT00001762802.
DR   EnsemblGenomes-Tr; EBT00001762803.
DR   EnsemblGenomes-Tr; EBT00001762804.
DR   EnsemblGenomes-Tr; EBT00001762805.
DR   EnsemblGenomes-Tr; EBT00001762806.
DR   EnsemblGenomes-Tr; EBT00001762807.
DR   EnsemblGenomes-Tr; EBT00001762808.
DR   EnsemblGenomes-Tr; EBT00001762809.
DR   EnsemblGenomes-Tr; EBT00001762810.
DR   EnsemblGenomes-Tr; EBT00001762811.
DR   EnsemblGenomes-Tr; EBT00001762812.
DR   EnsemblGenomes-Tr; EBT00001762813.
DR   EnsemblGenomes-Tr; EBT00001762814.
DR   EnsemblGenomes-Tr; EBT00001762815.
DR   EnsemblGenomes-Tr; EBT00001762816.
DR   EnsemblGenomes-Tr; EBT00001762817.
DR   EnsemblGenomes-Tr; EBT00001762818.
DR   EnsemblGenomes-Tr; EBT00001762819.
DR   EnsemblGenomes-Tr; EBT00001762820.
DR   EnsemblGenomes-Tr; EBT00001762821.
DR   EnsemblGenomes-Tr; EBT00001762822.
DR   EnsemblGenomes-Tr; EBT00001762823.
DR   EnsemblGenomes-Tr; EBT00001762824.
DR   EnsemblGenomes-Tr; EBT00001762825.
DR   EnsemblGenomes-Tr; EBT00001762826.
DR   EnsemblGenomes-Tr; EBT00001762827.
DR   EnsemblGenomes-Tr; EBT00001762830.
DR   EnsemblGenomes-Tr; EBT00001762831.
DR   EnsemblGenomes-Tr; Taci_R0001-1.
DR   EnsemblGenomes-Tr; Taci_R0002-1.
DR   EnsemblGenomes-Tr; Taci_R0003-1.
DR   EnsemblGenomes-Tr; Taci_R0004-1.
DR   EnsemblGenomes-Tr; Taci_R0005-1.
DR   EnsemblGenomes-Tr; Taci_R0006-1.
DR   EnsemblGenomes-Tr; Taci_R0007-1.
DR   EnsemblGenomes-Tr; Taci_R0008-1.
DR   EnsemblGenomes-Tr; Taci_R0009-1.
DR   EnsemblGenomes-Tr; Taci_R0010-1.
DR   EnsemblGenomes-Tr; Taci_R0011-1.
DR   EnsemblGenomes-Tr; Taci_R0012-1.
DR   EnsemblGenomes-Tr; Taci_R0013-1.
DR   EnsemblGenomes-Tr; Taci_R0014-1.
DR   EnsemblGenomes-Tr; Taci_R0015-1.
DR   EnsemblGenomes-Tr; Taci_R0016-1.
DR   EnsemblGenomes-Tr; Taci_R0017-1.
DR   EnsemblGenomes-Tr; Taci_R0018-1.
DR   EnsemblGenomes-Tr; Taci_R0019-1.
DR   EnsemblGenomes-Tr; Taci_R0020-1.
DR   EnsemblGenomes-Tr; Taci_R0021-1.
DR   EnsemblGenomes-Tr; Taci_R0022-1.
DR   EnsemblGenomes-Tr; Taci_R0023-1.
DR   EnsemblGenomes-Tr; Taci_R0024-1.
DR   EnsemblGenomes-Tr; Taci_R0025-1.
DR   EnsemblGenomes-Tr; Taci_R0026-1.
DR   EnsemblGenomes-Tr; Taci_R0027-1.
DR   EnsemblGenomes-Tr; Taci_R0028-1.
DR   EnsemblGenomes-Tr; Taci_R0029-1.
DR   EnsemblGenomes-Tr; Taci_R0030-1.
DR   EnsemblGenomes-Tr; Taci_R0031-1.
DR   EnsemblGenomes-Tr; Taci_R0032-1.
DR   EnsemblGenomes-Tr; Taci_R0033-1.
DR   EnsemblGenomes-Tr; Taci_R0034-1.
DR   EnsemblGenomes-Tr; Taci_R0035-1.
DR   EnsemblGenomes-Tr; Taci_R0036-1.
DR   EnsemblGenomes-Tr; Taci_R0037-1.
DR   EnsemblGenomes-Tr; Taci_R0038-1.
DR   EnsemblGenomes-Tr; Taci_R0039-1.
DR   EnsemblGenomes-Tr; Taci_R0040-1.
DR   EnsemblGenomes-Tr; Taci_R0041-1.
DR   EnsemblGenomes-Tr; Taci_R0042-1.
DR   EnsemblGenomes-Tr; Taci_R0043-1.
DR   EnsemblGenomes-Tr; Taci_R0044-1.
DR   EnsemblGenomes-Tr; Taci_R0045-1.
DR   EnsemblGenomes-Tr; Taci_R0046-1.
DR   EnsemblGenomes-Tr; Taci_R0047-1.
DR   EnsemblGenomes-Tr; Taci_R0048-1.
DR   EnsemblGenomes-Tr; Taci_R0049-1.
DR   EnsemblGenomes-Tr; Taci_R0050-1.
DR   EnsemblGenomes-Tr; Taci_R0051-1.
DR   EnsemblGenomes-Tr; Taci_R0052-1.
DR   EnsemblGenomes-Tr; Taci_R0053-1.
DR   EnsemblGenomes-Tr; Taci_R0054-1.
DR   EnsemblGenomes-Tr; Taci_R0055-1.
DR   EnsemblGenomes-Tr; Taci_R0056-1.
DR   EnsemblGenomes-Tr; Taci_R0057-1.
DR   EnsemblGenomes-Tr; Taci_R0058-1.
DR   EnsemblGenomes-Tr; Taci_R0059-1.
DR   EnsemblGenomes-Tr; Taci_R0060-1.
DR   EnsemblGenomes-Tr; Taci_R0061-1.
DR   EnsemblGenomes-Tr; Taci_R0062-1.
DR   EnsemblGenomes-Tr; Taci_R0063-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01990; SECIS_4.
DR   SILVA-LSU; CP001818.
DR   SILVA-SSU; CP001818.
DR   StrainInfo; 115128; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082996
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Thermanaerovibrio acidaminovorans Su883,
CC                            DSM 6589
CC   Culture Collection ID :: DSM 6589, ATCC 49978
CC   GOLD Stamp ID         :: Gc01091
CC   Greengenes ID         :: 1650
CC   Funding Program       :: DOE-GEBA 2007
CC   Number of Reads       :: 19,461 Sanger, 358,573 454
CC   Assembly Method       :: Newbler version 1.1.02.15, Phrap
CC   Sequencing Depth      :: 9.7x Sanger; 9.9x 454
CC   Gene Calling Method   :: Prodigal
CC   Isolation Site        :: Upflow anaerobic sludge bed reactor of a
CC                            sugar refinery, Breda, the Netherlands
CC   Collection Date       :: 1992
CC   Isolation Country     :: Netherlands
CC   Latitude              :: 51.589322
CC   Longitude             :: 4.774491
CC   Oxygen Requirement    :: Obligate anaerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Thermophile
CC   Temperature Optimum   :: 55C
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Sludge
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1848474
FT                   /organism="Thermanaerovibrio acidaminovorans DSM 6589"
FT                   /strain="DSM 6589"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:525903"
FT   gene            97..1440
FT                   /locus_tag="Taci_0001"
FT   CDS_pept        97..1440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: bsu:BSU00010 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18242"
FT                   /db_xref="GOA:D1B7I9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7I9"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACZ18242.1"
FT                   /translation="MDSGEVNHLEDLKVLWNEILDKGRDVLPPGAAGTWLKTCLPLEIS
FT                   GGMLVLDVPNVFIKEQIQSRFLLPLKELVRALGVAEDVELKVGSEIRPNEQKRAEAAAM
FT                   PLQSQRGGLNPNYVFDNFVVGKSNRLAHAASLAAAESPGVAYNPLFIWGGVGLGKTHLM
FT                   HAIGHYVCDNQPGAKVVYVSSEKFTNELISAIQNNRTQDFKAKYRSVDVLLIDDIQFLA
FT                   DKESTQEEFFHTFNSLHDAKKQVVISSDRPPKDIQRVEERLVSRFEWGLVTDIQPPDLE
FT                   TRVAILQKKAEMRGYEVPEDVIFFLAQNIPSNIRELEGALNRVVACSELNGEVISVENA
FT                   AEWLKDIIRNVMRGPVSIDLIQHLVAESFGMPVDDLLSTKRTSDLALARQVAMYLCREH
FT                   TEASLQQIGYAFNKKDHTTVLHACRKIDELLKTDLRVKSVVDNVRKKL"
FT   gene            1689..2828
FT                   /locus_tag="Taci_0002"
FT   CDS_pept        1689..2828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: mca:MCA3032 DNA polymerase III, beta subunit;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18243"
FT                   /db_xref="GOA:D1B7J0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7J0"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACZ18243.1"
FT                   /translation="MKLNIEKGPFIRAWNMAERCAGASSSGASSSVMIRSSAGRVELFA
FT                   TDMKTSLRCPVQGVQSDLDGEALLPVKVLGDLFKKCPDPSFTINLEEGRGTMVSGRSRY
FT                   RFSTYDVSEFPKFPSSASAAQFGTVKAQDLRNAISEGGIAASTSDEYPQYLSCVYLQGD
FT                   QGALRIVSTDSRRLAYSKCPMEGSSSESMLLPMRAIRELDRMLSGLQEDGDVRILLDQA
FT                   QAYFISDDFEFAIRRVDGKFPQYERIIPKSCTTFMEVSRSQMIGALERLDLVVRDFNKM
FT                   VAVNLSPGGSCTLRSRSPEFGDAVEEVEGAIEGEPLRIAFNVKFLLDGVKGLQDSLVRL
FT                   EFNGPGGHLCIKRIGSDSYLYLLAPLAMDESELPGDDAL"
FT   gene            2818..3882
FT                   /locus_tag="Taci_0003"
FT   CDS_pept        2818..3882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: gbm:Gbem_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18244"
FT                   /db_xref="GOA:D1B7J1"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7J1"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACZ18244.1"
FT                   /translation="MHFRSIKLYRYRNLEDQAVNLSPGLNLFFGPNGAGKTNLLEAFCA
FT                   ASGWGGFGRPSMIPRRGDGSPSPMSAAVAQASGEEEITCAFQFNRRPLLKIDGSAVTGS
FT                   ELRRRMPVLAFLPDSAALVDGPPSMRRRLLDMVCVLCVPGYGEALTRYRRAVRQRMASL
FT                   RCGRWEEMTLRVMAREAVEIWRARSVVAPRLCQLSQAFASRLGIHLEASYVGQHESLDR
FT                   LEPGRFLEAARSIKGEEMTHRRPRFGPHRDDVVLTSGGHAAGLALSRGQRRRAFAALVM
FT                   ASAQVVYKALRRGPVLVMDEVFAEVDREGRTLMARGLVELGVQVLASTADLPEAPDGAS
FT                   LYRVRSGVVTPVGG"
FT   gene            3889..5757
FT                   /locus_tag="Taci_0004"
FT   CDS_pept        3889..5757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0004"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; KEGG: mca:MCA0001
FT                   tRNA uridine 5- carboxymethylaminomethyl modification
FT                   enzyme GidA"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18245"
FT                   /db_xref="GOA:D1B7J2"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7J2"
FT                   /inference="protein motif:TFAM:TIGR00136"
FT                   /protein_id="ACZ18245.1"
FT                   /translation="MNRGDDFYPVVVVGGGHAGCEAALASARMGVRTLLLNMNLENTAL
FT                   MACNPSIGGPAKGHLTREVDAMGGFQAKAADRSALHVRWLNTSKGPAVRTLRIQCDMWE
FT                   FHRAYRLQVESQPNLHVLQAEAVDLWVEDRRIRGVRTSLGQVVECLAVILSPGTYSGAR
FT                   VYIGLDRFQAGPMGNLGSYRLAESLMSLGLKLGRLKTGTPPRLHRDSIDWDSIPHQEGE
FT                   EEPCAMSVFSEPRVVSGFFCGCTRTNLETHRIIIEALDRSPLYTGLIEGVGPRYCPSIE
FT                   DKVVRFPHRDSHPVFLEPVGKDSNEVYVQNFSTSLPYDVQVRMVRTLPGCEGARILKPG
FT                   YAIEYWYSDPRQLEPWLEVKGLAGLFMAGQVNGTSGYEEAASQGLVAGVNGALRAMGVN
FT                   EPFVLGRHEAYVGVLIDDLVTKGTDEPYRMLTSRCEHRLRLRHDNADRRLSFRARELGL
FT                   LDDLSWGVVMSRMEDQRKLREALEGAVLKPDFVNPRLRELGSSPVEEPVRALELLRRPE
FT                   VTWETLRDLTRIGGPSESWRSVEVEEKYRGYVAREDRRVERMSRMDQVRIPEGFDFGSV
FT                   RGLLRESLEKLNRVRPRTLGQASRISGVTPADVELIWMHLEGGDGP"
FT   gene            5754..6203
FT                   /locus_tag="Taci_0005"
FT   CDS_pept        5754..6203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   scl:sce9010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18246"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7J3"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ACZ18246.1"
FT                   /translation="MRSFREVISEARGEVRIGLGLAHLKRMWRGLVGEELGSRSRPASF
FT                   ERGCLLVVCSSSSARMKMMMCKKGVLVALRRLGLPVEDIRAVVGGGGFERPLEVKVSSP
FT                   RPKARPRPQVDPEALERARERLAGLVSDPEILTALARLMALRGEG"
FT   gene            6894..7892
FT                   /locus_tag="Taci_0006"
FT   CDS_pept        6894..7892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0006"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   glo:Glov_0358 2-nitropropane dioxygenase NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18247"
FT                   /db_xref="GOA:D1B7J4"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7J4"
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /protein_id="ACZ18247.1"
FT                   /translation="MISGPRLAGAVAACGGVGTIASVGLACASPHFDGRNYFEANQLAM
FT                   ADALREARAIAPEGVIAVNCMCALTDYDTQVRSACEAGADVIVSGAGLPLNLPELTRDF
FT                   PDVALVPIVSSLKAAELIVRRWEKQHGRQPDGFVVETPLHAGGHLGATKMEHVTDPEFS
FT                   LETVVPQLVRYVEDVLKSPIPVIAAGGIFDRSDMERAFALGAKGVQMGTRFACTEECDA
FT                   DVRFKEAYVNATADDVVVIMSPVGIPGRALRNPFVQRYLEGKVESKPCIARCLSHCTYI
FT                   RTRETFCIAQALVDAYRGNWEEGLFFCGDNVHRCQRIERVRDIFAELFPGD"
FT   sig_peptide     6894..6974
FT                   /locus_tag="Taci_0006"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.792 at
FT                   residue 27"
FT   gene            7969..8361
FT                   /locus_tag="Taci_0007"
FT   CDS_pept        7969..8361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0007"
FT                   /product="Superoxide reductase"
FT                   /EC_number="1.15.1.2"
FT                   /note="PFAM: Desulfoferrodoxin ferrous iron-binding region;
FT                   KEGG: gsu:GSU0720 desulfoferrodoxin ferrous iron- binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18248"
FT                   /db_xref="GOA:D1B7J5"
FT                   /db_xref="InterPro:IPR002742"
FT                   /db_xref="InterPro:IPR036073"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7J5"
FT                   /inference="protein motif:PRIAM:1.15.1.2"
FT                   /protein_id="ACZ18248.1"
FT                   /translation="MKMADLIQSGDWKGEKHVPVIEVKGPVKAGEPFEVQVSVGKEIPH
FT                   PNTTEHHIRWIQLIFKPEGGKFPYEVGRVTFDVHGESTDGANQGPAHTEPFGVFRLKVA
FT                   KGGTLTALSYCNIHGLWESSVDLAAE"
FT   gene            8644..10278
FT                   /locus_tag="Taci_0008"
FT   CDS_pept        8644..10278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0008"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: rsp:RSP_3255 ABC peptide transporter, periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18249"
FT                   /db_xref="GOA:D1B7J6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7J6"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACZ18249.1"
FT                   /translation="MRKKAVLLLLALGVMSLMSLPALAADKPVYGGTLVYREASDPPKI
FT                   DPAFTTDTTSDRASNLIFETLVINSPDGKRILPCLAESWTINKDSTVFTFKLRKGVKFH
FT                   SVSEGKPTLNKGREVKAEDVKYSFERLVRLKSPRAYFVEQIKGYKEFTEGKAKEWTGIK
FT                   VLDPYTVQFTLEYPFAPFLAVLAYHAFSVVPREDAEKWGKDFSFHPVGTGPFVFKEWKH
FT                   DQRFVVERNPHYWGKDAQGNRLPYVDRVEIRIVPDNSVAWLEFKKGNIDILSAIPNEYY
FT                   KECKGLYGPKKLFVERPGVGTFYIGMNTSKPPFKDNVKLRQALNWAIDRQAISDLILSG
FT                   RNRPVKGVLPPSMPGFNPNLKGYGYDPAKAKKLLAEAGYPKGLTVEFQFNSGGSNRQIA
FT                   EAVQAQLSQIGVNVKLKELDWGAHLDMCDRGETQMYRMTWVVDYMDPDNFLFVNLHSSN
FT                   AGSKGNYSFYKNPKVDRLLSEARRESNWNKRMKLYQEAEQLIVNDAPWIFMMATSSSMV
FT                   HQPNVKNVVLHAMGDYMTDLSRVWKVK"
FT   sig_peptide     8644..8718
FT                   /locus_tag="Taci_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            10495..12129
FT                   /locus_tag="Taci_0009"
FT   CDS_pept        10495..12129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0009"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: rsp:RSP_3255 ABC peptide transporter, periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18250"
FT                   /db_xref="GOA:D1B7J7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7J7"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACZ18250.1"
FT                   /translation="MRKKAVLLLLALGVMSLMSLPALAADKPVYGGTLVYREASDPPKI
FT                   DPAFTTDTASDRASNLIFETLVFNDPDGKKILPGLAESWTINKDSTVFTFKLRKGVKFH
FT                   SVSEGKPTLNKGREVKAEDVKYSFERLVRLKSPRAYFVEQIKGYKEFTEGKAKEWSGIK
FT                   VLDPYTVQFTLEYPFAPFLAVLAYHAFSVVPREDAEKWGKDFSFHPVGTGPFVFKEWKH
FT                   DQRFVVERNPHYWGKDAQGNRLPYVDRVELRVIPDQSVAWLEFKKGNIDILTAVPDEVY
FT                   KECVATYGPKKLFVERPWVGTYYIGMNTSKPPFKDNVKLRQALNWAIDRQAINQMILNG
FT                   RRKVNKGVLPPGMPGFNPNLKGYGYDPAKAKKLLAEAGYPNGLDVELQFNAGAGHKAIC
FT                   EAVQAQLSQIGVNVKLKELDWGVHLDTCDRGETQMFRMGWVVDYMDPDNFLFVNLHSSN
FT                   FGSKGNYSFYKNPKVDQLLSEARRESNWGKRMKLYQEAEQLIVNDAPWIFLFAYTTSMV
FT                   HQPNVKNVVLPAMGDYQIDLSRVWKTK"
FT   sig_peptide     10495..10569
FT                   /locus_tag="Taci_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            12190..13116
FT                   /locus_tag="Taci_0010"
FT   CDS_pept        12190..13116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0010"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH0029 oligopeptide ABC
FT                   transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18251"
FT                   /db_xref="GOA:D1B7J8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7J8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ18251.1"
FT                   /translation="MFQYVLRKLLVSIPVVWGVVTVIFILMAVVPGDPARIMMGQRGDP
FT                   ETLARIRADLGLDKPLTVQYVDFLSKLVRGDLGKSYRTNEPVSKAIGERFGVTMRLAIW
FT                   CIVLATIVGVAAGIMSAVKQYSIFDYSAMFIAIAGVSAPVFWFSLLLLLVFAYGLHWVP
FT                   GVGYEDGSFRYMVLPIIALGLRPAAIIARLTRSCMLEVLSMDYIRTARAKGLSERAVVL
FT                   KHALKNAMIPVVTIVGAEMSGLLSGAVLTETVFALPGVGRLAVEALVARDFPMIRGTVI
FT                   VIALIFLVANLLVDLSYGLFDPRIRYE"
FT   gene            13129..14052
FT                   /locus_tag="Taci_0011"
FT   CDS_pept        13129..14052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0011"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bsu:BSU11400 oligopeptide
FT                   ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18252"
FT                   /db_xref="GOA:D1B7J9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7J9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ18252.1"
FT                   /translation="MSVSENVTPNVCTAVVEEPKPRSLWADAWLRFKRNKLAMAGLIMT
FT                   ITVILAAVFAPVIAPYDPVKQLIWTEGMSARLAAPSAKHIMGTDLYGRDIFSRILYGAR
FT                   ISLQIGIFATVVSLLIGIPMGAIAGYVGGKVDDFISWVMNVIYAFPFLLFVLAVVAVFK
FT                   DPGLSTVYVAIGLISWVSIARVLRAQFMQLREMEFVEAAKALGLPSWRILFVHILPSAM
FT                   APVIVQATMGMGGIIMIEAGLAFLGFGAQPPTPSWGLMISEGQQYLASGIWWWSIFPGL
FT                   AIMYTVLAFNFLGDGLRDALDVRMKR"
FT   gene            14065..15051
FT                   /locus_tag="Taci_0012"
FT   CDS_pept        14065..15051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0012"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: dde:Dde_1182 oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein-like; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18253"
FT                   /db_xref="GOA:D1B7K0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7K0"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACZ18253.1"
FT                   /translation="MLLSIESLRTSFHTDHGVVRAVDGVSYQVKPGETLCVVGESGCGK
FT                   SVTALSVMGLLQKPSGRVDGGKIVFQGVNLLELSEAEMRKVRGNSISMIFQEPMTSLNP
FT                   VFTVGEQIREPLMLHQGLTKSQADERALEMLVKVGISEPRKRLDSYPHQMSGGMRQRVM
FT                   IAMALACNPKLLIADEPTTALDVTVQAQILDLMRNLKKDFGSAIMLITHDLGVVAEMAD
FT                   RVVVMYGGQVVEEALVREAFKDPLHPYTRGLLESIPRLNEDRDRLAVIPGSVPDPRYFP
FT                   AGCRFSNRCASCHDRCVVEGPPFYQLSDGRKVRCFLYDGDSRVTGVE"
FT   gene            15052..16017
FT                   /locus_tag="Taci_0013"
FT   CDS_pept        15052..16017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0013"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bja:bll2869 ABC transporter ATP-binding
FT                   protein; TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18254"
FT                   /db_xref="GOA:D1B7K1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7K1"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACZ18254.1"
FT                   /translation="MDAILNVEGLVKHFPIRKGLFQSVVGHVKAVDGVSLRIPKGKTMG
FT                   LVGESGSGKTTTGRTLLHLIEPTAGKVTFDGQDVSAKLKEDPRWVRRSMQIIFQDPYGS
FT                   LNPRRTVMDIVGEAPLYHRIVDRSSLADYVGQVLEMSGLKPSDAMRYPHEFSGGQRQRI
FT                   GIARALAVRPRFLVCDEPVSALDVSIRSQILNLLKDLRDQLGLTYLFISHDMSVVRHIS
FT                   DHVAVMYLGKLVESAPKGAFFKEPLHPYSKALLSAIPLPDPDAKSERIILEGDVPSPVN
FT                   PPSGCRFHPRCAYAMDRCRTDEPPLADVGGREVACWLHCR"
FT   gene            16121..17128
FT                   /locus_tag="Taci_0014"
FT   CDS_pept        16121..17128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0014"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   csa:Csal_1716 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18255"
FT                   /db_xref="GOA:D1B7K2"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7K2"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACZ18255.1"
FT                   /translation="MKVMMILPELVEGGVERHVLDLSNHLCTMGHRVWVVSAGGSLEDR
FT                   LSPDVEVLHLPVHLKNPATALYSAVRIARIASNNRLDVIHTHSRVPNWIGWWASRMSRV
FT                   PLVITAHSCYRRNVALLPINRADGVICVSESVREHLGELLPVRSAVIFNGMEEPSVTWV
FT                   GDPGGIPSFLFVGRITQSKGLGVLLEALGGVDGDWRLDVVGDGPQRHQMEALSCRLGLS
FT                   NRVTFHGFRDDVDHWMSRCSCFVFPSLEEGMGRTLMRAVQIGTPVMASNLPAVRELALD
FT                   PSELVPAGDPWAWRFALAGFLRGERPSARFDPGRIPSVQTMALRVLDVYRGVLA"
FT   gene            17200..17907
FT                   /locus_tag="Taci_0015"
FT   CDS_pept        17200..17907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18256"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7K3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18256.1"
FT                   /translation="MPRVFSLSLLSLLVAMLIASGASGFVSKKEEGERLGMEVRGRILS
FT                   SHYHSKSDLALWRQLVHGQGISPVERIGAGLALVDRLFPGGDPSMWSSVSGLMEEEVPR
FT                   SLVAADAVLYTAYLAYEALPEPEGAWLAYILMKPFFSSSGARLTFGRICPEPLAELMDR
FT                   MSRDGVEPPEGWPEPFRVVGYFPMAHPVSGSVAMDQVLLYGMERLDNQGRPSEQGNAYA
FT                   WDREAGVLYRISR"
FT   sig_peptide     17200..17274
FT                   /locus_tag="Taci_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.473 at
FT                   residue 25"
FT   gene            17953..19296
FT                   /locus_tag="Taci_0016"
FT   CDS_pept        17953..19296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0016"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /EC_number="2.7.7.13"
FT                   /note="KEGG: dol:Dole_2031 mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; TIGRFAM:
FT                   mannose-1-phosphate guanylyltransferase/mannose-6-phosphate
FT                   isomerase; PFAM: Nucleotidyl transferase; Cupin 2 conserved
FT                   barrel domain protein; mannose-6-phosphate isomerase type
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18257"
FT                   /db_xref="GOA:D1B7K4"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7K4"
FT                   /inference="protein motif:TFAM:TIGR01479"
FT                   /protein_id="ACZ18257.1"
FT                   /translation="MKVVILAGGGGTRLFPLSRSWLPKQFLEFDGKRSLLGLTLERAMG
FT                   IVRPSDLVVVTNPKHRDRVMLELESVGALGAHLVLEPVGRNTASAVALGASYLLNLGVP
FT                   RGEVILVAPSDHIMGPAGEFVGAVDKACELALRGRWVVFGVRPAGPETGYGYIEVGGPV
FT                   GPGFLVRSFREKPDVESARAYAEDPRYYWNSGMYCLTLGCLMDQLERHMEDLYRLVSRG
FT                   YDEFISAFADSPSVSIDRGLAEKSSDGAMVPFNGDWSDIGSWDAIYKWLQKDGDGNVIS
FT                   GDCVALNCEGSLIMGQGRLIAALGLRDMLVVDGGDAILVAPRNESQRVGLLAEKLASLG
FT                   GRELPELLAGCVNGVSCRSLIRGVGYDVTEVQVKPGGAIDPHHHAKSSESWGVIEGKAR
FT                   VTIGNREMTVLAGDGVWVPVGESCRIENVGDGPLRLVVVRIGHKVFGG"
FT   gene            19361..20455
FT                   /locus_tag="Taci_0017"
FT   CDS_pept        19361..20455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0017"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; KEGG: ret:RHE_CH00762
FT                   GDP-mannose 4,6-dehydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18258"
FT                   /db_xref="GOA:D1B7K5"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7K5"
FT                   /inference="protein motif:TFAM:TIGR01472"
FT                   /protein_id="ACZ18258.1"
FT                   /translation="MKRALITGITGQDGAYLAEFLLSKGYEVHGLKRRSSLFNTGRIDH
FT                   LYQDPHVEGRRLFLHYGDLTDSSSVIRILQEVRPHEIYNLGAQSHVKVSFETPEYTANG
FT                   DGLGVLRVLEAIRILKMEDSCRFYQASTSELYGRASEVPQRETTPFYPRSPYGAAKLYG
FT                   YWITVNYREAYGIFGCNGILFNHESPLRGETFVTRKITRGAARISLGLDDRLYLGNLDA
FT                   RRDWGHARDYVRAMWMMLQHHEPGDYVIATGRCHTVREFAELAFSKVGISLKWIGSGVE
FT                   EKGIDADTGRVLVEVDPRYFRPTEVDVLLGDYTKARETLGWEPTVTPEELVDEMVSYDL
FT                   MLAERERLCSRSGYPVHPPMEGAL"
FT   gene            20455..21411
FT                   /locus_tag="Taci_0018"
FT   CDS_pept        20455..21411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0018"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; dTDP-4-
FT                   dehydrorhamnose reductase; KEGG: Os06g0652400; hypothetical
FT                   protein ; K02377 GDP-L-fucose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18259"
FT                   /db_xref="GOA:D1B7K6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7K6"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACZ18259.1"
FT                   /translation="MAFDVPGPIFVAGHRGLVGSAVIRRLSSLGREDVITADRSELDLT
FT                   DQAAVRSFMRRVRPGCVFLCAAKVGGIMANAKYPADFIGENLAIEVNVIREAFGAGVGL
FT                   LLFLGSSCIYPKLCPQPIREDYLLSGPLEATNEAYAVAKIAGLKMCEAYSRQYGVSYIS
FT                   VMPSNLYGPGDNFHLETSHVLPAMIRKFHEAKARGAEQVVLWGTGSPRREFLHVDDLAC
FT                   ASVFLLENYRGYEPINVGTGTDVTIAELADMVRNVVGFRGRVVWDSSKPDGTPRKLLDV
FT                   SKIRSMGWSPSIGLEEGIRSTYRWFLDNWRDARGYAG"
FT   gene            21408..22402
FT                   /pseudo
FT                   /locus_tag="Taci_0019"
FT   misc_binding    22518..22720
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam(RF00174),
FT                   score 93.02"
FT   gene            22890..24824
FT                   /locus_tag="Taci_0020"
FT   CDS_pept        22890..24824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0020"
FT                   /product="aconitate hydratase"
FT                   /note="TIGRFAM: aconitate hydratase; PFAM: aconitate
FT                   hydratase domain protein; KEGG: afr:AFE_0423 aconitate
FT                   hydratase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18260"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006250"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7K7"
FT                   /inference="protein motif:TFAM:TIGR01342"
FT                   /protein_id="ACZ18260.1"
FT                   /translation="MGLTLTEKILNPHVVEGRPERGERVGIRIDQTLTQDATGTMTYLQ
FT                   FEAIGVERVRTELSVSYVDHNMIQEDFKNPDDHRYLMDVAKKYGIVFSPPGNGICHQLH
FT                   VERFAVPGRTLLGSDSHTPTSGGVGMLAIGAGGMDVALAMAGEPFYVNYPRIVKVHLTG
FT                   RLGPFVSAKDVILEVLRRIGVKGGVGKVLEYCGPGVETLSVPERATMANMGAETGATSS
FT                   IFPSDQVTRRWLAAQGREEAFVPLEADPDGVYDQEIEIDLSRVEPLVALPHQPDNVVPV
FT                   REVAGMEIQQVMFGSCTNSSLRDLESVAHILGDGPAHPEVDAGVSPGSRQVLHHIAASG
FT                   ALERILSAGVRILEVSCGACIGMGFAPPTEGVSLRTINRNFLGRCGHKTGKVCLVSPET
FT                   AAASAVEGRLTDPRDFAQRRGLKPFVFVQPERFHVDDRRFVFPPEDGSSIQIRRGPNIA
FT                   PLPAMEPLGEMVCGLVLLKVGDDITTDHIMPAGAKVLPLRSNVPAISKHVFQVVDGTFP
FT                   ERALASGGGFVVGGANYGQGSSREHAALAPRYLGVKAVLVKSFARIHLANLVNFGILPL
FT                   VFQDPADYDRIDQGDRLELATDEVRAGSVFRVTDVTKGIQVPCTTPVGEEDLNVIMAGG
FT                   RLNYVKARR"
FT   gene            25126..26379
FT                   /locus_tag="Taci_0021"
FT   CDS_pept        25126..26379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0021"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /EC_number="1.1.1.42"
FT                   /note="KEGG: sfu:Sfum_3896 isocitrate dehydrogenase, NADP-
FT                   dependent; TIGRFAM: isocitrate dehydrogenase,
FT                   NADP-dependent; PFAM: isocitrate/isopropylmalate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18261"
FT                   /db_xref="GOA:D1B7K8"
FT                   /db_xref="InterPro:IPR004439"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7K8"
FT                   /inference="protein motif:TFAM:TIGR00183"
FT                   /protein_id="ACZ18261.1"
FT                   /translation="MRFEGLELKIYKAPESGERILFDGGRLQVPDEPVIPYVEGDGIGV
FT                   DITPAMRMVLDQAVRKAYGGRRRLHWWEIYAGQKAMDMFGTAIPEDSFNAVRYFRVAIK
FT                   GPLTTPVGGGFRSLNVAFRQELDLFACVRPVRWFEGVPAPLKRPQDVDMVIFRENTEDL
FT                   YAGIEWEEGTDECRRVIEFLKGMGKEIRVDSGIGIKPISRTGTERLVRMAIQYAIANRR
FT                   KSVTLVHKGNIMKFTEGAFMKWGYELAKREFGHVCITEQEVSELHGGVVPEGKIVIKDR
FT                   IADAMFQQILLRPSEYDVLAMPNLNGDYMSDALAAAVGGLGLAPGANMNDQVAFFEATH
FT                   GTAPKYAGQDKVNPGSLILSGVLMLEHLGWREAAELVIRGMERAISEGVVTYDLARQRE
FT                   GAREVSCSAFARAICERM"
FT   gene            26393..26710
FT                   /locus_tag="Taci_0022"
FT   CDS_pept        26393..26710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0022"
FT                   /product="citrate lyase subunit gamma"
FT                   /note="KEGG: rfr:Rfer_2409 citrate lyase subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18262"
FT                   /db_xref="GOA:D1B7K9"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7K9"
FT                   /inference="similar to AA sequence:KEGG:Rfer_2409"
FT                   /protein_id="ACZ18262.1"
FT                   /translation="MMAGDGSPAVCLGGVLELIVESRAGTLESSDCLVCVYPSDRVEVR
FT                   LKGVCARMYPERTRALVEEGLCRMGITGALVEIQDQGAILPTLRARLKTALSRAVGGVE
FT                   G"
FT   gene            26707..27585
FT                   /locus_tag="Taci_0023"
FT   CDS_pept        26707..27585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0023"
FT                   /product="Citrate (pro-3S)-lyase"
FT                   /EC_number="4.1.3.6"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: gbm:Gbem_3859
FT                   HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18263"
FT                   /db_xref="GOA:D1B7L0"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7L0"
FT                   /inference="protein motif:PRIAM:4.1.3.6"
FT                   /protein_id="ACZ18263.1"
FT                   /translation="MRPVRSMLYVPGNSPGMLQHCATFGADSVLLDLEDAVALSEKDAA
FT                   RDLVCEMLKVLDFGSVVVTVRVNGADTEFFQEDLRAVVPLRPHAVRIPKCSSPEDVILA
FT                   DRLMGRIEEEHGLPVGSVRIHAMLETARGVVNALEIGRSSPRVEALTLGGQDLTADMGV
FT                   SKTREGWELFVARSQVALAARSLGLQALDTVWADVDDHQGLYEEARRVVGLGFTGKAAI
FT                   HPSQIEWIHRAFVPELSEVERARRIVDAACRAHAEGKGVVSVDGRMVDAPVVRRAENTL
FT                   RLWEMGEVEGL"
FT   gene            27582..29138
FT                   /locus_tag="Taci_0024"
FT   CDS_pept        27582..29138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0024"
FT                   /product="citrate lyase, alpha subunit"
FT                   /EC_number="4.1.3.6"
FT                   /note="KEGG: ppd:Ppro_1084 citrate lyase, alpha subunit;
FT                   TIGRFAM: citrate lyase, alpha subunit; PFAM: Citrate lyase
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18264"
FT                   /db_xref="GOA:D1B7L1"
FT                   /db_xref="InterPro:IPR006472"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7L1"
FT                   /inference="protein motif:TFAM:TIGR01584"
FT                   /protein_id="ACZ18264.1"
FT                   /translation="MRFVENAIGRPVPLEVPGFGAVIPYGGPFCRLGEEVPRVSPPMRG
FT                   YPARRDKVTHDVEEAIRRSGLESGMTVSFHHHLRNGDAVMCRVLEACERLGIRDLTLAP
FT                   SSLTDAHEEVSGFVRRGVVRMIHTSGVRGEVGKAISRGELEVPVVIHSHGGRARAIEEG
FT                   SIRIDVAFLGAPKCDRMGNFTGMLGRSACGSLGYAQQDARYARHVVAVTDDLSEDPLGV
FT                   VSVPQYLVDQVLVVDSLGDPRKIATGAARITRNPVDLKIARDAFRLILASGLMEDGVSF
FT                   QVGAGGASLAVARYVREHMSAKGIRGSFGCGGVTGYMAQMLEEGLFRVLYDVQSFDASV
FT                   TGSMLRNRNHVEIDQSWYANPLNRGCVVNHLDVVVLAALEVDVDFNVNVLTGHDGVLRG
FT                   ASGGHCDTAAGSKLSVVVLPSFRGGVPSIRERVGCVVTPGETVDAIVTERGVCVNPRCV
FT                   DLAESARRMGLCVKDIRELKEEVERLTGVPREVEEDRSRVVALVEYRDGSVIDTVFRVD
FT                   C"
FT   gene            complement(29218..29685)
FT                   /locus_tag="Taci_0025"
FT   CDS_pept        complement(29218..29685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0025"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: maq:Maqu_1318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18265"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7L2"
FT                   /inference="similar to AA sequence:KEGG:Maqu_1318"
FT                   /protein_id="ACZ18265.1"
FT                   /translation="MTGPSKFERALQAVGGLRMQRGLKALGNNSSKVTCKDSRMILGSV
FT                   DLDKDLKDQMPQDSRWDYVIGYENNKEDKAFFVEVHPAHTSEVSQIVKKAQWLKKWAET
FT                   NAKELWGMKHRIYWIATDGVHIRSNDHGLRKLSQLGVSRPVPRLDLDKCDP"
FT   gene            complement(29682..30878)
FT                   /locus_tag="Taci_0026"
FT   CDS_pept        complement(29682..30878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0026"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: maq:Maqu_1317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18266"
FT                   /db_xref="GOA:D1B7L3"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7L3"
FT                   /inference="similar to AA sequence:KEGG:Maqu_1317"
FT                   /protein_id="ACZ18266.1"
FT                   /translation="MEFQVRNVAQIAQADMRFGDLTVLVGPQGAGKSVLLQLFKLAIDR
FT                   AYVEDTMASFGQDWQRGNPRALLDAYLGLGMGRSWNESSQMLLQGEPVDLASEPKGHPT
FT                   QEALFYIPAQRAISMPAGWPQPYRAYRSTDPFVLKNFSEALRTHMDNISSRDNIFPTKW
FT                   KLKGPMRKQIDWGVFHGAKVSMGDLSMQRQVVLKVGGGRDNYGVSYTAWSTGQREFFPF
FT                   LMSCYRLLPSSKKTKDDNIQWVVIEEPEMGLHPRAIFSSVLPLVFDMLHRGYRVVISTH
FT                   SPSVLEALWAIREINARILSKYNARDRSNKVKLISEMMGLKTARGDVKDMVDSLLEKKI
FT                   QVYGFQLGQGKDHLVHVKDISTLDPSSDDPDISGWGGIVSYSCGISETVAKAERGAIR"
FT   gene            complement(30981..32099)
FT                   /locus_tag="Taci_0027"
FT   CDS_pept        complement(30981..32099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0027"
FT                   /product="peptidase T-like protein"
FT                   /note="TIGRFAM: peptidase T-like protein; PFAM: peptidase
FT                   M20; peptidase dimerisation domain protein; KEGG:
FT                   vsp:VS_1674 peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18267"
FT                   /db_xref="GOA:D1B7L4"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR010162"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7L4"
FT                   /inference="protein motif:TFAM:TIGR01883"
FT                   /protein_id="ACZ18267.1"
FT                   /translation="MINRERLLEEFLELVRIPSPSGREKAMADLLVAKLAQMGLQVTVD
FT                   DAGDKVGGQTGNVIGRLKGTVEAPTILFSAHMDTVTPCDAINPIVKNDTVYSDGTSVLG
FT                   ADDKGGITAILEALRVLKENSIPHGDVEVVFSIWEEGGLKGAFNLDTSALRAKHGYVLD
FT                   SGGDVGQIITSGPAQDKIDAVIRGRSAHAGVAPEEGVSAIMIAARAIDRMNLLRIDPET
FT                   TANVGYIMGGGATNIVTPEVTIRAEARSLDQEKLDRQSRHMVQCLEEAASHFGGSAEVT
FT                   VTRAYPPFRLDDQHPTVAMVKRALERMGVTPTTTSTGGGSDTNVLNSKGIPSVNLGVGM
FT                   RKVHTLEEHIHVKDLETSARMVLEIIRSFAGA"
FT   gene            complement(32160..33698)
FT                   /locus_tag="Taci_0028"
FT   CDS_pept        complement(32160..33698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0028"
FT                   /product="AbgT putative transporter"
FT                   /note="PFAM: AbgT putative transporter; C4-dicarboxylate
FT                   anaerobic carrier; short chain fatty acid transporter;
FT                   KEGG: she:Shewmr4_3833 AbgT putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18268"
FT                   /db_xref="GOA:D1B7L5"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7L5"
FT                   /inference="protein motif:PFAM:PF03806"
FT                   /protein_id="ACZ18268.1"
FT                   /translation="MSQKRRGLFNRFLDLVEKGGNKLPHPATLFLILGVAIIIISGIAG
FT                   SMGLKVTYERIAKGVAEQVTVEAVSLTNKEGIRRIVSEAVTNFTGFAPLGTVLVAMLGV
FT                   AVAEGTGLIQACLKKLVLSTPKRLITFVVVFAGVMSNIASDAGYVVLVPLGAIVFMGFK
FT                   RHPLAGLAAAFAGVSGGFSANLLVGTLDPLLSGISQAAANIFQPGYIVNPTDNYFFMAA
FT                   STFVLSIIGTVITEKVVEPRLGEYHGGDHDDHDISTITDQERKGLRWAGLSLLIFVAIV
FT                   AVLVAPSNGILRDDEGKILGHTPFMMGLVPLIAASFLIPGVFYGIATGSVKNDKHVANI
FT                   MGKGMSTMGSYLVLAFFAAQFVAYFGWSNLGIILAVKGAELLKATGMTGVSLIIGFVLV
FT                   AAFINLFIGSASAKWAIMAPVFVPMFMALGYTPAFTQLVYRIGDSCTNIITPLMSYFAV
FT                   IVAFAQKYRKDIGMGTLISMMLPYSLAFLVGWTALLVIWFLLGLPIGPGAFIRL"
FT   gene            34109..35317
FT                   /locus_tag="Taci_0029"
FT   CDS_pept        34109..35317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0029"
FT                   /product="ornithine aminotransferase"
FT                   /EC_number="2.6.1.13"
FT                   /note="KEGG: aba:Acid345_1822 aminotransferase; TIGRFAM:
FT                   ornithine aminotransferase; PFAM: aminotransferase
FT                   class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18269"
FT                   /db_xref="GOA:D1B7L6"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR034757"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7L6"
FT                   /inference="protein motif:TFAM:TIGR01885"
FT                   /protein_id="ACZ18269.1"
FT                   /translation="MYTSKELMEMEHKYGAHNYHPLEVVISKAEGIWVEDPEGRRYMDM
FT                   LSAYSAVNQGHRHPKIIQALKDQADLVTLTSRAFYNDRWPLFAKKLAEFVGKDMVLPMN
FT                   TGAEAVETAIKTMRKWGYLVKGVEQDKAEIIVFEENFHGRTTTIISFSVDPDARDHYGP
FT                   YTPGFVIVPYDDLEAVKRAVNKNTVGILVEPIQGEAGIRVPSDGFLKGLERICRENNVL
FT                   LAVDEVQTGFCRTGKTFAFQHEGVDPDIIIMGKALGGGVFPVSAVAANENVLGVFKPGT
FT                   HGSTFGGNPLACAVAMAAIDVLVEEKLADRAAELGKYFMDGLKAIQAKTDKIKEVRGKG
FT                   LLIGLVLNESAGKARIYTTALKDKGLLCKETHSWIIRFAPPLVITKEEIDRALKMIEEV
FT                   FVG"
FT   gene            complement(35610..38693)
FT                   /locus_tag="Taci_0030"
FT   CDS_pept        complement(35610..38693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0030"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   ade:Adeh_1476 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18270"
FT                   /db_xref="GOA:D1B7L7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7L7"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ACZ18270.1"
FT                   /translation="MLHRASLRRPIAMGCLLIALSLLGINAYRKMGLELMPKADVPYVT
FT                   VVAIWPGASPRDIETDVAKKIEDAVSSVDGIKHIKSTCMENVAVVSLEFELGTDVNVAA
FT                   NDVREKIDPIVPDLPEGVEKPIIQKFDINASPIITMALVGDMRLDELYDYADSRLKDRF
FT                   STIPGVAEVRLTGGSKRELHVLLDPFRLAERGLTSSQVTRALAEGVRTIPSGRIKDGED
FT                   EWSVRFDGDYRSVQDLAMMPIAARNGARVYLRDVAQIRFDTAERRQAVFLDGRQAVGIR
FT                   IVKKADANAVELVDRVMRTFESLKGELPGGMRLVWVTDEGTYIRSSVRNTISSIVQGIV
FT                   LTAGILFFFLYNLRSTLVVSVTMPLTIIMSLFFMQLMGYTLNTSTLLALGLSVGILVSN
FT                   SLVVLERVLSKLKEHGDPKRAALEGTSEVALAVLASAGTNVVVLLPIGLMGSMVGLFFR
FT                   PFAITSLTVNAMSIFISFTLTPILSAYLLKVTSGGRLERLEERFNRWLDRLSDRYVGAV
FT                   RHLVSSRARATGVLVLVLVLFLHAMTLPKRIGFNFAPDVDKGNVYVKLEFPTRQNLDAT
FT                   VQGVREAEERLRDLPHLRHVFSTVGTVEGIGENEEGVYLAQLLLNFSDKTERRESIFQL
FT                   VEEARRRMRDFPGAKVSVSIPSFIGGQNVPIQMDIMGDDFEQLDRIALEVQRRVQEKGG
FT                   FFDVDTSVREGKRELLVRPNRAVLADLGVPPLAIGGMLRNNLEGQKAAVFKTLDKNYDI
FT                   RVKFQEVSGTQRVASFQLPGPGGSTVPLASVAQVSQGLSPIKVYRSDKMRTSKLFASLS
FT                   PGYPLGTAVEDVEDMVKRENLLPPGYTVKFRGDYERMADANQAFLEAGVLSVILTFLTL
FT                   SAILESFKWPVLILTTVPLGMVGVFWALWLTSTGMNIFVLLGAVMLIGIVVNNAILVVD
FT                   QFRSLRAQRPGLDSAELMLMALKESFRPVLMVTLAAVLGMMPLALSRGMGSEFTTGIGI
FT                   ASAGGVAMSGLLALFVIPLLYIVHLEWKSRRGGDGGKG"
FT   sig_peptide     complement(38619..38693)
FT                   /locus_tag="Taci_0030"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.408 at
FT                   residue 25"
FT   gene            complement(38693..39871)
FT                   /locus_tag="Taci_0031"
FT   CDS_pept        complement(38693..39871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0031"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   gbm:Gbem_3852 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18271"
FT                   /db_xref="GOA:D1B7L8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7L8"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACZ18271.1"
FT                   /translation="MRIKADWRLGALAVLAALGVFWGLRHFSPPDEETVGKAQPVSVRE
FT                   VGPMDFREDFSTQGTIRALRFAAVTPKADGTILEVYVREGDRVRRGQPLFRTDNVRQEE
FT                   AYRIAQRDVDAASFAVEERTHAVIRARAELERVELDLKRFRELLDEGAISQSMFDDVST
FT                   RYRQAKAMYASAQSMLNSAQASLRKAQGALNIARKNLSDTTVVSPMDGMVSRRLMEPGE
FT                   MGRAGVPVLRIDDPSQVEVLAYLPSEMYPKVVPGVTRVELLDSSGAPVEVLTVKIKSPV
FT                   VDPTSRSFEVRCLAEGGPSKVPGAMAELRFLLGSSRSLGIPRRSVVHREEGDVIYTVSG
FT                   DVARMVRVVTGLSTDGHVELVSGDVKAGDLVVVDGAQMLDQGSKVKVVRRSK"
FT   gene            complement(40007..40717)
FT                   /locus_tag="Taci_0032"
FT   CDS_pept        complement(40007..40717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH1017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18272"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7L9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18272.1"
FT                   /translation="MGMRTLKAVSLASVLVLLLCASALGAPRVSVVTLRRTLGDLRISV
FT                   QYPRVETGGDPKVLLRMNRAFKEEAVRVLRQMEALAREAGDRGDPKLYRCERRVRVTFR
FT                   RGNLFSFTAEQFVSLPNMAHPDSGLVGRTYDASTGEAVTLDRLFLPQWKQLVQDRVGRM
FT                   AMDRIGSGKLEINQDQDIPSAEEYKDSFYLSRDRLVIYWERYRFTPGYVGVVAFEIPLR
FT                   ELRHLAREAAVRFH"
FT   sig_peptide     complement(40640..40717)
FT                   /locus_tag="Taci_0032"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 26"
FT   gene            complement(40717..41991)
FT                   /locus_tag="Taci_0033"
FT   CDS_pept        complement(40717..41991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0033"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="KEGG: mno:Mnod_4267 histidinol dehydrogenase;
FT                   TIGRFAM: histidinol dehydrogenase; PFAM: histidinol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18273"
FT                   /db_xref="GOA:D1B7M0"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7M0"
FT                   /inference="protein motif:TFAM:TIGR00069"
FT                   /protein_id="ACZ18273.1"
FT                   /translation="MKVLKSPRVKDRASSSDLYGVSHEVRRIIDWVVLHGDRAVLEGSR
FT                   LHDRSSRDSILVPVEELQRAHRSMDPELLEAVRYAASNVETFAQRQKGALMPLEESEVR
FT                   DGVYLGHRVVPVDSCGIYIPGGSYPLISTAVMLAVPARVAGVGRICACTPVRRGTNSPD
FT                   PSVLGTLYELGVTEVYAAGGAYAVAAMAHGTESIPPVDVIVGPGNKYVTEAKRQCFGKV
FT                   GIDFVAGPSEVLIIAQEGDPDFIAWDLLAQAEHDPDAKGVLVTTSPALARQVMDRVETI
FT                   LGEIVTSPVARSSWEDHGEVLAAEGMDEAVEFSNRMAPEHLELMVQDPDRWIPRLRNYG
FT                   ALFIGEHSAEVFGDYASGSNHTLPTAGASRYTGGLWVGTFLKVLTSQRVTREGARELAR
FT                   VSALLAQAEGLMAHRGAALARSRKG"
FT   gene            complement(42034..42960)
FT                   /locus_tag="Taci_0034"
FT   CDS_pept        complement(42034..42960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0034"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; Phosphomethylpyrimidine
FT                   kinase type-1; KEGG: rde:RD1_3737 ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18274"
FT                   /db_xref="GOA:D1B7M1"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7M1"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACZ18274.1"
FT                   /translation="MPRIVVMGASGREMLLKVAHHPNVNHPVLADSFEERTSGRGARQA
FT                   AACSRLRGQVSLISAVGSDGSERAVLEDMQDQRVNMRSSKVIRGAQTMREVTLRMAFGG
FT                   QSRVVYPGACAMLTSQHVLEASKTFQGVACALFQLELPVEAVMEGMRCARRAGAVVLLD
FT                   PYPATGNLPPEIWSLTQVVLPNAEEMARITGKDDPDEGAGRLMDLGVQAVAAHLGPLGA
FT                   ILYSRGSRPRSFQAFRVDTVDHDGAGDAFAAGVTVALSEGMDMEEAVRFGCAAGALACT
FT                   REGTLNAFPARQQVEGLLVSQPSPGRT"
FT   gene            complement(42962..43522)
FT                   /locus_tag="Taci_0035"
FT   CDS_pept        complement(42962..43522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0035"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: rce:RC1_1261
FT                   DsbA-like thioredoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18275"
FT                   /db_xref="GOA:D1B7M2"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7M2"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ACZ18275.1"
FT                   /translation="MEVFFDFACPYCYLVWSFLGRLGMLEGDLKWSPWMIRPDVPQGGL
FT                   RRRWPLLDELRRLGSDAEVPFAELEIIPNTRRALLAYLWADQRGLSREALKATFLGFFA
FT                   QGRDIGDPRELCALYAEGGLPDPSQAFEDVALMERLGQLDVRAEAIGVEVVPSFVEGDR
FT                   VVLSWRTSFVMKDLAEFMRGRGI"
FT   gene            complement(44107..45252)
FT                   /locus_tag="Taci_0036"
FT   CDS_pept        complement(44107..45252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0036"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   eba:ebA1626 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18276"
FT                   /db_xref="GOA:D1B7M3"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7M3"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACZ18276.1"
FT                   /translation="MRSNSQGVKVILAANMSWPVVNFRLPLIRDLVANGCSVEVLSPDW
FT                   PGEQLEILRSAGARGLTFPLQRTGINPLWDIRTLWHLYRHFRNSKPQVVFSFGAKTNVW
FT                   GMVAARMARVPRRVAMVEGMGYAFTDSPGGGVNRGLLRWILRMLYRLAFASAHRVVLLN
FT                   QDDLRDLTNLCGLDESKAYLLGPIGIPLEDWPMREPHLNPITFTMVGRILREKGVMEYL
FT                   EAARIVKSRHPEVRFNLLGPLFDNPGTLSAMDIKPYVEDGTVCWPGMVDVKPWLERTSV
FT                   FVLPSYYREGVPRSTQEAMAMGRPVITTDSVGCRDTVEDRVNGFLVPPRDVAALAEAME
FT                   RFVMEPELIVRMGLESRRMAEERFDMRSANRRIMEVMGVIA"
FT   gene            complement(45310..46449)
FT                   /locus_tag="Taci_0037"
FT   CDS_pept        complement(45310..46449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0037"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; KEGG: lpf:lpl0792 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18277"
FT                   /db_xref="GOA:D1B7M4"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7M4"
FT                   /inference="protein motif:PFAM:PF01041"
FT                   /protein_id="ACZ18277.1"
FT                   /translation="MVERIHLSPPHMTGEELALVKEAFESNWVTPLGPHVDAFEAEMCE
FT                   YLGVKGALALSSGTAAVHLGLVLLGVGPGDPVICSTLTFAASVNPVVYLGAEPIFVDSD
FT                   EETWNMSPEALERAIRWLHAQGRRPKAVIPVDLYGHSADYRRIREICDLWDIPVLEDAA
FT                   EALGATYGDRRCGTLGEFGVLSFNGNKIITCGGGGMLVSDRADDLERGRFLSTQAREKV
FT                   PWYEHRQVGYNYRLSNILAAIGRGQLKVIEDRVACRRRIFDRYVEGLGDLPGLSFMPEA
FT                   PYGRSNRWLTVIQLGEESPVTPLELMKRLEERHVESRPAWKPMHLQPLYRGKAYFPHRE
FT                   GYSVSDRLFQRGLCLPSGSSLREDQQDLVIQIIREAMGA"
FT   gene            complement(46442..47074)
FT                   /locus_tag="Taci_0038"
FT   CDS_pept        complement(46442..47074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0038"
FT                   /product="Undecaprenyl-phosphate galactose
FT                   phosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="PFAM: sugar transferase; KEGG: tmz:Tmz1t_1126 sugar
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18278"
FT                   /db_xref="GOA:D1B7M5"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7M5"
FT                   /inference="protein motif:PRIAM:2.7.8.6"
FT                   /protein_id="ACZ18278.1"
FT                   /translation="MYLRFGKRLMDLLLASLGLLLLWPLMLLVGLLVRIKLGSPVIFRQ
FT                   VRPGLEGKPFTLYKFRTMRDLHGSDGAPLPDRDRLTPFGVFLRSTSLDELPELFNVLKG
FT                   EMSLVGPRPLLMEYLDLYTPEQMRRHQVRPGITGIAQVMGRNALPWEERFRLDVWYVDN
FT                   LSLTLDLKILAMTVCKVIRREGISQEGQATVERFRGSGVSGGGSENG"
FT   sig_peptide     complement(46985..47074)
FT                   /locus_tag="Taci_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.852) with cleavage site probability 0.795 at
FT                   residue 30"
FT   gene            complement(47078..48940)
FT                   /locus_tag="Taci_0039"
FT   CDS_pept        complement(47078..48940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0039"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: polysaccharide biosynthesis protein CapD; Male
FT                   sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; short-chain
FT                   dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase; NAD-dependent epimerase/dehydratase; KEGG:
FT                   ppd:Ppro_3385 polysaccharide biosynthesis protein CapD"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18279"
FT                   /db_xref="GOA:D1B7M6"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7M6"
FT                   /inference="protein motif:PFAM:PF02719"
FT                   /protein_id="ACZ18279.1"
FT                   /translation="MKKSLPAHTSAVRKILLDVACALVSSLATFVLRLDLPLPVNFAPS
FT                   LVPYSILATATKLGLILWLGTWRQSWRNSSVPDLIQLLKVMVAFVVIMSGVGFVLGPAN
FT                   MPLPRGIPFIDGAITLLLWGGIRLLARGFHEREGHSGSHLRPVVIAGAGSAGTSLAREI
FT                   QRNRSCGMRVAAFLDDDPAKLKMTILGVPVAGTLDQLGEVLDRFGASEVLIAMPSAPGS
FT                   AVRLVMEQASSRRVRARIIPAIAEVLSGRVSLDLVRDVEVEDLLRREAVRLDLDEIGSY
FT                   LRGQRVMITGAGGSIGSELVRQAIPFGPSLLVLLGRGENSLHQLEMELKGMDPVPPFVT
FT                   VVADVRDRTRLGRVIARYRPSVVFHAAAHKHVPMMEEHPEEAVKNNVLGTLNVVECCIE
FT                   AGVSTLVNISTDKAVNPTSVMGASKRLAEMVVRRVADRVPPGGAYVSVRFGNVLGSRGS
FT                   VVPLFKEQIRRGGPVTVTDPEMVRYFMTIPEAAQLVLQAGGMGMNGAVFVLDMGEPVRI
FT                   VDMARDLIRLSGLEPDRDIRIEFTGRRPGEKLYEELLTAEEGTEASRHSKIFVARTEHM
FT                   GLELDQVIQRLSFAAEVGDQEAIRRILSEAIPTSRLEGIGPGGD"
FT   gene            complement(48937..49686)
FT                   /locus_tag="Taci_0040"
FT   CDS_pept        complement(48937..49686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0040"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: rlt:Rleg2_6420 transferase hexapeptide
FT                   repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18280"
FT                   /db_xref="GOA:D1B7M7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7M7"
FT                   /inference="protein motif:PFAM:PF00132"
FT                   /protein_id="ACZ18280.1"
FT                   /translation="MEGRYVDPRSTVDDSVVMGFGVVIEEDVLIGPNVSIGHNVVIHRG
FT                   VRIGPGCRIGSNTVLGRTAPADGGTPRELPPLVVAPNVTIGSLCVIYRGALINQLVQIG
FT                   DLVSVREDVTIGEMTVICRGVTIENKVTIGRKVKIEAEAYVTALSNIGDHCFIAPEVTF
FT                   TNDNLLGETRDRSRSSGGPTLLRGARIGGNATLLPGVQIGEDALVGAGSVVTRDVPAGV
FT                   IVAGVPARLLRPVPTEQLLMRRKMYDQ"
FT   gene            complement(49689..50678)
FT                   /locus_tag="Taci_0041"
FT   CDS_pept        complement(49689..50678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0041"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   acp:A2cp1_1503 porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18281"
FT                   /db_xref="GOA:D1B7M8"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7M8"
FT                   /inference="protein motif:PRIAM:4.2.1.24"
FT                   /protein_id="ACZ18281.1"
FT                   /translation="MTGSFPQSRCRRNRLYPTIRQALMETVITPSNLVLPLFVVPGESV
FT                   EEPVSSMPGVQRWSVDRLGKPVEEAMEAGVRCFLLFGIPSYKDPDGTSADRLDQPVQRA
FT                   LRLLRDRYPEAYLVGDVCLCEYTSHGHCGIIKEGNIDNDLTLKRLASVALSHAEAGAHA
FT                   VAPSDMMDGRVSVIRQELDGSGFSDVGVWSYAAKFASAFYGPFRDAAESTPAFGDRRSH
FT                   QLPVENRLEAIRDALMDQDEGADLLIVKPAGTSLDVVRDLREEARLPLGGYVVSGEHSM
FT                   LAGAISAGLLREDAYLEYHLCVKRAGCSVIITYGAVDLARRVRRLLGV"
FT   gene            complement(50680..51972)
FT                   /locus_tag="Taci_0042"
FT   CDS_pept        complement(50680..51972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0042"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III; KEGG: tgr:Tgr7_2421
FT                   glutamate-1-semialdehyde-2,1- aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18282"
FT                   /db_xref="GOA:D1B7M9"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7M9"
FT                   /inference="protein motif:TFAM:TIGR00713"
FT                   /protein_id="ACZ18282.1"
FT                   /translation="MSSGKSNLECFERAQRSLVGGVNSPVRAFGAVGGTPRFFERARGC
FT                   HLYDVEGNRYVDHVMSWGPMILGHGHPEVLEAVHRAVDAALTFGACSPLEADLAEMIKA
FT                   KFPSMDLIRFTSSGTEAVMGAVRLARGFTRRDLIVKFAGCYHGHGDSLLVSAGSGALTF
FT                   GTPSSPGVTRACGAQTLVLPYNDISAAREAFRRFGGQIAGVLVEPWGGNMGLVPPVEGF
FT                   LEGLREVTLEDGALLIFDEVITGFRVPQGGVQGLLGIRPDITCLGKVIGGGMPVGAFGG
FT                   RRDVMEHLSPLGPVYQAGTLSGNPVAMACGIATLRCLTDRAYVELEEKGAYLEGAILEA
FT                   ARSAGIPGSVTRLGSALGLFLGPVPRNLEEVKATRVDLYPRLFHLMLDQGVYLPPSAFE
FT                   TFFVSLAHGTEDLEQTGRAFAEAFRALKGMM"
FT   gene            complement(51982..53466)
FT                   /locus_tag="Taci_0043"
FT   CDS_pept        complement(51982..53466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0043"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; Uroporphyrinogen III synthase HEM4;
FT                   KEGG: dvm:DvMF_2767 uroporphyrin-III C- methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18283"
FT                   /db_xref="GOA:D1B7N0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7N0"
FT                   /inference="protein motif:TFAM:TIGR01469"
FT                   /protein_id="ACZ18283.1"
FT                   /translation="MIWLTGGGCASPRWLTQEGAEALGSASAVVYDRLIHPDLLLLCPP
FT                   GALFIQAGKRGSDHTMSQEEINRLLVELAADHPHVVRLKGGDPFVFGRGGEEAQELDRH
FT                   GIPWRAVPGVTAALGGLLKEGIPVTHRGAASAVCLATGHLEAPSESYWGSLARFDGSRV
FT                   LYMSASNLPENLGRLISLGLPENEPCVAVTWGGWGRSYVVGGTAGEGARGGWASQVRSP
FT                   SVVMIGGSARVRLTPAELPLKGLTVAVCRPMPEGYQTARRLEALGADAFTLPLLEVRPT
FT                   ASREELLASLEGADTVVFTSPRGPKVFRDLVMDLRLLRCRTVAIGEGTRRSLEEMGIGV
FT                   DLMPERADSRSLAELLVSCVRPGERILFLRNRRCSPLPVEAVRRAGALALELPIYEMVP
FT                   RGLPWRELILEHWQDTRPHAVVFGSAALAEAFADEFGPLPAGAVPVAWGEECAKRCGEL
FT                   FRRRGVVMASQDLDGLVSALLEIRGSEHPPKHRGRG"
FT   gene            complement(53463..54386)
FT                   /locus_tag="Taci_0044"
FT   CDS_pept        complement(53463..54386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0044"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: rfr:Rfer_1715 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18284"
FT                   /db_xref="GOA:D1B7N1"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7N1"
FT                   /inference="protein motif:TFAM:TIGR00212"
FT                   /protein_id="ACZ18284.1"
FT                   /translation="MTRFDLLTRSSPLAMAQARMWKDRIESLGHSVRLLDVSTHGDRDR
FT                   RRHLACFGGFGAFVKALEDRLLSGQGHGAVHSLKDVPSVQPDGLVIAGVLERGPRGDVL
FT                   VTREGLSLEELPSGAVIGTSSIRRAAQVRMLRGDLNVECCRGNVHSRLRKLEQGLFHGI
FT                   VLARAGLERLGIRAPMAELPFITSPGQGAVALEAREGSELHLLGARLTHRSTWLEVLAE
FT                   RSFLKAFGMGCSAPVAASAVMDRDTLTLKVQVLSPNGTSAAEAEVSCVPWGEEDAYALG
FT                   EAAFREISGSPEVLSAGSAAREVCGP"
FT   gene            complement(54383..54844)
FT                   /locus_tag="Taci_0045"
FT   CDS_pept        complement(54383..54844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0045"
FT                   /product="Siroheme synthase (precorrin-2
FT                   oxidase/ferrochelatase domain)-like protein"
FT                   /note="KEGG: siroheme synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18285"
FT                   /db_xref="GOA:D1B7N2"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7N2"
FT                   /inference="protein motif:COG:COG1648"
FT                   /protein_id="ACZ18285.1"
FT                   /translation="MSFGPMVALRRDEPILVVGGGPVGYRKTCSLLDGGASVTLVSLEF
FT                   CPELRELIGKDIVTAEERGVQRGDFERFRFAVLALPPEATLEALRMREGTRCLVCCCSL
FT                   PDMGDFALAAQWSHGNFRVGISSGGTDPAGAAKLKGLIRAFLEGKRLRR"
FT   gene            complement(54841..55704)
FT                   /locus_tag="Taci_0046"
FT   CDS_pept        complement(54841..55704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0046"
FT                   /product="Tetrapyrrole biosynthesis, glutamyl-tRNA
FT                   reductase-like protein"
FT                   /note="PFAM: Tetrapyrrole biosynthesis, glutamyl-tRNA
FT                   reductase-like; KEGG: ank:AnaeK_1362 glutamyl-tRNA
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18286"
FT                   /db_xref="GOA:D1B7N3"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7N3"
FT                   /inference="protein motif:PFAM:PF05201"
FT                   /protein_id="ACZ18286.1"
FT                   /translation="MTGPLALGVWPRRPDGALEALNLKTCWRDEWYALCENPDGAEFTG
FT                   PKAAMHLIRVLLGLESFAVGEFHIVNQVKRCYREQHASCGPVLHRLFQRSFRAARLIRG
FT                   TKHPGRAPSIPYLAASALKDHPGFPRLRVLVAGMGEMGREAAKVLSYLGCHVTCTSRSS
FT                   PPPPGLPWVGWGEFLSGGALRGIQGLFLCTGADRFVVEPKDLRGSGIWVVDLGSPPQCG
FT                   PGEGYRYVGIGEIAEASRGALRSYRQELAAMEEAASEAALVVWEEMLGRFPEILGGGSK
FT                   TGGIAV"
FT   gene            complement(55701..56609)
FT                   /locus_tag="Taci_0047"
FT   CDS_pept        complement(55701..56609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0047"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dds:Ddes_0036 nucleoside recognition domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18287"
FT                   /db_xref="GOA:D1B7N4"
FT                   /db_xref="InterPro:IPR038880"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7N4"
FT                   /inference="protein motif:COG:COG3366"
FT                   /protein_id="ACZ18287.1"
FT                   /translation="MALRGLLIGEARLTLSLIAGALAGELMVRYRVTDRVFRPVERLVR
FT                   RLKVNPQAISAMTVSVASPRVGAAMLASAHSRGEITQEDAVFGTLCLAFPAYVKRWLVT
FT                   APMAAALAGPLGVLYSSVLIFRSAARFLLCLHLLRRRGSGGSSPAVDDPAEGRTATASE
FT                   GRFLRQGLRSLPLAWIFFGVTYWAMPAVEAWALDNLRWLVSPSGLTVVTSALAHSTASL
FT                   ASAKGALEAGSLSLPGALLALLMGNALGTFTRVLRQNVGYWVGIFPGEVLRPLGIWHLG
FT                   TLLLFEALSIGLVLLWWGWSR"
FT   gene            complement(56600..57289)
FT                   /locus_tag="Taci_0048"
FT   CDS_pept        complement(56600..57289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0048"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: ppd:Ppro_3502
FT                   precorrin-2 C20- methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18288"
FT                   /db_xref="GOA:D1B7N5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7N5"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ACZ18288.1"
FT                   /translation="MILYGVGMGPGDRGLVTLRAVEVLKEAEVVFEPLSGRGRRSVAGD
FT                   LARDLVPGLVTVPVIFPMTGDDGELMSSVTEALRSTSPSWGGRSTLAMPVIGDSALYST
FT                   VLSLKRGLEALGEEVELRLVPGISAHSAAASLLSSFMAMRNQVLSVIPGSAGPERVLEA
FT                   LRACDSAALYKPSALKDRLGEVVTSSGPWERVVRVHRVGLEGERWVEGQEALEPTDDYL
FT                   AVMLLWR"
FT   gene            complement(57335..59809)
FT                   /locus_tag="Taci_0049"
FT   CDS_pept        complement(57335..59809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0049"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; Precorrin-6x
FT                   reductase CbiJ/CobK; cobalamin (vitamin B12) biosynthesis
FT                   CbiG protein; KEGG: dde:Dde_3181 precorrin-3
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18289"
FT                   /db_xref="GOA:D1B7N6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7N6"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ACZ18289.1"
FT                   /translation="MRALVLGLKGAREGAERLGSLLRVPVELAEGDLKARFEMAWGGHD
FT                   ALVFVGAVPIAIRAMAHLLSDKASDPAVLALPEDLSWVMVLAGGHLGGGSDLAWEIASR
FT                   TGARWIPSTATDRRLITAPDRWARRHDLRLLNKRLLPGLIRGLLDRGELRWWCDPLLPH
FT                   PPLPHGAVEAGTPEEAQVLYTVRDLGLEDRLVLVPRAISVGVGFRRDAAGEEIRSGVLD
FT                   ALRSHPEGPFLPEALRRLGTWEGKEGSRSLMEAAGSLGAEVRFFRQGEILGAEGPFSPS
FT                   AAERHLGLPGVSEPCAALMGRPLGGRMVLGGITAALALEDPPFAGSLSVVGIGPGDPRL
FT                   MTVEALEELEGCDVIVGYSLYVDLVPSHIRGAKRLESYRMGQEEDRVVRAVELAEAGYR
FT                   VALVCGGDPVLFGLGALAQRHAEGRVSFRIVPGLSAAQGAARAVGPYYTNGLSLLSLSD
FT                   YLQDWDRVREALESAAGGGLSAGIYNPVSRGREEKLEAVRRAFRGRRALVCTDISRPGE
FT                   EVREVAVEELTKDLVTMRSMIIVPGRGCERTPQGQWRDLRGYSSEGSHREMPELDVLVA
FT                   GGTSDGYEAARELLELGLRVGVSVAYGTGLSVVPPGAAALVGPLDRMGWEDRLRELSRR
FT                   GLRAVLDATHPFASEVKGHLDGACGALSIPLVRLSRPIRIPTEAVRVGSYGEMAEALIS
FT                   RTGPGDLVFLTFGVKGLVEVAGPLKGAGRRVLARVLPTEDSLRGALSAGLSGREILCSW
FT                   GSLGAVSDRAIMEDAGARACAAKASGDPSGLEGKRRACMEMGIPLVLLVPPRFEGLEMA
FT                   EALERVRAMLGR"
FT   gene            complement(59806..60573)
FT                   /locus_tag="Taci_0050"
FT   CDS_pept        complement(59806..60573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0050"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="KEGG: sea:SeAg_B2151 precorrin-4 C11-
FT                   methyltransferase; TIGRFAM: precorrin-4
FT                   C11-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18290"
FT                   /db_xref="GOA:D1B7N7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7N7"
FT                   /inference="protein motif:TFAM:TIGR01465"
FT                   /protein_id="ACZ18290.1"
FT                   /translation="MKGPVWIVGAGPGDPELITLKGARLLMEADLVLYAGSLVNPQVLE
FT                   HCRDTCEKVDSSRLSLEDQVELMADRCGRGLKVVRLHTGDPSLYGAIGEQIRALEARGV
FT                   ECRIVPGVSSLQGAASALKIEYTVPGGPQTLVCTRLPGRTPVPGGEDLRVYASTGATLA
FT                   IFLSSEMAQRASELCIEGGLDPRTPAAWVYRATWPDQRMGRTTLDRLGEHMASRGITRH
FT                   ALMVVGQCLDPQGRSLLYHPSFHHMYRKGAPED"
FT   gene            complement(60570..61808)
FT                   /locus_tag="Taci_0051"
FT   CDS_pept        complement(60570..61808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0051"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit"
FT                   /note="TIGRFAM: precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit; PFAM: Methyltransferase
FT                   type 12; Methyltransferase type 11; methyltransferase
FT                   small; protein-L-isoaspartate(D- aspartate)
FT                   O-methyltransferase; KEGG: dde:Dde_0803 precorrin-6Y C5,15-
FT                   methyltransferase (decarboxylating)"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18291"
FT                   /db_xref="GOA:D1B7N8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7N8"
FT                   /inference="protein motif:TFAM:TIGR02469"
FT                   /protein_id="ACZ18291.1"
FT                   /translation="MLELGEINVFGTGAGPWHLTDRVMWLIMGCSSLMGDRRILEALEV
FT                   REHQVRLPLAYGDQLGPAIEGAPKPLGILVSGDVGLFSLAQRVCGLFPHRVRLFPNVSS
FT                   LQLMASRLKRSWANVPVISVHGRPPLEALELRRFLWGRPEGAVLLGRPQDVRETLLRLG
FT                   ELVRPDVTGHLGWDLGTPREQVFHGGLDQLAHLPYTGNLSILWLSAGPQGFFGEQSLSC
FT                   LPPGPMDDSAFQRLQRVPMTKSPVRGLVTGLLQPLWGARILEVGTGTGALTCELARQAG
FT                   PGVVVSIERDPEAMELARGNLERLGLALGVHLVGGSAPLDLRGTFDRIVIGGHGGALED
FT                   VIRWARDLLVPGGRVLVPCVLARSGPRALQALEEADLKCGMTRLFPTWGRPLGGDWMAE
FT                   GMNPVDLVWGDLT"
FT   gene            complement(61808..62887)
FT                   /locus_tag="Taci_0052"
FT   CDS_pept        complement(61808..62887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0052"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CbiD; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiD protein; KEGG:
FT                   plu:plu2996 cobalt-precorrin-6A synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18292"
FT                   /db_xref="GOA:D1B7N9"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7N9"
FT                   /inference="protein motif:TFAM:TIGR00312"
FT                   /protein_id="ACZ18292.1"
FT                   /translation="MRYGFTTGTAAAAATLGAALWLLGRPSWWVKVTLPSGQVLPIPLG
FT                   GCERIEGGAQAWVFKDAGDDPDVTDRMAIAAKVWLRPGGGVEVDGGHGIGLVTRPGLPV
FT                   PVGGRAINPAPLRMIRENLLGALPRGLGARVEIWAPEGERVAKGTFNPKLGIEGGISIL
FT                   GTTGVVRPMSEDAVVETIGAELSVLRAEGATSVCLAPGNYGRDVAVRLGVPVHRVVNVS
FT                   NYVGPSLDRCRQLSFRGVLFVAQVGKMAKVASGSMDTHSAKSDGRMEALCAYGALMGMD
FT                   SCWIRRIMDCNTADQAATMMIQDPRGRLALEELCRRASRRVSERSEASGAAVTFALPNL
FT                   ELARSGPVEDLIRSMRGDG"
FT   sig_peptide     complement(62831..62887)
FT                   /locus_tag="Taci_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.773) with cleavage site probability 0.358 at
FT                   residue 19"
FT   gene            complement(62890..63786)
FT                   /locus_tag="Taci_0053"
FT   CDS_pept        complement(62890..63786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0053"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   dal:Dalk_0443 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18293"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7P0"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACZ18293.1"
FT                   /translation="MHKRRLVILLAVLLLAALPRFSWAVTVMDDLGRRVTVKGQVRRIV
FT                   SLYPAHTENLVALGVRDRIVGISQGDDPDLVKGARQLPLRPSPETILSLKPDLVVMRSL
FT                   QSSMQPQLISQLEGFVPVAVLDPPSFDGLESYVLRLGTLVGRRKEAQAKLKWALGILEE
FT                   SRRRNRGRSLGAVLIVNNRDATTCSPGTWPSRLMEASGLPPAVQGVPTSEGSAVARLGA
FT                   EGLLAASPKIKVILVQRGPMNPGGLEDFLRDQRFAPMEAVRRGSVFQVDERDVSRPSLM
FT                   RLQRGLNLLSSIREGAK"
FT   sig_peptide     complement(63712..63786)
FT                   /locus_tag="Taci_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 25"
FT   gene            complement(63870..64772)
FT                   /locus_tag="Taci_0054"
FT   CDS_pept        complement(63870..64772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0054"
FT                   /product="Sirohydrochlorin cobaltochelatase"
FT                   /EC_number="4.99.1.3"
FT                   /note="PFAM: anaerobic cobalt chelatase; cobalamin (vitamin
FT                   B12) biosynthesis CbiX protein; KEGG: sfu:Sfum_1101
FT                   anaerobic cobalt chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18294"
FT                   /db_xref="GOA:D1B7P1"
FT                   /db_xref="InterPro:IPR010388"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7P1"
FT                   /inference="protein motif:PRIAM:4.99.1.3"
FT                   /protein_id="ACZ18294.1"
FT                   /translation="MRSLLRFAALGLTLALSLLSPLVGGIALASEAKTQRNAILVVAFG
FT                   SSMREGQRAINAVVSSVKGAFPGTEVRLAYTSRIIMRKLAKEGQHFDDPLVALSKLHAE
FT                   GFTHVAVLSTHVIPGEEYEDLSAIVGAFNYMRDHGSKSGFEAIALSRPLLWSPEDFDKM
FT                   AAILNRAYGKDRTRAVVFMGHGSPHPAEGAYARLQTVSLRTNPNFVFGTVEGTPSLDDV
FT                   VSTLKHGKFKRALLVPFMLVAGDHAHNDMAGPEDESWKSVLSKEGIRVDVHLAGLGENP
FT                   EVRALLVEHLREAAKEAGF"
FT   sig_peptide     complement(64683..64772)
FT                   /locus_tag="Taci_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.877 at
FT                   residue 30"
FT   gene            complement(64820..65446)
FT                   /locus_tag="Taci_0055"
FT   CDS_pept        complement(64820..65446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0055"
FT                   /product="Precorrin-8X methylmutase CbiC/CobH"
FT                   /note="PFAM: Precorrin-8X methylmutase CbiC/CobH; KEGG:
FT                   plu:plu2997 precorrin-8X methylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18295"
FT                   /db_xref="GOA:D1B7P2"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7P2"
FT                   /inference="protein motif:PFAM:PF02570"
FT                   /protein_id="ACZ18295.1"
FT                   /translation="MSLSYDRDPISIERQSLSLIRQVLQSYSISPDLMPVAERVVHAGA
FT                   DFSLANLVCATPGWLSAARERLTRQRILCDVDMVRSGLSRNLLRQLGLEPVCLIHQECT
FT                   ADASRRMGITRAMASVDAALEMGIRLFAFGNAPTGLFRLMERGDPGGVDLIFAFPVGFV
FT                   GAAESKELALGWGAPCVALRGPRGGSNLCAAAVNAVMRLCGGTKG"
FT   misc_binding    complement(65541..65701)
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam(RF00174),
FT                   score 82.57"
FT   gene            complement(65709..66524)
FT                   /locus_tag="Taci_0056"
FT   CDS_pept        complement(65709..66524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0056"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: dvm:DvMF_1916
FT                   zinc/iron permease"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18296"
FT                   /db_xref="GOA:D1B7P3"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7P3"
FT                   /inference="protein motif:PFAM:PF02535"
FT                   /protein_id="ACZ18296.1"
FT                   /translation="MELHLWFQYLGPVTQALLGGVLTWGLTALGAAMAFLGANPSRKLM
FT                   DLMLGFAGGVMIAASFWSLLAPAIEISGELGMVEWLPPAVGFILGAVFLRLLDLVLPHL
FT                   HPALKGAKPEGIRAHLMKTTLLVLAITLHNIPEGLAFGVAFGAAGLSPSATLSGAVALT
FT                   LGIGLQNLPEGLAVAFPLRKAGFSRGKAFFFGQLSAVVEPLFAMLGAAAVEFVRVGLPY
FT                   ALSFAAGAMIYVVVEEVIPESQSEDNGDLATMGLILGFTCMMILDVALG"
FT   gene            complement(66529..67359)
FT                   /locus_tag="Taci_0057"
FT   CDS_pept        complement(66529..67359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0057"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   dvl:Dvul_1725 periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18297"
FT                   /db_xref="GOA:D1B7P4"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7P4"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ACZ18297.1"
FT                   /translation="MRRALTLMAALFWLVVLASPGLSAPVTVICPVEPLSHLARLIGGD
FT                   RIRVVTLIPRGADPHSFEMRPSHAKAVSEARGALRLGLPLEDRLLPKMRQRGVRIFQLK
FT                   FDPLYDGHRHLDPHAWTSVRNGMSMARSMAEAFAELDPAGAKAYRASLSNVLSRMRDLD
FT                   RRMGDDLSPFKGRGILSYHPSWNYLCQERGLVPLSVEVHGSEAGPRHISRLKDRISRED
FT                   IKVMFVEPSKAGKSAASAARALGVSLVELDPMGDDWFAMMEGALAAFRSALSGR"
FT   sig_peptide     complement(67288..67359)
FT                   /locus_tag="Taci_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.880 at
FT                   residue 24"
FT   gene            67557..68687
FT                   /locus_tag="Taci_0058"
FT   CDS_pept        67557..68687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0058"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems periplasmic component-like protein"
FT                   /note="KEGG: dde:Dde_2831 substrate-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18298"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7P5"
FT                   /inference="protein motif:COG:COG0683"
FT                   /protein_id="ACZ18298.1"
FT                   /translation="MVPKLRLPKLGMNPRLLRHVLGGLLVLSLVFMAWRLMGPKDVVVA
FT                   LWFEDKGGGAALSREVQQSTLFALEYFNLARRGWGYRLRPLVVTGKDDREALEAIRGAN
FT                   ASAVICGATSGFVARILPLLNQAKVPAIATNANAPSLAVEGDVLYRYSGPSGALEAGEL
FT                   ARDLGGFQRYLAVIDGSNSVYSRGQLEGFAKGLGRDPVRVMEGDPGVMFERFRKELMVG
FT                   DYDGLYLALPAYYTGIYLNMAWSLRDMGAVTSGWGVSSVSAALAGPNGTAWSVVFSPVE
FT                   LDMGHPFLRFLKGRIAGLPVLPALDSAYGAVSMLADALSSGGPGPQGVLRGLQGLRTVR
FT                   ALRGDYPLDAAGDAMLPLHRVILEDGVWRDRGGAGR"
FT   gene            68684..70837
FT                   /locus_tag="Taci_0059"
FT   CDS_pept        68684..70837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0059"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: gme:Gmet_1365 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18299"
FT                   /db_xref="GOA:D1B7P6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7P6"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ACZ18299.1"
FT                   /translation="MTSFKRLFVRWFGLVVTAGFLLVALQGVYMFQSQLSEWQRRSWIF
FT                   TENLSSNLVRHLDSELVKASYIASVPYKAETYFPDVELLARLLGDQVDQTFRGYIPTGI
FT                   ALSGMDQLEGLWQVSSVFNPDGHPQFVTVREMEGSRYLIGVRMDPSPLLVTGEMGASPV
FT                   LAGRDGRVIWADYGPVGRHFAARGWVDAGFLNGSTWGRGRTAQGLPFWARCFEVQNMRL
FT                   LVTVPERQVLLNAIRGSLIPILMSLAMFLLLFAFYRLWRDQVMPDMGEISDFFRRMEKA
FT                   LAGTRCPEELSNVIDSLSEEMGRKMERCRLEEFHAMLSGVAAAMRVLWTQQEEINAYGE
FT                   EVAAMNASLTESNEILRKREQIWGQTIQVANLVRSGYQAPDEVARIAETIREMLSAFGV
FT                   VVDRLEGDTLIPVAYSGYDQGLPPEPVKLDSSLIGRAVREGLIWAEDVSKAEGYLPLHE
FT                   AVVTEVVMGLSHMGRPVGGLTVSFTERRRRDETLLETLVPVASVLAGFLDASKSRQEIR
FT                   ESYYYLAQKLQEITGIYHNETEEHLSRIGTYASRIAMDLGRTETEAEEIGIFARLHDIG
FT                   KLKVPHEVLSKPSGLTRDEFELVKRHTVWGAEILGEAEWLAMARRICLTHHEKWDGSGY
FT                   PFGLAGVQIPWEGRVMALADIYDALRSRRAYKEGMSHEEAVRVILQGDGRTMPEHFAPE
FT                   VLEWFRQNHLVMDAIFQRFKDRD"
FT   sig_peptide     68684..68791
FT                   /locus_tag="Taci_0059"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.843) with cleavage site probability 0.354 at
FT                   residue 36"
FT   gene            70905..71750
FT                   /locus_tag="Taci_0060"
FT   CDS_pept        70905..71750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0060"
FT                   /product="spermidine synthase"
FT                   /note="TIGRFAM: spermidine synthase; PFAM: Spermine
FT                   synthase; Methyltransferase type 12; KEGG: bsu:BSU37500
FT                   spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18300"
FT                   /db_xref="GOA:D1B7P7"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7P7"
FT                   /inference="protein motif:TFAM:TIGR00417"
FT                   /protein_id="ACZ18300.1"
FT                   /translation="MEVRPKRLNEMWLFEEQTHNMKLGLRITQVLRNIKTQYQDLLVVD
FT                   TPEYGKVMVLDGAIQVTERDEFCYHEMMAHLALCSHPNPERVLIVGGGDGGTLREVLRH
FT                   DSVKEAFLVDIDQEVIRAARDFFPTLSCAMDDPRARVLPMDALKFIEDNRESFDVVIVD
FT                   STDPVEFAAGLFEAPFYANVHRSLKEDGFIVCQTESPFSDPHVVAGAIQDLRKVFPVVK
FT                   LAVGFMPTYPTGFWTYGIGTKGLDPAEVRRPAPEGTRYYSHEIHRAAFVLPPFLKSMIG
FT                   "
FT   gene            71755..74619
FT                   /locus_tag="Taci_0061"
FT   CDS_pept        71755..74619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0061"
FT                   /product="cobyric acid synthase CobQ"
FT                   /note="TIGRFAM: cobyric acid synthase CobQ; cobyrinic acid
FT                   a,c-diamide synthase; PFAM: CobB/CobQ domain protein
FT                   glutamine amidotransferase; Cobyrinic acid ac-diamide
FT                   synthase; KEGG: mag:amb0292 cobyric acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18301"
FT                   /db_xref="GOA:D1B7P8"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7P8"
FT                   /inference="protein motif:TFAM:TIGR00313"
FT                   /protein_id="ACZ18301.1"
FT                   /translation="MARGLIIAAPGSSSGKTTACAALARALSARGLRVQTFKVGPDYID
FT                   PSYLSAASGLECWNLDGFLTPGLVRWSYRTASEGADLCLVEGVMGLYDGLGPQGFHSTA
FT                   RTAGELGLPVVLLLDCRSASPTLAAQAWGLVNLPGAPEVAGIVLNGVSGPMGELLAASM
FT                   ESLHLPPVLGCIPRVEGGIPSRHLGLVQAFEDPNLTGSIDRLASAVPGELLDGLIRIAR
FT                   EALPPQRLPDLPVGEEVPVALARDEAFSFTYRSGRWALEEMGAHLVEFSPLRESIPEGV
FT                   RGVILPGGYPEEHMDRLALSPFMESLREAHRRGIPIYAECGGLMVLGRSIRDHLGRSAP
FT                   MAGLLKLDFAMGNRLSRFGYVTARFDADCLVGRRGERIFGHEFHYSEPYGEEEPLMEVS
FT                   KASSGRGWRCGYGGRDLFGSYVHLDPLGCPMPFRRFLDRCLASRPLEGGPRAIPGASAR
FT                   REGRALMVMGATSDAGKSFLVTGLCRLFARRGLRVNPFKAQNMALNAYSTPRGELGTAQ
FT                   AVQAEAAMVEPDPIHNPILLKPLGDSVSQVILRGRVYAEASARDYHRHMAKDLFFEAAS
FT                   ALRELKASSDLVIMEGAGSPAEMNLYAQDLVNVRMAKFAQAPGILVADIERGGVFASLL
FT                   GTLQLIPRCDRSVIRALVVNRFRGDPSLFDQGVIFLKEMSRLPVLGVLPLREDLSIPAE
FT                   DSLNRRDFGSGEVRVAVVALPRMSNFTDFDALGEDRCRVTFAGHPSEIRGAHLVVIPGT
FT                   KTTLEDLRWLKARGFPRAILEELGRGALVWGICGGYQMLGLSISDPLGVEGGGEEAGLG
FT                   LLPVRTVFEGSKVLGPARARVMGGHWLDRIAGAFVEGYEIHAGRTILEDGMAPLILDGG
FT                   IPDGAFGMDGRVFGAYLHGLADDPLFRRALLNHVRSLWGLESLRGEAMSGRAMRDRRYD
FT                   RLADFLEERLDVGKIEEMVFGGQA"
FT   sig_peptide     71755..71814
FT                   /locus_tag="Taci_0061"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.746) with cleavage site probability 0.611 at
FT                   residue 20"
FT   gene            74606..74986
FT                   /locus_tag="Taci_0062"
FT   CDS_pept        74606..74986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0062"
FT                   /product="translation initiation factor SUI1"
FT                   /note="PFAM: translation initiation factor SUI1; KEGG:
FT                   afw:Anae109_0917 translation initiation factor SUI1"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18302"
FT                   /db_xref="GOA:D1B7P9"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7P9"
FT                   /inference="protein motif:PFAM:PF01253"
FT                   /protein_id="ACZ18302.1"
FT                   /translation="MAKRRLPLAESQGNLNSLGEALARAGVSLPTPSGDPPEGRPSAEV
FT                   PAQGPKGAVLSLRRKGLKGHVGTCVSLRGLSEDQVQELCRDLKRSLGCGARVEEGEILI
FT                   QGDHRERLREMLSRRGFRVSGG"
FT   gene            74992..75813
FT                   /locus_tag="Taci_0063"
FT   CDS_pept        74992..75813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0063"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="KEGG: sat:SYN_00169 diaminopimelate epimerase;
FT                   TIGRFAM: diaminopimelate epimerase; PFAM: diaminopimelate
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18303"
FT                   /db_xref="GOA:D1B7Q0"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Q0"
FT                   /inference="protein motif:TFAM:TIGR00652"
FT                   /protein_id="ACZ18303.1"
FT                   /translation="MSHWVEFFKVDGNGNDFLFVDDLDGRLSSRFDLPELAVRACGRRT
FT                   SVGADGLLVMGWDRGAYRMRIFNADGSEADMCGNGARCFAMMLRWLGLEDPEMEFLTNV
FT                   GPVRAHVHRDSTVSLHMGFNPFGEGALFRVSERVGEVEAEMWYLHVGVPHLVLWADRWD
FT                   LREDGFRSLGARYRHDPRFPRGTNVNFVSPSEGGLTCITYERGVEDLTLSCGTGACAVA
FT                   ASAVMRGMGSPVRVESPGGYNLVEVGLEDLGARYRLRGPVRVSARGVLYVG"
FT   gene            complement(75810..76823)
FT                   /locus_tag="Taci_0064"
FT   CDS_pept        complement(75810..76823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0064"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   Ion transport 2 domain protein; KEGG: aba:Acid345_3283
FT                   TrkA-N"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18304"
FT                   /db_xref="GOA:D1B7Q1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Q1"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACZ18304.1"
FT                   /translation="MQNKCSGARRVAVIALILASLITVGVLEMRMDMGLSWVDSFFYTV
FT                   TTLATVGFEAPPNLTDRGKVILVLLIIVGFGVMAYAIGEITRYFVEDRILTMLGRRRDR
FT                   MLNTIRDHWIICGLGRVGTQIAETFASEGVPFVAIERGEQAMVSGVERGWLVVNRNATE
FT                   ERALEEAGITRARGLIATLSSDPDNVYVVLCARALNMNLKIIARANDPQSSNALYRAGA
FT                   NRVINPLVAGAFTMANVALRPKAAEAMQDLLSTTRKLNLEFDKVTISDDSLVAGLSLAQ
FT                   ANMRRNFNMLALAVDRKGKVVYNPPADFVLQGGDELLFLCQVDHVEDLRRLLTGNI"
FT   gene            76894..77673
FT                   /locus_tag="Taci_0065"
FT   CDS_pept        76894..77673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0065"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /note="TIGRFAM: exodeoxyribonuclease III Xth;
FT                   exodeoxyribonuclease III; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; KEGG: sfu:Sfum_2331
FT                   exodeoxyribonuclease III Xth"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18305"
FT                   /db_xref="GOA:D1B7Q2"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Q2"
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /protein_id="ACZ18305.1"
FT                   /translation="MSIFKVVTFNVNSIKARVPIVEALLDREGPDVLCLQETKTVDREF
FT                   PREIFEARGYRVLVRGMKAYNGVAAAIRGEEQDSFAGFPSGEEMDPYRLLGVRLDGMWL
FT                   VNCYVPQGKEIDHPDYAYKLRFLSRLAELVRELEGDGEVLLVGDLNVAPTEADVTNPKN
FT                   KADHVCFHRDVREAFEGLLGAGLVDVFRRHRPGEGEFSFWDYRVKGALERNIGWRIDHI
FT                   LATRGLADRSVDSAVLRDYRAMERPSDHGPVMGVFEL"
FT   gene            77670..78527
FT                   /locus_tag="Taci_0066"
FT   CDS_pept        77670..78527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0066"
FT                   /product="GHMP kinase"
FT                   /note="PFAM: GHMP kinase; KEGG: yen:YE4039 PduX"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18306"
FT                   /db_xref="GOA:D1B7Q3"
FT                   /db_xref="InterPro:IPR012363"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Q3"
FT                   /inference="protein motif:PFAM:PF00288"
FT                   /protein_id="ACZ18306.1"
FT                   /translation="MMAVASLRGTVGEWIQGWILPDGEALVSLTVEWRGSVRAFRGGGR
FT                   SRLAPKAHRALMLAREAFGVDDASVEVENPLRPALGLGTSTMDVGGVIASCGALGGREV
FT                   SEEELFRMCCSVEPSDGTMFRGLALVDHINGRLIERLPEPPEMWLAALLPYRTLDTEAY
FT                   RRDRGLLKAVRDRAQRHAKAYQVFKRGLLEGNSRKVAAAATMSSIIQQAIMPREEWPLL
FT                   LSACRERKGIGIAVAHSGTASGVIFKDPVSAEACREFIASRWDLGEVRVVRACGGGVDV
FT                   DVRG"
FT   gene            78505..78957
FT                   /locus_tag="Taci_0067"
FT   CDS_pept        78505..78957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0067"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0630 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18307"
FT                   /db_xref="GOA:D1B7Q4"
FT                   /db_xref="InterPro:IPR025328"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Q4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18307.1"
FT                   /translation="MTWMYEGDVRLDRVHLLVAILLTWVTLGLYPAYWIYSRRGAFNAM
FT                   GPRRVDDLLGIAPLGMAILSLVFAVLGRSADLATGVLDGLMSLVGGVIMIVVSFRFREN
FT                   LRSWVRERERSPLAADSVAKSGLMTFLFGPLYIQYHINRLKDAGLL"
FT   gene            complement(79011..80270)
FT                   /locus_tag="Taci_0068"
FT   CDS_pept        complement(79011..80270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0068"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ecm:EcSMS35_4860 major facilitator family protein CglT"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18308"
FT                   /db_xref="GOA:D1B7Q5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Q5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACZ18308.1"
FT                   /translation="MNRNVKKWITLFCLAFSGGIIYQLPYLREQFYIPLQNALQINNTQ
FT                   IGNLMTVYGIANLFLYLPGGILADRLPYKKLVPFSLIATGLTGLYYSTFPGYHMALAIH
FT                   VIWAFTTVFTFWPTMLKSVKMLGDSSEQGRLFGFLDFGRGLSATLSAFGALFVFKAFGA
FT                   TLLGLKGAIIFYSATMIALGVVVYFLLEEKKGEVAEGAKSLFDGIGDVLRMPAIWLAAM
FT                   IIFAGYSIGAGLTYITPYLTDVFKMSVSMGAFIAIIRTYGLRLGGGPVGGILADRIGSA
FT                   TRLIRMGFVAIAALVGCLYLIPGSPKLLALMLATTLSASFCVFAVKGVYFAPVDEIRIP
FT                   NHLAGAAYGAISLVGYLPDTFIYSYFGNLLDRYPGIQGYRLIFLSLIALAAIGFVSAHL
FT                   LLKHIRREAPSSNTIPLETE"
FT   gene            complement(80298..81005)
FT                   /locus_tag="Taci_0069"
FT   CDS_pept        complement(80298..81005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0069"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: bsu:BSU09620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18309"
FT                   /db_xref="GOA:D1B7Q6"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Q6"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACZ18309.1"
FT                   /translation="MKIIGHRGAAGLAPENTLEAIRRGLELNVHGIEIDVQLTKDRQVV
FT                   VIHDFTVDRTSDGSGEVDRLTLEELRRLDFGAKFHPSFKGERIPTLMEVLQTVPTDRLL
FT                   NVELKQIAYRRRGLEEEVAKVIRHFGQHHHIIVSSFDHRGLKTIKELLPEIRIGLLTYH
FT                   YPVNPRSYLEGLGFPVYSLHPAFELVDREDVKTYLDMGLEVLSYTVNDPQTARELESMG
FT                   VSGIFSDRPDLFV"
FT   misc_binding    81348..81466
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam(RF00174),
FT                   score 73.29"
FT   gene            81616..82977
FT                   /locus_tag="Taci_0070"
FT   CDS_pept        81616..82977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0070"
FT                   /product="Ethanolamine ammonia-lyase"
FT                   /EC_number="4.3.1.7"
FT                   /note="PFAM: Ethanolamine ammonia lyase large subunit;
FT                   KEGG: kpn:KPN_02784 ethanolamine ammonia-lyase, heavy
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18310"
FT                   /db_xref="GOA:D1B7Q7"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Q7"
FT                   /inference="protein motif:PRIAM:4.3.1.7"
FT                   /protein_id="ACZ18310.1"
FT                   /translation="MRLKTRLFGRVYQFKSVKEVLAKANEEKSGDRLAGIAAQSMEERV
FT                   AAKHVLANLTVADLRNNPVVPYEEDEVTRIIQDDVNERIYQEVAGWTIGELREWILSDQ
FT                   VTGEDIKRVSRGLTSEVVAGVAKLMSNMDLIYGASKIRISAHCNTTIGLPGTLASRLQP
FT                   NHPTDDVEGIRASILEGLSYGVGDAVIGLNPVDDTVENVKKILHSFQELKERYQIPTQI
FT                   CVLAHVTTQMEAVRQGAPTDLFFQSIAGSQKGNEAFGISGTMLAEAMELAARQGTSTGP
FT                   NFMYFETGQGSELSSDAHFDADQVTMEARCYGFAKRFKPFLVNTVVGFIGPEYLYDSRQ
FT                   VIRAGLEDHFMGKLTGIPMGCDACYTNHMKADQNDIENLAVLLTAAGCNYFMGIPHGDD
FT                   VMLNYQCTGYHDTAALRQLLKVRPIGEFERWLEKWGILENGVLTQRAGDASIFC"
FT   gene            82993..83886
FT                   /locus_tag="Taci_0071"
FT   CDS_pept        82993..83886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0071"
FT                   /product="Ethanolamine ammonia-lyase"
FT                   /EC_number="4.3.1.7"
FT                   /note="PFAM: Ethanolamine ammonia-lyase light chain; KEGG:
FT                   stm:STM2457 ethanolamine ammonia-lyase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18311"
FT                   /db_xref="GOA:D1B7Q8"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Q8"
FT                   /inference="protein motif:PRIAM:4.3.1.7"
FT                   /protein_id="ACZ18311.1"
FT                   /translation="MVKEQDLKQLVMEILNEMSRGAEPSPTQPSTPPQGAQEAPSGQEG
FT                   ELPDLTQVDIRTQCLVPSPKDPAALMAMKAKTPARIGVWRAGPRYKTETLLRFRADHAA
FT                   AQDAVFSEVSDEFLAKNDLQVVKTECADKDQFLTRPDLGRRFSPEATETIKRLVGSPPK
FT                   VLVYISDGLSTTAVETNAIDTFKAMAQALDRQGIKLPKPFFVKYGRVPAMDVISQVTGA
FT                   EVVCVLIGERPGLVTAESMSAYITYKGTVGMPEAKRTVVSNIHSGGTPAVEAGGYVAEI
FT                   IKLMLEKRASGIDLKL"
FT   gene            83915..84568
FT                   /locus_tag="Taci_0072"
FT   CDS_pept        83915..84568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0072"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: maq:Maqu_1242
FT                   microcompartments protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18312"
FT                   /db_xref="GOA:D1B7Q9"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009193"
FT                   /db_xref="InterPro:IPR030983"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Q9"
FT                   /inference="protein motif:PFAM:PF00936"
FT                   /protein_id="ACZ18312.1"
FT                   /translation="MKGDPLKARLLSVKIIPNVNPDMAKALGLRPDQRSLGMVTADSDD
FT                   VTYTALDEATKKADVEVVYAKSFYGGAANANTKLAGEIIGIIAGPNPAEVRSGLNAIAD
FT                   VIENEAWFVSANDDDTIPYYAHCISRTGSYLSKVAGIKEGEALAYLIAPPLEAMYALDA
FT                   ALKAADVRLAAFYGPPSETNFGGGLLTGSQSACKAACDAFAQAVIFVAENPLLF"
FT   gene            84592..85119
FT                   /locus_tag="Taci_0073"
FT   CDS_pept        84592..85119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0073"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: rpc:RPC_1168
FT                   microcompartments protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18313"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7R0"
FT                   /inference="protein motif:PFAM:PF00936"
FT                   /protein_id="ACZ18313.1"
FT                   /translation="MEGRSTGRALGILEVRGMLGAVEAADSALKGASVALVDLVKVKGG
FT                   IVTVLLSGDVGSVRAAVDVAVASLGRLGIPVTSHVIARPAPEVHQMLGHQGEPEGKACV
FT                   PPDEEPKESPAGTGGDVPDLESMTVAQLRRLARSLPVQMDRGRIKFASKGELIRQIRAL
FT                   YRGPGGGERQCR"
FT   gene            85110..86567
FT                   /locus_tag="Taci_0074"
FT   CDS_pept        85110..86567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0074"
FT                   /product="acetaldehyde dehydrogenase (acetylating)"
FT                   /note="TIGRFAM: acetaldehyde dehydrogenase (acetylating);
FT                   PFAM: Aldehyde Dehydrogenase; KEGG: kpe:KPK_4880
FT                   acetaldehyde dehydrogenase (acetylating)"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18314"
FT                   /db_xref="GOA:D1B7R1"
FT                   /db_xref="InterPro:IPR013357"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7R1"
FT                   /inference="protein motif:TFAM:TIGR02518"
FT                   /protein_id="ACZ18314.1"
FT                   /translation="MQVRDRDLLSRQEARDLISAARAAQRELARMDQEQIDRLVRALAN
FT                   AAMEEADRLGRMAHEETGYGKPEDKALKNRFAALGVYEAIKDMRTVGIIGEDPKRRVIE
FT                   VAVPVGVIAALIPSTNPTSTTIFKAMIALKSANGIVFSPHPSAKGCIMETVRILSRAVE
FT                   EAGGPKGIFGCMSVLSPEGTQELMRSDQVSLILATGGSAMVKAAYSSGTPAIGVGPGNT
FT                   PAFIDRTAHVPQAVSRIVASKTFDYSTICASEQSVVVDRKVEAQVREEFVRQGGYFLPP
FT                   EDAERVARTIFLPSGLMNPRTVGRSPRHIAEMAGISIPEGTRLLLAEGGGVGKEYPFSQ
FT                   EKLCPVLAFYAEDGWEACCELCIRLLDFEGAGHTLAIHSNDMEVIRQFGLKKPVSRVIV
FT                   NAGSALGAVGATTNLLPSMTLGCGAAGHNATSDNVGPLHLINVRRVAWGVREIEDLSAP
FT                   GPREPGGRDLDRLVDRITEEILRRLQA"
FT   gene            86623..86922
FT                   /locus_tag="Taci_0075"
FT   CDS_pept        86623..86922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0075"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: dde:Dde_3270
FT                   ethanolamine utilization protein EutM precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18315"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7R2"
FT                   /inference="protein motif:PFAM:PF00936"
FT                   /protein_id="ACZ18315.1"
FT                   /translation="MNNNMQALGMIETKGLVGAIEAADAMVKAANVTLIGKVLVGGGLV
FT                   TVMVRGDVGAVKAATDAGAAAASKVGELISVHVIPRPHSEVEFILPKLSPSEGA"
FT   gene            86943..87569
FT                   /locus_tag="Taci_0076"
FT   CDS_pept        86943..87569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0076"
FT                   /product="Propanediol utilization protein"
FT                   /note="PFAM: Propanediol utilization protein; KEGG:
FT                   dde:Dde_3276 propanediol utilization protein- like"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18316"
FT                   /db_xref="GOA:D1B7R3"
FT                   /db_xref="InterPro:IPR008300"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7R3"
FT                   /inference="protein motif:PFAM:PF06130"
FT                   /protein_id="ACZ18316.1"
FT                   /translation="MGSRDTGELADRVLEVLRERFTFPVEASGRHVHLSGPHVAALFGE
FT                   GHVLSPARPLSQPGQFLCEERVTLVGPKGEIRNVAVLGPERGRTQVEVSLTDGAALGIQ
FT                   VPVRESGQVEGTPGVLLVGPRGEVQLEEGLIAALRHIHMDPLDAALLQVRDGQTVSVRV
FT                   EGDRPVIFEQVLVRVSPKFQLAMHIDYDEANACGYRMGVRGRLVP"
FT   gene            87566..88414
FT                   /locus_tag="Taci_0077"
FT   CDS_pept        87566..88414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0077"
FT                   /product="ethanolamine utilization protein EutJ family
FT                   protein"
FT                   /note="TIGRFAM: ethanolamine utilization protein EutJ
FT                   family protein; KEGG: dds:Ddes_1363 ethanolamine
FT                   utilization protein EutJ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18317"
FT                   /db_xref="GOA:D1B7R4"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="InterPro:IPR013366"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7R4"
FT                   /inference="protein motif:TFAM:TIGR02529"
FT                   /protein_id="ACZ18317.1"
FT                   /translation="MTGPLGVMSPEALLEEAFRTGDETRRDWEGPLRVGVDLGTASVVL
FT                   TVVDRWGRPVAFEMEEASVVRDGLVVDFAGASAIVRRLKGRLEGRIGEELVASAIALPP
FT                   GTSERDGAAHRYVVEGSGLEVLAVMDEPTAANHVLGVSDGAVVDIGGGTTGIAAFRDGR
FT                   VVRVHDEPTGGVHVSLVIAGNRGIPLEEAEALKRDPAMQGELLGVVKPVFQKMGAIVRR
FT                   SIQGLPMERLYLVGGTCAFGGIDRVLGAEVGIQASIPPHPFLVTPLGIALGCPVRLDWK
FT                   G"
FT   gene            88420..89088
FT                   /locus_tag="Taci_0078"
FT   CDS_pept        88420..89088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aha:AHA_1326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18318"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7R5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18318.1"
FT                   /translation="MDRSQLVDLVVKELMRRLGPELSSSGGDVLVAGEVSDLPDGYRRS
FT                   LSLVPCSDCVSPGGFLAVLVPRLSMGQLVMASLGVPQDPVTSLILDGLVSGVPVMVTRE
FT                   ALGWMGGLRPGSPLANHYRACLDRLMSFGVRVVGGPEEVATPGECRVAPAEPMEARSPQ
FT                   GSGDVLDLRGIRVVSERDLKDRLTEGVRCILVDPRAIVTPLCGDLLRTRGVELRRGDGV
FT                   "
FT   gene            89085..89357
FT                   /locus_tag="Taci_0079"
FT   CDS_pept        89085..89357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0079"
FT                   /product="Ethanolamine utilization protein EutN/carboxysome
FT                   structural protein Ccml"
FT                   /note="PFAM: Ethanolamine utilization protein
FT                   EutN/carboxysome structural protein Ccml; KEGG:
FT                   dde:Dde_3273 ethanolamine utilization protein EutN"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18319"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7R6"
FT                   /inference="protein motif:PFAM:PF03319"
FT                   /protein_id="ACZ18319.1"
FT                   /translation="MIIAKVIGNVWATKKDDSLNGLKFFVVLPCKGEASQSFVAVDAAG
FT                   AGIGDHVLVSQGSSARVLFRDGTVPVDAVIVGIIDSVEVDESLLG"
FT   gene            89400..90512
FT                   /locus_tag="Taci_0080"
FT   CDS_pept        89400..90512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0080"
FT                   /product="Ethanolamine utilisation protein EutH"
FT                   /note="PFAM: Ethanolamine utilisation protein EutH; KEGG:
FT                   ecm:EcSMS35_2598 ethanolamine utilization protein EutH"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18320"
FT                   /db_xref="GOA:D1B7R7"
FT                   /db_xref="InterPro:IPR007441"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7R7"
FT                   /inference="protein motif:PFAM:PF04346"
FT                   /protein_id="ACZ18320.1"
FT                   /translation="MGINDVILYVMTGFMVIGAVDRAFFGNRWGFGEKFEEGFMAMGSL
FT                   MLAMGGVITIAPLLAELLKPVIVPLYTMVGADPSMFATTLLACDMGGYPLAMKMAINPT
FT                   VGKFAGIILGSMMGPTIVFSIPVALGIIEKKDHPALAKGILIGMITIPLGCFAGGLLML
FT                   NGEFPFMVMLINLVPVVVFSVLIVLGLKMIPETMIRGFILFGKGVVSVITIGLAMGIIE
FT                   ALSPFRFFPEGSPMALTPLTESYAVMGAIAIVLAGAFPMVSFITKVFNKPLMAFGKRLG
FT                   MNDVSAAGMVATLANNIPMFTMMKDMDERGKVINVAFAVSAAFVFGDHLGFTAGVERGL
FT                   ILAMIVGKLVGGITAVILACKFTPANGQAK"
FT   gene            90529..91092
FT                   /locus_tag="Taci_0081"
FT   CDS_pept        90529..91092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0081"
FT                   /product="Ethanolamine utilisation EutQ family protein"
FT                   /note="PFAM: Ethanolamine utilisation EutQ family protein;
FT                   protein of unknown function DUF861 cupin_3; KEGG:
FT                   maq:Maqu_1229 ethanolamine utilisation EutQ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18321"
FT                   /db_xref="InterPro:IPR010424"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7R8"
FT                   /inference="protein motif:PFAM:PF06249"
FT                   /protein_id="ACZ18321.1"
FT                   /translation="MGGGLRVPAGSPWGGWIYRSFIPRPWSLEGKPAEGVCPLNREELK
FT                   GMIREVLLDILKDQGVEGSSVPKVRDPSGVLAVRAGEVRPERFDTGKPSDRVYLKDILS
FT                   LEESPRLGCGVMEMERSTFKWTLRYDEVDYVIDGTLEIVVDGRRVVGHKGDVIFIPANS
FT                   TIHFSTPDFVRFLYVTYPADWASQ"
FT   gene            91106..91870
FT                   /locus_tag="Taci_0082"
FT   CDS_pept        91106..91870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0082"
FT                   /product="cobalamin adenosyltransferase"
FT                   /note="PFAM: cobalamin adenosyltransferase; KEGG:
FT                   maq:Maqu_1230 cobalamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18322"
FT                   /db_xref="GOA:D1B7R9"
FT                   /db_xref="InterPro:IPR009194"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7R9"
FT                   /inference="protein motif:PFAM:PF01923"
FT                   /protein_id="ACZ18322.1"
FT                   /translation="MKLVTEQDLRAQIGGKEVDRYVVDRDTIVTPSARQYLSDRRIQLV
FT                   VESPKVDLPAGEEEGPREVLRAALPAPFVGPDGGAFREKPEHMTHLKGNRLVPKGHPVI
FT                   AFRGKLDTLQARIVALQARAAEVGREDLAEELEDFLGLVRGLVSAEVMGSPVEEIPLMG
FT                   MEWDQIRRMSHNPRKHFGIGHIRAHYSMGSICAELNLLRALAREAELAAFKAFNREEGP
FT                   SRPDVIRALNRLSSAFYVMMYRNLPKGYDKEY"
FT   gene            91890..93320
FT                   /locus_tag="Taci_0083"
FT   CDS_pept        91890..93320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0083"
FT                   /product="Ethanolamine utilisation EutA"
FT                   /note="PFAM: Ethanolamine utilisation EutA; KEGG:
FT                   kpe:KPK_1352 ethanolamine utilization protein EutA"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18323"
FT                   /db_xref="InterPro:IPR009377"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7S0"
FT                   /inference="protein motif:PFAM:PF06277"
FT                   /protein_id="ACZ18323.1"
FT                   /translation="MGEVLTSVGIDIGTTTTQLIFSQLVLDDRAAMSSAPSVSVVEKRV
FT                   IYRSRIHFTPLLSPTEIDARAVRRLVEEEYRLAGVDPREVNAGAVIITGDTARKENAQA
FT                   VLESVEGMAGDFVVATAGSDLEAILAGKGSGAEALSRREGSTVANLDVGGGTTNVAVFR
FT                   EGHVVDTSCLNVGGRLVRLSQDGTVEHVSDLISPVLDHLGLRIRAGDRLEPKVAESICG
FT                   RMASLCDELLGLVPRTSLLDRMLTSHDLKDPRRELDRITISGGVGDCIHQGVWDDPYRY
FT                   GDLGVLLARAMMGTRMFALGKVVPPEETIRATVVGAGSHSMELSGSTIGFSHDGVFPLR
FT                   NLPILRVSEAEEAHCLPQALRERLGWFMDSAGEQMRVALALKGLSNPSFEEVQRLAEEI
FT                   LEGLGDYPVRSGLLVLVVERDMGKALGYALSSRLPQDVRVVSVDGVRVENGDYVDIGRP
FT                   LARGRVLPVVIKTLVFGA"
FT   gene            93332..94681
FT                   /locus_tag="Taci_0084"
FT   CDS_pept        93332..94681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0084"
FT                   /product="Respiratory-chain NADH dehydrogenase domain 51
FT                   kDa subunit"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase domain 51
FT                   kDa subunit; KEGG: cko:CKO_00783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18324"
FT                   /db_xref="GOA:D1B7S1"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017054"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7S1"
FT                   /inference="protein motif:PFAM:PF01512"
FT                   /protein_id="ACZ18324.1"
FT                   /translation="MEDLVSAVRDAGVVGAGGAGFPTHVKLGGGCESVLVNGAECEPLL
FT                   EVDQQLMALYPSRVLEALDAVVRSLGAREGIIGIKDKYREALEALGGEIGGFPSLRLHV
FT                   LPNVYPAGDEQVLVYEATGRIVPEGGIPLEVGVVVLNVETLLNIWGAMRGIPVTEKYLT
FT                   VCGEVHRPATVRVPLGVSFGEVVAAVGGSPLKDFVVIDGGPMMGRVVRRMDEPVTKTTK
FT                   GLIVLPPDHPLVVAKERDMRSMMSLAKTACCHCMLCTDLCPRYLLGHRLRPDKLMRLAA
FT                   YNDTCEGDAAATEAFLCCECGMCEVACVMGLQPWKLNRELKSRMGRMGIRNPHREAPKE
FT                   VNPFRSFRGFPTPKLLGRLGLSRYGGVHAPMGEVEVQPRRLVLKLKQHIGAPSVPVVAP
FT                   GKRVARGELLARLGGNVSANLHAPLGGLVESVGEDLLVLRVSDDLGGVEA"
FT   gene            94678..95226
FT                   /locus_tag="Taci_0085"
FT   CDS_pept        94678..95226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0085"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: dde:Dde_3265
FT                   putative propanediol utilization protein PduT"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18325"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR011238"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7S2"
FT                   /inference="protein motif:PFAM:PF00936"
FT                   /protein_id="ACZ18325.1"
FT                   /translation="MKGAIGLVEYKTVPKGVEAADAMLKASEVRLLFSSPICPGKYVTI
FT                   VAGEVDAVRTAVGKAVQVGGIFTVDSHVLPNVHPSVIPALTATGEYGDVEALGLVETIS
FT                   AVAAVSAGDVAAKAASVSLLEIRIARGLGGKGFVVVTGDLGSVEASIRACERKLGEEGG
FT                   IVSTAVIASPHRDLVSAML"
FT   gene            complement(95223..95666)
FT                   /locus_tag="Taci_0086"
FT   CDS_pept        complement(95223..95666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0086"
FT                   /product="ethanolamine utilization protein-like protein"
FT                   /note="KEGG: dde:Dde_3263 ethanolamine utilization protein-
FT                   like"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18326"
FT                   /db_xref="GOA:D1B7S3"
FT                   /db_xref="InterPro:IPR012381"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7S3"
FT                   /inference="similar to AA sequence:KEGG:Dde_3263"
FT                   /protein_id="ACZ18326.1"
FT                   /translation="MSRRRLMVVGPIGAGKTALLRALGLTSCSSKTEAISFCGDAVDTP
FT                   GEFFEIPRFYHTLITNSARASTVLLVADPKRPVRFPSMFVKAMRGSVIGVVTKADLASE
FT                   QELDRAARALQGAGVREIYRVSSVSGQGIQDLARRLGLEGQTP"
FT   gene            complement(95663..96001)
FT                   /locus_tag="Taci_0087"
FT   CDS_pept        complement(95663..96001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0087"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: maq:Maqu_1227
FT                   microcompartments protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18327"
FT                   /db_xref="GOA:D1B7S4"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009307"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7S4"
FT                   /inference="protein motif:PFAM:PF00936"
FT                   /protein_id="ACZ18327.1"
FT                   /translation="MEAKARVIQEYVPGKQVTLAHMICNPREELCSLVGVERAGAIGIM
FT                   TITPGEGAIIAADVASKAGNVNMEFIDRFTGCILFTGDVAAVESSLQMAVQVLSSSLGF
FT                   TPAPITRT"
FT   gene            complement(96109..96897)
FT                   /locus_tag="Taci_0088"
FT   CDS_pept        complement(96109..96897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0088"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   bmj:BMULJ_05008 putative lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18328"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7S5"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ACZ18328.1"
FT                   /translation="MKLGRTWAAGLICMALLAAVIALAPPGFAEDSEEGSFRIDEVNPT
FT                   TQPSASKPADSAGPGEEPKLVAIEARDAEYHQSIKDALRSMGLSPKDLTAWLLRHPESI
FT                   LHKLGSFSADDQRKVATVTRYIRGTNPSVAPMTALRTAGALVYYSAKYGIPVHLSTAVA
FT                   HTESRFDPKAVSNKGAMGIMQVMWRVHNGLLQANGIATKDDMFNPEKGVAAGCLLLSRY
FT                   INAYGSIPKALARYYGGSSTAYFRKVNTKMANIRSSIYPQ"
FT   sig_peptide     complement(96808..96897)
FT                   /locus_tag="Taci_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 30"
FT   gene            complement(97130..98893)
FT                   /locus_tag="Taci_0089"
FT   CDS_pept        complement(97130..98893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0089"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; PAS
FT                   fold-4 domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein; KEGG: mgm:Mmc1_1492 multi-sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18329"
FT                   /db_xref="GOA:D1B7S6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7S6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACZ18329.1"
FT                   /translation="MLRSIRGQVTLLLALPLVTLVALWWIFALKDTRGHLEDETRSNLS
FT                   ALSASAGALVRLSGTEPESLDRVLGHWASDTGVRCTVIDRDGRVLWDSQVPLEGLPSLE
FT                   NHLTRPEVRRAFEAGEGYSVRRSDTTGVEYLYEARRVELPGGPTVVRVSLERNRFEGVL
FT                   SSLRMRLLTTLGAALLLALGVGTWWMRRITGPILELARTADRAEAGEDIPLPPGGPNEV
FT                   RLLGLSIRRMARRLNRAMEDLEEERRTLKGLVETMPVGVLMVDRQRRVLFFNDPMSDLM
FT                   RSDSPPGTPVEGAVRHPKLMDAVDQLLKGGQVEATLTQSDAWSERHYLMRGVGVQGSAV
FT                   VTVQDITQRVRGEEALRRFVSDVGHEFQTPLTVIRGAAELLRDYALGDNLMLIDRILEQ
FT                   QRRLTDMVDRLLLLTRFEGGDLGDPRELDLADLVRRAAGDASWLARDGEVQVELSLPHE
FT                   APVRASAEMEAAVRNLIENAVKYVRSKFDRSPGGLVKVTLEDQGDRYSLWVEDNGPGVP
FT                   PGMEEQIFQRFRRGDQHRSRSSEPVGGYGLGLSIARGIARAHGGDVRLEWSQPGVGSRF
FT                   LLWVSKGLDKK"
FT   sig_peptide     complement(98801..98893)
FT                   /locus_tag="Taci_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.606) with cleavage site probability 0.306 at
FT                   residue 31"
FT   gene            complement(98894..99580)
FT                   /locus_tag="Taci_0090"
FT   CDS_pept        complement(98894..99580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0090"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: nha:Nham_0640 two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18330"
FT                   /db_xref="GOA:D1B7S7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7S7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACZ18330.1"
FT                   /translation="MRWRILVVEDEEGIREILSEAFRRQGYTVMCAADGDQAVDLALTA
FT                   VPDLIILDLMLPKMDGWEVCRRIREEQELRHVPVIMLTARRDERDAVAGLEAGADDYVR
FT                   KPFSIPELMARVRAHLRRSDSPQGGEVQISMGNLTLEPQGDVLVDGRPLDLSPTEHRLL
FT                   EVLMSGRGRLVSKEEILGKIWGHVGSDSRTVDVNVFRLRRKLEEAGARVTIKTVRGRGY
FT                   RVMEVS"
FT   gene            complement(99577..100272)
FT                   /locus_tag="Taci_0091"
FT   CDS_pept        complement(99577..100272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0091"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG: gsu:GSU1095
FT                   phosphate transport system regulatory protein PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18331"
FT                   /db_xref="GOA:D1B7S8"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7S8"
FT                   /inference="protein motif:TFAM:TIGR02135"
FT                   /protein_id="ACZ18331.1"
FT                   /translation="MEPLNIRKHMDQDLGEIRSGMMRLGAMAEASIRGGVAALVKRDRS
FT                   EARRVIESDDEADQLAGWLDMSCLEFMARYQPLGADLRAISCAIHMAVDLERIADLGVS
FT                   VAKRALRLMDQEPIKPLMDIPLMGDRVCAMLDLAVKAYLNGDEDLARELCAMDDQVDDL
FT                   QDRVERELLMIMIDRPATIAQASALGEVARVLERAGDHATNLGEHIMFMITGRRVKASQ
FT                   FRRPLGDRS"
FT   gene            complement(100289..101056)
FT                   /locus_tag="Taci_0092"
FT   CDS_pept        complement(100289..101056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0092"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: tgr:Tgr7_2650 phosphate ABC transporter, ATP-
FT                   binding protein; TIGRFAM: phosphate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18332"
FT                   /db_xref="GOA:D1B7S9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7S9"
FT                   /inference="protein motif:TFAM:TIGR00972"
FT                   /protein_id="ACZ18332.1"
FT                   /translation="MCQMEESKVVSKGLTLYYGSVPAVRNVNLSVPERSVMALIGPSGC
FT                   GKSTFLRCINRMNDFIEEVRVEGQVLIDGQDVYGPQTDVISLRRRVGMVFQRPNPFPFS
FT                   IWENVAYGPRLHGVKDRRVLDEIVERSLRGAALWDEVKDKLESSAMNLSGGQQQRLCIA
FT                   RAIAVEPEVLLMDEPTSALDPMGTAKVEELVRELKKSYTVIIVTHNMQQAARVSDRTAF
FT                   FLMGELVEEGPTREIFTSPRDPRTEAYITGRFG"
FT   gene            complement(101093..101947)
FT                   /locus_tag="Taci_0093"
FT   CDS_pept        complement(101093..101947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0093"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: dol:Dole_1927
FT                   phosphate ABC transporter, inner membrane subunit PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18333"
FT                   /db_xref="GOA:D1B7T0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7T0"
FT                   /inference="protein motif:TFAM:TIGR00974"
FT                   /protein_id="ACZ18333.1"
FT                   /translation="MKIRLVKDRLASWCLWALALLTLGALLAILGFLWVNGSSAITWDF
FT                   LTQMPRSGMTQGGIATPLVGTIQLMLLSMAFALPIGVATAVYLTEYAPKGPVASAVRLA
FT                   IRSLAGVPSVVFGLFGLSFFCIFLGLGASMLSASLTLACLVLPVVVTAAETALLNVPKD
FT                   LRDASFAMGATRWQTIRKVVLPTAMPSIMTGAILGLGRVAGETAPIMFTGAVFFTPNFA
FT                   KSPFESVMALPYHIYVLATAGTNIDATRPIQYGTSLVLVGTVFLLSLTGIAWRSRLRRS
FT                   GRA"
FT   sig_peptide     complement(101825..101947)
FT                   /locus_tag="Taci_0093"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.502 at
FT                   residue 41"
FT   gene            complement(101944..102891)
FT                   /locus_tag="Taci_0094"
FT   CDS_pept        complement(101944..102891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0094"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: sat:SYN_00057
FT                   ABC-type phosphate transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18334"
FT                   /db_xref="GOA:D1B7T1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7T1"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ACZ18334.1"
FT                   /translation="MESRGEVSSLSVGGPNGAPFSEGVTVVDAMRGDRLPRTLVAGVAF
FT                   TGIIVVGAILVFLVKESLPVLRDASLMEMLTGPYWYPSQEEPKFGMLPLWVGSLAVTGL
FT                   SALMSLPFSVGLGIFLSEVCPRGLREIIKPAVEVMGFLPSVVLGFIGMVVIAPHLQERF
FT                   GVLTGLNMLNASFLLGILMLPTVASLAEDSLSSVPKEVRDGSYALGATRLETTFRVVVP
FT                   YAARGIGSACILGVMRALGETMVVLMAAGGAAIVPESLVDPVRPLTSAIAAEMGETPVG
FT                   SSHYHALFFMGLMLLLATMGLNLAVMALERRRRA"
FT   gene            complement(102907..103725)
FT                   /locus_tag="Taci_0095"
FT   CDS_pept        complement(102907..103725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0095"
FT                   /product="phosphate binding protein"
FT                   /note="TIGRFAM: phosphate binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; KEGG:
FT                   sat:SYN_00056 ABC-type phosphate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18335"
FT                   /db_xref="GOA:D1B7T2"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7T2"
FT                   /inference="protein motif:TFAM:TIGR02136"
FT                   /protein_id="ACZ18335.1"
FT                   /translation="MRSILRVLCAALLVGVLGGAAMAGEIVMNGSTTLLPFAQSAAEAF
FT                   MKANPGVKISVSGGGSGNGIKALIDGTTHIANSSREMKSEEIEKAKTKGVTPVKHVVAF
FT                   DCIIPIVHPSNPVSNLTVDQLKNIYTGKVRNWKEVGGPDKPIVVLSRDTSSGTYEVWEQ
FT                   KVLRKEPVSPRALTVASSGAMIQTVAKNPLAIGYDGIGYVDQRFVKPLKINGVDGTPTT
FT                   ARNGKFPTARELYMYTNGEPKGEVKAFIDFMKGPNGQRYVAKEGFVTLKP"
FT   sig_peptide     complement(103654..103725)
FT                   /locus_tag="Taci_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            103900..104655
FT                   /locus_tag="Taci_0096"
FT   CDS_pept        103900..104655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0096"
FT                   /product="PAS fold-4 domain protein"
FT                   /note="PFAM: PAS fold-4 domain protein; KEGG: lch:Lcho_0902
FT                   PAS/PAC sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18336"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7T3"
FT                   /inference="protein motif:PFAM:PF08448"
FT                   /protein_id="ACZ18336.1"
FT                   /translation="MEELLMRALSASGEPVAVIRRDGSVVFVSDPMGAYLKVDPLRARG
FT                   MRCEELFGEDLCSLAMCAVRSASCPAFGVSSRDGRLECRIIPGEDGILGAVVRLNVRDR
FT                   AFRRAMRDLAFQRRLTGLVEQDPGTLMLVLDGDGRVLRANGAAGDLFRGSPVGRYAWEM
FT                   GSPHQAATLREAISKGDGTVHLTCPTRDRVRHLVVRIRSMGSGDGARTLVLWGHDVTEL
FT                   IQARDEADVFRSALDQFSQSVCITNPLGP"
FT   gene            104628..105587
FT                   /locus_tag="Taci_0097"
FT   CDS_pept        104628..105587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0097"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: abu:Abu_0994 response regulator receiver;
FT                   TIGRFAM: PAS sensor protein; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; PAS fold-3 domain protein;
FT                   SMART: PAC repeat-containing protein; metal- dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18337"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7T4"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACZ18337.1"
FT                   /translation="MHHKPLGAITYVNRAFEEMYGYTQQEALGKNPRILNPGLQVYLDH
FT                   GISQEDYRRRFQGMWDMVLDPSVGRWEGEVINRRKDGSLVWVQLIVSAIRGRDGDLKAI
FT                   MGIPVDLTAQRERAEQLLLEAYRAIVLIGEMRDEETGEHLIRIGSYCRILGEAMGLSDR
FT                   VCRDLEIFSQFHDIGKVGIPDSILLAPRKLDPHEFELMKRHTIMGYQILKGKGSLAMGA
FT                   EIALNHHERWDGSGYPQGLEGERIPLSARITAVADVYDALRSRRPYKEPIEHREVVDYI
FT                   LSGSGSQFDPRVVEAFNAVHLEMAEVFRLTQSIPVERG"
FT   gene            105592..107520
FT                   /locus_tag="Taci_0098"
FT   CDS_pept        105592..107520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0098"
FT                   /product="diguanylate cyclase with GAF sensor"
FT                   /note="KEGG: gme:Gmet_2721 diguanylate cyclase with GAF
FT                   sensor; TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; SMART: GGDEF domain containing protein;
FT                   GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18338"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7T5"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACZ18338.1"
FT                   /translation="MDLSLVTQLKRQLELAQSMAAACAKGAQLLSRHLRGWTVGMYLPR
FT                   NGVPGSFIWVDVSGVRGLVDHPLVRRAFESSGAVCGEWCGGTGWALPLSWAGEVLGVLL
FT                   VAGEAGCELGFEEAQLVEVAASLLAAALVSLRLKEQIQREASLARLREGALNLRVAMGE
FT                   SLARLFIRLAEEPTVEGLFRLVVDGLLEMGYQVASVVSRSSREGPMEFRCNRGSPVSAA
FT                   EVNYLIEAGLGLVGRVMSTGQAYLCEDSLTDQVVVRTEGDIRSELGVPMWGLDGHMWGM
FT                   IRVGKRQPRSLNLERDGKLLEALGAFLALRIERNEMICSLRRELDRTRLLHRVVQDLQG
FT                   AVDLEDLAQRVVASLSAQAGYDLVEFYQVQDGDPELLIVGSSVITREEMLPCSIRLKEA
FT                   GGGLVSKILQTQRLTVHRCSSEDGYLSFSDRSPAQQLDVPIFVMGRMRGVISVESHREA
FT                   FDSADIWFFETLAWHVGALWEGMEHLHLLELQSFKDPLTGLWNRKYLEARLEEELRRSA
FT                   RSGQAVCIAMVDLSNFKAVNDTYGHEVGDRVLAEVARALSASVRSCDVLVRYGGDEFVV
FT                   FSPGAGERELEGLLSRVRASMEEMKLCSVGGISFDYGVTCFSPDENIMDAIARADGIMY
FT                   LRKRGGR"
FT   gene            complement(107546..109405)
FT                   /locus_tag="Taci_0099"
FT   CDS_pept        complement(107546..109405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0099"
FT                   /product="oligoendopeptidase F"
FT                   /note="TIGRFAM: oligoendopeptidase F; PFAM: peptidase M3A
FT                   and M3B thimet/oligopeptidase F; Oligopeptidase F; KEGG:
FT                   bcy:Bcer98_0909 oligoendopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18339"
FT                   /db_xref="GOA:D1B7T6"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7T6"
FT                   /inference="protein motif:TFAM:TIGR00181"
FT                   /protein_id="ACZ18339.1"
FT                   /translation="MNVKPLLLAAALMASAGPASGGDLPSRDQVPQELRWRLEDIYPTD
FT                   ASWEEEFRAVQEQLPRLEAFRGKLSSPKELAACLKLRDQLSIAVGKLYAYAVMRSHEDT
FT                   ANPTYQALSDRASSLATLLGAKTSFIEPELVQLPRELLRSFLDEPSLKDHRFFLSEVIR
FT                   KSPHVLSREAEELVASMGEVLEVPERSFEMLTNADMTFAPIRDEKGKRVEMSEERYYRF
FT                   LRSKDRRVRREAYESLYDAYSAHENTLGATFGGMLKASSFLAKTRKYPSVLAMELFDDA
FT                   IPEEVYRQLVDTVESNLKPLHRYIDLRAKALKLDQLAPYDLHVPLAEEIHRDIPWDRAK
FT                   EMVLEALSPLGEDYVRKAREGLASGWVDVVENRGKRGGAYSWGSYGTHPYILMNYNGTI
FT                   SDVFTLAHELGHSMHTLYSHSTQPYPTSDYSIFVAEVASTVNEMLLLEHLIRNAKDPKE
FT                   KLYLINYQLDQIRSTLYRQTMFASFEREVHRRHQEGEPTSPRELRDLWGKLNRRYHGPN
FT                   FQVDQRITMEWARIPHFYSPFYVFQYATGISAAISLSEAILKDPSARDRYLNMLSRGGS
FT                   AHPIELLKDAGVDMTSPRPVLDAIGLFDRRLGEMETLLDQAGR"
FT   sig_peptide     complement(109340..109405)
FT                   /locus_tag="Taci_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            109530..110285
FT                   /locus_tag="Taci_0100"
FT   CDS_pept        109530..110285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0100"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: hch:HCH_04001 amino acid ABC transporter periplasmic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18340"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7T7"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACZ18340.1"
FT                   /translation="MVKVRYALLIMAVMWLTSGGSAFAGRVLTVAGDPWGPYLDPGHHR
FT                   LGLSAELVREALGTQGYRVEFKIIDWLKAQEMASRGEVILMNAWYTPDRASAFFVSDPY
FT                   LRSRVVFLARRGSGFKYRGIESLKGLRVGRMRGYAYDPEFIKVYIPYDGVSFIDLARKV
FT                   ASRRIDLVPEDQLVALWELKKKEPLLLDKLQVVEGPLKETTVHLMASRVMPDGEETIRA
FT                   FNRGLKELKRSGQYRAILAAYGASSVEVR"
FT   sig_peptide     109530..109604
FT                   /locus_tag="Taci_0100"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.971 at
FT                   residue 25"
FT   gene            complement(110296..111492)
FT                   /locus_tag="Taci_0101"
FT   CDS_pept        complement(110296..111492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0101"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: dds:Ddes_0583 tryptophan synthase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18341"
FT                   /db_xref="GOA:D1B7T8"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7T8"
FT                   /inference="protein motif:TFAM:TIGR00263"
FT                   /protein_id="ACZ18341.1"
FT                   /translation="MRNHAETETRRGYFGEYGGAFVDGSIGSRLKELDQAFLDALEDPS
FT                   FQQELTDLLRRYVGRPSALTFCANLSSRLGRGARLYLKREDLNHTGAHKINNALGQGLL
FT                   ARRMGKKEIIAETGAGMHGTACATVAALLGLECTVFMGSQDVQRQAANVARMKALGARV
FT                   VSVSQGDGTLKEAVDAALHEYASNPQAFYLLGSVVGPHPYPTMVRHFQSVIGHEAREQF
FT                   LKEEGRLPHYAVACVGGGSNAMGLFSAFTDDLDVKLIAVEPAGKGLDSGLHAASLMRGE
FT                   PAIIHGFKTYVITDPNGNPGRVHSISSGLDYPGVGPELAHLKDMGRISCEGVTDQEALD
FT                   GFLALSRHEGIIPALESAHAVAFAMKLLPTLSDGTTVLVNLSGRGDKDLNTVMRELEL"
FT   gene            111828..112346
FT                   /locus_tag="Taci_0102"
FT   CDS_pept        111828..112346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0102"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: dde:Dde_1320 rubrerythrin,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18342"
FT                   /db_xref="GOA:D1B7T9"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7T9"
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /protein_id="ACZ18342.1"
FT                   /translation="MNEEEEDSDMKTNENLMSAFAGESQANRKYLAFAKVAEKEGHRLA
FT                   AKMFLAAAEAETIHAHAHLKAAGGIGDTASNLKSAVSGETYEFTQMYPPFIDEAKAEGR
FT                   DEAVRTFTYANEAEKVHARLFQEVLDKLGTDDGDEFFVCTVCGHVHKGTSAPEQCPICG
FT                   AKSAAYKMV"
FT   gene            112488..114185
FT                   /locus_tag="Taci_0103"
FT   CDS_pept        112488..114185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0103"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   dimerization region"
FT                   /note="PFAM: pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region; FAD-dependent pyridine nucleotide-
FT                   disulphide oxidoreductase; FAD dependent oxidoreductase;
FT                   SMART: Rhodanese domain protein; KEGG: gme:Gmet_3484
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18343"
FT                   /db_xref="GOA:D1B7U0"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7U0"
FT                   /inference="protein motif:PFAM:PF02852"
FT                   /protein_id="ACZ18343.1"
FT                   /translation="MAGSDSKRVVVVGGVACGAKAASRLRRLKPHWDVTIIERSDTLSY
FT                   AACGMPFFLEGAVPDFKELLSTPAGVIRDANFFRNVKGIQVLTNHLALEVDRAAKVVRA
FT                   VDSSTGERKEIPYDKLVLATGASPVVPDLPGVDLAGVSPLWTPRNALEIRCALDSGNVS
FT                   RAVVVGAGLVGLEAAEAMAKRGIKVTVVELLDRPLAALLDGEFGAALAKAIRSYGVEFV
FT                   PCCRVMGFEGEGGSLRRVITDKGDFDAQLALVSVGVRPNSQLAADSGLEIGPTGGIKVD
FT                   SHMMTSDPDVYAGGDCVETFNTVTGRPVRQPMGSTANRHGRVIADNLVGMGTCFNGVIG
FT                   TAVMRFFNHTVGRTGLSEQAAREAGFDPVGVTVTDPDRPHFMAGSAPVVLRILADRNSR
FT                   RVLGAQLIGTGQVDKRLDTLACAVYGGMTVDMLADMDHAYAPPFSSALDVLTHGANHLR
FT                   NRLDGLVETVRPSEVAALVEQGAVLLDVRGPGEVEAQGQLPFDGILAIPLGQLDKRIQE
FT                   LPRGRKVIAYCKVSVRGWDAVSILRKHGFQDVAVLEGGVVGWPFNLRK"
FT   gene            complement(114244..114690)
FT                   /locus_tag="Taci_0104"
FT   CDS_pept        complement(114244..114690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0104"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; Helix-
FT                   turn-helix Mga DNA-binding trans-acting positive regulator;
FT                   SMART: regulatory protein AsnC/Lrp family; KEGG: bha:BH0868
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18344"
FT                   /db_xref="GOA:D1B7U1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7U1"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACZ18344.1"
FT                   /translation="MDQLDLKLLQDLTEDGRISYAELGRKYGLTRVSIKERIDRLRQEG
FT                   VIEAFTVTINPEATGKHVSAFFEIDVEPFHLDSVAHALAEKDEVENLYLMTGSSTLHMH
FT                   ALLRDMEDLERFVLDHVYSLKGITRVQTHLILKRYKSRSGGLRL"
FT   gene            complement(114765..115250)
FT                   /locus_tag="Taci_0105"
FT   CDS_pept        complement(114765..115250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18345"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7U2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18345.1"
FT                   /translation="MRILLCLALLLTFWSPSQGAPLRIEDPVLSPIGSHGKARLRSLVS
FT                   PGDGALLILFSPGCRSCRDGIREALGGLKGKVKVIPVSTSYPPREYLEERWREWGFKVQ
FT                   GYVDPGDRIFRAIQVREVPVFAFVRGEDGALLVLKVLDGRATSGHLASQARRLGLLR"
FT   sig_peptide     complement(115191..115250)
FT                   /locus_tag="Taci_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(115296..115466)
FT                   /locus_tag="Taci_0106"
FT   CDS_pept        complement(115296..115466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18346"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7U3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18346.1"
FT                   /translation="MDMVSALQAQREAVTGVQIQYATANKVLKATEALQVDMLNKLLGS
FT                   MGIGNNLNVEA"
FT   gene            115600..116256
FT                   /locus_tag="Taci_0107"
FT   CDS_pept        115600..116256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0107"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="PFAM: FeoA family protein; iron dependent repressor;
FT                   SMART: iron dependent repressor; KEGG: dal:Dalk_2732 iron
FT                   (metal) dependent repressor, DtxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18347"
FT                   /db_xref="GOA:D1B7U4"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7U4"
FT                   /inference="protein motif:PFAM:PF04023"
FT                   /protein_id="ACZ18347.1"
FT                   /translation="MSSRRSEDYLEEMLLQEIQGGTPSVTGLARALEVTKGTVVSVLKK
FT                   LSSEGLLSHERYGTPALTEAGRARALSIYRRHYNLVFFLELLGVDQDRAGRIACEMEHL
FT                   LDDDLEGRIFALSEFISQGIKASEGWARELQERLSNPGTLPHPLCLAGSRTCRVVRITA
FT                   EGPLRKRLMEMGFIPGASVELAGESWDRDPLKVRLQGRVVALRRDEASRVWVTEA"
FT   gene            116302..116538
FT                   /locus_tag="Taci_0108"
FT   CDS_pept        116302..116538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0108"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: rru:Rru_A2468
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18348"
FT                   /db_xref="GOA:D1B7U5"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7U5"
FT                   /inference="protein motif:PFAM:PF04023"
FT                   /protein_id="ACZ18348.1"
FT                   /translation="MCPLSSAREGEELSVMRVSLDQHVARRLGEMGLVKGASVRLVSRD
FT                   ESSVVVSVGGSRLALGGQMARCIWVSPCAHRRP"
FT   gene            116597..116869
FT                   /locus_tag="Taci_0109"
FT   CDS_pept        116597..116869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0109"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: rsq:Rsph17025_3854
FT                   Fe2+ transport system protein B-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18349"
FT                   /db_xref="GOA:D1B7U6"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7U6"
FT                   /inference="protein motif:PFAM:PF04023"
FT                   /protein_id="ACZ18349.1"
FT                   /translation="MKLLSDVPLGGVCRVSGFAQSGPVKTRVLQMGLVPGTVVEVMRPA
FT                   PMGDPMSVRFRGMEVSLRRQEASAVRVEMVSPCGGCAGCCGGCTI"
FT   gene            116866..118872
FT                   /locus_tag="Taci_0110"
FT   CDS_pept        116866..118872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0110"
FT                   /product="ferrous iron transport protein B"
FT                   /note="TIGRFAM: ferrous iron transport protein B; small
FT                   GTP-binding protein; PFAM: GTP-binding protein
FT                   HSR1-related; nucleoside recognition domain protein;
FT                   Ferrous iron transport protein B domain protein; Ferrous
FT                   iron transport B domain protein; KEGG: bcr:BCAH187_A4947
FT                   ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18350"
FT                   /db_xref="GOA:D1B7U7"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7U7"
FT                   /inference="protein motif:TFAM:TIGR00437"
FT                   /protein_id="ACZ18350.1"
FT                   /translation="MSAVWALAGNPNVGKTSLFNVLTGSRQKVGNWPGVTVERKEGRVR
FT                   LSRGEAVVVDLPGIYGLGATSVDEQIASQFISQEEVKGVILVLDASCLDRSLYLALQIR
FT                   ERGKPVLCALNMVDLAEKRGIRVDLKALEGALGVRVVPTVARTGQGVEDLLRCLEEESL
FT                   PGGTIQVDYGPELSTSLARLEGFLASHADKLPVSPQVGAVMAAEGDPRIWALLEDHREQ
FT                   LDQLVRRESLRLEEAMGMDLETALMERRWAMVSSIASRCVTFDPSAKASDSLDDRLDRI
FT                   FTNRFLGLPLFLLVAWGMFKLTFALGTPLADRLDELFGSLGEWAGGVLQSAGASEILMS
FT                   LVSDGIIGGIGSVLVFVPHIFILFALISVLEDSGYMARGAFVMDRVMRALGLHGKSFIP
FT                   MLLGFGCSVPAMMATRILDSPRDRKIALLSIPFISCSARLPVLVLFAGAFFPHAAGNVV
FT                   FGMYLLGMGVAILSAKLFSGTIFKGEPSQFIMELPPYRLPQPRAVIMSASTRAMAFVRK
FT                   AGTFILGTVILIWALANLPLGVEYASEESLIGRLGSAIAPLLEPLGFGFWQAGVSLVFG
FT                   FLAKEVVIGALGTVLGVGEEGLSSVLGGLFSPASALAFMVMTLLYVPCVAAMGTLYKES
FT                   GSLKWALFGAVYSTSVGYLAALLTYRLALVMGL"
FT   gene            118889..119575
FT                   /locus_tag="Taci_0111"
FT   CDS_pept        118889..119575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0111"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: metal dependent phosphohydrolase; TIGRFAM:
FT                   metal dependent phophohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18351"
FT                   /db_xref="GOA:D1B7U8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7U8"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ACZ18351.1"
FT                   /translation="MNLQTSTPELDQSPWGAWRQSDPFRRYPVMWLLDGNTRLHSIRVM
FT                   GIAVRIGRAAGLEGPRLETLSTAALLHDVGKVKVPEGVLLKGGVLNDHEKAMIQRHPVH
FT                   SAEILSSEGFDPEVVEAVRHHHERFDGRGYPDGLSGNRIPLLSRIIALADSFDAMTSHR
FT                   PYRRAMGVSQALGEIWHHRGDQFDPMLAELFVALFDERPLEGIPCDPHVPHRDLMHSVR
FT                   VHREAC"
FT   gene            119777..121642
FT                   /locus_tag="Taci_0112"
FT   CDS_pept        119777..121642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0112"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; KEGG: glo:Glov_2776 methyl-accepting
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18352"
FT                   /db_xref="GOA:D1B7U9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7U9"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACZ18352.1"
FT                   /translation="MIFFRSLGVRGRVLFLLGASLGALIAVGSLGCLSTRGVLSSMEAM
FT                   RSRCLDSVRELTRMEANLAKAKGNVYDLIFLDRTKEKDAVTADIAEWEVEQWSSQCREL
FT                   IDRFKGAPLDSFEAERLEALADAMKEWDSVRGMTLKLAKEGRRDEALVNFKEEELPAMS
FT                   KVLKGLEVLGDHRSELAGGISSRVARRAYRWSLLVALIAAGAFWGLLVLGLSLSNSISK
FT                   PLGGVMDAMDRLSRGDVAPSGDSLVDSPVPELSRLARGVANAVEQVRDSILEVRRCARE
FT                   LLDRSCEFTSLSERAGEGAARAAQGVDSLAERLEELMESSRCMAASVEELSQGVQRLSH
FT                   SCARMVRQSQEARSAGLLGAQMVQRLSQGLEGMASHAEGAAQRLEGLDRRASDIRGFVS
FT                   RIEELSDQTNLLALNAAIEAARAGDQGRGFAVVAEEVRKLAEETRGAAVTIAQLAQGIQ
FT                   GDVASVAEAANGSLHGCLASRDLAEQARGAIDTMMGLLEEMSSDTGELASVAERQATYS
FT                   QEMAATVRDMSAMAGQAFLESRRVRMEVQGLEEEANLVALGAREVEALSYALGEAVGRF
FT                   RVEPSLTQVDLEVDKPLEKDQGLVDMTPWVEKIPLEGYPSHVAAI"
FT   sig_peptide     119777..119872
FT                   /locus_tag="Taci_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.746 at
FT                   residue 32"
FT   gene            121683..122498
FT                   /locus_tag="Taci_0113"
FT   CDS_pept        121683..122498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0113"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase type
FT                   3; sucrose-6F-phosphate phosphohydrolase; KEGG:
FT                   vha:VIBHAR_02386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18353"
FT                   /db_xref="GOA:D1B7V0"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7V0"
FT                   /inference="protein motif:TFAM:TIGR01484"
FT                   /protein_id="ACZ18353.1"
FT                   /translation="MIRLLALDMDGTILDEGGVLPPRRAELLRELADEGIRITFVTGRM
FT                   FRSAVRYGEMVPLGAPLVAYNGAMIVDLMGVMWYHDPIPEEETRRVLGFFRDWGVYVQA
FT                   YNREELWVEEATSPASRYYARLSGVEPTQVGDDLYRGGFASTKILAVEEDPKRMEELIR
FT                   EARSSFPSLDFYTSKGQFLEVMLKGVNKGRSLEMLIYFLGIQKDQVLVMGDGDNDSHML
FT                   SSFPNSVAVAGASDLAKRSARFVVPQGAEPVEWIRDNVICGAEPCRCGG"
FT   gene            complement(122540..123205)
FT                   /locus_tag="Taci_0114"
FT   CDS_pept        complement(122540..123205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0114"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="KEGG: bha:BH1352 deoxyribose-phosphate aldolase;
FT                   TIGRFAM: deoxyribose-phosphate aldolase; PFAM:
FT                   deoxyribose-phosphate aldolase/phospho-2-
FT                   dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18354"
FT                   /db_xref="GOA:D1B7V1"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7V1"
FT                   /inference="protein motif:TFAM:TIGR00126"
FT                   /protein_id="ACZ18354.1"
FT                   /translation="MDRRELAAKIEHAFLKPDTDVNAIRRGISDSVEAGLGAVVLQPCH
FT                   VKMAANVTDGSRTKVVAVVGFPLGSTYTEAKVLETRMCVDDGADEIDMVMNLSLFASGS
FT                   YDQVQRDVEAVISSAQGRPVKVIIETALWDEGAIVKACQLARDSGASFVKTSTGFFGGA
FT                   EEWSVRLIRKTVGNRLGVKASGGIRDLSKMLAMLSAGADRIGTSSSLEILDQWDKRFR"
FT   gene            complement(123260..124489)
FT                   /locus_tag="Taci_0115"
FT   CDS_pept        complement(123260..124489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0115"
FT                   /product="Tetratricopeptide domain protein"
FT                   /note="SMART: Tetratricopeptide domain protein; KEGG:
FT                   noc:Noc_0511 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18355"
FT                   /db_xref="GOA:D1B7V2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7V2"
FT                   /inference="protein motif:SMART:SM00028"
FT                   /protein_id="ACZ18355.1"
FT                   /translation="MRQDQQRTEEPPLENPPPKEPRTVSKGTLGLIGLVMLMAFLGGGW
FT                   WHYRTKVLPERLFMEAEDLYRAGRYAEALPVYQRVYQLRPVRKDVVLRIALCQERLGRL
FT                   NDAMDSFDLQSRLDPKDPRPLLGKGRILLSLGRPEEALGPLKRAQKLSSSSPYSNRLLA
FT                   EAYRRVGSHDMAIKHLKLSAERDRDPERVLMDAKDLFQLKDFEGARWAFERTLELSPDH
FT                   RGARHGLDAANAMLGIPNDRNLLVVPGRSLGPVEIGMSRDQVLETLGEPNGSDGLDVSG
FT                   RAYEVWTYNSVTLKDQPGVKYPGLRILFDPTGTVVQVESSSDRYKTYDGIGTMSFMKDR
FT                   FKDRFEIWQENTHDHLGYRYCLKGGGLTLYVSDLGGVTDQGERRALVVHRGFLPVDDVS
FT                   PDLWVRVEPN"
FT   gene            complement(124656..124760)
FT                   /locus_tag="Taci_0116"
FT   CDS_pept        complement(124656..124760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18356"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7V3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18356.1"
FT                   /translation="MIFDPNYIIKMEMVLAGNAKIESDIYDLIRRVAM"
FT   gene            125030..125881
FT                   /locus_tag="Taci_0117"
FT   CDS_pept        125030..125881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dvm:DvMF_0998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18357"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016732"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7V4"
FT                   /inference="similar to AA sequence:KEGG:DvMF_0998"
FT                   /protein_id="ACZ18357.1"
FT                   /translation="MQDDYLALLDLTGSVTADHCFPVLFGWDQALEYRLMFHDGLCWIR
FT                   QERPRPVYLAPVGDWQGRDWERELALHLPLGAEVLSVPEELALEWGRQLGGRILLEEDR
FT                   DAFEYLHLTEDLAHLKGNRYMRKRNHVNRFARQFGYRYVEMTSGDLERIMDFQRRWCAA
FT                   RDCSGSFVLEGENRAIMRVLDNYQALRGLVGGYVEVGGSVVAYAIGEGRGDTLFVHFEK
FT                   GDPAYGSVYQVINREFALHNLGFKFLNREEDMGDPGLRDAKMSYLPMDFVRKHRAVLRP
FT                   GS"
FT   gene            125909..126427
FT                   /locus_tag="Taci_0118"
FT   CDS_pept        125909..126427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0118"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="TIGRFAM: intracellular protease, PfpI family; PFAM:
FT                   ThiJ/PfpI domain protein; KEGG: dvm:DvMF_0594 intracellular
FT                   protease, PfpI family"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18358"
FT                   /db_xref="GOA:D1B7V5"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7V5"
FT                   /inference="protein motif:TFAM:TIGR01382"
FT                   /protein_id="ACZ18358.1"
FT                   /translation="MDHKKVMLLVEDLYEEMELWYPKYRLEEAGYQPVVAGPEARKVYS
FT                   GKHGYPCRSDASVYDLKDQDFMGIVIPGGFAPDKLRRIPKVLELVRNFMASGKLVAHIC
FT                   HGGWICASAEVVSGFRLTSTPGIKDDLVHAGALWTDEPVVVDRNMVSSRRPDDLPLFMA
FT                   ECLKFLGTR"
FT   gene            126629..127828
FT                   /locus_tag="Taci_0119"
FT   CDS_pept        126629..127828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18359"
FT                   /db_xref="InterPro:IPR024258"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7V6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18359.1"
FT                   /translation="MRLRRLGWLALSALLVLWGASCALGAPKFHIGIATLTVSQAEDTL
FT                   RGAERMIQEYGDVAKGGMIKHITLPDNFMSEMETTISQIASFADDPLMKVVVVDDAIPG
FT                   TTEAFRRIKEKRPDILCLAGEPQEDPGVISSVADFAIGVDNIARGYLIIHTAKQLGAKT
FT                   FVHISFPRHMSYELLSRRRAIMEAACKDLGLKFAFETAPDPTSDVGVAGAQQFILEKVP
FT                   AWVKKYGKDTAFFCTNDAQTEPLLKQVAAYGAIFVEPDLPSPIMGYPGAFGIDLSKEKG
FT                   NWPAILKKVEAAVIKAGGKGRMGTWAYSYGWSTVCALAEYGKRIVEKKAKLGNLEDLWK
FT                   CYDRYTPGAKWNGQLYRDVNTGVKMKNFVLVYQDTYVFGRGFMNVTSVKVPEKYFKIKK
FT                   "
FT   sig_peptide     126629..126706
FT                   /locus_tag="Taci_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.888 at
FT                   residue 26"
FT   gene            128023..129216
FT                   /locus_tag="Taci_0120"
FT   CDS_pept        128023..129216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18360"
FT                   /db_xref="InterPro:IPR024258"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7V7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18360.1"
FT                   /translation="MRKRLLVALAVAALGALLALPAFGAAKFHIGVVTGTVSQSEDDLR
FT                   GAERLIKEYGDVAKGGMIKHLTYPDNFMSEMETTISQIVGLADDPLMKVIVVNQAIPGT
FT                   TEAFRRVKEKRPDILCFAGEPHEDPGVIESAADLAINADNVARGYLIIAAAKKMGANAF
FT                   VHISFPRHMSYELLSRRRNIMEAACKDLGLKFAFETAPDPTSDVGVAGAQQFILEKVPA
FT                   WVKKYGKNAAFFCTNDAQTEPLLKQVAAYGGYFVEADLPSPLMGYPGAFGIDLSKEKGN
FT                   WPAILKKVEAAVIKAGGKGRMGTWAYSYGYATTAALGEFGKRIVEKKAKLSDFKALMAC
FT                   YAKYTPGAQWNGSYYVDMGTGVKKKNHVLVYQDTYVFGKGYLGMTSVKVPEKYFKIK"
FT   sig_peptide     128023..128097
FT                   /locus_tag="Taci_0120"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            129354..130973
FT                   /locus_tag="Taci_0121"
FT   CDS_pept        129354..130973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0121"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: aha:AHA_2310 D-ribose transporter ATP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18361"
FT                   /db_xref="GOA:D1B7V8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7V8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ18361.1"
FT                   /translation="MASNEPILRLEHVGKEYFGNRVLSDVSFTLGPGEIMGLVGENGAG
FT                   KTTLMKILFGMPVIHQTGGYDGKIFFEGREVSFKSPFEALDAGIGMVHQEFSLIPGFTA
FT                   TENILLNRESTRYNLLVEVFDDRLRTLDRPVMRQRAQRAISTLGVEIDPDTLCSEMPVG
FT                   HKQFTEIAREIDRSNTKLLVLDEPTAVLTESEAEILIKAVRNLAAKGMSVIFISHRLQE
FT                   VIDLCDKIVVLRDGHVVQEAKTCDVTVRQIAGWMVGRKVEESHREEGEVRSFGPTILSV
FT                   RNLWVDMPGETVRDVSFQVRQGEIFGIGGLAGQGKLGIANGIMGLYPAGGAVELNGKPI
FT                   RLNDPEGSLRAGMAFVSEDRRGVGLLLDEGIDWNMAFTAMQIQEKFIRPLLGGLVKWRD
FT                   DRAIEECANEYIKALEIKCTGPKQRAVELSGGNQQKVCLAKAFVVRPEVLFVSEPTRGI
FT                   DVGAKKLVLDTLRRYNREYGTTIVMTSSELEELRSICDRIAIVDEGRIAGVLPAQAPSE
FT                   EFGLLMMGEIKVSTEEKVKACE"
FT   gene            130966..132012
FT                   /locus_tag="Taci_0122"
FT   CDS_pept        130966..132012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0122"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: sugar ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18362"
FT                   /db_xref="GOA:D1B7V9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7V9"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACZ18362.1"
FT                   /translation="MNDKLRSFIEAAGWPRVIIGLFLLSLFVAAPFVGVRVDTSLSDTL
FT                   VRVGMNGVMVLALVPMVQSGCGLNFGLPLGIIAGLVGAVTSIEMDVRGLPGFLVAMAIA
FT                   IALAVVLGYAYGLLLNRVKGDEMMIATYVGFSSVALMCMAWLLLPYKSPNMIWGYGGSG
FT                   LRTTISVQGYWLKVLSDFMSFNVGPYFYFPTGMFLFFALMCFLMWAFFKTKTGTAMTAV
FT                   GSNPEFARACGIDVDRMRIVSVVLSTVFGAIGILVYQQSFGFIQLYMGPFYMAFPAVAA
FT                   ILLGGASVNKASLLNVIVGTFLFQGILTMTPSVINSIMQTDMSEVIRIIVSNGMILYAL
FT                   TRKVQVKR"
FT   gene            132009..133112
FT                   /locus_tag="Taci_0123"
FT   CDS_pept        132009..133112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0123"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: scl:sce4028
FT                   ribose ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18363"
FT                   /db_xref="GOA:D1B7W0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7W0"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACZ18363.1"
FT                   /translation="MKDANVKEKIQRLLISNAVPIIFVLLSAVAIPLSGFTPQYLIQEM
FT                   MTRVARNSFLVLSLLIPILAGMGLNFGMVLGAMAGQIGLILISDWSVSGLPGMLLAALI
FT                   ATPIAVFLGWICGTVLNRAKGREMVTSYILGFFINGLYQLAVLYGMGKLIPIRKAELVL
FT                   SRGYGIRNAINLQGIRHCLDDLIPLKIGDMSVPLATYLVIAAFCLFILWFQRTKLGQDM
FT                   RAIGQDMAVADSAGIPVERTRIIAIIISTVLACYGQIIFLQNIGTMNTYNSHDQAGMFA
FT                   IAALLIGGATVARATIGNVFLGVVLFHLMFVVSPMAGKQLIGQAQLGEYFRVFVSYGII
FT                   AISLALHAWKRQKDRERARRSLRGQAA"
FT   gene            133127..133513
FT                   /locus_tag="Taci_0124"
FT   CDS_pept        133127..133513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18364"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7W1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18364.1"
FT                   /translation="MTRRNAVRLALLAALVALGALLFLLGKEHQLFIDNQNVTVSGRDL
FT                   APIESLRVSVAGGEPMEFMADDRDVTVVRGPRASIRVEVLDQDGKVLKTVDASLSFSFE
FT                   DRAMISLPALVEGLPYRLEPPGAQ"
FT   sig_peptide     133127..133207
FT                   /locus_tag="Taci_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.725 at
FT                   residue 27"
FT   gene            complement(133612..134490)
FT                   /locus_tag="Taci_0125"
FT   CDS_pept        complement(133612..134490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0125"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; KEGG: cvi:CV_1912
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18365"
FT                   /db_xref="GOA:D1B7W2"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7W2"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACZ18365.1"
FT                   /translation="MARGFAHMTDMKIGFIGGGDGALKIMRHLMRLGFKIAGVVDLSDD
FT                   APAMREARANHIPTYKRMEDLLSKPLDLVIEVTGRDSVAKEAEEKKSPRTGLLRSGDAR
FT                   FMYEIIAREEENSKVIRRQIEEIASLRRRLEEVLEPLKEAFEGLASGNKDVEATMRPML
FT                   DSMDKLSQQTQRSDELVGTIHAIARQTKMLGLNAAIEAARAGELGKGFAVVADEVRKLA
FT                   EQTTASVQEVGDVLTDIASIAKTLAEPIQQFSQVAEKRVKAIEGLKGKVETLSSMIRSA
FT                   QEVEQRLEKLL"
FT   gene            134561..135076
FT                   /locus_tag="Taci_0126"
FT   CDS_pept        134561..135076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0126"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="KEGG: gme:Gmet_1573 cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase; TIGRFAM: cob(I)alamin
FT                   adenosyltransferase; PFAM: ATP:corrinoid
FT                   adenosyltransferase BtuR/CobO/CobP"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18366"
FT                   /db_xref="GOA:D1B7W3"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7W3"
FT                   /inference="protein motif:TFAM:TIGR00708"
FT                   /protein_id="ACZ18366.1"
FT                   /translation="MGMVQVYTGNGKGKTTAAIGLAVRAVGHRMRVKMIQFLKGWDFYG
FT                   EIEGTQGLPGFELVRTGTPDYVPKGGARPIDHQEARRGLELAREALSSGEYQLVILDEI
FT                   NVAMDYGLVPVEDVLEAIANRHPDTEVVLTGRYAPEEVLEVADLVTEMREVKHPYQRGI
FT                   KARQGVEY"
FT   gene            complement(135109..135879)
FT                   /locus_tag="Taci_0127"
FT   CDS_pept        complement(135109..135879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0127"
FT                   /product="Dimethylargininase"
FT                   /EC_number="3.5.3.18"
FT                   /note="PFAM: amidinotransferase; KEGG: pap:PSPA7_4183
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18367"
FT                   /db_xref="GOA:D1B7W4"
FT                   /db_xref="InterPro:IPR033199"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7W4"
FT                   /inference="protein motif:PRIAM:3.5.3.18"
FT                   /protein_id="ACZ18367.1"
FT                   /translation="MFKNVIARRPGTSITEGITSAPELGKPDHQLALRQHQAYCQALES
FT                   CGVQVTVLPPLEEYPDSCFVEDTAVLTTRCAVITNPGAPSRRGEVDHMVDVIRSFYPAD
FT                   RVEFIRDPGTLEGGDVMMVGDTFYVGLSARTNREGIEQFARILGRNGFKVRAVPLSQVL
FT                   HLKTGVNYLEGGNLLVSGEFVDHPEFASFNRIVVPPEEAYGANCIWVNGTVIVPQGYPT
FT                   VEAQVRDLGYRVILVDTSEFRKIDGGLSCLSLRF"
FT   gene            complement(135947..137407)
FT                   /locus_tag="Taci_0128"
FT   CDS_pept        complement(135947..137407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0128"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: pmr:PMI2114 sodium:alanine
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18368"
FT                   /db_xref="GOA:D1B7W5"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7W5"
FT                   /inference="protein motif:TFAM:TIGR00835"
FT                   /protein_id="ACZ18368.1"
FT                   /translation="MSFVDLVSVIVWDYLWGMPLVLTILGVGAYLTIRSGFFQVVGFRS
FT                   AMGYALRSVLGREGDRGKGLLSSAEAMSAALGTTIGVGNIGGVATAIATGGPGAVFWMW
FT                   VAGLVGMVIKMAEITLAVHYRSTDHRGETYGGPNYYMRRGIGEEMGKRGLFKVLSGIFA
FT                   FGFLTSYFINIQTYTVSEAVGNTFGLSMTWVGVVYTVFLYGMISGGLKGLGRIASWLVP
FT                   FMCVFYLAAGVFIIVRNLPAIPGALGLIVSSAFNGTAAVGGFAGAAVAQAMKVGFSRSV
FT                   FSNEAGWGSAPMIHATARVDHPVKQGLMGIFEVFVDTFVICTITCLVIVATGTWSSGQD
FT                   GATLTLSAFEMSIGSYGRYVLALAVFIFGLTTSGGVYAQIEVVLRYLLDESPLKDRLLW
FT                   LYKWTYPLPSLAMVYIAVRYGLPGTLVWVFSDASTALPIFANVVALFFLSNRFLALLKD
FT                   YRARHMGEVTHREAPVPLFFEGGQGEEA"
FT   gene            137562..138041
FT                   /locus_tag="Taci_0129"
FT   CDS_pept        137562..138041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0129"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18369"
FT                   /db_xref="GOA:D1B7W6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7W6"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACZ18369.1"
FT                   /translation="MSGDSDRLLDETGWRILEELQENCRISYKELGRRVGLSTPAVIER
FT                   VRRMEEAGIIEGYRAVVNPRRVGYSFRVMLAMSSIYSNPDDPIMRALEELPEVIRCWSV
FT                   TGSNDFYMEALIPSMEFLEALLTRMSRHGRIVTSVVLPNLGGSGSGRVTRPREGL"
FT   gene            complement(138084..139994)
FT                   /locus_tag="Taci_0130"
FT   CDS_pept        complement(138084..139994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0130"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: bsu:BSU00060 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18370"
FT                   /db_xref="GOA:D1B7W7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7W7"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACZ18370.1"
FT                   /translation="MNAPVSQYTAKDIQVLEGLSAVRKRPGMYIGDQGQRGLHHLVYEV
FT                   VDNAIDEAMAGFCDTVQVTVHPDGSVSVEDNGRGIPTEMHPTMGRPAAEVVLTVLHAGA
FT                   KFDKKAYQVSGGLHGVGVSVVNALSEWLEVTIWRNGKEHRQSYRRGVPVTDLIAGEDTD
FT                   RRGTKVHFMPDGEIFSTLEFSADTLIGRLRELAFLNPGVTIVFRDLRQDPPMERKLHFE
FT                   GGIRSFVEYLNRGKEVLFSPPMVVKGEKDGVIVEVALQYNDTYLERIFAFANLINTVEG
FT                   GTHVSGFRTALTRLINDQARKEKLLKDKDPNFTGDDLKEGLTAVISVKLLEPQFEGQTK
FT                   TKLGNGDVKGIVDSVVYEGLKVILEDQPQILRPVVEKAVKARQAREAAKKARDLVRRKS
FT                   AMSGMDLPGKLADCSNRRPEECELYIVEGDSAGGSAKMGRDRSFQAILPLRGKILNVEK
FT                   ARLDKILSNDQVRTIIQALGCGVGDEFDYSKLRYHKIFLMADADVDGAHIRTLLLTLFF
FT                   RYMPQIIENGHLYVAQPPLYRVQEGKNVHYCYSDRELKEIMQRLSGRKASVQRYKGLGE
FT                   MNPEQLWETTMDPANRVIKRVEIEDAVLADELFSVLMGDAVEPRREFIEAHAKEVRNLD
FT                   V"
FT   gene            complement(139991..140224)
FT                   /locus_tag="Taci_0131"
FT   CDS_pept        complement(139991..140224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18371"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7W8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18371.1"
FT                   /translation="MFLSLGSGELVSARRVVAMVRDGNRTYVHLDDMSALASNLLPASI
FT                   LARSRALLGLEGSSSGKDTTKEANMEKKERME"
FT   gene            140289..141413
FT                   /locus_tag="Taci_0132"
FT   CDS_pept        140289..141413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0132"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_01565 lipid-A-disaccharide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18372"
FT                   /db_xref="GOA:D1B7W9"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7W9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18372.1"
FT                   /translation="MRYQVYMVVNSPGEMAGWARPVALELTRRGCSVSLVIPPCQYASG
FT                   GEEDLCAAMGYRSYRLGRFILDRPWLADPSVPARLLRLGWDLKLTALLGSAGGLVTDAY
FT                   VGAPRTARGVRTYLTPDWAGRDVLASRGVNAVRVGYPIFDLPLKTRRFHAPRPVVFMVG
FT                   SRPFEALHALPFMVEAAWTMAQTDPGVLPVFPLARTLDPDVMGRLLASLGEVDRPQRPG
FT                   LLAYRGVPMAITWDGSLPEGAFLWVALPGTNNLEAVSLGVPLLVLLPLNRAWEIPLDGI
FT                   LGMIPAHLPGLRGLKKWLISRAALRLPHVSLPNRILGRRLVPEMVGDLEPRQVARRALE
FT                   IMGSPLGEEMRRAFLQIRRENLGASRRIAQVVTS"
FT   gene            complement(141403..143073)
FT                   /locus_tag="Taci_0133"
FT   CDS_pept        complement(141403..143073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0133"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   chemotaxis sensory transducer; SMART: extracellular
FT                   solute-binding protein family 3; chemotaxis sensory
FT                   transducer; KEGG: gsu:GSU1300 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18373"
FT                   /db_xref="GOA:D1B7X0"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7X0"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACZ18373.1"
FT                   /translation="MIPGSKEVPGGAASAAEALEHMELGLDDLEGAVEALKGSIGSIEE
FT                   EASAVARAGAEVNAHARRMTEELMRNASAAREAMEVMERALKIGTAVQEDAQRSRGMLD
FT                   ETNRAVMAMVSSAQGVADSIQRMTKVLQDISEITGHITAIAKQTKLLSLNASIEAERAG
FT                   EHGKGFGVVAAEVRKLAQRTDEAASKISQLASSSRAIGDEASSSIAQAVGLSTQASERT
FT                   QATMEALETMFQSILTVAEALRSGAKTASQQSRSASELAEMSQAMAQRTDEQASMLTTV
FT                   DGKVKENRIVMDLLPQRILDSSRHLESLKGALCGDDHGEPSVASIRQRGEVLMGIEADD
FT                   FGKFHWWEGRIPKGLDVDLGEAIARELAVPARWVAIPWGNGERGTVTGTWTLGDFDGFH
FT                   FLCTTVTKLPERLRHVTFSRCYFKSGQSVVVPRASGIRAIGDLKGRRVAVTSGSTSEAA
FT                   ARRHLKESKIVPFPTGVQEANALANGEVDAMVLDRPVAWDHLERHPEWTELGISLSVES
FT                   FAVTMPKGTSPALKALIDQVVIRERDRLFSKYFANRVRR"
FT   gene            143236..143799
FT                   /locus_tag="Taci_0134"
FT   CDS_pept        143236..143799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18374"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7X1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18374.1"
FT                   /translation="MKKVRLGGWMGLLCALALVLALSTGALAAPVALTSVGQSPDAMMV
FT                   KVLLKKAGLDSDYEATMKASQLSKEHKVLVAVVGGSMKGLGAAGINKEQERDRVKDLLG
FT                   AARSKGVKVLVMHVGGKGRRGELTDFLMGVAFPAADAAMVVKGGNDDGLVDKLVPKGVK
FT                   VQQVETIQAVSDPLKAKLAAWGVK"
FT   sig_peptide     143236..143322
FT                   /locus_tag="Taci_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 29"
FT   gene            143807..145096
FT                   /locus_tag="Taci_0135"
FT   CDS_pept        143807..145096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0135"
FT                   /product="TRAP C4-dicarboxylate transport system permease
FT                   DctM subunit"
FT                   /note="PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; Citrate transporter; KEGG:
FT                   bcs:BCAN_A1214 TRAP transporter, 4TM/12TM fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18375"
FT                   /db_xref="GOA:D1B7X2"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7X2"
FT                   /inference="protein motif:PFAM:PF06808"
FT                   /protein_id="ACZ18375.1"
FT                   /translation="MGNWFWPEGALTVLMVGAFILGAFKLKLPISLALGLASVVGAVAS
FT                   GAGLPVRHLVEGMFGYLDTILIIAFAMIFMKSVQGCGLLNSLAAWVIRRFARRPVLLCL
FT                   SITLLVMLPGMITGSSTAGCLTTGALVAPVLVRLGVPRAKVAAAIAMGAIYGMIAPPID
FT                   IPVMIIGGGIDMPYVGFGLPLLLATVPLAILSSLWLLLPHLKRVTLGGQMEEELRRMEE
FT                   VPLKGSLFLPFLVLLVLMGAERLFKSPLLSLGMPLQFLLAAASAFAVGKPMRPLEVARE
FT                   AIRDALPVLGILMGVGMFIQVMTLTGVRGFVVVSCLAVPAALLYPVMGISIPLFGAVSA
FT                   FGAASVLGVPFVLALLGKDQIVVAGALALLSGLGDLMPPTALAGIFAAQVTDEEDYFKV
FT                   LRHCVVPGVVTALWGLGMIALANPIASLLR"
FT   gene            145111..145254
FT                   /locus_tag="Taci_0136"
FT   CDS_pept        145111..145254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18376"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7X3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18376.1"
FT                   /translation="MTWIYMGLVALVLFLVVDRCLRDRDPMTQATAAMVAIPLVLRLLR
FT                   VK"
FT   gene            145264..146394
FT                   /locus_tag="Taci_0137"
FT   CDS_pept        145264..146394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0137"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: wsu:WS0783 putative
FT                   periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18377"
FT                   /db_xref="GOA:D1B7X4"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7X4"
FT                   /inference="protein motif:PFAM:PF04952"
FT                   /protein_id="ACZ18377.1"
FT                   /translation="MMGKERRSALLMLALAAAVCLWASRDFLAMRERDRVFPAPGFRVE
FT                   MLSSYLPDLKGTGMDTEVYVQEGPEKGGTVFVLGGTHPNEPAGYLAAVLLVENAKVRRG
FT                   RLMVVPFGNASGFTHNQPQEASPNRLTFQLDDGSMRTFRYGSRDVSPLVMWPVPDVYVH
FT                   KPSGQSLSGNESRNLNRSYPGDPDGSPAERLGFAIMELLRREEVSVAFDLHEASPEYPV
FT                   VDAIVAHEKGMEVAAAAAMDLKLEGIEMRLEPSPKNLRGLSHREWGDGTGAVPFLIETA
FT                   NPSQGRLRGRTDERLVKTGLDKAYLKASSLGRLFVPYDQGGKPLDERVGRQLATLSALV
FT                   SAFSMFDQDRGVEIRGIPSYQDVMSRGIGHFLRSGR"
FT   sig_peptide     145264..145335
FT                   /locus_tag="Taci_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.961 at
FT                   residue 24"
FT   gene            146428..148140
FT                   /locus_tag="Taci_0138"
FT   CDS_pept        146428..148140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0138"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="KEGG: vei:Veis_3445 gamma-glutamyltransferase;
FT                   TIGRFAM: gamma-glutamyltransferase; PFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18378"
FT                   /db_xref="GOA:D1B7X5"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7X5"
FT                   /inference="protein motif:TFAM:TIGR00066"
FT                   /protein_id="ACZ18378.1"
FT                   /translation="MKFKSGFLALVMVLVLGVGTLWAGQGDVYARNGMVSSAHELASRA
FT                   GVEILKRGGNAVDAAVAVALALNVVEPNASGMGGGGFMTIRTADGKTVVVDYRETAPLS
FT                   STKDMFASEEAKKGKWSIRGGKSVAVPGFVAGMFHVLERYGTMSFAQVAQPAIDLAEKG
FT                   FKLHPMQNQIITDEYEKLATYNDPAKVPFFKDGMPMPAGEVLTQPDLAKTLRILSKEGK
FT                   GAFYGGPIGEALVRAVNASGGKMSMEDLKAYRVVERKPVFGTYRGYRIYSTPPASSGGT
FT                   HVAELLNILENFPMRDLKHNSASYLHVMAEAMKLIYADRAKYMADTAFVKVPIQGLTSK
FT                   AYAAKQAQRIDFKKVAKEVVPGDPWPFDRGMASYRADGIDERISTSSFSVADKMGNIVA
FT                   ATNTINYFFGSGVMVPGYGIVLNDEMDDFSWDPKSVNAPEPGKRPLSSMSPTVVLTPEG
FT                   KPFMSVGAAGATRIITAVSQIIMNVVDFGMSMDDAIEQARIYNLVSGSKAGNLFAEEGI
FT                   DPMALEVLGIKGHTVELKPKAGAFGTAQGILFDPVKGLNGGADSRRLGVPVGF"
FT   sig_peptide     146428..146499
FT                   /locus_tag="Taci_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            148196..149530
FT                   /locus_tag="Taci_0139"
FT   CDS_pept        148196..149530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0139"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; KEGG: pap:PSPA7_5943
FT                   two-component sensor EnvZ"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18379"
FT                   /db_xref="GOA:D1B7X6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7X6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACZ18379.1"
FT                   /translation="MADIPIRIRRPISLWVGMGLILFWALSLRMGASWILEALDRASRG
FT                   LSVGDLALGALRLVAINSGRALMLYGGWFALGLSLKGGIRSLWGFVVILLGVPLSYGVS
FT                   WGLMGGPGLHFGTSALASLVAVLVLRWLTQGLKGWLDRLIVMALLVLAIQWLDICPSLT
FT                   PYGFGGGELSMGLKAMASVMGEGVLFDWIGFLGFALSLVGAVGSASITMGKVLQERQFR
FT                   LIRSQERRMAQLREEGRRARVFRELQGLVHDLRRPLTVIMGLGDVLMAERPGDERLVRM
FT                   MASAEGMDRMIREILSGDAAGEVRLRDLYDLVLSQVSPMPYRGRIFEAGDEAVGGLVIR
FT                   ANLMRLARALTNLLDNAANAYDGPVEFGGRRVDRGVELFVLDRGPGFGVQGQEVRFGTG
FT                   LTFVEQVARDHGGSFQVRTPEGGGCEAVIFLPLVEVDGDAADRGP"
FT   gene            149508..150137
FT                   /locus_tag="Taci_0140"
FT   CDS_pept        149508..150137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0140"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: eli:ELI_02135 two-component
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18380"
FT                   /db_xref="GOA:D1B7X7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7X7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACZ18380.1"
FT                   /translation="MLRIGALDDDENILFTLSSMAESQGWEMETTTSCDRFLRWVRDGA
FT                   KDIYLLDYHLPRMSGLEVLRQAKALRPNAVVAMLTIEQDPVTARTLISAGADDFIAKPI
FT                   RLADFCARVNLLRRVGLSAGSSWRERKGLSEGRIRRAMEILEGAGGRWVTVEEMASLMG
FT                   LAYATAHRYMEHLAMKGLVEREEALSDGRPGRPRVLYRIPSGPQGR"
FT   gene            150230..152680
FT                   /locus_tag="Taci_0141"
FT   CDS_pept        150230..152680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0141"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase; cobalamin
FT                   B12-binding domain protein; Methionine synthase B12-
FT                   binding module cap domain protein; dihydropteroate synthase
FT                   DHPS; KEGG: gsu:GSU2921 5-methyltetrahydrofolate-
FT                   homocysteine methyltransferase, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18381"
FT                   /db_xref="GOA:D1B7X8"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7X8"
FT                   /inference="protein motif:PFAM:PF02574"
FT                   /protein_id="ACZ18381.1"
FT                   /translation="MLLDRGRVRSLLGEVRSPLVMDGGMGTQLAERGWHPPMLPEEMCL
FT                   HMPQAVREVHESYVESGAAVLETNSFGGSVRKLSMRGLGHLAEELALRSAQIARQAAGD
FT                   ALVAGSVGPTGEMLAPLGEMSFEEAVKSFEPQVRGLIRGGADLILIETMLDLKEAAAAV
FT                   EAVKRVDPLFPFVVSFTFDRDGRTVTGTTPEAAACWAQAVGALGVGANCGLGPRGYVPV
FT                   VRRLAEASPLPVWVYPNAGVPSAGDYLGPDEFVGECEELLKAGASVIGGCCGTTPDHVR
FT                   ALAALARGRRVTRLHCDLGGVRLSSRSRVISAGAGLPLAMIGERINVSRKSPLREQVGE
FT                   YRYGEVKREAKAQTVAGAAVIDVNVGLPQIDQVRAIREAIWAVESVTHLPISIDSDAPA
FT                   VLEAGLAEAVGVPLMNSVTAKEESLELGIRLALRYGAVLAVLLIDQRGILEDGLERARI
FT                   AQRVLDVASSRGLGPNRIVFDPLTLTLGASQSNGLETLRAVEAVSRMGGHTMLGISNVS
FT                   HGLPARGLLNRTFLAMAMERGLDMVICNPLDRELLGVVRAADALRGRDRGLGAFMAFGP
FT                   SWREPERGAVQAAEASAGEVCSGLSELSRRVMEGDRDGALAEALTVMAQEGPMEVISGH
FT                   LIPALDEVGRRYETGEFFLPQLMEAAEAASAVCRLAEEELLRLGRSANRGTVVLATVEG
FT                   DLHDLGKNLVGTVLKSHGYRVVDLGKDVKAEVILEAAQREGAQVVGLSALMTSTVPRMR
FT                   EFIEEARRRGAGFKVIVGGAAVSPAYARSIGADGMSYDAVGAARLVERLLSGLPCDWEG
FT                   LGCS"
FT   gene            152671..153567
FT                   /locus_tag="Taci_0142"
FT   CDS_pept        152671..153567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0142"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="KEGG: afw:Anae109_2667 5,10-
FT                   methylenetetrahydrofolate reductase; TIGRFAM:
FT                   5,10-methylenetetrahydrofolate reductase; PFAM:
FT                   methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18382"
FT                   /db_xref="GOA:D1B7X9"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7X9"
FT                   /inference="protein motif:TFAM:TIGR00676"
FT                   /protein_id="ACZ18382.1"
FT                   /translation="MFIRELFGRGRPVISFEIFPPRGGVPVEEVYRTLGAIKDLAPDFV
FT                   SVTYGAGGSTRDATLEIASTVKNRFGLEVMAHCTGLCHTPPEVHEMVEDLMYEGVHNLL
FT                   AMRGDPPRDRHVPEGPSFPHGSDLIGYLRRAFGDEVCIAAAAYPEGHVEARDMEEDLAF
FT                   LKLKVDMGAELLITQLFFDNEIFYRFLESIGRLGIRVPVCAGIFPVLNARQVERIVSLC
FT                   GVSFPPKFTRMVARYADDPASLAEAGVAYATEQIVDLLAFGVDGIHIYTMNRPDTTRRI
FT                   MNNIGLVSRRAVAGSGD"
FT   gene            153756..154037
FT                   /locus_tag="Taci_0143"
FT   CDS_pept        153756..154037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0143"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_0843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18383"
FT                   /db_xref="InterPro:IPR023860"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Y0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18383.1"
FT                   /translation="MTVSGGSRLGVVAIVVEDLEMVHRVNSVLHEHAQIVVGRMGIPYR
FT                   DRGVSVISLIVDGSNEEISAMTGKLGRISGVSVKAAYAKLRDAGEGIG"
FT   gene            154034..155092
FT                   /locus_tag="Taci_0144"
FT   CDS_pept        154034..155092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0144"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: sfu:Sfum_0841 biotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18384"
FT                   /db_xref="GOA:D1B7Y1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024021"
FT                   /db_xref="InterPro:IPR034422"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Y1"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACZ18384.1"
FT                   /translation="MSLVRDEVEIRELVSSMVGGYLPTMDEMEFLLSLDWEGAQVLLEG
FT                   ARKVKEELFGPEVHIRGIIEFSSHCSGRCLYCGLRADNRDLARYRMEEEEIVRCAEEAI
FT                   GAGYMSLVLQSGEDGWYDRWTLGRVIERIKGIKDVAITLSIGERSYEDYRYLRQAGADR
FT                   FLMKHETADQGLYDRLHPHSSFRRRLECLTQLKELGYQVGSGFMVGLPGQTLRSIARDV
FT                   LLLKKLDVDMAGIGPFVPHPRTPLGDQPAGDPFLVLKTVALARLLLRRPHLPATTALGV
FT                   LDRRMRDWAFHGGANVVMQKLEPHRYRRLYDIYPKGVGEERSIAEEREELERALESMGL
FT                   RVARDRGDAVRV"
FT   gene            155141..156568
FT                   /locus_tag="Taci_0145"
FT   CDS_pept        155141..156568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0145"
FT                   /product="biotin and thiamin synthesis associated"
FT                   /note="PFAM: biotin and thiamin synthesis associated;
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; KEGG: sfu:Sfum_0842 thiamine biosynthesis
FT                   protein ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18385"
FT                   /db_xref="GOA:D1B7Y2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024007"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Y2"
FT                   /inference="protein motif:PFAM:PF06968"
FT                   /protein_id="ACZ18385.1"
FT                   /translation="MGVLSARALDTADFIDHGRITEVLEAARSRAGDVGYLREVLAKAR
FT                   QAKGLDPQEAAALLSVQDPAMEDEMFSLAREVKERIYGRRIVLFAPLYVSNHCVNDCSY
FT                   CGYKCSNRGFERRRLTMEELAEEVRILEGLGHKRLALEAGEDPVNCPLDYILDCIGTIY
FT                   SLKFDNGSIRRVNVNIAATTVEEYRRLKEAGIGTYVLFQETYHRPTYRALHPRGPKSSY
FT                   DYHTTAMDRAMEAGIDDVGLGVLYGLYDHVYDTVAMLFHARHLEERFGVGPHTISVPRL
FT                   RRAHGVDVSAFQLVDDEAFKRLVAVIRLAVPYTGMILSTREDAEFRDQVISLGISQISA
FT                   GSCTGVGGYADHYGRRAEDEKPQFEVGDHRSPMEIIKSLMRGGYIPSYCTACYREGRTG
FT                   DRFMSLAKSGQIGNVCQPNALLTLKEFLLDYGDEEAREIGERLIEREVNEIPHPRAREA
FT                   ALEMLRRVESGDRDLRF"
FT   gene            156584..157780
FT                   /locus_tag="Taci_0146"
FT   CDS_pept        156584..157780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0146"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; Miro domain protein;
FT                   KEGG: ppd:Ppro_1494 small GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18386"
FT                   /db_xref="GOA:D1B7Y3"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023873"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040644"
FT                   /db_xref="InterPro:IPR041606"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Y3"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ACZ18386.1"
FT                   /translation="MDTPKANRLHIAIFGRRNAGKSSLINALTGQDAALVSSEPGTTTD
FT                   PVMKAMELLPIGPVVFIDTAGIDDQGELGQLRVERTRRVLDRTDLALLVVSPPVTDLSM
FT                   EEGWLAELRGRGIPVVGVFNKSDQGELPVQWVSGRLGLRLTPVSALTGDGIQELKAAIQ
FT                   EAVPEGWEMRTILGDLMEAEDLVLLVAPQDVQAPKGRLILPQVQVMRDVLDHDGVAMMV
FT                   KTGELRGAMELLEAAGRRPDLVVTDSQVFHLVKDLVGPDVRLTSFSILMARYKGDLRTL
FT                   VEGARAVDRLVDGDVVLIAEACTHHPLEGDIGREKLPALISEMSRARLEFRVVAGNDFP
FT                   RDLKGFSLVVHCGGCMLNRKHMMSRIMAARSQGVPITNYGVLFAKRSGILDRAVVGLI"
FT   gene            158005..158529
FT                   /locus_tag="Taci_0147"
FT   CDS_pept        158005..158529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0147"
FT                   /product="NADH dehydrogenase (ubiquinone) 24 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone) 24 kDa
FT                   subunit; KEGG: pca:Pcar_1846 NADP-reducing hydrogenase
FT                   chain A"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18387"
FT                   /db_xref="GOA:D1B7Y4"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR028431"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Y4"
FT                   /inference="protein motif:PFAM:PF01257"
FT                   /protein_id="ACZ18387.1"
FT                   /translation="MSCCCCGKENGQQFRELEEFIDKLPNKKGELITVLHKAQEIFGYL
FT                   PEEVQAFVARKLEIPLAKVYGVVTFYSFFTMEPKGKVAVSVCMGTACYVRGAEDVLHEL
FT                   EKAMGVKAGKVSEDGYFSLDTLRCVGACGLAPVVIVNGRVFGRVTPADVPGIVDQYRPK
FT                   VAGSEVNTCNV"
FT   gene            158522..158926
FT                   /locus_tag="Taci_0148"
FT   CDS_pept        158522..158926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0148"
FT                   /product="NADP-reducing hydrogenase chain B"
FT                   /note="KEGG: pca:Pcar_1845 NADP-reducing hydrogenase chain
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18388"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Y5"
FT                   /inference="similar to AA sequence:KEGG:Pcar_1845"
FT                   /protein_id="ACZ18388.1"
FT                   /translation="MSNKIKSLDELRKIKQSVKEGTELREKGQDIDKMIEVKVSMATCG
FT                   IASGAREVMAEMIEEAKRRGLSNVVFTQSGCMGFCHSEPTIMIVRPGEEPVLYGNVKGT
FT                   ERIKEIFDHVIEKGEMVDGMIPTSYRTSHE"
FT   gene            158942..160732
FT                   /locus_tag="Taci_0149"
FT   CDS_pept        158942..160732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0149"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase domain 51
FT                   kDa subunit; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: ppd:Ppro_3516 NADH dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18389"
FT                   /db_xref="GOA:D1B7Y6"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Y6"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ACZ18389.1"
FT                   /translation="MAVKMHILVCGGTGCISSQSDRLAEALKEALAKRGLAEEVKVVLS
FT                   GCFGFCEQGPIVKVAPDNTFYVKVTPEDADEIVAEHILKGRKVTRLLYKDPKTAHEVSD
FT                   SKHMDFYKKQMRIALRNCGFIDPENVNEYIARDGYEALGKVLTSMKPQDVIAEVKKSGL
FT                   RGRGGGGFPTGLKWEIASRFSADQKYVICNADEGDPGAFMDRSILEGDPHSVIEAMAIC
FT                   GYAIGATKGMVYIRAEYPLAVKRLQKAIEDAREVGLLGKDILGSGFDFDVELRYGAGAF
FT                   VCGEETALIQSLEGNRGEPVSKPPFPAERGFYGKPSNVNNVETFACVPPIILKGADWFA
FT                   SIGTEKSKGTKVFALAGKVNNVGLVEVPMGITLREVIYDIGGGIRDGRKFKAVQTGGPS
FT                   GGCLTEKHLDTPIDFDTLLEAGSMMGSGGMIVMDEDNCMVSVAKFYLEFTVEESCGKCT
FT                   PCRVGNRRMLEMLDKICQGKATRDDLNRLRELALIIKDTSLCGLGQTAPNPVLSTLDNF
FT                   FDEYLAHVEEKRCPAGKCKDLVRYVIDPEKCKGCTLCAKVCPADAISGKVREPHVIDQD
FT                   KCVKCGACYTACKFGAISRS"
FT   gene            160750..162507
FT                   /locus_tag="Taci_0150"
FT   CDS_pept        160750..162507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0150"
FT                   /product="hydrogenase, Fe-only"
FT                   /note="TIGRFAM: hydrogenase, Fe-only; PFAM: hydrogenase
FT                   large subunit domain protein; iron hydrogenase small
FT                   subunit; ferredoxin; 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; KEGG: pca:Pcar_1605 NAD-reducing iron-only
FT                   hydrogenase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18390"
FT                   /db_xref="GOA:D1B7Y7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Y7"
FT                   /inference="protein motif:TFAM:TIGR02512"
FT                   /protein_id="ACZ18390.1"
FT                   /translation="MINLNIDGKYVKVPEGSTILEAARQLGIDIPTLCHLKLDDNVGMV
FT                   NKSASCRVCVVEVKGRRNLAPACATPVAEGMEVRTNTIRVLNARKTVLELLLSDHPKEC
FT                   LTCAKSGNCELQDLAERFCIREVRYQGVQSTYKKDHSPALERDMDKCVMCRRCETMCNE
FT                   VQTVGVLSGVNRGFNAVVAPAFEKPLVDTVCTFCGQCAAVCPTGALVERDYSWRVIEAL
FT                   ADPDKVVVVQTAPAVRAALGEEFGLEPGTLVTGKMVSALRQMGFDYVFDTDFAADLTIM
FT                   EEASEFLDRLNRYLKGDKAVRMPILTSCCPAWVKFFEHQFPELLDVPSTAKSPQQMFGA
FT                   VAKNFFAKKLGIPREKMVVVSVMPCLAKKYEASRPEFAVDGNPDVDISISTRELAHLIK
FT                   RCNIDFLSLPDEDFDRPLGESTGAGVIFGTTGGVIEAAVRTAVEWATGKPLEKVDFTEL
FT                   RGMQGCREAWVNVGDLKLHIGIAHGLGNARRLLEAVRDGKGEMFHAIEIMACPGGCVGG
FT                   GGQPYHHGNFEIVKKRAEAIYREDQGKPIRKSHENPEIVKLYEEFLGKPLGETAHHLLH
FT                   THYFKRSDV"
FT   gene            162589..163431
FT                   /locus_tag="Taci_0151"
FT   CDS_pept        162589..163431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0151"
FT                   /product="formate/nitrite transporter"
FT                   /note="PFAM: formate/nitrite transporter; KEGG: gsu:GSU0234
FT                   FNT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18391"
FT                   /db_xref="GOA:D1B7Y8"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Y8"
FT                   /inference="protein motif:PFAM:PF01226"
FT                   /protein_id="ACZ18391.1"
FT                   /translation="MGYKTPAELVQSCARMAEKKGAWAPVQMLVLGFMAGAYIAMAGFL
FT                   YTVVTQDAARYVGTGIAKLLGGTVFPLGLILVVIAGGELFTGNCLMPMGILVGCVPLGR
FT                   VIKNWAWVFLSNMAGAVAVAFLVHWSGLAEGEVGANALKIAAVKMSLPFGQAMVRGVLC
FT                   NWLVALAVWMSMAADDVAGKISAIFFPIMGFVASGFEHNVANMYYMALGILVRREGSTL
FT                   TASSLPADKLSHVNLAGYVGNLLPVTLGNVLGAILFVVVTYFVVFKDQVAGGTEDRGG"
FT   gene            complement(163473..164528)
FT                   /locus_tag="Taci_0152"
FT   CDS_pept        complement(163473..164528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0152"
FT                   /product="Fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="PFAM: deoxyribose-phosphate aldolase/phospho-2-
FT                   dehydro-3-deoxyheptonate aldolase; KEGG: aeh:Mlg_2089
FT                   fructose-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18392"
FT                   /db_xref="GOA:D1B7Y9"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Y9"
FT                   /inference="protein motif:PRIAM:4.1.2.13"
FT                   /protein_id="ACZ18392.1"
FT                   /translation="MLSVSEIENILGDEAEDLLNYTCKGIPKEDLHLPGPDFVDRVFAQ
FT                   SDRNPQVLRSLQQLFSHGRLGNTGYLSILPVDQGIEHSAAASFAPNPMYMDPENIVRLA
FT                   IEGGCSAVASTLGVLGMVARRYAHRIPFVLKINHNELLSYPNVHDQTLFATVEQAWDMG
FT                   AVAVGATVYFGSPECRRQIIEVSKAFRRAHQLGMATILWCYLRNPVFEKEVDYHLSADL
FT                   TGQADHLGATIEADIVKQKLPENNGGFRAIGFGKTHPRVYEELVPNHPIEYVRWQVANG
FT                   YMGRVGLINSGGPSGKNDLKDAVRTAVINKRGGGMGLILGRKAFQKPFEEGVKLIKAVQ
FT                   DVYLCDEIVPA"
FT   gene            164678..166102
FT                   /locus_tag="Taci_0153"
FT   CDS_pept        164678..166102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0153"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: dps:DP1550 NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18393"
FT                   /db_xref="GOA:D1B7Z0"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Z0"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACZ18393.1"
FT                   /translation="MDRTVEVLIAGGGPGGRVSYMALWNMGVRSIAMVADEPPTVICSL
FT                   PYSVGRRLIPNGPCAVAVDLENSHRLPKEIAQDVIWGSVRSVDHALRTARVETRDGEVT
FT                   VRYRKLILAQGAAPWIPDVPGVLAGEGSSGPTVMVGDRLLPRDALAPNVKVLRGLQDAK
FT                   DLDQMAKSAKRAVVVGSGAIGLEVAEALHQRGLSVTVVEVLPHAVAALDEDMAAVLENK
FT                   LLQNGIDLKVGLTVSEVLRDGILLSDGSKLEAELVVFASGVRPRLDLARSLGLKVDRGV
FT                   VVDGRMMTSLEDVYAVGDMAQLTDAATGLPLLPLIGTLAMRQAMVAAMNVAGMPAQLPP
FT                   VTTWGVSQVFDLHWGSVGWTVEAARRCGVEAVGVRIPVRSRDPFMEGRDGAWKITVAMG
FT                   GPGVTPGQIIGFQVLTEGDNPVHLAERFIDVVASRSTVQDLFARYFIHSPSHNSVDDPY
FT                   LGLMMEARRLMEQPRG"
FT   gene            complement(166148..166837)
FT                   /locus_tag="Taci_0154"
FT   CDS_pept        complement(166148..166837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0154"
FT                   /product="methyltransferase GidB"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: hypothetical protein;
FT                   K03501 glucose inhibited division protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18394"
FT                   /db_xref="GOA:D1B7Z1"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Z1"
FT                   /inference="protein motif:TFAM:TIGR00138"
FT                   /protein_id="ACZ18394.1"
FT                   /translation="MDLDLAMSFHLVKENEGNLRRYGALLASGNSKVRLTGTAGEEDLW
FT                   EQHIVDCGALVSLLPRGARVIDVGTGGGLPGMVWALCRSDVGVTLLDSVGKKCAAVEEM
FT                   ARMMGLEPHRVQVVCSRSEEFARLNREVYDVACARALSEAPVLAELLSPLVAVGGMVWA
FT                   MKGPRCEEELAPGEGRWGELGLSDPEVLDYDLGDRHRKLVIWRKISPCPDRYPRRPGMA
FT                   EKRPWYR"
FT   gene            166947..167783
FT                   /locus_tag="Taci_0155"
FT   CDS_pept        166947..167783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0155"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: gbm:Gbem_2425
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18395"
FT                   /db_xref="GOA:D1B7Z2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Z2"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACZ18395.1"
FT                   /translation="MTPLSRPFRGLAWFPLLLLLLLLIPQGANGAVRGLNHINLDSILS
FT                   TPVEGELRFLVVGDTRGPGSRFRFLVPQMREDQGLFVIHLGDLTNRGTQGEYREALELL
FT                   RSIRKPFLVVIGNHELVDRGRGRFEDIFGSWRDRAFVLGGALLVLLDNADGRPLSEERL
FT                   RWLDRELASHPGPKMVFMHQPLFDPRPGKSHAMDERGAREMLEVLKRHRVDRVFASHVH
FT                   AFFQGDWDGVPYTISGGGGASLYSRDPESGFHHYHRVTVGPGGVRVETVPLGGYVR"
FT   sig_peptide     166947..167039
FT                   /locus_tag="Taci_0155"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.990 at
FT                   residue 31"
FT   gene            167814..169052
FT                   /locus_tag="Taci_0156"
FT   CDS_pept        167814..169052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0156"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: Metal-dependent hydrolase HDOD; metal-
FT                   dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region; KEGG:
FT                   dde:Dde_0643 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18396"
FT                   /db_xref="GOA:D1B7Z3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Z3"
FT                   /inference="protein motif:PFAM:PF08668"
FT                   /protein_id="ACZ18396.1"
FT                   /translation="MGLVSIENVRPGMVLASELRAPDGRVMLGKGVTIEDRHIRMLRLW
FT                   GIPVADVEGYEDRAIAEEEGVREEALRKARALVSRWMNPGTAFEEEIFAQAVREVGQRI
FT                   AKEGSVPSAWIPYPPAEVPKVTLGDMGVGVPAMRHLVRQHVRLSSFPAIYFKLREVIES
FT                   PVSSASKIAEVVSKDPALTVRLLRLVNSSYYGFPKRIDSIQRAVAIVGTNQLTALAMAV
FT                   SAVGAFKGIPSSRIDVESFWEHSISCAVICRVIAFTLRMPNEEQFFLSGLLHDVGRLVL
FT                   FAKVPWVMKSLMDLALYEGVPMHRVEERHLGFHHGSMGEALLKEWNIPDFIRTMVGGHH
FT                   SPDESDLPRESAVVHLADAMALALRWGNSGSHLVPTLSQRGLDMLEIPPEALPAMVSQA
FT                   RRQIAEIRRIFLI"
FT   gene            169064..171817
FT                   /locus_tag="Taci_0157"
FT   CDS_pept        169064..171817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0157"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase"
FT                   /note="KEGG: azo:azo3945 putative hybrid sensor and
FT                   regulator protein; TIGRFAM: diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; response regulator
FT                   receiver; ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: GGDEF domain
FT                   containing protein; histidine kinase A domain protein;
FT                   response regulator receiver; ATP- binding region ATPase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18397"
FT                   /db_xref="GOA:D1B7Z4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Z4"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACZ18397.1"
FT                   /translation="MNTSRLSELERRFRMLEAERERINRILAVAVGLVPSAVEEDGHLD
FT                   RILVRAADRARSLIKIGAWTCLLFSEDGMDLSRVAGQEGEVDFDAALAEMSSDGTLAWA
FT                   LTHPNPMFMSLPQGSFLVSALSTPSKILGVFMASLEERPEEIPEIGVAFFRTLMSYTAI
FT                   SIENQMRLEEVRSLNGQLKENVERLEETKRALEEANRLKDAFLAHIGHEIRNPLGGMMG
FT                   LLRTTLGAELPPPVAHRMEVLLRECETLNSLLDDLLDYSKLEAGRLDITAIPFSPQALL
FT                   EELASTFSVRAQDRGLEFRFFTDALPDRIMGDPRRLRQILVNLLSNSLKFTRKGHVSLS
FT                   GWGGEGRVYFAVEDSGLGMGDQEMGRLFVPFSGSSSGAGLGLYLSKELANRMGGDITVR
FT                   SRPGYGTVFTLDLPVRQEEGTGCPLDGLRALVLDDNNTSLSAACGVLRECGVQAVGAQS
FT                   VQEALEEAEDGKFDFVLMDLNLPGGDGLSAMHRLHEALGCRVVGLTAGVSPDVEEAFLR
FT                   EGMLKVLRKPLDVMELAWALKHREAPQRNLQTDLLETFRADMARLEDVMLKAFREGDQD
FT                   LFLKSLHEFKGAALSFGQWRGSGGASFRVPMGVGGRFGGVEFPQGMRLLVADDNPSTRE
FT                   GILRIFSNRGIRVLTASTGEEALEVLLKGEVDVALVDYMMPHIGGVEVIRRLREEEQCS
FT                   ERYTYVIMITVKDTKEDLVLAMASGADDYVVKPFDPDDLTLRVLSGTRVMEVQRKLRFM
FT                   ARHDQLTGLLNRRAVIEMEEREMARSVREGGSLSVAMMDIDRFKAINDTYGHLAGDQVL
FT                   REVARRVGSKLRVYDVVGRYGGEEFLLILPGASLGDAKRLCERMRSAIGSEPVLYDGLQ
FT                   IPVTASFGVAEFVPQLTVDQLNNLADQALYLAKASGRDAVRALGAD"
FT   gene            complement(171814..173049)
FT                   /locus_tag="Taci_0158"
FT   CDS_pept        complement(171814..173049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0158"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   gur:Gura_0271 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18398"
FT                   /db_xref="GOA:D1B7Z5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Z5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACZ18398.1"
FT                   /translation="MTERKDRGGWPVVLYVVLVAAYFMSNFFRVSPAVLLPRLAREMGM
FT                   TAGVTGFISSLFFYAYGGVQPLCGSLNDRYGPMRIGALGMLICAVGTFMFSFADSPASL
FT                   GVARMLTGLGLGPIFSGVLVHQAHGFPKERYPMLTGLTIALGNLGAVVSVVPLGLALDS
FT                   MGRFNTFLLLGIVSAGIALVLWVLKGHDPVTSSGGKGPMLKGLKEGMRILVSGHRGIKV
FT                   AALLWASAVGVQLSLQGLWGVAWFEEAYRCGPSAARNWATMIGIGMMAGTLLGGPLASM
FT                   ARGRRSSFAAIGGSVAASWGLFLALMALRAPIWASGWAGALMGITTGGAVVAANSAIND
FT                   LVDRERIGALLGAANMMVFALVILCQWGSGLMIEAFGGQSHGAFLKAYGIMALFLLACT
FT                   LPILTVRSFKRS"
FT   gene            173279..175105
FT                   /locus_tag="Taci_0159"
FT   CDS_pept        173279..175105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0159"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: scl:sce3157
FT                   molybdopterin-containing oxidoreductase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18399"
FT                   /db_xref="GOA:D1B7Z6"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Z6"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /protein_id="ACZ18399.1"
FT                   /translation="MKILSACAFDCPDACGFEAQWGSSQVRGRDDHPYTRGFVCRKLTK
FT                   LLDALEGPRPTQPMLREGGVLNPISWDRALSILAGRIESAVKRDPRRILWGTGSGNLLM
FT                   TNCLLDLFSQRLGGFTGLAGSLCGGEGGHGLSLSYPVRRHVPPEEVLESRRILLWGRNV
FT                   AETNVHFVPLIARARAMGAKVGYLDVRPTRTHGLADVAWTLRPGSDLALGAFLCGEVLR
FT                   GGGGPVGEFRGLEEFEGSIRWATRQEVGRLTGLSSQELDEILQFVTSDGPLSLWAGWAM
FT                   QRRQGGDLLMRVLDSLVFLLGSQGVPGGGMVFSADDGAPFPPGFAEGCFSRLAPRPVVG
FT                   PWLKGAQDPPVELVIFSRCNPVTQTQGVEDLLELMDREDPFFVCLDWRLSATASRSHLF
FT                   IPVAPFPEQPDGLVFSYWHDLLQVTRPVRRSPCPSEADLLDSILRMLGFDPCVRGSFEP
FT                   FVRQVLSNPGLVPVAEGIWRFPHPDRNRGAFSFPLVPPVGPAGDSLTLVTPHRFDAVNG
FT                   GGCESWAEGDGLVFRLSPREASRLGLRDRQRVAVRSPWGEVRGVLRVEEGVAPGTCWTH
FT                   SGQRGVNLLVGPQLTDRWNCCLSQVEVELRPL"
FT   gene            complement(175102..176283)
FT                   /locus_tag="Taci_0160"
FT   CDS_pept        complement(175102..176283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0160"
FT                   /product="amidohydrolase"
FT                   /note="TIGRFAM: amidohydrolase; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein; KEGG:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18400"
FT                   /db_xref="GOA:D1B7Z7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Z7"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACZ18400.1"
FT                   /translation="MNHHDQLLARVLDFLDRNREEAVRMSDRICDHPELGGEEVRTSGE
FT                   FARALREGGFRVKTGILDLPTAFHATWGRGPVNVALLAEMDALPEIGHGCGHNLHGTAS
FT                   VFAALALKEALREEDATIHVFGTPAEETNGSKVEMARAGLFDEMDLALMFHCCSGGSYV
FT                   DYRSMAIDSLEFTFSGRTAHAAAAPWEGRNGLNGVILLFHALDMLRQHVRPHVRMHGII
FT                   THGGAAPNIVPHEARAHWYFRAPTREELDQLVERVKAIAHGCAAATETEVSYRYNEASF
FT                   DHMRPNPPAEEAMERILTELGFRLRKGPGPSGSSDVGNVSRRCPALQPELSISDREIPL
FT                   HSREFALATKSEGGHRALIQGAKALAWMGLDVIFNPQLRERIRRAFESPTTHG"
FT   gene            176437..177792
FT                   /locus_tag="Taci_0161"
FT   CDS_pept        176437..177792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0161"
FT                   /product="xanthine permease"
FT                   /note="TIGRFAM: xanthine permease; uracil-xanthine
FT                   permease; PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   shl:Shal_0658 uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18401"
FT                   /db_xref="GOA:D1B7Z8"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Z8"
FT                   /inference="protein motif:TFAM:TIGR03173"
FT                   /protein_id="ACZ18401.1"
FT                   /translation="METRGARGYGDGILYKVDDRPPLNLSVVLAIQHIMAAFGGIVAVP
FT                   LIVGGALKLPVHDLGFLVSAALLAAGIATYIQAKGIGPVGAKLPCVMGTDFTFVGPSIA
FT                   VGAQMGLPGIFGATIAGSFIEIALSRFIKPLRRFFPPVVTGTVVMLIGLTLLPVAIDWA
FT                   AGGYGAPDYGSVRNVSIALSVMTVIMLLNRYAKGFLSSAAVIIGLIFGYLICIPFGMLD
FT                   MSPIAKAGWFEVPTIFKYGVKFSMGGFFAFFTAYLVTTVETVGCLFAIGEASGKELDSE
FT                   DISKGILADGVGSLIAGFVNAGPNTSFSQNVGLIPLSKVASRYVVQVAGIILILMGLFP
FT                   KLGALVAIMPNPVLGGAGIIMFGMVMAAGIKTLKGVELNNRNMLILAISLGIGIGVTVR
FT                   PDFISSMPRAVRSFFSSGISAGTVAALLLNVVLKDDAEGDLEEDLEVRPEEA"
FT   gene            complement(177845..180358)
FT                   /locus_tag="Taci_0162"
FT   CDS_pept        complement(177845..180358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0162"
FT                   /product="diguanylate cyclase and metal dependent
FT                   phosphohydrolase"
FT                   /note="KEGG: aeh:Mlg_0691 diguanylate cyclase with PAS/PAC
FT                   sensor; TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: GGDEF domain containing protein; metal- dependent
FT                   phosphohydrolase HD sub domain; PAS fold domain protein;
FT                   PAS fold-4 domain protein; SMART: GGDEF domain containing
FT                   protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18402"
FT                   /db_xref="GOA:D1B7Z9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D1B7Z9"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACZ18402.1"
FT                   /translation="MDTRYREILPRAFESWPYPLLLLEDGPPPRVIYHNPAFAGLLDRE
FT                   DLEGAILSDLPHLGGCDLSDLAGLPAGERGYLKAKDRTFNIQRTAPAEGVSLLIFQDVS
FT                   QEMRRIDLLEVEGERVSKISLEFEDVFEGIQEGAFLVRAHPDGSFRYVLVNRLYRDMFM
FT                   IGSRDVRGLTARELLGDRMGAMVEANYRDCINSRSPITVAERFLLPNDQVRLLQTSLVP
FT                   SFLDHAPSHIVGFIKDVTDERRAQEERDAALRRYEAMFREHPAVMLLIDPESGQILDAN
FT                   PSALNFYGYRHEEITRMTIQDINQLPEEEVRRRSLLAAHGKQRYFLFPHRLRSGAVRLV
FT                   DVFTAPVNIGESTALFSIIFDVTEREEAKRRLHQEKETLNTTLMSIADGVVATDAGGTI
FT                   TSINPSALKMAGIKEQDALGRPFSHVFSIIESKTLNEGDPLGAAIRSGRIIPISDAVAN
FT                   TPGGKIHISGSASPVRNSLGEVTGAVAVLRDVGQEKQWRDKMLYMSYHDPLTKLPNRRF
FT                   LEEEISRLEEEQVMPVSVIMADVNALKMTNDAFGHERGDALLINAAKVLKAACRRGDVV
FT                   GRWGGDEFLILLVGATERGAEMAAQRIREMVRDSPLGDIPMSIALGWGTRSNPGQGILP
FT                   AMKEAEEMMYRHKLIDGRDQRQMLLDRILSALSSRCHEDEDHRNRLKKICLAVGSAMNL
FT                   SPREMEDLSLLTYYHDIGMIGIPPEVLRAEGPLTENQMEDIRRHPEVGYMIAQNVKEIV
FT                   SVADLILLHHERYDGSGYPRGLKGDQIPIQCRIFALADAYEAMTSGRPYRRPLSHREAL
FT                   EEIASLKGIIFDPQVVEAFVSSLGN"
FT   gene            complement(180470..181843)
FT                   /locus_tag="Taci_0163"
FT   CDS_pept        complement(180470..181843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0163"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: vha:VIBHAR_00948
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18403"
FT                   /db_xref="GOA:D1B800"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D1B800"
FT                   /inference="protein motif:TFAM:TIGR00835"
FT                   /protein_id="ACZ18403.1"
FT                   /translation="MEGFLMDLVSSANGVLWGKVMVWLLLGTGVFYTLRLRFPQVRHFG
FT                   HMFKVTLGGRKSQEGGISSFQALCTGLAAQVGTGNLAGVATALVSGGPGAIFWMWLTAV
FT                   LGMATICGEAILAQLFRVKDQDGTYRGGPAYYLEKGLGQRWMGMLFAVSIIVAMGFIFN
FT                   AVQSNSIAAGLRGAFGMRELPVAAVLMAVTAVVIFGGLKRIAHVAEVVVPVMAIAYIAI
FT                   SLYITLTHISLLPSIISMIFQGAFGAKQVAGGVLGHTVAQAFRYGVARGLFSNEAGMGS
FT                   TPNAHATAEVRHPARQGFVAMMGVFVDTLLVCSATATIILVSGQLGSGATGIELTQLAI
FT                   RSAVGSWGPYFIAAALLFFSWTSILGNYYYGESNLKYLFPNCGTLGLGAYRVIVLGMLL
FT                   FGATSSVPLVWELADFFNGIMALLNLVGIILLSNLAVRAMNDYESKLKSDPDPSYDGN"
FT   gene            181993..184143
FT                   /locus_tag="Taci_0164"
FT   CDS_pept        181993..184143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: outer membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18404"
FT                   /db_xref="UniProtKB/TrEMBL:D1B801"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18404.1"
FT                   /translation="MTSRPVRSFLLALSLAILCQLSPQPSMGATLPELEEMVSSSPEVL
FT                   RAVYDLLALQAREEALVASSGLKFFAEASVTGSNRPESRSDDARLEGYSTLSGRVGLAL
FT                   PVLGSWHRERVSQIRARIDSLKGAQREMEARRANLTALRKAYVLLWTSQRRELLSRWFL
FT                   RLEGQAMPPMRRRTEEGYLLKADLLEMESWFHLARRQLEGALADQEMAMGIIRKATGRP
FT                   YQEILKAETPSLRPVRYSKGALGRYVNQDDPELGILQQVTEQMELAAHHQGRGGYEAEV
FT                   RAGVSYSLEDPGRGGHDAFVSFGLTAPVGLSKASRLSREAALFEAQAAAEEEAIHRMDR
FT                   LSSILHGVSRCRHALSQLEFSSARLESALEALRVADLRASSIPGDVLERRLRAQMDLFS
FT                   AAMDVVEAEGLAMQYHAELLELIPQDGPQEDPVVISSPPPGTSQRWALVMTALGGTPSP
FT                   RGQSTGALQLGAYLWNGDRVLNGEGDRLLELIGRSPFRRILISFTSRGIRSILDGGPAS
FT                   RRLHDFLRSARSSGVWVELLLGDPDFILDPKGMVDLISRLKGLPFDGLHLDLEVDQIPG
FT                   ASQRRQELNRRFLQAVEAAAKASPWGVSVSIHPRYLEEPFRQETLEGLHRSRVRGVAVM
FT                   IYTSSTDRAVERFLSVARGVGDIRMWLAVSVEGNVSPEESLRGLGPAGFSDALDRMGRA
FT                   GVRSVLVQSFEDHLSMTGGGGR"
FT   sig_peptide     181993..182079
FT                   /locus_tag="Taci_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            184140..185240
FT                   /locus_tag="Taci_0165"
FT   CDS_pept        184140..185240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0165"
FT                   /product="Multidrug resistance efflux pump-like protein"
FT                   /note="KEGG: saz:Sama_0507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18405"
FT                   /db_xref="GOA:D1B802"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR020719"
FT                   /db_xref="UniProtKB/TrEMBL:D1B802"
FT                   /inference="protein motif:COG:COG1566"
FT                   /protein_id="ACZ18405.1"
FT                   /translation="MRIRFSRKESPNVDPGGLKVDYGPARRAALKWRWYLLLLLLFSPL
FT                   AFLLWKVASYAILVSAPGVVRLETVTVSSPIQGVVSLPLRPGQLVRRGDQLFSVRDPSV
FT                   EARLAVLNAELGALKSSPYRPPSLNRVDLSPLASQVQVQRRSVAYQREVRDRIRDLFSR
FT                   GAATRAELDQAEDRLRQAEAALAQAEAALSTLKPSAQPASQFSEYEAMRLNRMAQIQAE
FT                   AEQLGSVRHKVVTSPVDGVVLELLVNDRGSVPMGGGVVTLGDRSRVRIWGYLDPRFMPY
FT                   GEVGSPVRVRTPDGMTVQGRVEATPTLSTQIPPDLSGPLNERGRAVLISVTCPELPAAY
FT                   HVDGIKVDLRFPFSWRNAMRSLGIRI"
FT   gene            185254..186600
FT                   /locus_tag="Taci_0166"
FT   CDS_pept        185254..186600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0166"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18406"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR040572"
FT                   /db_xref="UniProtKB/TrEMBL:D1B803"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18406.1"
FT                   /translation="MIGEAHGGHGILRVGSVLALREALEGATRGILVPRGAETLEVLME
FT                   LRSHRDRGLIPAFVEGETDRFLAELCDGVDLTEAQMSSRAEEIWDRLQGIQWDLLGSSL
FT                   DYRLIAFLYSRPHRGLSPVLRPLTGRVYLWPLMEALGGGKVDPQGWIARLADGGYLEEG
FT                   ELVERVRFCPFCDGGHLNYVDLCPSCGSMDIENVQFIHCFTCGRVGPKEDFLVTGEMIC
FT                   PFCAARLRHIGSDYDIPMENQRCRDCGAAFSEPRVSCHCLLCGQWSDPADLIPRNFRVW
FT                   RLTDKGVLAAQTGEMQSRYEVMDTLNYMKPEPFRHILQWMLNLSRRPPVEPFCLLSISF
FT                   GDLDAFVARVGLRRAMETLRSIMGRIKEMIRTTDVSTRSEHEEILLLLPKTPLEGGLVV
FT                   ARRIGQIRSALPQEVASTLPLEVKIASVPEDLEDSADVDLFLAKLREVR"
FT   gene            186602..187954
FT                   /locus_tag="Taci_0167"
FT   CDS_pept        186602..187954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0167"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; chitin
FT                   synthase; KEGG: glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18407"
FT                   /db_xref="GOA:D1B804"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1B804"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACZ18407.1"
FT                   /translation="MGPFLVTDVLRMAAAAIRGLLEDPLSSQVWVVIFKFVPMVVFLEL
FT                   PYYAFVLAGVLKYAMERALLPWEEVQYHPSVSCIITCYSEGEDVKLTIRTLAHQIYPGR
FT                   IQIIPVIDGALVNSHTHRAALEMMDQVMRAPNRELLVLPKWQRGGRVSSLNAGLSVARG
FT                   EVVMALDGDTSFDNDMVSKAVRHFRDPNVAAVAGCLRVRNWRSSLAAALQGLEYMLAIG
FT                   VSKTGLSQFNAVNNISGAFGIFRREVLNLIMGWDAGSAEDLDITMRIKNYFGRYRSVRI
FT                   LFDPEVIGHTDAPPTFRGFFKQRLRWDGDLFYIYVRKHLKSFSPSMMGWRNFITVTLGG
FT                   LYFQIVVPLILLVYTAFSFITLPLGTVFRILLLVYLFYLGVTLVFYLLGLAFVSERPRD
FT                   DLILGVLLPLFPVFTFASRLWSAAAVIWEMVARGHLDSSMAPWWVLRKGRF"
FT   gene            187987..189210
FT                   /locus_tag="Taci_0168"
FT   CDS_pept        187987..189210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0168"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: Metal-dependent hydrolase HDOD; metal-
FT                   dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region; KEGG:
FT                   dde:Dde_2455 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18408"
FT                   /db_xref="GOA:D1B805"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:D1B805"
FT                   /inference="protein motif:PFAM:PF08668"
FT                   /protein_id="ACZ18408.1"
FT                   /translation="MPKVRVSDLREGMVLQEDLLAPNGRFILPKGAVIRESYIKTFKAW
FT                   GVVEASVAEGPVAEEPPVPEGLAPFIDRARALADMFFPREGRDEMPMREIHRCGVLAMA
FT                   KSLAEGEEFPLEVGCIPVSPSSVGVRRKVTPHELVAANAFVTLPDIYYRIDEVIKAPNS
FT                   SVEQIARVVGKDPSLSAKLLKLVNSSFYGLPSRVDSVARAVTLVGTKELLNLAIGVSLL
FT                   SAFKGLDPGYVSVRSFWTHSVACGVFARILAAKMGIREEERFFLAGLMHDIGRLILYVK
FT                   VPFSMGEVIRLSSQGQDIYETEQDVLGFDHGHLSYYALREWKIPSSIGELVRFHHRPSS
FT                   ARTPEELVVHVADVFAMAGRFGTSGSFMVPRLSPYHWDQLGLSVNVIEPVFVQGQRQIR
FT                   EIIGMFFS"
FT   gene            189225..191270
FT                   /locus_tag="Taci_0169"
FT   CDS_pept        189225..191270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0169"
FT                   /product="diguanylate cyclase and metal dependent
FT                   phosphohydrolase"
FT                   /note="KEGG: gsu:GSU1656 sensory box/response regulator;
FT                   TIGRFAM: diguanylate cyclase; PAS sensor protein; PFAM:
FT                   GGDEF domain containing protein; metal- dependent
FT                   phosphohydrolase HD sub domain; PAS fold domain protein;
FT                   PAS fold-4 domain protein; SMART: GGDEF domain containing
FT                   protein; metal- dependent phosphohydrolase HD region; PAS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18409"
FT                   /db_xref="GOA:D1B806"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D1B806"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACZ18409.1"
FT                   /translation="MEQDPQKRVRELEAQLEQAQRERMEAVMALQIAMEFSSHLPSSYK
FT                   DGPLRDMLDEAASKVRSILSPIAFAFYVVAPGFPSFDLAGCYPSSKMPLLEREKDILIE
FT                   DGSFAWAVEVSKRTWCTSSDGNLRMLLQPMVSNDRVMGMFLAAMDFGDVPDVKLVFLSV
FT                   ILSSLAGAIQSRQLIDALKEANGELVSRCFSLERSKLEARAERRKLDQEIAEARTEARG
FT                   AQERVFQVFEAMDDPVLLVDRGHRLSYCNGAFLSRYGLSMDEALGMSPEELLGDGDYAE
FT                   TWRGLIGQALSSSSPIRRDVESVAGGSRVVFDSSLFPMRGLSGGVEAVGIVLRDVTERR
FT                   AAEEMMRFMGYHDPLTGLYNRRFFEEEMRRLDTDRQLPLCVLMGDVDGLKLTNDVFGHH
FT                   EGDRLLMDVAEHLKRSIRREDVLARWGGDEFVVLLPKTDPEVAMEIARRLSVMDSSRKP
FT                   VPYKITFGLGVKTSPEQDANSVLRMAEDRMYSLKGRERDWVREKIVNSLMLDIEKRSCE
FT                   TCEHRRRVANLALGIGRAMGLEDDDLERLMLLGEYHDVGMIEVGEEVLRKEGPLDRYEM
FT                   SLVMKHPETGYRVANASSSSLGEIARLILHHHENYDGTGYPHGLKGNQIPLLDRIFRVA
FT                   DSYEVITGGRPYRPPMSPDQALEEIASRSGTWYDPAVVQALLGLMG"
FT   gene            complement(191267..191752)
FT                   /locus_tag="Taci_0170"
FT   CDS_pept        complement(191267..191752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0170"
FT                   /product="ybaK/ebsC protein"
FT                   /note="TIGRFAM: ybaK/ebsC protein; PFAM: YbaK/prolyl-tRNA
FT                   synthetase associated region; KEGG: mxa:MXAN_2533 YbaK/EbsC
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18410"
FT                   /db_xref="GOA:D1B807"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D1B807"
FT                   /inference="protein motif:TFAM:TIGR00011"
FT                   /protein_id="ACZ18410.1"
FT                   /translation="MKSKGKTNAIRILEQMGIHFETREYQADESDLSARAVALKVNLPL
FT                   EQVFKTLVLKGDRTGHLVAVIPGNREADMKALAALSGNKRVELIDLKDLQPLTGYVRGG
FT                   CSPVGMKRHFPTYIDESARSFPFISVSAGVRGMQVLMNPHDLLRATSGSWGKISREG"
FT   gene            191827..192984
FT                   /locus_tag="Taci_0171"
FT   CDS_pept        191827..192984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0171"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: putative phytochrome sensor protein; TIGRFAM:
FT                   PAS sensor protein; PFAM: Stage II sporulation E family
FT                   protein; PAS fold-4 domain protein; SMART: protein
FT                   phosphatase 2C domain protein; PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18411"
FT                   /db_xref="GOA:D1B808"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D1B808"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACZ18411.1"
FT                   /translation="MSDKIDPIRDLLNYHPDMLFVLDRSGRIVEAGASAFVFLGLMPND
FT                   IRGTSFANLLPPDRREEFLRFISRPRMLRMNRYPMVRHDGVEVTMELHVSKGSWAGEEA
FT                   IYLTAIDLSERVRSEAQVEFYMEEMERIAMKLRQTQQALDDQLQKAAKLHRKLMPAIPK
FT                   MEGIVGAGCFDPASRIGGDFYGVVPLGDRALAYLVDVSGHGLDGALISLFVRDWVAEYL
FT                   SGRTPSQVDPLNLLEHISSRFLGEELLYDYFICLQIALFDRGKGTFRLVNAGNPVRPML
FT                   FTPEGGVALLDCVGTPVAGLGEEDITPVEVPFRSGSRLLLLTDGVVDQDSSGERFGVFR
FT                   VKDLLERHGAESPEEILRAIYSAFQTFLGDKPRRDDVTMLCFGAE"
FT   gene            193012..193107
FT                   /locus_tag="Taci_0172"
FT   CDS_pept        193012..193107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18412"
FT                   /db_xref="UniProtKB/TrEMBL:D1B809"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18412.1"
FT                   /translation="MKVRITSRFWLNMVSKHGRDFRMIMSTIIAG"
FT   gene            193357..193863
FT                   /locus_tag="Taci_0173"
FT   CDS_pept        193357..193863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccv:CCV52592_1651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18413"
FT                   /db_xref="GOA:D1B810"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1B810"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18413.1"
FT                   /translation="MNFKNRRLWAVLAVIMVLSAALLMKVFERRREAVEGLTFEVSARS
FT                   EIERALSSGLPVMIDFGSEYCGPCRAMESELIWAEALVRGKGIILFADVWKDSSLAEGF
FT                   PLRVIPTQFFFNRDGTPLAVPKDDQLGLFEYRDGSGRHVYTIHEGPLTSHQILGLFRLM
FT                   GVDVE"
FT   sig_peptide     193357..193419
FT                   /locus_tag="Taci_0173"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.384 at
FT                   residue 21"
FT   gene            193860..194504
FT                   /locus_tag="Taci_0174"
FT   CDS_pept        193860..194504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0174"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: rlt:Rleg2_1643 cytochrome c biogenesis
FT                   protein transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18414"
FT                   /db_xref="GOA:D1B811"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:D1B811"
FT                   /inference="protein motif:PFAM:PF02683"
FT                   /protein_id="ACZ18414.1"
FT                   /translation="MIHGASLVGAFGMGLLGALSPCLAVTIPMTLALAAGTRSPSRAMG
FT                   LAMGLLLWAGMALALVPLGVGASFLGGALRARPGLLYGALGVLTMLAGLGTLDLIQLPS
FT                   VRLPMHGRFTGPLGALAAGFAIAFLSSPCSSPLLIAALGLSASGGAISAAAVMLAYSAG
FT                   HSVPFLLAGASAALVRRLLEDRRLTGSVRIVRIGAGLVLLGLSARFFYLAL"
FT   sig_peptide     193860..193964
FT                   /locus_tag="Taci_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.516 at
FT                   residue 35"
FT   gene            194584..194907
FT                   /locus_tag="Taci_0175"
FT   CDS_pept        194584..194907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18415"
FT                   /db_xref="UniProtKB/TrEMBL:D1B812"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18415.1"
FT                   /translation="MSRGFIVGPKGSKANPICCCGGSQCDPEMTLEGAAEEIRRILSAE
FT                   GFEDVSVTVEDPSDPSCDHVARRAAESSPDLIPLVMVDHKVAAYGGVKPDLLLRILRKM
FT                   KGV"
FT   gene            194938..195174
FT                   /locus_tag="Taci_0176"
FT   CDS_pept        194938..195174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0176"
FT                   /product="redox-active disulfide protein 2"
FT                   /note="TIGRFAM: redox-active disulfide protein 2; KEGG:
FT                   dps:DP0946 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18416"
FT                   /db_xref="InterPro:IPR005243"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1B813"
FT                   /inference="protein motif:TFAM:TIGR00412"
FT                   /protein_id="ACZ18416.1"
FT                   /translation="MEIQILGTGCPKCKKLTEMAEQAARELGLEFTIRKVSDINEIMEF
FT                   GVMSTPGLAVDGKVLTAGQLPTYERVKDLLSRL"
FT   gene            complement(195212..195514)
FT                   /locus_tag="Taci_0177"
FT   CDS_pept        complement(195212..195514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0177"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: scl:sce0880 putative anti-sigma
FT                   factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18417"
FT                   /db_xref="GOA:D1B814"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D1B814"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ACZ18417.1"
FT                   /translation="MGYNITTEGQKATVAVRGHLYVEDVADMKARIFDEIANGVVNFQF
FT                   DLTDLNYIDSAGLGLLISIQKRVIPLGGRVTVTGAQGLVLEIFELTRLDRVFFPR"
FT   gene            complement(195492..195929)
FT                   /locus_tag="Taci_0178"
FT   CDS_pept        complement(195492..195929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0178"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mag:amb2658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18418"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1B815"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18418.1"
FT                   /translation="MRFVFESLEELAGSRDRILQVLRIMAPSKALRIFVTLNEALNNAA
FT                   LHGEPPIVLEIDKHTRETTGEERLIIKVSCGGRGFVPRLRLSDPEVPRGRGLWLMGAMA
FT                   DRLAFEDRGRMVIMEHRLDRPGRKRSLDTYWGDEDGIQHNH"
FT   gene            196021..196419
FT                   /locus_tag="Taci_0179"
FT   CDS_pept        196021..196419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0179"
FT                   /product="ribonuclease H"
FT                   /note="PFAM: ribonuclease H; KEGG: afw:Anae109_0764
FT                   ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18419"
FT                   /db_xref="GOA:D1B816"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D1B816"
FT                   /inference="protein motif:PFAM:PF00075"
FT                   /protein_id="ACZ18419.1"
FT                   /translation="MFKGYFDGASRGNPGPAGAGALLEDEDGRVVWEHREYLGRRTNNE
FT                   AEYWALIALLEEARSRGIDRLIAMGDSQLVVSQVTRKWKINMPHLRELARRVWELSEGM
FT                   DVSFRWIPREENRRADRLSNQAIDMASE"
FT   gene            196433..197086
FT                   /locus_tag="Taci_0180"
FT   CDS_pept        196433..197086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0180"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   bac:BamMC406_1881 GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18420"
FT                   /db_xref="GOA:D1B817"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1B817"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACZ18420.1"
FT                   /translation="MISSTAADEAYRAIRLKIMLGELKPGERLYENLLADMLGISRTPV
FT                   REAIRRLDSDGLVTLVRNGGAWVSNPTEEEIRDAFELRVILEGMAARRGAVGRRTSTLR
FT                   RLEEVVHREELAVDQGDMEGYIDASWMFHRLVGESSGSKTLLECLDRPLAKTFAFAVLH
FT                   RELFEGEMGLGRASTGDHAAIVRALDQGAPDLAEELVRRHVIHVAERMGFPIGS"
FT   gene            complement(197073..198278)
FT                   /locus_tag="Taci_0181"
FT   CDS_pept        complement(197073..198278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0181"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; protein
FT                   of unknown function DUF894 DitE; KEGG: sfu:Sfum_2384 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18421"
FT                   /db_xref="GOA:D1B818"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1B818"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACZ18421.1"
FT                   /translation="MGSMRGLFRSLRHRNFRLFFMGQSVSLTGFWMQKVATGWLVYRLT
FT                   DSPMALGTVDFAGSIPMLFLTPFTGAVLDRLDLRRTLFVCQALCALQALALGILTLAGV
FT                   ISFWHVVLLSAAMGVINSFEMPTRHSMVPQLLDNRDDLGNALALNSSLFNLARLVGPSV
FT                   AGFAIAKLGEGICFLANGVSYLATLKALTMMNLPRVDRPASRSSTLDDLLAGWRYGMEN
FT                   RTIRSVLLTLSALSFFAFPYLVMLPAVARDVLRGDSVTLGLLTSATGVGGLTGALFMAW
FT                   ASGMDLKRLLPTAVLAFGLSLTAFGASRVTGLSMISVACAGFSMVMCLIGSNTLLQLNA
FT                   EDSKRSRVMSLYILAVMGMGPFGSLIIGGLSKALGVSMGIALGGVLTLLSGGLLMTSLR
FT                   NR"
FT   gene            198331..198729
FT                   /locus_tag="Taci_0182"
FT   CDS_pept        198331..198729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18422"
FT                   /db_xref="UniProtKB/TrEMBL:D1B819"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18422.1"
FT                   /translation="MSVTPDSPEDRLRLSAYNAERLVAVLATLADRIDQAVSNRNQELV
FT                   DHYQREFQKASLKFMGNVEALLDEYYLMRGRKRSRIANEPLEPRELEEIYASVRRMIDL
FT                   LPPEEVQRLEAASPQRSPLPKGRLDVKG"
FT   gene            complement(198726..199622)
FT                   /locus_tag="Taci_0183"
FT   CDS_pept        complement(198726..199622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0183"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: amc:MADE_00423 predicted permease, DMT
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18423"
FT                   /db_xref="GOA:D1B820"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D1B820"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACZ18423.1"
FT                   /translation="MSMLGLFLGLVTACFWAISPILLKVGMRGVRREDVNPMRSFGFLL
FT                   GMTLIALLTRSGGFVPNGALAAVMVVLNVVLGNYLGDQLYFGAIKELGVSRAVSVGSSY
FT                   PLMVTLVSVLWLKERPGVLHLMATGLIVLGLVLLKMEPHREGERVYPIGGYIKALGAAA
FT                   CWGVSIPMTRWLVTAGGLSPVGANWWRSLTLVVVAWGLWFRGPGSRPERRRALARIPLK
FT                   TWLILNVAGAIGLALGGYTFAVALTMSPASLITPITASSPIITALVAVAFMGERLARHQ
FT                   WIGVGMVVLGSAIIGAL"
FT   gene            199778..200224
FT                   /locus_tag="Taci_0184"
FT   CDS_pept        199778..200224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0184"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   bha:BH3588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18424"
FT                   /db_xref="GOA:D1B821"
FT                   /db_xref="UniProtKB/TrEMBL:D1B821"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ACZ18424.1"
FT                   /translation="MSGSGGLEFLLESIQRGVKLGLRTTWTLVKISVPVYVVVSLLGAT
FT                   PALGWVARLFGPLMGIFGLPGEAAMVLVVGNAINLYAAIGAMKALDLTGYQVTTLALML
FT                   SFSHNLFVEGALCRKMGVSFWLMAAIRLGMASAAGLLMGTLGGA"
FT   gene            200238..200702
FT                   /locus_tag="Taci_0185"
FT   CDS_pept        200238..200702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0185"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   bsu:BSU34980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18425"
FT                   /db_xref="GOA:D1B822"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:D1B822"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ACZ18425.1"
FT                   /translation="MKIALGAMRSVKNLAVVVIPLMILMQLARDYRLMERLLGAFAPVS
FT                   RALGMSKRASLPLLVGLAFGLAYGAGVIIQASEEEGLSLRDRFLVILFLVGCHAVVEDT
FT                   LVFVAVGANGWLLITARILAASAITVLCARFLPRSAFRVKVDPHGDRCGG"
FT   gene            200680..201891
FT                   /locus_tag="Taci_0186"
FT   CDS_pept        200680..201891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0186"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: glo:Glov_2809
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18426"
FT                   /db_xref="GOA:D1B823"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D1B823"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACZ18426.1"
FT                   /translation="MGTAAGGRGLTLRRAYVGHAVAALATFALLAGGLFAYRRWVLPFD
FT                   GALTALLLLAPVTGFSLLTPFLRRRLAGPIGDLVEDASYLAVPVGFLWGLLTWGLVALR
FT                   CLGLWRAVSAVPLGALWRLIPAPWDLGLTLGVSVLAVAWGLGEASRVRVVRYVVGSDRL
FT                   PPGTSIRVVQISDLHLGMVNDRAFVARLCETLRGLEPHLLVSTGDLLDGPPEGLRDLAE
FT                   ALASVPHPLGAYAVLGNHEHYAGLEEAMEFHRACGMRILRDQWVPVGPLRIVGVDDPGY
FT                   LSGPGRSREEAELWGSVPEDGVFTLALKHRPTVHRCSAGRFQLMLCGHVHGGQIFPFTL
FT                   LALSAYRHSKGLKRMKGPFEGSLVYVSAGTGTWGAPVRLMAPPEVTVFQLVHRSSELRG
FT                   EEAE"
FT   gene            complement(201862..203442)
FT                   /locus_tag="Taci_0187"
FT   CDS_pept        complement(201862..203442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0187"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; SMART:
FT                   phospholipase D/Transphosphatidylase; KEGG: bcy:Bcer98_0907
FT                   cardiolipin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18427"
FT                   /db_xref="GOA:D1B824"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D1B824"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ACZ18427.1"
FT                   /translation="MALRRGSIKRGTLLALLGLGLLLVILSNLPSFRLALGAIQRGWAH
FT                   GGLIRELLGLVGRGYALARGALFNPLSVALYGVVIGAVILLENRNPDRTVAWLMALALV
FT                   PLLGLVAYLLVGPKFASARALRRRHQELARHRRYPLEVEIPPSEFQGVARLLVRTNGAF
FT                   PLAFQDPTILSDSASAFGAMFAALEEAKGYLHAQFFSLTSDGTGRRFAQLLTEARRRGV
FT                   EVRLLYDGVGSWGLERDLLEELKAAGVRAVPFLPISFPMFRREFNYRNHRKILVVDGSV
FT                   AFVGGFNVGDKYVGLAKGLSPWRDTMLRIRGDGALGLDDVFRRDWRFASGEELPLWNPP
FT                   PAWGGPFVQVATGGPDSPGDPLKHAYLAAMGACRERLWLTTPYLVPGMEVMEAMRTAAM
FT                   RGVDVRLVIPGRPDHRTVYFASRHHIGELLEAGVQVYRYQRGFIHAKTMIVDRELAAVG
FT                   TLNLDVRSLEINYEVQAFIHHRRTVERLEADFVKDFMDSHLVTREEWASRGLWERLLDS
FT                   SFRLLSPEL"
FT   sig_peptide     complement(203329..203442)
FT                   /locus_tag="Taci_0187"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.523 at
FT                   residue 38"
FT   gene            complement(203433..204677)
FT                   /locus_tag="Taci_0188"
FT   CDS_pept        complement(203433..204677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0188"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   mms:mma_0278 glutamate dehydrogenase (NAD(P)+)"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18428"
FT                   /db_xref="GOA:D1B825"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1B825"
FT                   /inference="protein motif:PFAM:PF00208"
FT                   /protein_id="ACZ18428.1"
FT                   /translation="MVYDLYSMFVKQVERAEPYLGANSELLPIFLEPREVTEYTLPLRM
FT                   SDGTIRPIKAWRSRHNNALGPYKGGVRFYREASREEIMALSGWMTVKCSAAGLPFGGSK
FT                   GGVKVDPHQLDHEELERLARLYGMAIASDSGEEVEIPAPDVNTNPQIMAWMLDTFEKVR
FT                   GISSPGAFTGKPPEVGGSQGRGEAGAMGGAFVLEKVLRRMGKDPRGMKVAIQGYGSLGI
FT                   TAHRALSAMGFRVVAITDSHGGVYREGGLDPEDLSSHKIMTGVLRDYRDADNITGDEIF
FT                   GVDCHVLVPAALECAINDRTAPAVRAQIVLELANAPTTPEGDQILADKGTVVIPDVLAN
FT                   SGGVTVSYFEWVQCRSGEVWRHSKVVRKLKEKLKGAMWDTLELSETYGIPLRTAAFVRG
FT                   VGRVLRAMKLKGVWP"
FT   gene            204795..206132
FT                   /locus_tag="Taci_0189"
FT   CDS_pept        204795..206132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0189"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   mca:MCA0339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18429"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:D1B826"
FT                   /inference="protein motif:PFAM:PF02646"
FT                   /protein_id="ACZ18429.1"
FT                   /translation="MNYLVLALSGLGVSAANLAVSIWILGRVRAQQGEVQRDIRRLEEA
FT                   LSREAGQVRMDMRSLREELLKYQQDQRVELRNLVETSSIRQMDALSRGMESLGQGQASQ
FT                   LERILKGLEASSSRVFQGLGTMNESVLSGLSRVQEVLAEGMERIRRGNEEKLDRMRDVV
FT                   EEKLQGALERRLGEAFSSVSERLEKVHQGLGEMRALASDVGDLKRVLSNVKSRGIWGEI
FT                   QLGNMLEQVMSPDQYGVNVQVVPGSSNRVEFAVKLPGDESPVWLPLDSKFPQEDYHRLL
FT                   SAQEASDPKGAEEARRELANRIVAEARSIRDKYVCPPHTTDFAVMYLPVEGLYAEVLKA
FT                   PGLAERLMTEFRVVPSGPMVLAALLNSLQMGFRTLAIQRRSGEVWKLLGQVKGDLRRFG
FT                   EMLEKARRKIQDAGDELDRAASRSRTMERRLRDVEELPEEAGQGVE"
FT   sig_peptide     204795..204854
FT                   /locus_tag="Taci_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.607 at
FT                   residue 20"
FT   gene            complement(206162..207739)
FT                   /locus_tag="Taci_0190"
FT   CDS_pept        complement(206162..207739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0190"
FT                   /product="BCCT transporter"
FT                   /note="PFAM: BCCT transporter; KEGG: csa:Csal_0820 BCCT
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18430"
FT                   /db_xref="GOA:D1B827"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:D1B827"
FT                   /inference="protein motif:PFAM:PF02028"
FT                   /protein_id="ACZ18430.1"
FT                   /translation="MLAGNGDMKVRKEVFYPMAAIFIGAIALGIAAPEAFYKAENAIVE
FT                   FAFVNFGWLFQLSSVMFLAICTYLGFSKYGDIKFGGKDAKPTLTDWQWFSISLCGGIAT
FT                   GILFWGIAEPITHFMSPPDVLGLKPQSEGAAMFSMVTTFIHWTFIPYSMYGIAGLGIAY
FT                   CAYNMGLPYSVSSTLYPLFGNRTRGTVSALVDNICLLAIAGGVAAVLGVGAMQAGSGLQ
FT                   TLTGIKTGKTVWATVLAITVTIYVVSSYSGIMRGIRILSDYNAKIFLLMMLFFFVVGPT
FT                   SFILNLGVQSFGHFLDSFFERTMFLSPIDGSPWPRWWPVYYWAIWLAYAPLIGMFLARL
FT                   SYGRTVRQFLLFNVVLPSAFGLLWFSIFGGNAIHSQIHGGQIWDSIQKSGLEVSVFSFL
FT                   KNYPLGTAWSWIFISVLILSIVTLCDSMTTTVASLSMTGSHLEGKEPPAPMKIFWGITM
FT                   ASMAIINLLSSSGKISGIDATKQIATVAGFPILFFMCLMALGTARAIMKGMGPVDQETD
FT                   PAEAPKGA"
FT   gene            complement(207796..209319)
FT                   /locus_tag="Taci_0191"
FT   CDS_pept        complement(207796..209319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0191"
FT                   /product="phenylalanine/histidine ammonia-lyase"
FT                   /note="PFAM: phenylalanine/histidine ammonia-lyase; KEGG:
FT                   bur:Bcep18194_B3018 phenylalanine/histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18431"
FT                   /db_xref="GOA:D1B828"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D1B828"
FT                   /inference="protein motif:PFAM:PF00221"
FT                   /protein_id="ACZ18431.1"
FT                   /translation="MTVTLGDRPISIHQVLSVARGEGVEIHPEALQRCTATWEALMDIA
FT                   NRGHPKVYGLNTGVGINKDQEVTKDSYCRYNMNMLQVHCVGLPPYGNLEEARAVMVIKL
FT                   NHLLMGYTGITPRFITLLKDMINLGVHPAIPLRGSVGEADIACLSHLGLVMTGQGLVIQ
FT                   DGRPVPSGPELERMGLEAVQPGPKDGLGLVTSNALGEALGALILDRIGRIVDTADLVYA
FT                   MTLEAFHGNPSPLDPRAMDLYPSPGAQRSAQTVRSLLAGSYIWDDPKSLQDPLSLRCSA
FT                   MVHGTVRDLIRRCIKVLTAHINAPDDNPLAFPDGTVVPSALFEPLPWVVHFEGLKVALG
FT                   HLAQTVARRTLRLGSDRFTGLPRFLNNDPCNCHAFGVIQKTLSYLLAEVRHLCNPCSMD
FT                   VESLSEDQEDRGCNTPMVMDQLGQIAQRLEALLAIEAIHAAQGMDLRGARYGVGSSAAL
FT                   ERLRREVAFLDVDRDLSCDILSAQALIAGGGLLKASRDALGEVVAYRDL"
FT   gene            complement(209316..211562)
FT                   /locus_tag="Taci_0192"
FT   CDS_pept        complement(209316..211562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0192"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead; KEGG: ecc:c3444 xanthine
FT                   dehydrogenase subunit XdhA"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18432"
FT                   /db_xref="GOA:D1B829"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D1B829"
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /protein_id="ACZ18432.1"
FT                   /translation="MREGKVGIPLNRLDGEAKVRGTFRFLADRLPGDVLHGRLITSPVA
FT                   NGWVHGFQVSEANRVDGLVRIFTPQDDPLLKPFNSAVYMEDQTDLRDERIFTDRPLFVG
FT                   DIVGAVLARTPQGAAEAALRVRVLCQAMEPVVSIHQALERPFLDSRPGRLEGRISAGEE
FT                   VHQEECETLSVTASTPKVHHGAMEPHICLSYMDGPTLVVESPCQMPFAVRYVLSQALGL
FT                   PMSRVRVIKAPMGGTFGGKQEVILETRCALMTLLTGRPVLLTTSREETINSTRSRAATV
FT                   GQVHMTARRDGRILSRRIHVICDAGAYASGGHRITMAMGKKAFRLYRIPHQEFLGITVF
FT                   TNTVPSGPCRGYGSPQIHAITEIAMDLMARRLRMDPAELRLRNLVHPFDPDPTGAPNLG
FT                   NARVRDCLTRGMEAFRWAERRDELENGKGGRFVQGVGLACASHGNGYFGSPFLDVMGIS
FT                   IRLAEDGSALVSGAFQELGNGTMTAMTQIAAQALSLPVERVFVSEADTHLSPFDVGCVA
FT                   SRVTYVCGSAVLEAARSLKDLMAEAFLRLAGLEGDPSRVRFADGRLELDGTSMTYRDLA
FT                   TRALRELKLELASHGTHHPVDNPASFGVHFAQVEVDTLTGLVRVTDYLACHDVGRAINP
FT                   KLLRGQILGGVQMGIGMALSEELRYDRSGRPLCGSLSRYHMPNCPDMPDVKVLLVEEGE
FT                   EGGPFGAKSIGEIATVPVAPAICNAVNMALGTSMTELPFTPERIVSAMNGGNVR"
FT   gene            complement(211568..212389)
FT                   /locus_tag="Taci_0193"
FT   CDS_pept        complement(211568..212389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0193"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; KEGG:
FT                   shl:Shal_0653 molybdopterin dehydrogenase FAD- binding"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18433"
FT                   /db_xref="GOA:D1B830"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:D1B830"
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /protein_id="ACZ18433.1"
FT                   /translation="MTHLKPTSLDQLVKSVACAPEETRYIAGGTDLVPQINRHGLPGPL
FT                   VDLTSVPELRRLQLGDQILLSSGVTFAEVAQASVPQGLRDMASMVGSPQIRNRGTLGGN
FT                   VANLSPAADAVPMLLALDARVEVLNPRDHMTRLEPLEGLLSTRGRVVQSPLDLIVSFRV
FT                   TNRWDISFFGKVGSRRQVTISKLNLAFAADLGSNVCRVFMGAIGPTPVRCPQAEEAILA
FT                   LKGRDLMEQLPRILSRAVEMAIPTRASMPYKRRAVMGLGEDLARCILTHGR"
FT   gene            complement(212386..212850)
FT                   /locus_tag="Taci_0194"
FT   CDS_pept        complement(212386..212850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0194"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: [2Fe-2S]-binding domain protein; ferredoxin;
FT                   KEGG: dps:DP2532 aerobic-type carbon monoxide
FT                   dehydrogenase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18434"
FT                   /db_xref="GOA:D1B831"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D1B831"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ACZ18434.1"
FT                   /translation="MSVRFTLNGSPVTYSPAPSERLVDMLRNLGMRSVKEGCGEGECGA
FT                   CTVLMDHRPVTSCTVMAFQAHGSEILTLEGLERMGVLHPIQRAFVDNDAVQCGFCTPGM
FT                   IMSAYALLSSNPDPTREQVAEALSGNLCRCTGYVPMVEAVLDAARRLRGS"
FT   gene            complement(212911..214628)
FT                   /pseudo
FT                   /locus_tag="Taci_0195"
FT   gene            complement(214643..215320)
FT                   /locus_tag="Taci_0196"
FT   CDS_pept        complement(214643..215320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0196"
FT                   /product="response regulator receiver and unknown domain
FT                   protein"
FT                   /note="PFAM: response regulator receiver; Helix-turn-helix
FT                   type 11 domain protein; SMART: response regulator receiver;
FT                   KEGG: bha:BH2751 two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18435"
FT                   /db_xref="GOA:D1B832"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1B832"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACZ18435.1"
FT                   /translation="MKPVRTLITEDDPMVSFIIGRLVNSLGDFLLVGQAQNGREALEQI
FT                   RAHKVDLVLLDLSMPEVDGKEVMLTIRNEDLDSDVIIITSSYRKADAVEALRLGAWDYI
FT                   VKPFSYDRLRVSLDSYKDAFRYRASLPAELAQEQLDRVFYPESRLNLYSTSGIQRGDTA
FT                   QRIMDVLSQEERPLSAGEIADKIGISRITVRKYCEALVSTGRLIAQNHYQPKGRPIKKY
FT                   QPI"
FT   gene            215428..216558
FT                   /locus_tag="Taci_0197"
FT   CDS_pept        215428..216558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0197"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: jan:Jann_2048 peptidase
FT                   M24"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18436"
FT                   /db_xref="GOA:D1B833"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D1B833"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ACZ18436.1"
FT                   /translation="MYHWSINLLEVGDLRRDRIEGLLARLSEEGMDGIFLGPSGDLTYL
FT                   TGLELFPDERCKGLMVSGAGCFGLVPLLYRQEMGERLEGIPLFVWDDREGFLGAFARGC
FT                   ASLGLVGKVIGINSGMRAVDLIEAMGVVRARYVNGSKVMDPLRRVKDPGELDLMRSASE
FT                   MADRVMWRVFESLRPGVTERQVRDLILRSFEEMGVVPSFEPIVAFGANASMPHYSGGDG
FT                   VAREGDCAVLDFGCRFKGYCSDMTRTFFVGDPSDEARRIYRVVLEAQLAGLAAVRTGVE
FT                   AQMVDRAAREVISRAGYGEFFLNRLGHGIGLEVHEGPYIVEGNSNPLEAGNVFSVEPGI
FT                   YIPGLMGVRIEDLVAVTPQGCQVLNSFPKEFMVAGR"
FT   gene            216643..218268
FT                   /locus_tag="Taci_0198"
FT   CDS_pept        216643..218268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0198"
FT                   /product="Alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /note="KEGG: bce:BC2986 alkaline phosphatase; PFAM:
FT                   Alkaline phosphatase; SMART: Alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18437"
FT                   /db_xref="GOA:D1B834"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR042085"
FT                   /db_xref="UniProtKB/TrEMBL:D1B834"
FT                   /inference="protein motif:PRIAM:3.1.3.1"
FT                   /protein_id="ACZ18437.1"
FT                   /translation="MVRRIRCWVMLLALLLVTAPADARARNVIVLMCDGTGATHTTVAR
FT                   WYKGGPLAMDQMYVGRVRTWGAESLITDSAPAATAFATGHKASDKAIGVMPWSVAMPGV
FT                   PAVTEETKARPVASVLEAAKLAGKATGIVVTSNVQHASPAAYSSHWPDRNDYNEIGEQQ
FT                   LYLGMDVIFGGGSRYLIPAEKGGARKDGEDLMEEARRLGYRVVSDRSGMMSLSSGRVLG
FT                   LFAPDDLSYEFDRPVLTPSQPSLSEMTAKAIEILSKDPDGFFLFVEGSKIDWASHANDP
FT                   VGVVSDVLAFDDAVLVALDFARRSGDTAVLVFSDHGNGGMSLGSKVTDASYSKLPLNAL
FT                   VEPLRRARLTGEGVERLLGDQRTESGIREVVASNYGITDLTDDEVKAIAQAEKGRMNYV
FT                   LGPILSRRSPIGWTTNGHTGEDLFINYYGLKEPLKTIENTDIARICAREMGVNLDEATS
FT                   RLFVDAFAVFGSMGASVRLDKSDPNNQVLVVERGRVRAEIPLSKSTMRLGGRVVSTGGL
FT                   SVLSPITGKVYVPQRAVEVFKAAM"
FT   sig_peptide     216643..216714
FT                   /locus_tag="Taci_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.752 at
FT                   residue 24"
FT   gene            complement(218334..219851)
FT                   /locus_tag="Taci_0199"
FT   CDS_pept        complement(218334..219851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0199"
FT                   /product="C4-dicarboxylate anaerobic carrier"
FT                   /note="PFAM: C4-dicarboxylate anaerobic carrier; KEGG:
FT                   shl:Shal_2586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18438"
FT                   /db_xref="GOA:D1B835"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:D1B835"
FT                   /inference="protein motif:PFAM:PF03606"
FT                   /protein_id="ACZ18438.1"
FT                   /translation="MSGPESKNKTTWMLDTYIIIFLVVAFMAALTYVVPVGKFETHEIK
FT                   YTMSGKEKTRTVLKPESFTIVKDESGNPLKKGIALFEPGGEVGFLNYVFEGLVSGDKWG
FT                   SAVGVVAFILVIGGAFGIILRTGAVENGIMTIISRLQGKEILLLPILFVLFSLGGAVFG
FT                   MGEEAIPFVMILCPVCVAMGYDSITAILVSYVATQIGFATSWMNPFSVAIAQGVSQIPV
FT                   LSAAGFRIAMWSFFTLFGIGYTLRYAKKVKENPTSSISYKTDEFFRKDISEHSSRGGNF
FT                   TLGHGLVVFTVALGIVWVIWGVVEEGYYIPEIATQFFVMGLVAGIIGVVFRLEGMKVND
FT                   IAVSFRKGAEDLVGAALVVGMAKGIVLVLGGTDPSTPTVLNTVLHYAGEAFKGLPAAVS
FT                   AWLMYIFQSCFNFFVVSGSGQAALTMPLMAPLSDILGVSRQVAVLAFQLGDGFTNLIVP
FT                   TSGVLMACLGAARMDWTQWARWQIKFQGLLFLFGSLFVVGGVVMGLK"
FT   gene            219988..220728
FT                   /locus_tag="Taci_0200"
FT   CDS_pept        219988..220728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0200"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG: eba:ebA3736
FT                   GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18439"
FT                   /db_xref="GOA:D1B836"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1B836"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACZ18439.1"
FT                   /translation="MEDQLGAMQKVESHVLSRIVSRRYLPGDRLTEPALAEELGLSRTP
FT                   VRHALSALVSDGVLVREEGRRGYLIPRLTREDMTEVFSAREVLEGFMAQKAALAATGED
FT                   IGCLRAINAKEEALANLGDVEGYCAANDEFHMAVARMARNGYLMKAFKLVYWRSQLYVH
FT                   ALIDFLPPSEDGGSQSLLEHRRIVDAIERRDPEGARRAAEEHLRSTRGYRIAFGGREAL
FT                   FLDMFEGEKRHRRGRRAPGREDRI"
FT   gene            220725..221897
FT                   /locus_tag="Taci_0201"
FT   CDS_pept        220725..221897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0201"
FT                   /product="isoaspartyl dipeptidase"
FT                   /note="TIGRFAM: isoaspartyl dipeptidase; PFAM:
FT                   amidohydrolase; Amidohydrolase 3; KEGG: bha:BH1129
FT                   isoaspartyl dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18440"
FT                   /db_xref="GOA:D1B837"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010229"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D1B837"
FT                   /inference="protein motif:TFAM:TIGR01975"
FT                   /protein_id="ACZ18440.1"
FT                   /translation="MRSYLLRGGDVFSPEPLGRCDVLCVGERIAAVGDLGGVCLPDLEV
FT                   VDVSGLVVLPGLIDNHVHILGGGGEGGPATRTPELSVEEAFRSGVTTVIGVLGTDDVTR
FT                   SVASLVAKSRGLAAEGMSAWVMVGSYQLPVATLTGSIRSDIALVEAVIGVGEVALSDHR
FT                   SSQPSFEEFVRLAAAARVGGMLKGFGGKVNVHMGDGPRGLEMLRRAARETEIPVDQFIP
FT                   THVNRNPKLFDEAVAYALEGGVVDLTTSTTPVFLAEGEVKCSLGLRRLLDAGVPVERIC
FT                   FSSDGQGSLPDFDPEGNLRGLTVGGVGSLWEEVRDSVLSEGVPLERAVPVATSSPARFH
FT                   RLPRKGSVAEGFDGDLLVVDQDLRPVHVMSRGSMAVRDRELIMRSTFSRR"
FT   gene            complement(221964..223091)
FT                   /locus_tag="Taci_0202"
FT   CDS_pept        complement(221964..223091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0202"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: dac:Daci_1010 metal dependent
FT                   phosphohydrolase; TIGRFAM: metal dependent phophohydrolase;
FT                   PFAM: metal-dependent phosphohydrolase HD sub domain;
FT                   SMART: metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18441"
FT                   /db_xref="GOA:D1B838"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D1B838"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ACZ18441.1"
FT                   /translation="MEEIASYPDAVFVKNIFSSSGSALLVPNKVPIGEILGKFRNPERL
FT                   VSSLKAEGIDQVELEFSHRVDKGVMRELLKQIDSSFETVDPKVSQEVSDTLSEVFSRLT
FT                   IDQKFNFPKGEVDRLGNMLGDEIRRTNQILYSLASADRADSYTHTHSLNVSLLAGYLAK
FT                   RLCEINRCQEPVVDKAIRAGLLFDLGKTAIPKEVLDKSEPLSDQERALIRQHPLHSERI
FT                   ARESGVDDPDILLGIRHHHERWDGSGYPDGLTEKDIPLIARILAVADTFDAMTSDRSYK
FT                   QAVSAKAAFNFVMSANETHFDPEVCKVLLSGMGIYPPGSVVELSDGTIGTVAASTEGNL
FT                   LQPKIMVKEPDGTTRIIELHKEVHRKLFIKRALDV"
FT   gene            223283..224839
FT                   /locus_tag="Taci_0203"
FT   CDS_pept        223283..224839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0203"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems periplasmic component-like protein"
FT                   /note="KEGG: afw:Anae109_4416 extracellular ligand-binding
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18442"
FT                   /db_xref="GOA:D1B839"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D1B839"
FT                   /inference="protein motif:COG:COG0683"
FT                   /protein_id="ACZ18442.1"
FT                   /translation="MDQSMALDRIGEILDRYGRELLEDPDRLQHLLEGEWGAGREWFFP
FT                   FVMAVRTAREVGYSMPLSSPMGAVVADAMVDRFGIDPETARWASSGLVLLSRRHYGSSS
FT                   EVTRSRVVDLEGVPRRRPMLSPSQILWAVMGLLWFFAALSFGVYRMLADRRPEGGEFRI
FT                   TLMAPLTGPGGPAGQAMLRAGQLAVEQVNAQGGIRGYRVRLLGFDSFAPDGAGAAEMAD
FT                   RMKAKTRPHVVVAAVGDAGALELVNWSQSTLTPVIALDAKDPKVPAVSPYKPNPFMFAL
FT                   LAGPNVEGRSLAHLVSRGLNRRRVLLVFDGGSPRSVEAQRRFESAFPAAGGEVANRFDV
FT                   SQGSLDQLQRVLDEAALAESDSAVVALVFDHRLVDLARILRLRFRGPLVGLGLPREAHL
FT                   EAFRNSWWLDDLAPGDVYVQPFVVAYRQRYKEQLPRDLVAPAVLSYDGVRWAADAISRA
FT                   SSYRPEGIRYALADTRSVPLVHATLTIDPSIHAPSSKAMALIYVGDRGPAFQRRIWVRG
FT                   R"
FT   gene            224893..226377
FT                   /locus_tag="Taci_0204"
FT   CDS_pept        224893..226377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0204"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   hha:Hhal_2209 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18443"
FT                   /db_xref="GOA:D1B840"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D1B840"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACZ18443.1"
FT                   /translation="MDRLEKFLKGKLEESPGTNCYWWKGQWRTRRDLADLVVHSRRTLE
FT                   ESGFREGMRLGLMMPNCPMVLALSIAAWSLGGAVAPLNLRSGFEGLMRLISMLDLHGVA
FT                   FMEDRPEIGEGLKQAGIPSSPCGLEGPLRPFTGRGASQLDLPDVAVIFSTSGTTGLPKA
FT                   VPISHRNIMSNVTAVIDHVEFLRPGEVLLNALPNFHTLGYSVAGMLPLIGEISQAIIPS
FT                   FIPPDQALAAINAAAVTGIIAVPTMISMLVGSVARGGERPRGVNFVISGGDKLNVEMDR
FT                   RCGELLGAPILEGYGLTECSPVVAVNRSYDKRRLGTVGPIVKGYEWQIRDLNDNLLEDG
FT                   SEGVLWVKGPSVTAGYFRDRENTQARFRDGWFNTGDVVRIDPDGYVTILDRATDIIIVG
FT                   GFNVYPQEVELCLLEHPAVAAAVAVGERNSMTGEVVKAFVVLKEGASASPRDIIDFAKD
FT                   KLPHFKVPRKVVILPELPISSTGKVSRRALREMDAQ"
FT   gene            complement(226448..226891)
FT                   /locus_tag="Taci_0205"
FT   CDS_pept        complement(226448..226891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0205"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; KEGG:
FT                   gme:Gmet_2094 MOSC"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18444"
FT                   /db_xref="GOA:D1B841"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:D1B841"
FT                   /inference="protein motif:PFAM:PF03473"
FT                   /protein_id="ACZ18444.1"
FT                   /translation="MPRTEGRVTAVCLSESKGTVKHRVDQARILEGFGLEGDAHGGDWH
FT                   RQVSLLAQEDIDMMAEKLSSIVNGSFGENIGVSGIDLSSLPIGTRIQVGEALLEVTQIG
FT                   KECHTRCQIYHTTGDCIMPRRGIFCRVLRSGLVRTGDPVTVLD"
FT   gene            complement(226878..227330)
FT                   /locus_tag="Taci_0206"
FT   CDS_pept        complement(226878..227330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0206"
FT                   /product="FeS cluster assembly scaffold protein NifU"
FT                   /note="TIGRFAM: FeS cluster assembly scaffold protein NifU;
FT                   PFAM: nitrogen-fixing NifU domain protein; KEGG:
FT                   dol:Dole_0755 NifU domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18445"
FT                   /db_xref="GOA:D1B842"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR017787"
FT                   /db_xref="UniProtKB/TrEMBL:D1B842"
FT                   /inference="protein motif:TFAM:TIGR03419"
FT                   /protein_id="ACZ18445.1"
FT                   /translation="MAYSEKVVQYFMNPVNVGELPDPDGVGEVGNPKCGDVMKIYLRIR
FT                   DGKIEDVRFQTFGCAAAIATSSMVTEMVKGKTIDEALNVTNKDVAEALGGLPPEKVHCS
FT                   LLAEQGIRAAIEDYLRRQRGESPEPTGGSCFSHHEDEEGMESRAAD"
FT   gene            complement(227345..228511)
FT                   /locus_tag="Taci_0207"
FT   CDS_pept        complement(227345..228511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0207"
FT                   /product="cysteine desulfurase NifS"
FT                   /EC_number="2.8.1.7"
FT                   /note="KEGG: sat:SYN_01251 cysteine desulfurase /
FT                   selenocysteine lyase; TIGRFAM: cysteine desulfurase NifS;
FT                   PFAM: aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18446"
FT                   /db_xref="GOA:D1B843"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D1B843"
FT                   /inference="protein motif:TFAM:TIGR03402"
FT                   /protein_id="ACZ18446.1"
FT                   /translation="MSRRVYMDHSATTPVDPKVVEAMVPFFTEHYGNPNSLHGWGKEAR
FT                   SAMDRARGQVASLIGAEPKEIIFTGGGSEADNLAIKGAAWAMRDRGRHIITSAIEHHAV
FT                   LDAFKWLGKNGFEVTVLPVDREGLVSPEDLRGAIRPDTTLVSIMFANNEIGTVQPIGEL
FT                   GGICRERGVLFHTDGVQAAGHMPLDVRSLPVDMLTMAAHKMYGPKGIGALYVRRGIKLT
FT                   PLIHGGGQEFGLRSGTENVPLVVGFGMAAEMAAERLSKGEHEREAQLRDRLIEGVLSSV
FT                   EDSFVTGSRTHRLPFHASFCIPRVEGEAMVLRLDFAGVAASSGSACTSGSLDPSHVLLS
FT                   IGLPHELAHGSLRLTLGKDTTQEDVDHVLSVLPPIIKTLRDMSPYKKA"
FT   gene            complement(228504..228944)
FT                   /locus_tag="Taci_0208"
FT   CDS_pept        complement(228504..228944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0208"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   atc:AGR_C_1499 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18447"
FT                   /db_xref="GOA:D1B844"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1B844"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ACZ18447.1"
FT                   /translation="MVPIGVNQKTQYALRALYELSVQYRAGPVKIARIAEAQRIPRKFL
FT                   EVILSELKAMGYVESLRGREGGYVLARPPWEISIGDVIRDVQGPLSPVDCLIGRGGCRL
FT                   SGQCSFRPLWARAARALEEVYDGTTFQDLVDGITAEEVSEDE"
FT   gene            229123..230847
FT                   /locus_tag="Taci_0209"
FT   CDS_pept        229123..230847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0209"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: dac:Daci_2408 phosphonate ABC transporter,
FT                   periplasmic phosphonate-binding protein; TIGRFAM:
FT                   phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; PFAM: chemotaxis sensory
FT                   transducer; SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18448"
FT                   /db_xref="GOA:D1B845"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="UniProtKB/TrEMBL:D1B845"
FT                   /inference="protein motif:TFAM:TIGR01098"
FT                   /protein_id="ACZ18448.1"
FT                   /translation="MRSQVDSTSSLLLDAIESVGIKAQQSFSDGALQGKAAEELRQGVL
FT                   SIRDRVSSLSKRMGEVSGDVMGLSEELKRLEAFSVEASQAEARSKDLIGGALGEMSQMQ
FT                   RFLEAMEASSRANQELLSGLVQAAEQVSGLLSQIGKVTRQTQMLALNAAIEAARAGEAG
FT                   RGFSVVAQEVGNLALSTQDIARRIDASMGDLKSKLAEVTRALEGTRDGLSQGSSALRTT
FT                   SSSVEEAGRAALEMGGRLKEMAQMVLRQSKLAEEVAQKTASMSQEALEAWSTTAQMDRL
FT                   LTKEAQSAKRLRDGLRSLVALVETLQGRCAQVRPQDELWVGFTPFTSPEEIRDSYGPIV
FT                   EALADRMGKRCRLFVSSDYGSLGEALRDGRLQVAWFSPLAYVVAAEKVPMRVLGIPKVK
FT                   GKPSYRGLIIARKDSGIGSIGDLRGRRFAFVDRASGSGYLYPRVLMAKSGLNPDRDLGD
FT                   VAFLGTHDRVIEAVLAGEVDAGATYTDAWDAAAKKMNLSELAIVATTDDIPKDAVAVRA
FT                   DSPEEEISRASGALLSLSTQDPRCGGAMRALGIDGFVRGDDSMYDVIREAQRMAKGS"
FT   gene            complement(230851..232185)
FT                   /locus_tag="Taci_0210"
FT   CDS_pept        complement(230851..232185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0210"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eli:ELI_01925 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18449"
FT                   /db_xref="InterPro:IPR025515"
FT                   /db_xref="UniProtKB/TrEMBL:D1B846"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18449.1"
FT                   /translation="MTPPGELPPPPVSRIQVPIWVSMEDLRSLADRGIPSEMTGSGPIR
FT                   EGAFRGIGRYRVQRQGDVAVIARDGRLTLSVPARFQAQVTGSGEVLGISIPVSVSAQGS
FT                   PVIGLSTRPRVDRDWRVAPDLKVWVQWREPPRAEILGVSMTFQGAADRFVEDTVRRRRG
FT                   EMEAWIDRELGLKGLIEERWRELQEPVALSEDPPLWLMVSPLSIRVPPVEVTPRGVLLD
FT                   VTIGARVGITTDLPASRDLTPLPSPEEGGSDGGGFRIQAAATLGYQAMNRILNRELAGR
FT                   SIPLGGRGSVKISGVEVRPNGEALTLAVQLEASEGPWFLPRRIQGTGYVTGVPRWDRES
FT                   RTIRIEEVDFDPGTIRGLARAASWVIRPELLKALEASAVFPMGERLEELERSLDAMLRD
FT                   RSIGGEVRIDGSVRRVTLDSVSVTRDGLVLLLMLEGDATLRWVPR"
FT   gene            232362..232559
FT                   /locus_tag="Taci_0211"
FT   CDS_pept        232362..232559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18450"
FT                   /db_xref="GOA:D1B847"
FT                   /db_xref="UniProtKB/TrEMBL:D1B847"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18450.1"
FT                   /translation="MYLLFRLSGLLALLGLLGAAVTGLGGAILRRLVDPRRILRLHRAL
FT                   GILGVIGGLVHGAIYWTQFR"
FT   sig_peptide     232362..232439
FT                   /locus_tag="Taci_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.440 at
FT                   residue 26"
FT   gene            complement(232611..233165)
FT                   /locus_tag="Taci_0212"
FT   CDS_pept        complement(232611..233165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0212"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: pca:Pcar_0509
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18451"
FT                   /db_xref="GOA:D1B848"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D1B848"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACZ18451.1"
FT                   /translation="MPYVDFLAIAQARYSLRRYDPRPVPREVLERCLEAARLAPSACNG
FT                   QPWRFFVADREPMRGRLAEAAFGGPYRMNSFAAKAPVLVVVVSTPLPWTARIGQFIGGV
FT                   PFAPCDAAVATEHLILQGASEGVGSCWLGFFNFKAVGSLLNLPGDLRPLFMVAMGYPPE
FT                   GLGVPERVRRPAEEVWTFLQE"
FT   gene            complement(233180..233611)
FT                   /locus_tag="Taci_0213"
FT   CDS_pept        complement(233180..233611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0213"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   gme:Gmet_3146 peptidylprolyl isomerase, FKBP- type"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18452"
FT                   /db_xref="GOA:D1B849"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D1B849"
FT                   /inference="protein motif:PFAM:PF00254"
FT                   /protein_id="ACZ18452.1"
FT                   /translation="MALKAQKDDTVKVHYLGTLADGTVFDSSEGRDPLEFVVGSGSVIE
FT                   GFDRAVIDMEEGQSKEVTIPSDRAYGPWSQELVFSLDREAFPFEPQEGMVVRLSLPSGE
FT                   DMAATVCAVEDQTVTLDANHPLAGKDLTFKITLVGIQRS"
FT   gene            complement(233678..234874)
FT                   /locus_tag="Taci_0214"
FT   CDS_pept        complement(233678..234874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0214"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: mag:amb2530 GGDEF domain-containing protein;
FT                   TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain containing
FT                   protein; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18453"
FT                   /db_xref="GOA:D1B850"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D1B850"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACZ18453.1"
FT                   /translation="MRLVDTYSLILAFIVVQLAALGALGADLMKDPERRDLSFLSGRVL
FT                   QIIGWTMIFYRDVLPDGLSVLVGNCAMFAGICLDSASLVAISGGAPRYFRRIYLSAWLL
FT                   FSGAVALEPLGLISREAMFLVGTLVHGALMVASGWFFVSCPRSSPLRRVLTGFYLSMGL
FT                   VLGFRAVWLTSISRYALSDPALPQVLSILGAFAISTVSAISYGLLKKEMALRQVRIMAD
FT                   QDPLTHLYNRRAFTRIGEDLFRRARQEGTPLWAMMIDIDHFKSINDTFGHSAGDEIIAD
FT                   LAFIMAKVLPCHLTCRYGGEEFGALLTGLSDPQALETAEMIRAEAERASVMGISYTVSV
FT                   GLAKLEGQKTMYALLDDADAALYRAKGLGRNRVEVFHQDMIPRERDLEAVSADQGIGG"
FT   sig_peptide     complement(234797..234874)
FT                   /locus_tag="Taci_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.833 at
FT                   residue 26"
FT   gene            234985..236163
FT                   /locus_tag="Taci_0215"
FT   CDS_pept        234985..236163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0215"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="PFAM: malic protein NAD-binding; malic protein
FT                   domain protein; KEGG: bha:BH3168 malic enzyme (malate
FT                   dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18454"
FT                   /db_xref="GOA:D1B851"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:D1B851"
FT                   /inference="protein motif:PRIAM:1.1.1.38"
FT                   /protein_id="ACZ18454.1"
FT                   /translation="MSDVYQRSLELHRAHRGKISVESRVPIETREDLALAYTPGVAEPC
FT                   RAIEADPAEAYRLTSKGNMVAVVTDGSAVLGLGDIGPLAALPVMEGKCCLFKHFAQVDA
FT                   VPLCVDERDPDRFVDAVAKVSVSFGGINLEDIAAPRCFEIERKLQERLDIPVFHDDQHG
FT                   TAVVVAAALMNALELLGRPLEDCRVVMNGIGAAGSSIAEMLIHLGCRDLVLCDRYGVMD
FT                   RDDPRLSDRQRELAGLTNPRRVKGGLAEALSGAQVFIGVSKGGILTREMVSSMAKDPIV
FT                   FAMANPVPEIFPEEALSAGAFVVATGRSDFPNQVNNCLGFPGIFKGALSVRAREINMEM
FT                   KLAAARAIRDVIASEVERDRVIPDALDPRVVPAVARAVAEAAVRTGVARTIG"
FT   gene            236156..236731
FT                   /locus_tag="Taci_0216"
FT   CDS_pept        236156..236731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0216"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="PFAM: methyladenine glycosylase; KEGG: azc:AZC_0402
FT                   DNA-3-methyladenine glycosylase I"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18455"
FT                   /db_xref="GOA:D1B852"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D1B852"
FT                   /inference="protein motif:PRIAM:3.2.2.20"
FT                   /protein_id="ACZ18455.1"
FT                   /translation="MAEGPIRCPWCLKDPLYVAYHDLEWGVPERDELKVFEHLCLETFQ
FT                   CGLSWLLVLRRRRHLRAALLGFDPEALASWGEGEISAALRAEGMIRCVSKVRGVVRNAR
FT                   TLLDLWDRGLRLSDLVWSPFGGETRVNRRRLGEALPPSTPESEDLSRRLRGLGFSFVGP
FT                   VVCYSLMQALGVVDDHVVECVRHPSRRG"
FT   gene            236739..238586
FT                   /locus_tag="Taci_0217"
FT   CDS_pept        236739..238586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0217"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="KEGG: gsu:GSU0910 aldehyde:ferredoxin
FT                   oxidoreductase, tungsten-containing; PFAM: aldehyde
FT                   ferredoxin oxidoreductase; Aldehyde ferredoxin
FT                   oxidoreductase; SMART: Aldehyde ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18456"
FT                   /db_xref="GOA:D1B853"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:D1B853"
FT                   /inference="protein motif:PRIAM:1.2.7.5"
FT                   /protein_id="ACZ18456.1"
FT                   /translation="MILTRFHVDLSSRRVEREDVDPVEVRRWGGGKGLALPVLLDRIGP
FT                   SVDPLGPQNVLILAAGLLTGMPFHGMCRYGAYARSPLTMGYGESEAGGFFGPGIRSQGV
FT                   DSLVLTGRADETCYLWVQDRQVSVIPDPAMAGMETGEVMDRLRDRHGDCTAVVVGPAAE
FT                   ALVRFACIVNDLHHVNGRSGLGAVMASKNVKAVACPSPRALPVQDRQLLSELQRLFAGW
FT                   RDHPGAMGLHRYGTSATLMGLNSMGMLPTRNFREGIFEGAQAIGHEALTDRYLIDRGGC
FT                   FACAVRCKRVAGGGRYGADSRYGGPEYETLASFGSLCGVDDLEAILKAHELCNRLGLDT
FT                   ISCGMSIAWLMECVEEGLVDPGDAVVSGFGDPEGMLRLIPMIASRTGVGDLLAEGTHRA
FT                   AKRLGKGSSRFCLTIKGQEMAMHDPRGKVGVALGYGVAASGADHLQVPYDTLFTNPESF
FT                   ACEAVKPLGILESMDLTGFAPSKVAAMGELWKIWGAINHLGGCYFVFAPRSYFPLERIP
FT                   DLVSAMTGWRTSLIEISKMGHRGHCAARILNRRLGQGAEDDSLPLRMHQPLPHGPFEGR
FT                   PIDPGEYRRALEMFYHLMGWDREGNPTEHTRLALGLPLD"
FT   gene            238642..239907
FT                   /locus_tag="Taci_0218"
FT   CDS_pept        238642..239907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0218"
FT                   /product="ketose-bisphosphate aldolase class-II"
FT                   /note="PFAM: ketose-bisphosphate aldolase class-II; KEGG:
FT                   gbm:Gbem_1007 fructose/tagatose bisphosphate aldolase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18457"
FT                   /db_xref="GOA:D1B854"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1B854"
FT                   /inference="protein motif:PFAM:PF01116"
FT                   /protein_id="ACZ18457.1"
FT                   /translation="MLDVNSGSYRELMRRRPLNVQARFGGEDVALVSGRDVAGAMGEAG
FT                   AIALAANARNALVIKGVLKAAKRCSAAVYIELAKSESTYCGANYENIPEYAARYSAELG
FT                   HGVVFALHVDHYGIKGEEDVLKGVSHLQHIISRGFTSVALDASHLPDYQNLCATRDLAD
FT                   WIPSGLGLEVEVGEIKGAGELSTVEEALYFIGGLNAWGVFPDYLAISNGSLHGTYDSSA
FT                   GVVEGIDLGRTKEIADAIAPYGVAIAQHGISGTPLDKVKAFRSYGIRKGNVATLFQNVV
FT                   FGLEMDPDTGNAVIRDGSYVKDPSRGVSKALWDRMVEWCDSKGMSRKSGDYKKLNLPFH
FT                   DAIMEESEDIRDRIVDEVAWWAERFMKAFGAEGTAEKVMEIALRRRDHNASPERKVLGC
FT                   RADFGPEKAPNSTKSSNGDYSD"
FT   gene            240011..241516
FT                   /locus_tag="Taci_0219"
FT   CDS_pept        240011..241516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0219"
FT                   /product="protein of unknown function DUF342"
FT                   /note="PFAM: protein of unknown function DUF342; KEGG:
FT                   azo:azo1270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18458"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:D1B855"
FT                   /inference="protein motif:PFAM:PF03961"
FT                   /protein_id="ACZ18458.1"
FT                   /translation="MSQGDDRDRSREELFAENLERFIADMDRRLSGMELGRDVVDASYR
FT                   LEVSRDRMSARLDLFPPLNGGSPLDWLVLVDRLSSEGLRGLLTEEIASAVDRCNSGQVV
FT                   KDVVVARGTPPVPSEEGRVEILFPLSMEESLDEDQDLPLHLRKVVKVRAVRSGDRLAIF
FT                   HPPKPGRNGVDVYGEEIPVEDPKDVSLFPGPGVSILEDARTYVASREGQPVLDGRTLRV
FT                   DPVFEVRGDVGVSTGNVRFDGSIVVRGNVSEGFSVVAGVDLEVFGGVFNASIQCGRDCV
FT                   VHGGVVGERASVEAMGSVLLHHLEHGRVISDGPVTVERYSLNGKISSGDRVTVKGNRGV
FT                   MGGVVIALSTVDVTSAGSPAEVKTLLAVGTSFRVQAQLERLKGELRDVVASIMRAENLV
FT                   RAVSDRVKDLSSLREDVRERIGKVMALYEGLKRQEGEIKARIAVLEEMLRSSAQNGLVK
FT                   VRGEVHPGVVVEVSGVKRYVMEPMRYVSFYLGEDGEVTFGPYR"
FT   gene            241541..242059
FT                   /locus_tag="Taci_0220"
FT   CDS_pept        241541..242059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0220"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcz:BCZK1679 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18459"
FT                   /db_xref="GOA:D1B856"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1B856"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACZ18459.1"
FT                   /translation="MSRSDTFEIRDGVPADAGRLTQIAYAAKAHWGYDPATIDQWAGPL
FT                   TVTEDYISSNRVFVACDGSGYPVGFSSLLWDQGRCELDHMWVDPPHMGLGLGRRLFEHA
FT                   VREAARAGAKWVWILSDPFAEGFYRHMGAFRIGDWPTVVTGERRIIPVMAYDIEPGAYD
FT                   RYGRVDQPR"
FT   gene            242056..243702
FT                   /locus_tag="Taci_0221"
FT   CDS_pept        242056..243702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0221"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: helicase domain protein;
FT                   DEAD-like helicase; KEGG: afw:Anae109_3468 DEAD/DEAH box
FT                   helicase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18460"
FT                   /db_xref="GOA:D1B857"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1B857"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ACZ18460.1"
FT                   /translation="MRRPDREEDLEFQGSPGEGGGLFYPWQEEACHAIGGRDAILSAPT
FT                   GSGKTWVAYRWAGLMDREGRPNMPAGRVIFTAPIKALSNERYLDLRNMGFDVGLETGDF
FT                   KKNSDAPVLCCTQEIYTLKYCRRPNQRVIVDEFHFIFGDPDRARAYMDGIRGTHRDSRL
FT                   LVMSATFGNPGTVKDYLEEMAQRDFVLYETSQRVTRLVFRRKGVKFSQIHDALVFAFSR
FT                   KGVEYVAREIARTRKRLPREDRSRLREMAYILEVDQIPEVLLKGVGIYYGSLLPKEKLL
FT                   VEMAFRERVLDVVVGTDALSLGVNLPAETVVFAQLAKFFDGPLTKNEFLQMSGRAGRRG
FT                   FFETGYVTFIPKSRCEHPDYDTERLYAKLLGAPKEPARIEVRPAVGALLRKERTYEEEA
FT                   RVVAQCSLPKREFETVLAEIEETMYLINRTVGLVKDPETRRRLKRVLGDLWFDEMSVPS
FT                   NIGAAHLFVRHGTPHALDLAEVLRREERNYLQALLKVKRYANRLPEGYSIQGLDELDQE
FT                   VNRIDPTVFGFEEKIGQLKVSEEGWDLDEEV"
FT   gene            complement(243699..244316)
FT                   /locus_tag="Taci_0222"
FT   CDS_pept        complement(243699..244316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0222"
FT                   /product="phosphoribosyl-ATP diphosphatase"
FT                   /note="TIGRFAM: phosphoribosyl-ATP diphosphatase; PFAM:
FT                   phosphoribosyl-AMP cyclohydrolase; phosphoribosyl-ATP
FT                   pyrophosphohydrolase; KEGG: son:SO_2067 bifunctional
FT                   phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP
FT                   pyrophosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18461"
FT                   /db_xref="GOA:D1B858"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:D1B858"
FT                   /inference="protein motif:TFAM:TIGR03188"
FT                   /protein_id="ACZ18461.1"
FT                   /translation="MTDRIEWGNEDLLPVVVQSARSGRVLMLAYANREALDLTLDRGEA
FT                   WFFSRSRGRLWRKGETSGNTMRVLEVRLDCDGDSILYLVEESGPACHTGERSCFHRVLK
FT                   GSGGEACLFLHRLAEIVDQRISRGDQGSYTRSLWERGASRIAQKVGEEGVEVALAVATM
FT                   DRERAVEEAADLLYHLTVALRRVDATLLDAEQVLMARHQARG"
FT   gene            complement(244313..245077)
FT                   /locus_tag="Taci_0223"
FT   CDS_pept        complement(244313..245077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0223"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="TIGRFAM: imidazoleglycerol phosphate synthase,
FT                   cyclase subunit; PFAM: histidine biosynthesis protein;
FT                   KEGG: gox:GOX0483 imidazole glycerol phosphate synthase
FT                   subunit HisF"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18462"
FT                   /db_xref="GOA:D1B859"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1B859"
FT                   /inference="protein motif:TFAM:TIGR00735"
FT                   /protein_id="ACZ18462.1"
FT                   /translation="MTMIRIIPCLDVKGGRVVKGVNFQGLRDAGDPAELGERYCIEGAD
FT                   EVVFLDIAASGEGRGTMRGWTCRVAEVMTIPFTVGGGISSPEQAVELVRAGADKVSLNT
FT                   AALRDPDLVRRCALALGSQAVVVAVDVKSSPLGFQVHACGGTEPTGISMVDWIRRVESL
FT                   GAGEILLTSIDRDGTQEGFHLEALQAAREATDLPIIASGGAGRREHFLEAARAGADGLL
FT                   AASVFHYGGIPIGDLKDFLSSHGIPVRRGVRA"
FT   gene            complement(245074..245772)
FT                   /locus_tag="Taci_0224"
FT   CDS_pept        complement(245074..245772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0224"
FT                   /product="histidine biosynthesis protein"
FT                   /note="PFAM: histidine biosynthesis protein; KEGG:
FT                   pzu:PHZ_c0042 phosphoribosylformimino-5- aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18463"
FT                   /db_xref="GOA:D1B860"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:D1B860"
FT                   /inference="protein motif:PFAM:PF00977"
FT                   /protein_id="ACZ18463.1"
FT                   /translation="MEIYPAVDLYGGKVVRLTGGRFQDATVYPTSPGEMALLFAQAGVR
FT                   WAHVVDLEGAKTGRPVHLWALEAFAGAGLKVQFGGGIRSIQSVRDALSAGATRVMMGSA
FT                   LFDRSVDVVEAHRLFGPAILPAVDHRGWRVSVKGWTQGTDIPVDRALENLSRVGFSLFL
FT                   VTDGDRDGTLSGPDLEGYRKICARYGIIAAGGIGELGHLRGLRNAGAAGAVLGKALYEG
FT                   AISIEEAMRL"
FT   gene            complement(245773..246354)
FT                   /locus_tag="Taci_0225"
FT   CDS_pept        complement(245773..246354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0225"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: predicted protein; K02501
FT                   glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18464"
FT                   /db_xref="GOA:D1B861"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D1B861"
FT                   /inference="protein motif:TFAM:TIGR01855"
FT                   /protein_id="ACZ18464.1"
FT                   /translation="MIGIVDYGAGNLENLRRALTRIGRDARVLRSPGEAEGLQLLFLPG
FT                   VGSFGSAMGSLRASGWDRALIGWAEAQRGLIGICLGMQMMMEFSFEDGGHRGLGIFRGT
FT                   VEPYRGGRRIHMGWDRVEWTQGGPGADTFYFVHRYCARSCPSQAAICGSDGEQFVAAVR
FT                   EGSVMGFQFHPERSGPEGLELLRWAIGEVV"
FT   gene            complement(246356..246925)
FT                   /locus_tag="Taci_0226"
FT   CDS_pept        complement(246356..246925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0226"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="PFAM: imidazoleglycerol-phosphate dehydratase; KEGG:
FT                   hha:Hhal_1094 imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18465"
FT                   /db_xref="GOA:D1B862"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:D1B862"
FT                   /inference="protein motif:PRIAM:4.2.1.19"
FT                   /protein_id="ACZ18465.1"
FT                   /translation="MITRCDRSTRETRISLELTHPGTGLFQVDMEPSFLTHMLEALVLH
FT                   GGMDLHGSAQGDLHVDMHHLTEDLGIVMGRCLLEIWPGSPRVRYGHAVIPMDEALVRCA
FT                   VDLSMRPGAFTSGELPRGSCGGFDGELVLEFARALSNEARITMHLDVLKGVNLHHTVEA
FT                   CFKAMGRALRQALAPAEGTMSTKGAM"
FT   gene            complement(246922..247545)
FT                   /locus_tag="Taci_0227"
FT   CDS_pept        complement(246922..247545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0227"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="KEGG: mca:MCA1964 ATP phosphoribosyltransferase
FT                   catalytic subunit; TIGRFAM: ATP phosphoribosyltransferase;
FT                   PFAM: ATP phosphoribosyltransferase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18466"
FT                   /db_xref="GOA:D1B863"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:D1B863"
FT                   /inference="protein motif:TFAM:TIGR00070"
FT                   /protein_id="ACZ18466.1"
FT                   /translation="MLTMAIPTGRSMEDAAELLTKADILPPDTDPGRRLEIPLRDMRII
FT                   LVKPQDVPPLVHMGFAQLGLAGQDVILESGARVAVLHDTGLCPCRMVIAGPPKAREGLM
FT                   NSPNRKLRVATKYVRTADQVLPQRGLRTVTVPLHGSVEIAPALGIAEVIMDIVQTGNTL
FT                   KANGLSVLMELFPVTMRLIANPGALNLQWDRIRPMLERIREVSG"
FT   gene            complement(247539..248726)
FT                   /locus_tag="Taci_0228"
FT   CDS_pept        complement(247539..248726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0228"
FT                   /product="tRNA synthetase class II (G H P and S)"
FT                   /note="PFAM: tRNA synthetase class II (G H P and S); KEGG:
FT                   acp:A2cp1_2692 histidyl-tRNA synthetase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18467"
FT                   /db_xref="GOA:D1B864"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:D1B864"
FT                   /inference="protein motif:PFAM:PF00587"
FT                   /protein_id="ACZ18467.1"
FT                   /translation="MRVPRGALNPHQELSYSMEACRMKAMEVFIRHGYRPIYPPSVQRL
FT                   DDLWEVLEPSKAGSIVPLTSPHGEPCALTFDVTVSAVLKLMRQEERRQRPIRICYAERA
FT                   FRRPDPPEESFEAYQTGAEIVGADGEGADCEAIYLADRALREMGMGDHLFVVGDPAMLR
FT                   RALRGLPRGMGQELMGALRRRDLVAYRGILDGLGDPPKAQLLRDIPNMKGDPSLLDRVR
FT                   HRFDPRELEDLDRIGEFARDSGVRIVFDLSLTRNPDYYSGPAFEIYAPDGTHLGGGGRY
FT                   DGLLRRAGLLGQAVGFSLDLTALGSKAPMEVPPPRAMVWCGPLPPSKGLEFTRRLADRG
FT                   ITFEVSWHGRAQSSMEICAMKGIRYWIDPSGGLAIHLPTGERLTVSRFIEENSPC"
FT   gene            248882..249694
FT                   /locus_tag="Taci_0229"
FT   CDS_pept        248882..249694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0229"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18468"
FT                   /db_xref="GOA:D1B865"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1B865"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ACZ18468.1"
FT                   /translation="MRIDGVIFDVDGVLVDVGGSYPRVIRRAVAWGWEALGGEVDCEGY
FT                   TDEHQRVTKAHRAFNDDYDIPWAMLCMARCRGIGPLSRSFPIPGEWEEELALFDGDDPV
FT                   PWAMERFGEPEFDGSFREAVRGFCDRLYVEGLDGEEPYFKYESPLIRRRFDHIPLPVGI
FT                   YTGRPWRELDLAFRLLGWEDFPRHLAVTPDSGILKPSPEGLRILCQELNISNPAFFGDS
FT                   ESDRAAMEAFGRGVFVAIGDSPGGDGPRFSNVEEGLDWVLSQAGGEGP"
FT   gene            249691..250779
FT                   /locus_tag="Taci_0230"
FT   CDS_pept        249691..250779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0230"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG: maq:Maqu_1024
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18469"
FT                   /db_xref="GOA:D1B866"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1B866"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ACZ18469.1"
FT                   /translation="MTFQFEAHPKRSLEKLAPYEALPSGVDLPRGDLVVMNANESPYGP
FT                   SPRALEGALGALKGGVNRYPDPSARDLTGALSAHWGVEEDRILVDNGLDGVITLLGITF
FT                   LEEGDQVLHGEVTFSVYKSLAMRLGAVSVPVPMGDRWELDLEGFLQRIADRTRLVFVCN
FT                   PNNPTGTLVSHRRMEEFMSLVPRRVLVVSDEAYGDFAGDDLPRTLELMERYPNLIMMRT
FT                   FSKAYGLAGLRVGYLIAHPSVVMAMRRAKEPYGVNAVALGAALGALEDREHLRRTVEAL
FT                   LEGRRFLEEGLERLKVPFVRSHANFVFMPLGDRAGDVFRGLVARGVLVRLFDSLGAIRV
FT                   SVGTPKENLAFLKALSEVICDE"
FT   gene            250772..251932
FT                   /locus_tag="Taci_0231"
FT   CDS_pept        250772..251932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0231"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: dde:Dde_2206 prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18470"
FT                   /db_xref="GOA:D1B867"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D1B867"
FT                   /inference="protein motif:PFAM:PF04073"
FT                   /protein_id="ACZ18470.1"
FT                   /translation="MSDANGAVFVPAQSNPAKVKDRALCSFVTSGKGAFNAKEGRLLLL
FT                   PLGLEALGGVVKRLSDWIVSQGGVMCGGAEDHGHLRSLAERYMRDHRRTLWGAHWGYQF
FT                   IFARFDSRGEVSIGKPDLPVLEVQEVEPGGLRRLWVVPSHGDALTGRELLGCQGCGALW
FT                   SGDSPLEPQVEPGEMGDLPPMEEVHTPSTSTIEDLCRFLGVEPRDTIKTVALMEDGGGR
FT                   LAAGLVPGDMGLSYAKASRALGYRVVMADDRAVRSLFGPCAGYLGPVGIQGGDIIAHDS
FT                   LRTPRPMVAGANRVDHHLRNVVPLRDFRCSFADLGALTPGSPCPRCGGSLAPRPVRVVG
FT                   EVTIPDDPGEMGFTVSSREGRESFSTVALGRVDLVALLLAMEESES"
FT   gene            251936..252922
FT                   /locus_tag="Taci_0232"
FT   CDS_pept        251936..252922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0232"
FT                   /product="Arginase/agmatinase/formiminoglutamase"
FT                   /note="PFAM: Arginase/agmatinase/formiminoglutamase; KEGG:
FT                   bba:Bd1812 formimidoylglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18471"
FT                   /db_xref="GOA:D1B868"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:D1B868"
FT                   /inference="protein motif:PFAM:PF00491"
FT                   /protein_id="ACZ18471.1"
FT                   /translation="MDLLTPPDRGLFFTKEDPKDPRMGELVIPVDQSFGDRVVSEFDAV
FT                   IIGMPEDRGVRANRGREGARLAPDEVRRHFYKLTPGFGPSLSELKIGDLGNVKVEGMTL
FT                   DEAHGALRWVVRWVSSMGIIPIVIGGGHDNSYPGLYGLSEGLKLGEGELGVVNVDQHLD
FT                   VRDLSWGGVTSGTPFYRSLEEMPTRCLRGRNFVEYAIQEGHNSPYYYEWLCERHATVMT
FT                   FDEVQGRPMETFIRALQIAGRGTRAIAVSVDIDSVRSTDAPGASAVSPNGLSSHELNKI
FT                   AYLAGRSYKVKYLDVMEISPPLDQDGRTASLGADVIFRFLKGMCERR"
FT   gene            252919..255654
FT                   /locus_tag="Taci_0233"
FT   CDS_pept        252919..255654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0233"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="SMART: AAA ATPase; KEGG: pol:Bpro_1406
FT                   transcriptional activator domain"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18472"
FT                   /db_xref="GOA:D1B869"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:D1B869"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ACZ18472.1"
FT                   /translation="MRPMKARLLGPMALWSHGEGVHLPFKKAYGLLAYVLVNRRVHRDR
FT                   LMDLLWGDVDRVKASGSLRNALYEIRRHLPPEALVPRRLWVERGPGWEVDLDLLEEGRL
FT                   PPEAGDFLEGFSLPECPLFDDWVYQVRQQVRERIRRMVLEGAGGEGDRHLMWLFRSDPT
FT                   DHRVVPVVMGALMGSNRPGEALRAFWLHRRALMEDLEDGPSEQVLELRDRVLERVLRRS
FT                   KLVGRDRELRAALDFAASPGGSVVWISGEPGVGKTRFARELVRLSYPARALWGRPTLGR
FT                   VPLWPWEDLLKGLSPIGHLPGAEEAAMRLGRVFPSLGVRGLDFQPSDAASIGVMAFRII
FT                   RQVARTEGPVWLCFDDLHRFDHPSLEALRAFLSCLGGDGGVSVALVSRRGDHPIRRHLR
FT                   SLKGRGVELLELELSPLDVRSGAAMYLALTGVELTPREAEALHASTLGLPLFIEEAAGR
FT                   SSWRTDLLSGAVEGLMGDLSGPEVELMEALSVLDGPVEVEDLREVSGLSEGAFREALRS
FT                   LLGLRLVRLEGGGEVVDVYHGIFRECVYLSMDPLVKGELHRRAGGVLGRKGDPFSVQRG
FT                   IHHMRRGGDPRGELKLRLKDLTRHMELHYELFPPLPDEALKAPSPFYGDREATLEMLDQ
FT                   VGPLVGASGGDRGYLARFLMLKGGFLLWWGEYGRGRGMVLQALELAEGLGDGVLVLGAL
FT                   RRLGYLYVQLEDHRSLGDVASRMEVASGGDLPHLGLALRLRGLSLAFAGLHREALEVFG
FT                   ESAQVFSLLGESGFRYHLNRLAAEAYRGESTFAMGRREEGLQLVRRCLEEAESLGMRRL
FT                   RPFMMSLLGRLECLEGRWAEGAWLGAEALRALDQMPWWRIDAPTLAMGALQEALEGRRD
FT                   RARSLMGEARSALGIRKPSWDSFLRLAQEELRRLSSLPEA"
FT   gene            complement(255651..256127)
FT                   /locus_tag="Taci_0234"
FT   CDS_pept        complement(255651..256127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0234"
FT                   /product="PTS system, glucose subfamily, IIA subunit"
FT                   /note="TIGRFAM: PTS system, glucose subfamily, IIA subunit;
FT                   PFAM: sugar-specific permease EIIA 1 domain; KEGG:
FT                   cvi:CV_0980 phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18473"
FT                   /db_xref="GOA:D1B870"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:D1B870"
FT                   /inference="protein motif:TFAM:TIGR00830"
FT                   /protein_id="ACZ18473.1"
FT                   /translation="MISGWFKPRELKILSPFTGILRPLSEVPDQVFSQRLVGDGLAVEP
FT                   TQGLVLSPVEGTIEVLMDSGHAFGVRTPDGVEVLIHIGIDTVNLKGEGFEALRRQGDRV
FT                   SAKEPVIRFHLDLIRQKAPSILSPVVITTGQVVRVLKDPGSSVCAGEEIISYKP"
FT   gene            complement(256124..257062)
FT                   /locus_tag="Taci_0235"
FT   CDS_pept        complement(256124..257062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0235"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypb:YPTS_2252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18474"
FT                   /db_xref="GOA:D1B871"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:D1B871"
FT                   /inference="similar to AA sequence:KEGG:YPTS_2252"
FT                   /protein_id="ACZ18474.1"
FT                   /translation="MRMLDLQASHLDRMSPAELLESIRSAEGRTVAAEVIARSRPLLGD
FT                   VSNPELAKAMGADLIILNMLDMEDPRVEGLHNPSDLESLFRSSFFHGDEPEPSNGIRLA
FT                   RALTGCPVGVNLEPLGDPGGVSLPPGRLATPENARRAAELGASFLIVTANPHTRIGVRH
FT                   IMDAVRSIRRAVPEVIIGAGKMHAAMSDSPWGDLPDLAEEMMSAGADLVLIPCPGSVPS
FT                   LSQEVFAQAADRVHRLGGLVMSTIGTSQEGSDRETIRQMALMAKIGGADVQHIGDSGYS
FT                   GMAVPENIMTLSLAIRGRRHTFRRMARSIAR"
FT   gene            complement(257068..257820)
FT                   /locus_tag="Taci_0236"
FT   CDS_pept        complement(257068..257820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0236"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /note="TIGRFAM: glucosamine-6-phosphate isomerase; PFAM:
FT                   glucosamine/galactosamine-6-phosphate isomerase; KEGG:
FT                   bsu:BSU02360 glucosamine-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18475"
FT                   /db_xref="GOA:D1B872"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D1B872"
FT                   /inference="protein motif:TFAM:TIGR00502"
FT                   /protein_id="ACZ18475.1"
FT                   /translation="MRIVVARDYEQMSRMAAIVVSSRVILQPNCVLGLATGSTPVGLYR
FT                   NLVEFYRHGDLDFSRVTTFNLDEYVGLGPNHPCSYHRYMRENLFDHVNLRPERCHIPRG
FT                   DAEDLEGECLRYEEEIRRAGGIDLQILGLGVDGHIGFNEPDVKFERRTSVVKLAESTIQ
FT                   ANSRFFDGPDQVPRHAISMGIRTIMMARRIMLLASGPEKARAVRGAVMGEVTPSLPASV
FT                   LQLHPNVTIIVDRDAASLIGDAIQRAEV"
FT   gene            complement(257817..258944)
FT                   /locus_tag="Taci_0237"
FT   CDS_pept        complement(257817..258944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0237"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="KEGG: sun:SUN_2245 N-acetylglucosamine-6-phosphate
FT                   deacetylase; TIGRFAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18476"
FT                   /db_xref="GOA:D1B873"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D1B873"
FT                   /inference="protein motif:TFAM:TIGR00221"
FT                   /protein_id="ACZ18476.1"
FT                   /translation="MKALRGVRVLTSTGDTMEATVVFDRVIRQVIPGSPDVPGAETIPG
FT                   DGLLLTPGMVDLHIHGIAGFDGCDGTPEALMAMSEALARHGITSFLPATMTLPREQIRL
FT                   ILANVGRAMESPQPGARILGAHLEGPFISPERPGAQDPKFIAAPDPDLLEEFRPVIKVV
FT                   TFAPERDPDHRGLNHMLRLGMIPSAGHSNASYREASEAFGLGVRSVTHLFNAMSPFQHR
FT                   EPGLVGAALDHRVHCEIILDGIHCHPAAVRLALKALGEDRLVPVSDSMRAADLGEGVFS
FT                   LGGQRVTVSQRVARLDNGAIAGSVITLEDAVRNLRDFTGLPLERCILMASRNPSELLQD
FT                   RSMGAIEPLRRADMVLWDRDRPVRTYVEGREVFSS"
FT   gene            complement(258955..260347)
FT                   /pseudo
FT                   /locus_tag="Taci_0238"
FT   gene            complement(260405..261133)
FT                   /locus_tag="Taci_0239"
FT   CDS_pept        complement(260405..261133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0239"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein; regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: bcz:BCZK3809 GntR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18477"
FT                   /db_xref="GOA:D1B874"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1B874"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ACZ18477.1"
FT                   /translation="MTLHKESPVPLYYQLKERLLRKIEQGELKPGDPIPSERELCEIYQ
FT                   ISRMTAAKAVSALVNEGVLVRQRGIGTFVAQPKPPCSSSRLGGFTDNIREAGLSSRTVI
FT                   ISFEEEAADGSLPERLMIQKGSPVLSVLRLRLVEEEPFSLEHAWIPKERFPDLSRELLE
FT                   GDSLYRLFREHLRRPPVLARQTIEPVLASDYEARMLEVPPRCPVLLFRRVALDETGLPL
FT                   EFSKCIYRGKRFLYEITFSI"
FT   gene            261256..262356
FT                   /locus_tag="Taci_0240"
FT   CDS_pept        261256..262356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18478"
FT                   /db_xref="UniProtKB/TrEMBL:D1B875"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18478.1"
FT                   /translation="MKLLCRCVLLLALVALTCPSRALAQGESFLVRIPLEVGRQARVEV
FT                   EGISMQVGRVESVPSRPQMNAFGASKWGQPGTVVATAVNAVHLLLGKREGRGVIVSLLP
FT                   SYTVAPASRPFSAVVVDGVGGSGLFGAYAPPVGTRVWAVLRDGSHVPLSEEVLKDAVEI
FT                   RYRVSPPEGAPLWVEIENRLGGKVRGVYQSGVKLIGEVVHPVGGIGVFEGSHYQGVGRI
FT                   RANHPGVVCVSTSPPGMMGGFQVVPEEHALSAEMRSAWYEPQWLIIRGQGPLAGRPPLF
FT                   SGFLVPGPSERDLKGRYLTPLLIPSVKVRIDGGDWVDMPPACTPEEGAILRRVTHLRIL
FT                   YPMEEAEPQWVPDQGEQEAPGDSVSP"
FT   sig_peptide     261256..261330
FT                   /locus_tag="Taci_0240"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 25"
FT   gene            complement(262353..263501)
FT                   /locus_tag="Taci_0241"
FT   CDS_pept        complement(262353..263501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0241"
FT                   /product="sodium ion-translocating decarboxylase, beta
FT                   subunit"
FT                   /EC_number="4.1.1.70"
FT                   /note="KEGG: sfu:Sfum_3585 sodium ion-translocating
FT                   decarboxylase, beta subunit; TIGRFAM: sodium
FT                   ion-translocating decarboxylase, beta subunit; PFAM:
FT                   Na+transporting methylmalonyl- CoA/oxaloacetate
FT                   decarboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18479"
FT                   /db_xref="GOA:D1B876"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:D1B876"
FT                   /inference="protein motif:TFAM:TIGR01109"
FT                   /protein_id="ACZ18479.1"
FT                   /translation="MDMAHQLLLYFGKTLSAFTYKELVMILVGLGLIYLAVVKDFEPNL
FT                   LLSMGFGTILVNIPFSSALDQLVDGKLSEGALSLLFNLGIATELFPLLIFIAVGAMCDF
FT                   SPLISNPRMFVFGLAAQGGIFLTMGLALLMGFDINEAASIGIIGAADGPTSIYVSNRFA
FT                   PHLLGPISVAAYTYMALVPLIQPPVIKLLTTRSERAMRMTYVQRDVSRFKLIAFPIVIT
FT                   VAASIVAPPSAALIGFLMFGNLLRVSGVTERLSQAAQNELANIVTILLGFTIAATMTGE
FT                   RFVNPSTLLIISMGLVAFVLDTACGILMAKGLNLFLPKHLKVNPMVGAAGISAFPMSAR
FT                   TIQKLGQEADPGNFLLMHAVGANVSGQIGSVLAGGLLLALLS"
FT   gene            263656..265110
FT                   /locus_tag="Taci_0242"
FT   CDS_pept        263656..265110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0242"
FT                   /product="glycoside hydrolase family 18"
FT                   /note="PFAM: glycoside hydrolase family 18; SMART:
FT                   chitinase II; KEGG: wsu:WS0692 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18480"
FT                   /db_xref="GOA:D1B877"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:D1B877"
FT                   /inference="protein motif:PFAM:PF00704"
FT                   /protein_id="ACZ18480.1"
FT                   /translation="MIRALFMALAGLVLPLILVPGAVGSEGVPAEQRAVEVPLYVSTLG
FT                   DRPVRFGSAIQDGERLLFPLSVLRRTGANVAFNQESKLVVMEVQRSPLIDFPVPAEGMR
FT                   LTAPGRSVNGDVYMDVAGFEPVLGIAFQPLDDGVVLMRASSRGELPLRSPLGNQIQHPF
FT                   SLVWDPLYRTDPHQDPSFPPVSVVSPSWFRIRPDGEVEFKGRASYVEGAHRLGAQVWPL
FT                   VNNGFDPSATKTFLNDPAAVNRAVARLAAYAMLFGVDGFNLDFENMDPADRDAYSAFVQ
FT                   AVAERMRPLGRKTSVDVTVESTSAFWSRCYDRRALGEAADYVMVMTYDEHWGRSPVAGS
FT                   VASLPWVQRGVEGLLRSVPAEKLLLGLPFYTREWEETQTQSGVKVRSKALSMAAAEARV
FT                   RDNSASLTWLEEAGQMYAEYRSGGKRYRIWLEDERSLALKSSLVPRYGLAGVAAWRRGF
FT                   ERPEVWAAIHNTIGAAAARSRVSTAQ"
FT   sig_peptide     263656..263730
FT                   /locus_tag="Taci_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.548 at
FT                   residue 25"
FT   gene            265188..265760
FT                   /locus_tag="Taci_0243"
FT   CDS_pept        265188..265760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0243"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: sfu:Sfum_1749 BioY
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18481"
FT                   /db_xref="GOA:D1B878"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D1B878"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ACZ18481.1"
FT                   /translation="MHSISASSSRTRHWVLAGLFAALTAVGAFIRIPIPYVPFTLQFFF
FT                   CALSGILLGSRWGFASQVIYVLMGLSGLPVFTAGGGPSYVFQPTFGYLVGFCLGGYLTG
FT                   LIWERAKARNFLWAYLAALGGLAVIYLVGVPYLWMIVDMYLGKGRGVAWAVKVGFLTPI
FT                   GGDLVLCALIAMVALRLDKLGVRLVRG"
FT   sig_peptide     265188..265274
FT                   /locus_tag="Taci_0243"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.682) with cleavage site probability 0.347 at
FT                   residue 29"
FT   gene            265765..266724
FT                   /locus_tag="Taci_0244"
FT   CDS_pept        265765..266724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0244"
FT                   /product="Biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: dps:DP2549 biotin synthetase BioB; PFAM:
FT                   biotin and thiamin synthesis associated; Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18482"
FT                   /db_xref="GOA:D1B879"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:D1B879"
FT                   /inference="protein motif:PRIAM:2.8.1.6"
FT                   /protein_id="ACZ18482.1"
FT                   /translation="MSLAISAARSVLCGGSIHVEDALELLSCPLEELEEGARMIRRALV
FT                   PAGVELCSICSVHTGGCSEDCAFCAQSTRAPGGAVVDLDLDSVISMARRARSFGVARFS
FT                   LVSSGLRAPGWVVDLAVQAAPILRDMGLSPCVSLGMLDRRDLLRLQLAGVERIHCNLEA
FT                   SPAFFPKVCSTHWWGQKMEFISMARTMGFQVCCGGIIGMGEGWEDRLALSVWSRRLGAQ
FT                   SFPVNVLDPIGGTPLEGAAPLPPEDFLRFVCVLRYIHPTARIRIAGGRRLIRPMDRRSL
FT                   EGPVDSLMTGDYLTTRGVSFQEDLEMISSLGLAPVMAR"
FT   gene            266721..267413
FT                   /locus_tag="Taci_0245"
FT   CDS_pept        266721..267413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0245"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG: eba:ebA6011
FT                   cobyrinic acid a,c-diamide synthase:dethiobiotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18483"
FT                   /db_xref="GOA:D1B880"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1B880"
FT                   /inference="protein motif:TFAM:TIGR00347"
FT                   /protein_id="ACZ18483.1"
FT                   /translation="MSGAFWILGTGTDVGKTHLSCLILRAAGAMGRRWGYFKPVGTGVR
FT                   LVDRVPMPEDGVAVSRVTGADPRDLVGLWFRFPASPHLSASLEGASIGPREEALVRDRL
FT                   DLVIRSHPVTLIEGAGGAAVPLGDGLMLAHWVARWGHPAALVAPGGLGTLSCVVTGLEY
FT                   LRSLGVDVRCVVLNRFDPEDPIHRDNARWIRDNCGVPVFTVAPEGSHGDLVGEWMETFM
FT                   EVMGLEDE"
FT   gene            267400..268746
FT                   /locus_tag="Taci_0246"
FT   CDS_pept        267400..268746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0246"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoateaminotr
FT                   ansferase"
FT                   /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   mca:MCA0017 adenosylmethionine--8-amino-7- oxononanoate
FT                   transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18484"
FT                   /db_xref="GOA:D1B881"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1B881"
FT                   /inference="protein motif:TFAM:TIGR00508"
FT                   /protein_id="ACZ18484.1"
FT                   /translation="MRMSSLVERDLRVNWHPCTQMADHQDFPPLVVTSARGVWLHLENG
FT                   GRLLDGISSWWVNLFGHCHPRLLRVLADQASRLDHCMFASLTHPWAVELSERLTALSGL
FT                   HRVFYADNGSSAVELAMKMAYHYQVNLGHPERKLFAHLSGSYHGETLGALSVGDLGLYG
FT                   EPYRGITRRNLRLEGPNCVDCSYGGTRSFCSLECLKRDVATLEAAAPEVCAVIVEPLVQ
FT                   GAAGMRMYPAGYFRGLREAAGRLGILFIDDEIAMGFGRTGRIFAYQHAGVVPDLVCLSK
FT                   GITGGMMPFSAVLATEGIYQAFYGGGLERAFLHSHSYCGNPLGCALGIEVLKMLEDMEV
FT                   TALVGRLGDRLVDLMERYFRPFRYTWDIRSLGLVGAVELRRPDGSLLPPQMRLGRQIGL
FT                   ECMRRGVLLRPLGDVIYFLPPYVIGEDELELMVRTACQAAERVLEGADL"
FT   gene            complement(269244..270830)
FT                   /locus_tag="Taci_0247"
FT   CDS_pept        complement(269244..270830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0247"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; extracellular
FT                   solute-binding protein family 3; SMART: chemotaxis sensory
FT                   transducer; extracellular solute-binding protein family 3;
FT                   KEGG: gme:Gmet_2422 methyl-accepting chemotaxis sensory
FT                   transducer with PAS/Pac sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18485"
FT                   /db_xref="GOA:D1B882"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D1B882"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACZ18485.1"
FT                   /translation="MDQRPGLGLPSGDGGGASADQMIEALSDLDGLLRSFLREQHLAVA
FT                   LASADSSGLLRELDQGRLALDKACNEMESSRRRMAEVIRDVESMKGSLEMAVQDGDRST
FT                   DMMERATRSLDEMNRSFEDVQGLVASLASVAKDVAEMLNGIERVAKQTNLLALNAAIEA
FT                   ARAGEHGKGFAVVADEVRKLAAESTGITKRIASLMEMLSKKTQETQEGIATFRELKEAT
FT                   VQEILEGARTLKGSMANLRASSTKLQDISRRVEEQGEIEGAVLERTCAIGHKISEAVEV
FT                   STAQEAKRRSLFSGLERYAKEARRNFDRFLKIRSAASVPGRITFGHDDSYAPWVYLSEG
FT                   TSKGISVEVARKAASALGLNGDFIGAPWDQVFPLLVEGRIDVILNAGWPNSYFDSFPVA
FT                   ATRPYGTFKTRIYASRKDGLGRTRDLGSLRDMKGMSVGVQRGGTGNLISILKSRGARVV
FT                   EIDNDPLSFAEHMWNRVDLVACEERVAKHLNDTIYDGLFEPVGDVLETVNVVMLVHRDR
FT                   QDLLQRLNGAI"
FT   gene            complement(270982..271203)
FT                   /locus_tag="Taci_0248"
FT   CDS_pept        complement(270982..271203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0821 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18486"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:D1B883"
FT                   /inference="similar to AA sequence:KEGG:Pcar_0821"
FT                   /protein_id="ACZ18486.1"
FT                   /translation="MSSDRIVDARGLSCPQPVLMTRRALEESGDLPLTVLVSTVTSREN
FT                   VIRFGTSKGLKVSFEETPEGDFRVTFSR"
FT   gene            complement(271220..272323)
FT                   /locus_tag="Taci_0249"
FT   CDS_pept        complement(271220..272323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dol:Dole_3245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18487"
FT                   /db_xref="GOA:D1B884"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="InterPro:IPR026366"
FT                   /db_xref="UniProtKB/TrEMBL:D1B884"
FT                   /inference="similar to AA sequence:KEGG:Dole_3245"
FT                   /protein_id="ACZ18487.1"
FT                   /translation="MNKAGGLLTSRLGPVITGVAVGVLAPLLVHLGNPGNMGICVACFT
FT                   RDIAGGLGLHRAAVVQYLRPEIPGILLGALGASLVFGEMRPRAGSSPIIRFFLGFFAMV
FT                   GALIFLGCPWRAYLRLAAGDLTAVAGIAGLIAGIALGIYFLWNGFNLGRSRPATRATGY
FT                   VMPVAMLGLLALLVASPLMGRTPDGDPTGPIFFSAQGPGAMHASVAISLVAGLLIGWMA
FT                   QRSRFCTVGAFRDLMMLKDPHLFWGIGALVVTAVITNLALGQFKLGMEGQPVAHANHLW
FT                   NFLGMVLSGLAFTLAGGCPGRQVIMAGEGDSDASVFVLGMLVGAAFAHNFTLASTPKGP
FT                   SPYVMGAWALGMAFCVAVGFLNRNENV"
FT   gene            complement(272367..273530)
FT                   /locus_tag="Taci_0250"
FT   CDS_pept        complement(272367..273530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0250"
FT                   /product="cysteine desulfurase family protein"
FT                   /note="TIGRFAM: cysteine desulfurase family protein; PFAM:
FT                   aminotransferase class V; KEGG: sat:SYN_01071 cysteine
FT                   desulfurase / selenocysteine lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18488"
FT                   /db_xref="GOA:D1B885"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010969"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D1B885"
FT                   /inference="protein motif:TFAM:TIGR01977"
FT                   /protein_id="ACZ18488.1"
FT                   /translation="MSCRVYLNNAATTWPKPPAVAEAMYRFMTHGGANLARGSASPGDL
FT                   ETMDQVLSCREELADLLGAPDGDPRYVTFTSNVTEALNVVLKGYLRPGMTVVTSSMEHN
FT                   AVIRPLRRLEASGVTVRVVQCDAEGFLPLGDLGQALQGADLAVLCHGSNVCGTLQDLEA
FT                   ISEACRLRGVPLVLDSAQTAGVEPISVEDLGLGALCFTGHKGLMGPQGVGGIVWNPHMA
FT                   EACSPLVDGGTGSFSHEEVQPNVMPDKFEAGTPNLPGIVGLRAALGWIREVGIQGIRER
FT                   EMALKGILLEGLSQIKGVQILGPRDSRRGLGVVALNHPSVDNGTLAMELSERGIETRPG
FT                   LHCAPLAHRTLGTFPQGALRLSVGYFNTEEEVRMAVGAIQEVLRSHM"
FT   gene            complement(273530..274138)
FT                   /locus_tag="Taci_0251"
FT   CDS_pept        complement(273530..274138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0251"
FT                   /product="SirA family protein"
FT                   /note="KEGG: sfu:Sfum_3402 SirA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18489"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR019870"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:D1B886"
FT                   /inference="similar to AA sequence:KEGG:Sfum_3402"
FT                   /protein_id="ACZ18489.1"
FT                   /translation="MVKVDARGQSCPKPVMMAKEAVDRGASRLEVLVDNPVSGENVTRF
FT                   LKGQGFQVTRSEGPEGILLTAERSAPPAEVPEDHPPCSCPSDAPSKAPMGLLILSRTLG
FT                   GESAELGEALMKAFLDTMRQAGTVSVVALMNGGVFLSLPDSSASDTLKEMEAQGTRVLV
FT                   CGTCTKHFGVTDRVCVGSISNMFEITSEVFAAAKPVVIG"
FT   gene            complement(274159..274380)
FT                   /locus_tag="Taci_0252"
FT   CDS_pept        complement(274159..274380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0252"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_01183 NifU -like protein involved in
FT                   Fe-S cluster formation"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18490"
FT                   /db_xref="InterPro:IPR021778"
FT                   /db_xref="UniProtKB/TrEMBL:D1B887"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18490.1"
FT                   /translation="MAGWVYCLFESASEGMMLHRRLREVGLEHHICPSPRHLTESCGIA
FT                   LKMSGELVERALEAASELKLRVRVVESN"
FT   gene            complement(274383..275117)
FT                   /locus_tag="Taci_0253"
FT   CDS_pept        complement(274383..275117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0253"
FT                   /product="CoA-substrate-specific enzyme activase"
FT                   /EC_number="1.3.7.8"
FT                   /note="KEGG: dps:DP2514 2-hydroxyglutaryl-CoA dehydratase,
FT                   alpha subunit; TIGRFAM: CoA-substrate-specific enzyme
FT                   activase; PFAM: ATPase BadF/BadG/BcrA/BcrD type"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18491"
FT                   /db_xref="GOA:D1B888"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:D1B888"
FT                   /inference="protein motif:TFAM:TIGR00241"
FT                   /protein_id="ACZ18491.1"
FT                   /translation="MILGIDAGSRFIKWALMDRHRVADLGRISSEGADLTGLPKLLPRA
FT                   SSAGVTGYGRHLLREVFPACRVLSEISAHALGARHLKGDTTLVLDVGGQDSKAIEMDRS
FT                   GRVLDFRVNDRCAAGTGRFLENMGRVLGIGVQDMIQEAIRAQRSAPVSSMCAVFAESEV
FT                   ISLLSKGTPRGEVARGIFESLRGRLEALASCLSKGDFAFTGGLSEVSGAGEALSSRSVR
FT                   LIPLPNGAYAGAIGAALAAMGN"
FT   gene            complement(275138..276409)
FT                   /locus_tag="Taci_0254"
FT   CDS_pept        complement(275138..276409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0254"
FT                   /product="2-hydroxyglutaryl-CoA dehydratase D-component"
FT                   /note="PFAM: 2-hydroxyglutaryl-CoA dehydratase D-
FT                   component; KEGG: dal:Dalk_3066 2-hydroxyglutaryl-CoA
FT                   dehydratase D-component"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18492"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:D1B889"
FT                   /inference="protein motif:PFAM:PF06050"
FT                   /protein_id="ACZ18492.1"
FT                   /translation="MADYREMWSQLGLDLELHDQLCAALPPLFEGAFLHQKDRPSGMDY
FT                   FNMVIAEVHGLRIKELVDHKRNGGFVAGSFCVYVPEELVMALGGVMVGLCAGSQFWVPE
FT                   GEKVLPRNLCPLIKAALGAKLSKTCPYFQSVDLVIAENTCDGKKKAWEEMGRLVPTHVM
FT                   DLPNRKSPEGLALWRAEVRRLVSRLEGISGRKLTYDSLLSAIDKVEAKRQALRELYETR
FT                   KADPVPISGIDALVASQIAFYDDPDRFTAMTAQLAQECAQRVQGGIGVFPKGTKRILLT
FT                   GSPIVVPNWKVHHVIETTGAVVVVEENCTGTRYFTGSVDRSPRDLDGLLDALADRYIRD
FT                   INCACFSPNDGRADDVVRLAREYKVDGVVDVTLSFCSTYQVEQGSLQRRMKAEGIPFLA
FT                   LETDYAPGDEGQMRTRIEAFLESL"
FT   gene            276764..278110
FT                   /locus_tag="Taci_0255"
FT   CDS_pept        276764..278110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0255"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: dal:Dalk_2553
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18493"
FT                   /db_xref="GOA:D1B890"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D1B890"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACZ18493.1"
FT                   /translation="MRDEILGRDPIPSLIVRFSGPAIVALLAHALYNITDRVFVGRAVG
FT                   SSGLAALSLAFPFMLAFISWGLVCGVGTSARMAISLGASDREGARRYLGNGILMALVGS
FT                   VVMLALGFWGMEGLLRSQGGSGEILPMAQRYLRVILLGAPFSVLGMTFTPVLRPMGRPN
FT                   AAMGIQLVGAFLNIALDWWWVMVLHMGVEGAAWATVASQAVQALLGAALVLNSSRIRPR
FT                   HMVPEPSRMGRIFSVGLPSGLTEMGFTIVIAIMNRQVKLYGGDAGLSALGIFFGLDALF
FT                   FLPAIGVGEGAQPIIGYNYGAGNLQRVRRAIWTAVGYAVGYFCLSLLLVQIFAPELVSL
FT                   FVKDDPVLLDMAAWGLRVSYAGAPMAGMSITAAYYFQGIGNWRAGLITAMCRIVIFVMI
FT                   PLMILPPIMGITGVWASLPVADVGGCMLGFLMVRRSLRSIGACDPSGPA"
FT   gene            complement(278147..280146)
FT                   /pseudo
FT                   /locus_tag="Taci_0256"
FT   gene            complement(280368..281201)
FT                   /locus_tag="Taci_0257"
FT   CDS_pept        complement(280368..281201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0257"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG:
FT                   acp:A2cp1_2839 aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18494"
FT                   /db_xref="GOA:D1B891"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D1B891"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ACZ18494.1"
FT                   /translation="MMLCYHDGQFTPLEKAYVPLSDYAIQRGIGVFESIRTYDRRPFAP
FT                   GPHLERLLRSAEQAGIEAREIISQIPAVFREGLGRPELQGGEIIMKPYVTGGDVMVNKR
FT                   FPNPRLYVLFEPLELPDPGLYQTGITLEPVNMERPFPLIKSINYMFGYIPVAGRGDVFE
FT                   SLFCPDGEITEASSSNFFLCVDGKLVTAPVGRVLPGITRGIVLHLAREAGFKVEERCPK
FT                   VTELDRADEAFITGSIKEVLGVTRIGGRRIGNGRPGPVTQHLHRLYRASIHKWLG"
FT   gene            281335..282336
FT                   /locus_tag="Taci_0258"
FT   CDS_pept        281335..282336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0258"
FT                   /product="Butyrate kinase"
FT                   /EC_number="2.7.2.7"
FT                   /note="PFAM: acetate and butyrate kinase; KEGG:
FT                   pca:Pcar_2852 butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18495"
FT                   /db_xref="GOA:D1B892"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="UniProtKB/TrEMBL:D1B892"
FT                   /inference="protein motif:PRIAM:2.7.2.7"
FT                   /protein_id="ACZ18495.1"
FT                   /translation="MRCLLGLNLSSRGLEFLARRDDGTTPLSGLIQLGQGDRPSASGLA
FT                   ERTVSSLGDLVVSAVAASGGFDGCTEGGVLPLSDPDRDMLASSGPMGLAPLVALELSHM
FT                   LGVEALLVEPFTAREGVRGLTGLPELPIRPLRHAPQVKWCYLRAREEGLYPPEASAVVA
FT                   YLGRGTSVCALKGGRVVDSNNPEETGPFSVAFAGSLPAMELVRRAMSGALRREDLTRLV
FT                   AGGGGVVGYLGTYDLVEVEALYHRGDQKARLVVEAMAHQLAQEMGSMAQSLGGRVDFMA
FT                   LCGGGAAFAALAERVSQRVQWIAPVLRYPEVDALESVVQLALRHLATRGQPG"
FT   gene            complement(282324..283352)
FT                   /locus_tag="Taci_0259"
FT   CDS_pept        complement(282324..283352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0259"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; NADP oxidoreductase coenzyme
FT                   F420-dependent; KEGG: afw:Anae109_4181 glycerol-3-phosphate
FT                   dehydrogenase (NAD(P)(+))"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18496"
FT                   /db_xref="GOA:D1B893"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1B893"
FT                   /inference="protein motif:PRIAM:1.1.1.94"
FT                   /protein_id="ACZ18496.1"
FT                   /translation="MGSGEKNERTGRVSVLGAGSWGTAVADLIARGGLEVTIWCRDPEG
FT                   ARRMNSSGRNPRYLTEVLLGSNVTVTHHLEEALEGAELIVSAVPAQAVRELLKASSSAA
FT                   PPSARWLNLAKGIEISTGKLLHQVFEEQLPGVSYSILSGPSHAEEVARGLPTAVVVASS
FT                   RPEDARLWQEVLNSSRFRVYASSDVVGVELGGAVKNVIAIACGMARAMRMGDNGISALA
FT                   TRGLAEMTRLASRMGADPLTLSGLAGVGDLMATCFSMNSRNLKLGMLVGSGKDLQEARQ
FT                   ELGQVAEGAFTAQAIRNHARSWGVEMPICEGVYRVLFEGELPRRLMEELLCREPKMEIY
FT                   PG"
FT   gene            283500..283991
FT                   /locus_tag="Taci_0260"
FT   CDS_pept        283500..283991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0260"
FT                   /product="protein of unknown function DUF988"
FT                   /note="PFAM: protein of unknown function DUF988; KEGG:
FT                   bce:BC1599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18497"
FT                   /db_xref="GOA:D1B894"
FT                   /db_xref="InterPro:IPR010387"
FT                   /db_xref="UniProtKB/TrEMBL:D1B894"
FT                   /inference="protein motif:PFAM:PF06177"
FT                   /protein_id="ACZ18497.1"
FT                   /translation="MWDPKVSKLSRAGLIGAAYVALTLAFAPISYGAVQFRVSEVLTLF
FT                   PFLWPEAAAGLVVGCLISNLLGGLGWVDVVFGTLATGLAAYLTMRARNEYWAALWPVLV
FT                   NGLVVGGYLSVLLGMPWYLSMAYVAVGEAGVCFGLGVPLVKALRAMPLVSRLVPPRGGQ
FT                   "
FT   sig_peptide     283500..283598
FT                   /locus_tag="Taci_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.944 at
FT                   residue 33"
FT   gene            284026..284544
FT                   /locus_tag="Taci_0261"
FT   CDS_pept        284026..284544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18498"
FT                   /db_xref="UniProtKB/TrEMBL:D1B895"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18498.1"
FT                   /translation="MSLRSKLSWKLRQLLYPEELRLPEPEFDGDQLDTLEELIQLIQPA
FT                   LISAEDVHRRDKRDLARFLAELGTGVWRVKKKVEAMKRVPKEIKEAIFALESTWESMAS
FT                   QGVQLIDHVGEVPLGMVPKVVQVVQVPGLEREMIVEALRPTIMLKGEVIQVGEVILGRP
FT                   GGEADGDPA"
FT   gene            284528..285484
FT                   /locus_tag="Taci_0262"
FT   CDS_pept        284528..285484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0262"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; Tetratricopeptide
FT                   TPR_2 repeat protein; SMART: Peptidoglycan-binding LysM;
FT                   KEGG: rpi:Rpic_2267 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18499"
FT                   /db_xref="GOA:D1B896"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D1B896"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ACZ18499.1"
FT                   /translation="MAIPHRRHHGAPKLEGLPGASGAKAVLEGYQRVEAIAALVESVII
FT                   WRAQWLVRCGDMLEAEEILFRLIYKEGSTNPQAMDLLARIYFHKGQDQKAVELWRRAAE
FT                   LQPGNFALKRTLSLAKSIEEGKRSVILAAYRMGLAVKSLMAVGGVAVLLVALSLGAKGI
FT                   ERWLRGPEPTPLEAHYYYDISKLSEPVKGTYTLGFTRVRQGTSASRGRVEVLVEQDGDS
FT                   VRAYGKVPSLLTRYQVEMALYAMEGIKNVDLRGLQVERSYTVQRGDSLWLISRRLYGEG
FT                   QAWTVLSRHNGLSDPSRLKVGQVLNLPLGDEELVPDR"
FT   gene            285484..285774
FT                   /locus_tag="Taci_0263"
FT   CDS_pept        285484..285774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18500"
FT                   /db_xref="GOA:D1B897"
FT                   /db_xref="UniProtKB/TrEMBL:D1B897"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18500.1"
FT                   /translation="MARSFEDRMGCVEAILRVGLLWGGYLIYSLAVRALWPGLSLDLRP
FT                   VTPLKLLIALAGLWGCFKVSGLVTLRTMGCLRHRMESGEDAGGDVSAGPPA"
FT   gene            complement(285727..287088)
FT                   /locus_tag="Taci_0264"
FT   CDS_pept        complement(285727..287088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0264"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="PFAM: CHASE4 domain protein; SMART: PAS domain
FT                   containing protein; KEGG: dvm:DvMF_1907 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18501"
FT                   /db_xref="GOA:D1B898"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR007892"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D1B898"
FT                   /inference="protein motif:PFAM:PF05228"
FT                   /protein_id="ACZ18501.1"
FT                   /translation="MREVRFKVPLMFTLLFLALSGILYLSLLARADRVLYQLELSNGIK
FT                   GGEAVRNFLDHQARQLDLLCLDWASWDQMYHFVEGRMESFERQILSYESLENAEVSHGA
FT                   LFRRDLTVVWHGKPEGRIRSVVPCAPEELTKLRETVIRAERYGYARGLTVMSDRILMVS
FT                   ARQVKDTAMGLPYNGWLVLARPLASAGELRRVLPSLVDVRPSQVAMEPKVVTVPVSPSV
FT                   METRVPLMDITGRWSMEARLRVDRWIAMGLRELMGMVLVGIAMLGVSLGTAIFLWHRTS
FT                   ISQPLEEMRRRISRMISEGGLRPLEAPSEELESVVGLANLLIRHCTTMERRLIGENRRI
FT                   REILDGMDLLVALCTTSGDVTFANRAMRDLFDSLEPLVGRKIWEIGDVEDRERIRDRFL
FT                   ATAEGAPQLIRVHLREKRTSMVMNMSHVHRVGGDGEVLVLCRRSSAHIPPGIFA"
FT   sig_peptide     complement(286993..287088)
FT                   /locus_tag="Taci_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.885 at
FT                   residue 32"
FT   gene            287258..287623
FT                   /locus_tag="Taci_0265"
FT   CDS_pept        287258..287623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0265"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: dvm:DvMF_0226 response regulator
FT                   receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18502"
FT                   /db_xref="GOA:D1B899"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D1B899"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACZ18502.1"
FT                   /translation="MALRFLVADDDVSSGRLFRIYLEDMGEVVLAEDGQEALRLFEEAL
FT                   DLGNPFDGVVLDMLMPRADGAEVLEGIRTLESSRGLKPVPVVVISALDQEEVEEAMARD
FT                   PMVAMVQKPVLKGLMSG"
FT   gene            287640..288314
FT                   /locus_tag="Taci_0266"
FT   CDS_pept        287640..288314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0266"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent, beta
FT                   subunit"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: bha:BH2497 L-serine dehydratase beta subunit;
FT                   TIGRFAM: L-serine dehydratase, iron-sulfur- dependent, beta
FT                   subunit; PFAM: serine dehydratase beta chain; amino acid-
FT                   binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18503"
FT                   /db_xref="GOA:D1B8A0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004643"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8A0"
FT                   /inference="protein motif:TFAM:TIGR00719"
FT                   /protein_id="ACZ18503.1"
FT                   /translation="MALEEIVGPVMVGPSSSHTAGAVRLGNLARLCWGGEVTDVDIYLR
FT                   CSFAATFWGHGTDRALLAGLMGFSPSDEALKDSFRIAAERGVRYRFHGEKVDGAHPNSV
FT                   RFVIREGERTMEVVGASLGGGAVELQEVDGFVLRATGELPTMVTFHRDEPGVIAAVTAI
FT                   LAEAGINVGSMNVHRQGRGKGAAMVLELDGLPPEQVVERIKGCHSAIRRLMLIPAGGEE
FT                   VR"
FT   gene            288311..289183
FT                   /locus_tag="Taci_0267"
FT   CDS_pept        288311..289183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0267"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent,
FT                   alpha subunit"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: bcr:BCAH187_A4271 L-serine dehydratase, iron-
FT                   sulfur-dependent, alpha subunit; TIGRFAM: L-serine
FT                   dehydratase, iron-sulfur- dependent, alpha subunit; PFAM:
FT                   serine dehydratase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18504"
FT                   /db_xref="GOA:D1B8A1"
FT                   /db_xref="InterPro:IPR004642"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8A1"
FT                   /inference="protein motif:TFAM:TIGR00718"
FT                   /protein_id="ACZ18504.1"
FT                   /translation="MRSFESILERCRSLPLPEAILSMEEEERGLPRDVIAGRMLDRLRE
FT                   MKSSVLSVEQRPPRGRLVGGEGEALEAYRRSQGALSGDLVATACSMAMKVAVGNAAMRR
FT                   IVACPTAGSCGIVPGVLGAYSRLNDPSEEELLKALIVAGAVGSVIAQRATLAGAEGGCQ
FT                   AECGAAAAMAAAALTYLRGGDPEAVFHSSALVLQSIMGLVCDPIAGLVEVPCVLRNGTM
FT                   VGMAVLCSDLAMAGIRSTVPPDEVVDAMDSVGLALPSALRETSEGGLAATPTGQRIARQ
FT                   LLSEAPRLD"
FT   gene            complement(289219..290307)
FT                   /locus_tag="Taci_0268"
FT   CDS_pept        complement(289219..290307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0268"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="TIGRFAM: sugar fermentation stimulation protein;
FT                   PFAM: sugar fermentation stimulation protein; KEGG:
FT                   sat:SYN_02078 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18505"
FT                   /db_xref="GOA:D1B8A2"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8A2"
FT                   /inference="protein motif:TFAM:TIGR00230"
FT                   /protein_id="ACZ18505.1"
FT                   /translation="MNQPMSPTDPDPITGTFVRRLNRFVALVQPSGSEPVQAHLPNPGR
FT                   LLELLFPGQRVMLLPSGGSKPYRIYGTFRYGDFVYLDTVAMNRVAEDLIRRELIAPLQG
FT                   MTVKGREVRSQDSRFDLLLGGPQGDMLLEVKTCTLFTRDTAFFPDAPSERAARHARHLS
FT                   HLTGQVRTGILFLVQSPSPTRFLPDWHTDPDFARALLDAREAGVSTMAVGIHLDHRLEL
FT                   LQEPRELAIPLEGVRPHLADRGAFLAMMAHGGQQGLQEGEELTVHVSPHGDLLSRRMGA
FT                   FSRWAQRTSKADPAGPNLVRIFPVRSADPVTDRLAEGLAALGGREVAGGPTLGRDFKVS
FT                   LGPGTPREIFELVLEVRAGIDI"
FT   gene            complement(290366..291322)
FT                   /locus_tag="Taci_0269"
FT   CDS_pept        complement(290366..291322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0269"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="KEGG: bcb:BCB4264_A0423 carbamate kinase; TIGRFAM:
FT                   carbamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18506"
FT                   /db_xref="GOA:D1B8A3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8A3"
FT                   /inference="protein motif:TFAM:TIGR00746"
FT                   /protein_id="ACZ18506.1"
FT                   /translation="MAATKVVVALGGNALQEAGTPPTAEAQLEVVKKTATYLAEISKRG
FT                   YEMAVVHGNGPQVGRIVLSQEIAAQANPETPAMPFDVCGAMSQGYIGYQIQQALRDALR
FT                   NRNLNIPVVTLVTQVVVDANDPAFKNPTKPIGPFYTEEEAKKLMAEKGYVMKEDAGRGW
FT                   RRVVASPEPKKITEISAVKRLWDTTIVVTAGGGGIPVVENMDGSLSGVAAVIDKDLAAE
FT                   KLAEEIEADILLILTEVDKVCINFKKPNQQELSHMTVAEAIKYMEEGHFAPGSMLPKVM
FT                   AAVKFARTFPGKKAIITSLYKAVDALEGREGTVVTMA"
FT   gene            291539..292012
FT                   /locus_tag="Taci_0270"
FT   CDS_pept        291539..292012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0270"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: aba:Acid345_0634
FT                   transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18507"
FT                   /db_xref="GOA:D1B8A4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8A4"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACZ18507.1"
FT                   /translation="MQVEKCLDEVGRKILRALQEDARISYSELGRKVGLSSPAIAERIR
FT                   RMENAGIIKGYKAVVSYEKLGFPITAFIRIAIPASRIHEADQIAERIPEVLECHHVTGT
FT                   DGIILKVVVSSVGHLEEVVNQMGFYGQTTTSVVLSSPITGRVVEPASSDREDD"
FT   gene            292014..292529
FT                   /locus_tag="Taci_0271"
FT   CDS_pept        292014..292529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0271"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: dvl:Dvul_0809
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18508"
FT                   /db_xref="GOA:D1B8A5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8A5"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACZ18508.1"
FT                   /translation="MNDMIRTILSRRSIRRFRPGEVGEEVISLLLQCACAAPSAANSRP
FT                   WHFIVVTDRQVLDRMADAHPYGKMLFQAQLAIVVCGDPTKNDYAARYWEEDCSAAMQNI
FT                   LLGATALGLGSVWLGVKHSPEREAAMRMILSVPDHIAIMGIAAIGHPDEEKEPHRGIDE
FT                   GVVHRDRW"
FT   gene            292635..295085
FT                   /locus_tag="Taci_0272"
FT   CDS_pept        292635..295085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0272"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: bha:BH0007 DNA gyrase subunit A; TIGRFAM: DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18509"
FT                   /db_xref="GOA:D1B8A6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8A6"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ACZ18509.1"
FT                   /translation="MEKGNGSSDLFQKVIPLPLEEEIKHSYIDYAMSVIVGRALPDARD
FT                   GLKPVQRRILYAMRELGLRHSQPFKKSARVVGETMGKYHPHGDAAIYETMVRMSQDFSM
FT                   RYPLVDGQGNFGSIDGDPPAAMRYTEARLHSLGEEMLADIDEDTVDWLPNFDESLEEPA
FT                   VLPSRIPNLLVNGSTGIAVGMATNMPPHNLREVVDACCTLLDNPDVEVGELMTHVPGPD
FT                   FPTGGVIMGRDGIIDAYTTGRGKIVVRGCAEIEDAKRGKKAIVITQIPYMVNKSNLIET
FT                   IVKGVQAGQLDGITDVRDESNREGIRLVLELHRDSDPHLVLRQLYSRTQLQTTFGVINL
FT                   ALVDGRPVELNLKGLLQIFIDHRRMVVRRRTQYRLRKAEERAHILEGLVKALDMIDMVI
FT                   ALIRSSEDPLVAKGRLVEELGFTEAQAQAILDMRLQRLTSLEKHKLQEELAELMAQIAR
FT                   YRLILGDPAELDSVVREELLEVKRAYGDERRTVIEDSVDDVSYEDLIPETEVVVAMTRD
FT                   GFIRRMPLQDYRCQARGGKGVKGAAVKGEDEVSLVAVTTTHRSLYLFTDRGRVFSLKCL
FT                   AIPEPKSGRGKHVSTFISLDEGESVVTFRDSALEGARFVFLVTKMGLAKRLPVGELEGI
FT                   TRAGRRILGLEEDDTIARVRFTGGEDQLLLTTAKGQTLRVSETEFRPQGRAAKGVRGIK
FT                   LDPDDLVVGCDVIMPGRQVLFISQLGMGKRTRYEEFTVHHRGGMGVRAMRLGERTGHLV
FT                   GAWGVADDDEIMVITSRGRVVRFSARDVSSLSRSAMGLTLVRLDEGDQVADVTVIRCSM
FT                   EEGE"
FT   gene            295082..295699
FT                   /locus_tag="Taci_0273"
FT   CDS_pept        295082..295699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0273"
FT                   /product="phosphatidylserine decarboxylase related protein"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: sat:SYN_00913 phosphatidylserine
FT                   decarboxylase; TIGRFAM: phosphatidylserine decarboxylase
FT                   related protein; PFAM: phosphatidylserine
FT                   decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18510"
FT                   /db_xref="GOA:D1B8A7"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8A7"
FT                   /inference="protein motif:TFAM:TIGR00164"
FT                   /protein_id="ACZ18510.1"
FT                   /translation="MINRHGLPSIGAVLFMMAGAWFISRPVSLALALPLGFLFWFYRDP
FT                   ERRPPEDPSVWVSPADGKVVEIQPIDDPVVGRCCKVGIFMSPLDVHVNRMPFQGEVFHL
FT                   RYVPGRKWLAFEPKASENNERLYVGIRTPHGDAMLVQIAGLLARRIVAWAPVGSRFARG
FT                   ERYGMIKLGSKVDLYLPASVEPVVSLGQRVRAGETPVGVVKS"
FT   sig_peptide     295082..295174
FT                   /locus_tag="Taci_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.593 at
FT                   residue 31"
FT   gene            295696..296424
FT                   /locus_tag="Taci_0274"
FT   CDS_pept        295696..296424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0274"
FT                   /product="CDP-diacylglycerol/serineO-phosphatidyltransfera
FT                   se"
FT                   /note="TIGRFAM: CDP-diacylglycerol/serine O-
FT                   phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; KEGG: wsu:WS0623
FT                   phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18511"
FT                   /db_xref="GOA:D1B8A8"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8A8"
FT                   /inference="protein motif:TFAM:TIGR00473"
FT                   /protein_id="ACZ18511.1"
FT                   /translation="MRRRFKRDLPFRKIVPNMITSGSVLCGFLALALCYYDRFLPAAWL
FT                   VGVAVIFDYMDGRVARMLGGSSDFGVELDSLADALSFGAVPAFMTYSAYVGLEGGLIGA
FT                   LSGAFFTLCGVLRLARFNVTHVVGPFQGLPIPAAGLTLVSFVMGGIYIPWWAASALMAV
FT                   LGGLMVSRVPYGNLKKVHRGDLNRLRATALLVTLGVVSVVLKERAPVVLCFTYVLSGPV
FT                   GLDWGRWLVKKESVEAEGKI"
FT   sig_peptide     295696..295794
FT                   /locus_tag="Taci_0274"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.821) with cleavage site probability 0.786 at
FT                   residue 33"
FT   gene            complement(296483..296995)
FT                   /locus_tag="Taci_0275"
FT   CDS_pept        complement(296483..296995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0275"
FT                   /product="proton-coupled thiamine transporter YuaJ"
FT                   /note="TIGRFAM: proton-coupled thiamine transporter YuaJ;
FT                   KEGG: bsu:BSU30990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18512"
FT                   /db_xref="GOA:D1B8A9"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8A9"
FT                   /inference="protein motif:TFAM:TIGR02357"
FT                   /protein_id="ACZ18512.1"
FT                   /translation="MDNTRVRMLTEGAVAAALSLALSFLKVFQMPQGGSITLEMVPLLA
FT                   FAAMRGVRAGAMCGATSGLLQMMLNGYVVNPVQAVLDYPLAFGLLALGGLQTRDLKGTA
FT                   LAMILAGLARLTCHVLSGVIFFASFAPEGSNVWVYSITYNATFLVPSLAISMLIALPLV
FT                   RRLKGRI"
FT   sig_peptide     complement(296906..296995)
FT                   /locus_tag="Taci_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.600) with cleavage site probability 0.581 at
FT                   residue 30"
FT   misc_binding    complement(297052..297158)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam(RF
FT                   00059), score 65.61"
FT   gene            complement(297232..298557)
FT                   /locus_tag="Taci_0276"
FT   CDS_pept        complement(297232..298557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0276"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="KEGG: hha:Hhal_2178 UDP-glucose 6-dehydrogenase;
FT                   TIGRFAM: nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase; UDP-
FT                   glucose/GDP-mannose dehydrogenase dimerisation; UDP-
FT                   glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18513"
FT                   /db_xref="GOA:D1B8B0"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8B0"
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /protein_id="ACZ18513.1"
FT                   /translation="MRISVIGTGYVGLVTGACLAGFGNRVVCVDVDQEKVRMLNQDRVP
FT                   FYEPGLEDIIRNNRTAGRLGFTCSLEEGIRGASVCFITVGTPSDVDGSADLQYVLAVAR
FT                   QIGAHMEEPLVVVTKSTVPVGTADKVRAAIREELEARGVQIPFTVASNPEFLREGAAVS
FT                   DFMCPDRVVIGTDDPATEETLKELYSFLPPEKVLCMDIRSSEMTKYAANAMLATKISFM
FT                   NEMARICELVGADVEKVRLGIGSDSRIGYAFISPGCGYGGSCFPKDVRALRHTALRHGY
FT                   SPRILQAVEDVNESQKHVIFQKILRHFGQDISGLTFAIWGLSFKPNTSDMREASSVTLI
FT                   QDLLGAGARVRLHDPKAMDEARHILEGRSGVTFVEDQYEAIKGAQGLALVTEWDVYKQP
FT                   DFQRIREEMESPVIFDGRNQYSPQEMRRLGFTYYAIGRPNKG"
FT   gene            complement(298595..299491)
FT                   /locus_tag="Taci_0277"
FT   CDS_pept        complement(298595..299491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0277"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   gme:Gmet_0882 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18514"
FT                   /db_xref="GOA:D1B8B1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8B1"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ACZ18514.1"
FT                   /translation="MKILALKVDVDTLRGHREGVLNLLNLFDRLSLKASFFFSMGPDNS
FT                   GKAIVRIFRKGFLGKMLRTKAPSTYGFKTLFYGTLIKAPMIAQSFPGLLKETARRGHDF
FT                   GIHAWDHVKWQDRIHKLPVTTIEADLRRAFDLFYQYTGHQPRSFAAPGWQVSQDALLVL
FT                   DSMRLRYTSNTRGLFPYVPRWGRKAFSTLEIPTTLPTMDELLGRRGLKGEEMARHLASL
FT                   LKEGLNVFTLHAEMEGLSQIGVFESFLRSAMDQGAKCVPLSFVADQIPRDELPRCEIGI
FT                   GTVEGRAGTLAVQATEA"
FT   gene            complement(299503..300501)
FT                   /locus_tag="Taci_0278"
FT   CDS_pept        complement(299503..300501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0278"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   gbm:Gbem_2983 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18515"
FT                   /db_xref="GOA:D1B8B2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8B2"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACZ18515.1"
FT                   /translation="MKKVLILGANGFIGSHLCEKILEHTDWEICALDVGSHNLSGVLES
FT                   PRVEFVESPMGSAWDWIRDRAREAFAVVPLAGIARPAMYIEDPLYTYELDFEENLKVVR
FT                   ICAELRQWVIFPSTSEVYGMCPDRELKEDESNLVLGPIRNVRWIYSCSKQMMDRVIWAM
FT                   GISKGLPFTLFRPFNWIGPRQDDPRTPKGNRLVPQMLGNIIRREPIRLVNGGHQRRSFT
FT                   DIEEGVMGILSILRNPDAAVGEIFNLGNPRNNHSVREVALALVRAASRIPGYEYALEIP
FT                   LVEVSGEEHYGKGYEDVQDRLPSVDKAASKLGWVPKATLDEILDRTVRYYL"
FT   gene            complement(300554..301483)
FT                   /locus_tag="Taci_0279"
FT   CDS_pept        complement(300554..301483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0279"
FT                   /product="formyl transferase domain protein"
FT                   /note="PFAM: formyl transferase domain protein; KEGG:
FT                   gme:Gmet_0884 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18516"
FT                   /db_xref="GOA:D1B8B3"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8B3"
FT                   /inference="protein motif:PFAM:PF02911"
FT                   /protein_id="ACZ18516.1"
FT                   /translation="MRPRVAVCAYSQVGTRCLESLLELGANVVALFTHQDNPSENLWFR
FT                   TPDRVAERHRIPVIRDSLRSPEGAMALRELKPDLLLSFYYRDMIPGELLEIPPLGAFNV
FT                   HGSLLPRYRGRVSVHWAMIMGEMRTGATLHVMTPRPDDGPVVDREEVPIHLHDTSRDVM
FT                   ERLAEAAHRLIRRAYPTLEDGSYRAVPQDQGAASYFGGRRPEDGLIQWDREDSLGAYHM
FT                   VRALTRPYPGAFSTLADGRRLTIWRAHPLPEKAVPRAEPGTLMEDPEGYVLVRCMAGAL
FT                   RILEAELDGRCGHPLDLGLGDMRGQLLG"
FT   gene            complement(301480..302418)
FT                   /locus_tag="Taci_0280"
FT   CDS_pept        complement(301480..302418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0280"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gme:Gmet_0885 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18517"
FT                   /db_xref="GOA:D1B8B4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8B4"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACZ18517.1"
FT                   /translation="MIDVSIVIPVYNEEESLPDLFGRLFPVVEALDRPAEVIFVNDGSS
FT                   DGSLRMLLEEARRKDYVRVVDFNGNFGQHMAIMAGFSMARGDKIITLDADLQNPPEEIP
FT                   RIVAEMDRGHDMVGTYRAMRKDPAITRKIPSKLVNWVTNRITGLNIRDYGCMLRGYDRR
FT                   IVDLINMCKETTTFLPALGKRFAQNPVEIPVSHEERHKGTSKYGLYQLIRLNFDLMTGF
FT                   SMVPLQAVTITGLLVSVGSLVFALYLLIRRLLVGSEAEGLFTLMAINFFLMGILLFGVG
FT                   IAGEYVGRIYLEVRQRPRYLIRAVYPEDPKP"
FT   gene            complement(302415..303566)
FT                   /locus_tag="Taci_0281"
FT   CDS_pept        complement(302415..303566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0281"
FT                   /product="Glutamine--scyllo-inositol transaminase"
FT                   /EC_number="2.6.1.50"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; KEGG: glo:Glov_3272 DegT/DnrJ/EryC1/StrS
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18518"
FT                   /db_xref="GOA:D1B8B5"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8B5"
FT                   /inference="protein motif:PRIAM:2.6.1.50"
FT                   /protein_id="ACZ18518.1"
FT                   /translation="MRESFLPFSRPSIGEEEVSAVREVLLSGWITTGPVTQRFEEEFAR
FT                   LVGAAHGVSVSSATAGLQIALMALGVGPGDQVITTPMTFAATVNAIIYTGATPVLVDVE
FT                   GDTLNMDPSKIEGAITDRTRAIMPVHFAGLPVDLDPIREIASRHRLHLVEDCAHAIGSA
FT                   YKGRPIGSSPSPLGVFSFHPAKNMTTAEGGIIVTDREDLADACRVMRQHGMSKGAWKRF
FT                   AQSGRPDYEIVSPGIKANLTDLQSAIGLEQLKKLSHFQERRSQIAQIYDSELRGLKGLI
FT                   TPGTPRYPHVHGHHLYWVMLKTEELGMSREEVMARLKEMNIGTGVHYKAVHHHVRYREF
FT                   GWSDQDLPNASYASSRVMSIPLFPEMTREDAMDVVRALWEVCR"
FT   gene            complement(303595..305274)
FT                   /locus_tag="Taci_0282"
FT   CDS_pept        complement(303595..305274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0282"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   gme:Gmet_0887 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18519"
FT                   /db_xref="GOA:D1B8B6"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="InterPro:IPR040845"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8B6"
FT                   /inference="protein motif:PFAM:PF02366"
FT                   /protein_id="ACZ18519.1"
FT                   /translation="MSTFRSHAAALAALVTLLSLVYFYNLGGWGLIEPDEGRYSEIPRE
FT                   MIASGDWVTPRLNGVKYFEKPVMYYWMVASSLKAFGPSELSARIPCAASALLGAMGTYA
FT                   MGASYGPSAAFLGAFITGTGFLWFALAHITLTDMALGAFMTLSMVLIFKGLTGSRPALW
FT                   LGYAAMGLSVLTKGLIGIVLPGLVFLTWIALTRRWRLILKGISPVGILAFLGVAGPWFY
FT                   RVIKANPDFAWFFFVHEHLLRYSTMVSNRYQPWWFFLAILPVALLPWTGTVLQGVVSAL
FT                   GELRYLRSDVSSRIRDHETPSEAEEALFMLLWAAVILAFFSASRSKLIPYMVPAMPPLG
FT                   LLGGIFLDRGLYGRRYGAVSLGFGITAVLMVLLGAALIVYPSYQDRFDPQALRQLGAVV
FT                   GSVTIACGVIPLGVALMRRSPVAIGCVAAIVFLLAMKQVFPLVAQARSPKALASMAQPL
FT                   VTPDSRVIIYKDYDQAIPFYLNRTVTLVQEGGDYGELTFGYRAERPSWFTDPKGLQEMW
FT                   QAEACVMILRPEHLQEIQQLGLKYQVAGQDPAYYGKMILVNR"
FT   sig_peptide     complement(305191..305274)
FT                   /locus_tag="Taci_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.821) with cleavage site probability 0.551 at
FT                   residue 28"
FT   gene            305402..306664
FT                   /locus_tag="Taci_0283"
FT   CDS_pept        305402..306664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0283"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: gsu:GSU1033 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18520"
FT                   /db_xref="GOA:D1B8B7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8B7"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACZ18520.1"
FT                   /translation="MRFLRSFRSSVRIWFILVLGLAVALGSHWLPTPFAVGLAAAYLLV
FT                   AGLVGHSIYAPVGDMERGMREISSRLDLTFRTFTWAGDEVGEVSRSVNSFLTALDEAMG
FT                   KVKGAHGRNEQAASKLAEASNRLGQLAGEVVRSIGDSRARVSRAASSIEEINAGVEEVA
FT                   AGAQTVAQRSSDMAEQAASATRAGEAGLASVKEATEVIGSLAEEAVGSSKRVRELAERA
FT                   HQIQSIVGSISQIADQTNLLALNAAIEAARAGEAGRGFAVVAEEVRKLAEESNQAAKNI
FT                   AQLAGVIVNDLEEVVRSVDRTAERADLARERAASVDSSIRSIQESLRSISMATQDMAAV
FT                   AQEQAASSQEIAESVQGAADMVMEVDRAFEVLARVSEEFKGATGSVEGAMRDLEATAKE
FT                   LGRAIGAFKISGASSVPALRG"
FT   sig_peptide     305402..305509
FT                   /locus_tag="Taci_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.396 at
FT                   residue 36"
FT   gene            306677..307588
FT                   /locus_tag="Taci_0284"
FT   CDS_pept        306677..307588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0284"
FT                   /product="Cache domain protein"
FT                   /note="PFAM: Cache domain protein; KEGG: rpi:Rpic_0536
FT                   methyl-accepting chemotaxis sensory transducer with cache
FT                   sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18521"
FT                   /db_xref="GOA:D1B8B8"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8B8"
FT                   /inference="protein motif:PFAM:PF02743"
FT                   /protein_id="ACZ18521.1"
FT                   /translation="MIREGEIPLPFLLARVVVAGRVCDIYLSRLWAASPGFRPRGDGTV
FT                   NSVRGRLIGVFLLVSLLALGSLGYVTLHRTEALLTEGAQREGMALAEGASAKTDALIGR
FT                   LLALLEFQAQRPEVLGMDWTVQRDALAAGSKGAGFLDVFVLDPAGKGRSISGKEGDYSD
FT                   RGYFKEVLSTRRSYVADPVISKSTWESVVVFAVPIVKGPELRGILMATMRTKDLAAFAA
FT                   SMRWAKTGYAFIVDRKGLIAAHPNAELVGKLNLAEAGEKVPRNLRRRSAPLLGGVRRLG
FT                   STPSMGRIPWGPLCPFGAPGGV"
FT   gene            307588..308823
FT                   /locus_tag="Taci_0285"
FT   CDS_pept        307588..308823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0285"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: bha:BH3915 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18522"
FT                   /db_xref="GOA:D1B8B9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8B9"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACZ18522.1"
FT                   /translation="MLLAPLSEVLAPVRALRVLVLSSLVLLSLLVLAASVWMGNSMSRP
FT                   IAAVVEGMGRIARGDLSVRLEVRSSLREVSDLVSCINGTTEAMRRSVLGILDASQVLLS
FT                   KAQDVSSSAEELAAGASEVASMAGRVSSNVQDTVAAIEETTAGVNEVSLAAQEGAKGAM
FT                   GAGEEAEAISHLAQMGGRSVEEMAALMGRMSESGRAVSSAIEDLASSVGQISGFVSTIS
FT                   QIADQTNLLALNAAIEAARAGEAGKGFAVVAEEVRKLAEESNQAAAQISGLIDQVTSKT
FT                   RGALEHTRSSGEQLEAVVAKTYETRDVILDVVQKVGAISDRVRSIASAMEEQSASAEEM
FT                   NAGMDSISRSSQEVAEQTLRITQTMEEQRRAVEALAGAAEELLSLSESLRSSVSAFKVR
FT                   GESEGGLVPLGA"
FT   sig_peptide     307588..307689
FT                   /locus_tag="Taci_0285"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.932 at
FT                   residue 34"
FT   gene            complement(308910..310106)
FT                   /locus_tag="Taci_0286"
FT   CDS_pept        complement(308910..310106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0286"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   flavodoxin/nitric oxide synthase; KEGG: cha:CHAB381_0232
FT                   flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18523"
FT                   /db_xref="GOA:D1B8C0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8C0"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACZ18523.1"
FT                   /translation="MEKAIPIREGIYWIGANDRETDLFEALWTLPRGVSYNSYLICDDK
FT                   VAVIDTVKSSFMRDYLQRLSWVLRDCKPVDYLIINHMEPDHSGSIAMMRKVYPDMKIVG
FT                   NKKTLEMIKAFYDIEDGLVEVSEGDVIDLGSHKLSFHMIPMVHWPETMVTYDQTTKVIF
FT                   TCDAFGGFSALEGGVFDDEVDMDYYEDEILRYFANIVGRYSSFVQKAIAKLRTLEISVI
FT                   CPSHGPILRSNPWRVVDLYDRWSRHETEEGCVIVYGSMYGNTKKMTDAIARSLTESGIQ
FT                   KIIVHDVSRSNMSFMVRDIWKYRGLVMGSCTYNTELFPPMAYLARTLANKMMKNRVLGL
FT                   CGSYSWSKGALAELLAFAEKGEWDRVDPTVEVKSSPTEEDIQACWLLGQNMAKAIKRA"
FT   gene            complement(310195..310569)
FT                   /locus_tag="Taci_0287"
FT   CDS_pept        complement(310195..310569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH3624 flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18524"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8C1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18524.1"
FT                   /translation="MEMHQCQVCRKLFASSGPKICPSCIKRLDRVYEKARSYLRDNPDA
FT                   NLNAKELAEAIDEDVLDIEILIAEGRFERDLAEDLNDIRRQQLLNEFQKSLSKTQENLR
FT                   ALQEQKKTTYGKDRHGKGIA"
FT   gene            310822..312501
FT                   /locus_tag="Taci_0288"
FT   CDS_pept        310822..312501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0288"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="KEGG: methylmalonyl-CoA mutase, large subunit;
FT                   K01848 methylmalonyl-CoA mutase, N-terminal domain;
FT                   TIGRFAM: methylmalonyl-CoA mutase, large subunit; PFAM:
FT                   methylmalonyl-CoA mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18525"
FT                   /db_xref="GOA:D1B8C2"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8C2"
FT                   /inference="protein motif:TFAM:TIGR00641"
FT                   /protein_id="ACZ18525.1"
FT                   /translation="MFEEKELQAIAEKRGQYEAAVEKALAKNPEMRKEFTTGGGIPLKR
FT                   VYTPEDVKDLDYNRDLGFPGAFPYTRGVQPTMYRGRFWTMRQYAGFATAEESNARYRYL
FT                   LSQGTTGLSVAFDLPTQIGYDSDHPMAQGEVGKVGVAIDSLADMEILFDQIPLDKVSTS
FT                   MTINAPASVLLAMYIAVGEKQGVPSTELSGTIQNDILKEYIARGTYIFPPKPSMRLITD
FT                   IFEFCSTHVPKWNTISISGYHIREAGSTAIQEVAFTLADGIAYVEAAVKKGQDPNVFGK
FT                   RLSFFFNAHNDFLEEVAKFRAARRLWAKIMRDRFGVTDKSAQMLRFHTQTAGSTLTAQQ
FT                   PENNIVRVAIQTLAAVLGGTQSLHTNSLDEALALPTEKSVRIALRTQQIVAYESGVTQT
FT                   IDPLAGSYVIEALTNQIEEGAAEYIRKIDEMGGMLVAIEKGYVQQQIQDAAYEYQKAVE
FT                   SGDRVVVGVNRFQIEEDASERTLLKVDPVVGEMQAKKLAKLKESRDNLKVKACLEDVRK
FT                   AAQGEENLMPPIIEAVRNYATEGEICGVLREVFGEYRENVVL"
FT   gene            312522..312944
FT                   /locus_tag="Taci_0289"
FT   CDS_pept        312522..312944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0289"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; KEGG:
FT                   gsu:GSU1578 B12-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18526"
FT                   /db_xref="GOA:D1B8C3"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8C3"
FT                   /inference="protein motif:PFAM:PF02310"
FT                   /protein_id="ACZ18526.1"
FT                   /translation="MDRKIRVVVAKPGLDGHDRGAKVIARAFRDAGMEVIYTGLRQTPE
FT                   QIVQTAIQEDADAIGISILSGAHEHYFKVIIEMLKERGAGDIIVFGGGVIPESDVPRLL
FT                   ELGAGAIFGPGTPTSECIKWLEEAVAKKREKEGVNG"
FT   gene            312941..313342
FT                   /locus_tag="Taci_0290"
FT   CDS_pept        312941..313342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0290"
FT                   /product="methylmalonyl-CoA epimerase"
FT                   /note="TIGRFAM: methylmalonyl-CoA epimerase; PFAM:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase; KEGG:
FT                   dol:Dole_0080 glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18527"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8C4"
FT                   /inference="protein motif:TFAM:TIGR03081"
FT                   /protein_id="ACZ18527.1"
FT                   /translation="MKPTVVDHIGIAVRSIDESLKFWQDVIGIECHGVEEVAEQKVKTA
FT                   FLPLGDTEIELLEGTSEDSPVSKFIEAKGEGIHHIAIRVPNIEEALEELKAKGVRLIDE
FT                   KPRMGAGGAKIAFVHPKASGGVLLEISER"
FT   gene            313411..314970
FT                   /locus_tag="Taci_0291"
FT   CDS_pept        313411..314970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0291"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: dal:Dalk_3780
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18528"
FT                   /db_xref="GOA:D1B8C5"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8C5"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ACZ18528.1"
FT                   /translation="MAERTIDELCEQLLAKRKAAEEGGGKKAIDKQHEKGKLTARERIE
FT                   RLLDPGSFVEIDEFVEHRCSNFGLEKTKFLGDGVVTGYGTVDGRIVYVFSQDFTVMGGS
FT                   LGEMHARKICKVLDLALQNGCPVIGINDSGGARIQEAVDALSGYGSIFFRNVKASGVVP
FT                   QISVIAGPCAGGAVYSPALTDFIFMVDKIGIMHITGPAVIKAVTGEDVTSEQIGGAMAH
FT                   NTTSGVAQFFASNEDECFAQVRKLLSYLPSNNMEEAPIGDESDDPMRMEMSLREAVPTN
FT                   PNKGYDVRDVIRKVVDHGDFFEVQPLWARNIVTGFARIGGRVIGVIANQANYMAGCLDI
FT                   DASDKASRHIRICDAYNIPIVTFEDVPGYLPGLNQEMGGIIRHGAKLLYAYSEATAPKI
FT                   TVVLRKAYGGSYLGMCSKDLGADVVLAWPQAEIAVMGAEGAANIIFRKEIDAAEDKAAM
FT                   RAQKIEEYREAFANPYQAASRGFVDRVILPEETRGAIYQALVMCDGKRELRPKRKHGIM
FT                   PH"
FT   gene            314984..315373
FT                   /locus_tag="Taci_0292"
FT   CDS_pept        314984..315373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0292"
FT                   /product="sodium pump decarboxylase gamma subunit"
FT                   /note="PFAM: sodium pump decarboxylase gamma subunit; KEGG:
FT                   aba:Acid345_3024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18529"
FT                   /db_xref="GOA:D1B8C6"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8C6"
FT                   /inference="protein motif:PFAM:PF04277"
FT                   /protein_id="ACZ18529.1"
FT                   /translation="MNVSSHFVGPAGGILMSLIAFSVVFLVIAGLMLIMMATKMVAGAV
FT                   DGRSKPVPPSPSKPQSPAAPAPSAAPAPGAKAQDDLELVAVVTAAVAACAGRPVSVRSV
FT                   RPLQARSFGGAWRAMARVEGMEGLE"
FT   sig_peptide     314984..315052
FT                   /locus_tag="Taci_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.807) with cleavage site probability 0.649 at
FT                   residue 23"
FT   gene            315426..315827
FT                   /locus_tag="Taci_0293"
FT   CDS_pept        315426..315827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0293"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: sfu:Sfum_0461 conserved carboxylase region"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18530"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8C7"
FT                   /inference="protein motif:PFAM:PF00364"
FT                   /protein_id="ACZ18530.1"
FT                   /translation="MARMYRVVVNGKAYEVEVEELGGASAPAPVTSAPAPAPVPAPAAA
FT                   PAPAPAPAAAPAPAAPAGAGAVTAPMPGKILKVMVQQGASVSAGQAIVILEAMKMENEI
FT                   FAPSAGTVTEVRCKEGDSVNTGDVLVVIS"
FT   gene            315849..316973
FT                   /locus_tag="Taci_0294"
FT   CDS_pept        315849..316973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0294"
FT                   /product="sodium ion-translocating decarboxylase, beta
FT                   subunit"
FT                   /EC_number="4.1.1.70"
FT                   /note="KEGG: mgm:Mmc1_3197 sodium ion-translocating
FT                   decarboxylase, beta subunit; TIGRFAM: sodium
FT                   ion-translocating decarboxylase, beta subunit; PFAM:
FT                   Na+transporting methylmalonyl- CoA/oxaloacetate
FT                   decarboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18531"
FT                   /db_xref="GOA:D1B8C8"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8C8"
FT                   /inference="protein motif:TFAM:TIGR01109"
FT                   /protein_id="ACZ18531.1"
FT                   /translation="MELYVAALKGLIDQSGLVGLTGGNVIMIVVALVLLYLAIAKGFEP
FT                   LLLTPIAFGCLIVNLPLSGIMDPGGFLYYVSFGTRHEIYPIIIFMGIGALTDFGPLLAN
FT                   PITFLLGAAAQLGVFVAVVGAMFLGFNIREAAAIGIIGGADGPTSIYLCMKLAPKIVGA
FT                   VAVAAYSYMSLVPLIQPPVIKLFTSKADRGIRMDQLRPVTKTERVLFPIISTIACGLIL
FT                   PPAVPLVGMLMFGNLLRECGCTERLNQAAQNEILNATTIFLGITVGATMEAESFLTLAT
FT                   IKIIALGLVAFAFSTAGGCLFGQVMKVLSGGKINPIIGAAGVSAVPMAARVCQRVVQQE
FT                   FPGSYVLMHAMGPNVAGVIGTAVAAGAMLTLLTR"
FT   gene            complement(317122..318606)
FT                   /locus_tag="Taci_0295"
FT   CDS_pept        complement(317122..318606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0295"
FT                   /product="Alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /EC_number="2.4.1.15"
FT                   /note="PFAM: glycosyl transferase family 20; KEGG:
FT                   dde:Dde_2060 alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18532"
FT                   /db_xref="GOA:D1B8C9"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8C9"
FT                   /inference="protein motif:PRIAM:2.4.1.15"
FT                   /protein_id="ACZ18532.1"
FT                   /translation="MPNRPSRLVIASHRLPIVLFMEDGELKVIHGAGGLVTALKPVLTL
FT                   RGGKWIGCPGTVPGARAEEVDRILAETRQESPFELIPVHLTEEQHRLYYEGASNSVIWP
FT                   LFHDFLSLCDFDGRYFKAYEEVNRLFASTLASHTDEKDLIWVHDYQLMEVALHLKDMRL
FT                   HRRCAFFLHIPFPSPDIYLKLPWRDRIIRALLEFHFIGFHTVREVRNFVQCVKIFEKDA
FT                   LVRRRGNWGTITLGSRMVSVGALPIGIDFRHFDRLSRHPAVRARAAEIKNNHRGRKIIF
FT                   GVDRLDYTKGIPERLTAFELMLERHPEMLKNVTFLQLLVPSRETVREYAELRDRVERRI
FT                   SSINGRFSQDDWVPVIFMSRSMPQEELVAHYLAADVGLVTPRKDGMNLVSKEYCAAHSD
FT                   LSGTLVLSEFAGAACQLQRGAILVNPNDREGVAEAIYQALVMPEGDKRRRMKILRHAVR
FT                   RHDVFWWADSFLLAASGKHIKDFPTAGDPVVPSFHP"
FT   gene            complement(318596..319438)
FT                   /locus_tag="Taci_0296"
FT   CDS_pept        complement(318596..319438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0296"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   trehalose-phosphatase; PFAM: trehalose-phosphatase; KEGG:
FT                   dde:Dde_2061 trehalose-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18533"
FT                   /db_xref="GOA:D1B8D0"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8D0"
FT                   /inference="protein motif:TFAM:TIGR01484"
FT                   /protein_id="ACZ18533.1"
FT                   /translation="MISTGASTVNIPSTIPPRGIPAWFWNQLRRSGGLSLFLDYDGTLA
FT                   PLTAERDRAHPWPGIREALESLMNLGARLAIISGRRAHQIPTLLGLRPADIFGCHGAER
FT                   LMPDGTRSSQEIPRWVEHLLNAAHREALELLPPEMVEMKAASVEVHLRSMPQDLRPLIP
FT                   QLARSWEALVHRGLSFRHFNGGFELRAPGIHKGLAVERLLQETPNGHLVTLLGDDTTDE
FT                   DAFETLGERGLSILVHPKGRRSIAQCHIKPPEELLDFLRQIHRELEGKMRKGVKMCAE"
FT   gene            complement(319435..320670)
FT                   /locus_tag="Taci_0297"
FT   CDS_pept        complement(319435..320670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0297"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   afr:AFE_2083 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18534"
FT                   /db_xref="GOA:D1B8D1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8D1"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACZ18534.1"
FT                   /translation="MSLSITDYEPVIGPGPLMHLRRLGEMLKDRSVVHLNSTRVGGGVA
FT                   EILENFVPLMRELGIDARWEVITGTEDFFKATKLIHNSLQGAEQDLSPTMKEVFMETNR
FT                   ENAQRLAGLLEEADFVVIHDPQPAPLLSMIPQRRGKWIWRCHIDVSRPNRSVWNFIKGL
FT                   VGRYHASVFSLVDFAQPLPHPQYIIPPGIDPLSYKNRDLSDQELNRVYEEFNLDPTRPI
FT                   ITQISRYDRFKDPVGVIRAYRMAKAYHENLQLVLAGGDATDDPEGALVLRETLEAAGDD
FT                   PDIHVLSLPSDAHLTINALQRISHVILQKSTREGFGLTVSEGLWKRKPVIGGDTGGIRL
FT                   QVIDYHTGFRVRSPEGAALRIRQLLQDPRMMRSMGEAGHSHVRDHFLITRQLRNLMTTL
FT                   ACLQMEETGVTA"
FT   gene            complement(320667..321344)
FT                   /locus_tag="Taci_0298"
FT   CDS_pept        complement(320667..321344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afr:AFE_2084 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18535"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8D2"
FT                   /inference="similar to AA sequence:KEGG:AFE_2084"
FT                   /protein_id="ACZ18535.1"
FT                   /translation="MTVEPMEPFRFHSCEMAIVSTGLVARTLSELRDCVRRAPEGSLHT
FT                   HFWGWKMRPQLGEREYTNDLANWVASTLRDRGMAEKLSALSPKDFEDLDSLREEIISVL
FT                   DRRLEGDDAMAWSRASHPFFFTDSRMLVFDTGQTASTLKEFREAIRTIDTNSIFYHVID
FT                   AVRRTPGHEDDFSAWLSGFGELTANLRARLRRIDTALLTLGEIREKINSAIRKSLPWEG
FT                   DEQ"
FT   gene            321566..321928
FT                   /locus_tag="Taci_0299"
FT   CDS_pept        321566..321928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH3004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18536"
FT                   /db_xref="InterPro:IPR024617"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8D3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18536.1"
FT                   /translation="MGENTVFLAAYARLPQDIAAYGLYKSVGVYAEVEVDTGVIIEADV
FT                   SFYSQVSINMIRAILKGKNIVLDREVILKAFESRYWGGGRKAVITAVKRLFERYDEVME
FT                   QLERDPIPDLTDEYRL"
FT   gene            322218..323372
FT                   /locus_tag="Taci_0300"
FT   CDS_pept        322218..323372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0300"
FT                   /product="YidE/YbjL duplication"
FT                   /note="TIGRFAM: YidE/YbjL duplication; PFAM: YidE/YbjL
FT                   duplication domain protein; KEGG: dps:DP0976 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18537"
FT                   /db_xref="GOA:D1B8D4"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8D4"
FT                   /inference="protein motif:TFAM:TIGR01625"
FT                   /protein_id="ACZ18537.1"
FT                   /translation="MLSFAKLMQNPIFVMTLTAMLGVLIGKVKLGRFSLETSGALFVGL
FT                   VVGAVGYSVPEAFFNFTLTLFVVAVGLLASGDMLNVIRRYGLKFAFLGGFITFVGALVT
FT                   YVLALMFRGGASPHLIGGTYTGALTSSPGLAAALEATNNNPDVTVGHSIAYPFGVLAVI
FT                   LFVQLIPMVFRIDVDREREEFKATLAAMRDGQGEAGGGYKNAFSMVAFGLCIVAGYLLG
FT                   GIKVPLGGKLSISLGATGGGLIAALVLGSMIKSGPFDMRMDPKVLGAVRSLGLSYFLAI
FT                   VGINAGAEVVEVLKVHGVLLVLIGFFAALAAEVAAFLLARYGWRMNWILIAGAICGGMT
FT                   STPGLGAAIDATKTEDVAVGYGATYPVALLGMVIFTSMLHMLLE"
FT   gene            323387..324922
FT                   /locus_tag="Taci_0301"
FT   CDS_pept        323387..324922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0301"
FT                   /product="succinate CoA transferase"
FT                   /EC_number="3.1.2.1"
FT                   /note="KEGG: rru:Rru_A1927 acetyl-CoA hydrolase; TIGRFAM:
FT                   succinate CoA transferase; PFAM: acetyl-CoA
FT                   hydrolase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18538"
FT                   /db_xref="GOA:D1B8D5"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8D5"
FT                   /inference="protein motif:TFAM:TIGR03458"
FT                   /protein_id="ACZ18538.1"
FT                   /translation="MKTVALDIRDRVRCESLRSLIMDPHEAAKLINDGDVIGASGFTPS
FT                   GYPKEVPMAIARRKLETGSPSNLTLWCGASVGPELDGELTASGALARRFPYQTDDRLRK
FT                   AINEGTVLFQDIHLSHGTQNLRYGFYGKMDVAIVEAVAINQDGSIVPSTSVGNSPTFVK
FT                   MAEKVIVEVNVTQPMSLEGVHDIYIPGDPPSREPIPIASVSDRIGTPFIPCDPSKIVAI
FT                   VPSDVPDKQRPLAAVDEVSARMARNLLDFLDVEVKAQRLPRDLFPLQSGVGEVANAVLA
FT                   GFLEWPSENLRMYTEVIQDSMLDLIDAGKVSFASGTSFTPSPEGARRMYANMDLYRQRV
FT                   ILRPQEISNHPEVIRRLGVIAMNTAVEVDVYGHVNSTMALGSKMINGIGGSGDFARNGY
FT                   LTVFLTPSTAKGGSISRIVPFCSHVDHTEHDVDVVVTEWGVADLRGLTPRERSVEIVGK
FT                   CAHPDYRSALMDYIRRAQANGGHEPHDLKEAFSFHLRLIRNGSMLPVGGVRES"
FT   gene            325139..325987
FT                   /locus_tag="Taci_0302"
FT   CDS_pept        325139..325987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0302"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit"
FT                   /note="TIGRFAM: hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit; PFAM: Fe-S type hydro-lyase
FT                   tartrate/fumarate alpha region; KEGG: dds:Ddes_1528
FT                   hydro-lyase, Fe-S type, tartrate/fumarate subfamily, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18539"
FT                   /db_xref="GOA:D1B8D6"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8D6"
FT                   /inference="protein motif:TFAM:TIGR00722"
FT                   /protein_id="ACZ18539.1"
FT                   /translation="MPRLIDSDELSRLVRDLALKANFVLPRDVRDVLSSALELERVELA
FT                   RSALEDLVLNFQMAETEKMPICQDCGLAVVFVDWGQEVLLTGGSLQEAVDLGIRDAYVE
FT                   GYLRKSVVYDPVYDRRNSFDNTPAVIHLRMVPGDRVEVTVAPKGMGSENMSAIRMLKPA
FT                   DGEEGVLRFIEEVVSSAGPNSCPPVVVGVAVGGNFETAPLWAKRSLLRPMGQRNPDPRY
FT                   ARLEEEALRRINRLGIGAGGYGGLVTALDVRIEALPTHIAGMPVAVNLCCHALRHAKGV
FT                   I"
FT   gene            325987..326544
FT                   /locus_tag="Taci_0303"
FT   CDS_pept        325987..326544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0303"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, beta subunit"
FT                   /note="TIGRFAM: hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, beta subunit; PFAM: Fe-S type hydro-lyase
FT                   tartrate/fumarate beta region; KEGG: dde:Dde_1254
FT                   tartrate/fumarate subfamily Fe-S type hydro-lyase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18540"
FT                   /db_xref="GOA:D1B8D7"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8D7"
FT                   /inference="protein motif:TFAM:TIGR00723"
FT                   /protein_id="ACZ18540.1"
FT                   /translation="MSRIELTTPLGEEVRSLRAGDLVSLSGVVYVARDQAHRRMLEDLD
FT                   RGSLPFQLEGQVIYYAGPSPTPPGRVIGAMGPTTSGRMDPFTPRLLELGLRGMIGKGRR
FT                   SKEVLDAMARHGAVYLGATGGAAVLLSRSIRSCEVVAYQDLGPEAILKITVDRMGLVVL
FT                   GDAHGGDIYASGPAGARKMMDG"
FT   gene            326537..326746
FT                   /locus_tag="Taci_0304"
FT   CDS_pept        326537..326746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18541"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8D8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18541.1"
FT                   /translation="MDDIRIRVLLDGSSLSVRVPRGAPVRRALQEAGVDLSHVGMVVWD
FT                   WRLLDLDEEVPAGEICVLPPLDGG"
FT   gene            326863..327621
FT                   /locus_tag="Taci_0305"
FT   CDS_pept        326863..327621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0305"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dvu:DVU0440 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18542"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8D9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18542.1"
FT                   /translation="MDISRYLRSLYSNTPDPLVDREVGLASWGDLWALVPHLTQEEEEW
FT                   ILERADQNYRLAQRGVLKPRGRALGYRLWRGSFDEDPIWVVRAMCGAALDFALSDPKAG
FT                   AVPLRGCVASGVLLTVPLTVICNYLSKDRRALAEAMALGGLVGCYITSRLDGRVGYDLL
FT                   LGAAAGCAAGLAKLSDGSIKVVERASATAVCLTLGDVGDNCGCLDYLASVLAGQAVVAC
FT                   QMALSGQGFGLSMDEARGMFEHWARGRESQ"
FT   gene            327663..328559
FT                   /locus_tag="Taci_0306"
FT   CDS_pept        327663..328559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0306"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   rce:RC1_3612 lipid A biosynthesis lauroyl acyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18543"
FT                   /db_xref="GOA:D1B8E0"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8E0"
FT                   /inference="protein motif:PFAM:PF03279"
FT                   /protein_id="ACZ18543.1"
FT                   /translation="MEQPLIYRGLNLVGALFRSLGHRRALELGGSLGELVGRASPRRLE
FT                   EASRRCSRVLGILPGEAREVVLGAYRHFGMALAELMRFPVMGRDLLDLVEFQDLERLDR
FT                   ALSLGRGAIILSCHMGNWELTAAALALLGYPIRVVAADQRDPRVNQTLVNLRSSCGVVT
FT                   IGKATDLKGVFRCLEEGGALAVLLDQDAKAKGIVSDFLGFPASTPLGPVKLARKLGCPV
FT                   VPCRSQRSLSDPTRHSVRFLDPLKGPNGEEFGLDEAGSVGVCNRLLSGWIREVPQQWMW
FT                   MYDRWASTVPREAWTAA"
FT   gene            328517..328975
FT                   /locus_tag="Taci_0307"
FT   CDS_pept        328517..328975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0307"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sil:SPO2801 lipopolysaccharide core
FT                   biosynthesis mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18544"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8E1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18544.1"
FT                   /translation="MGQHGSPGGLDCGIDPGRCKVGVAFGDRELRFSLVIPRDRLGELI
FT                   RVLTQGDLEPLREYLTYGSIPPEVHLSGSVFVGAGTGSGEVLEELRRAGVRFVPVPEAG
FT                   STLMARELYFRLHPPRGLGRLIPRGLRVPPRDVDDLAAWVIVLMGRGT"
FT   gene            329091..329579
FT                   /locus_tag="Taci_0308"
FT   CDS_pept        329091..329579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pat:Patl_0248 CheC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18545"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8E2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18545.1"
FT                   /translation="MSTQVIASLVNAYAGAFVSVSQMMGVEATFLKGEITPGVNAPGSR
FT                   VAALIGVVGPSVHGTVALMADMAGFSAYVKAMTGGMIEANPEDPMSMSVIGELTNMTSG
FT                   QALMKVEVPGLDITPPQLMAGENLKAIPTKKADVKSFTLPFDVGPEKGRVYLVLSFHE"
FT   gene            329698..331731
FT                   /locus_tag="Taci_0309"
FT   CDS_pept        329698..331731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0309"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   SMART: chemotaxis sensory transducer; histidine kinase HAMP
FT                   region domain protein; KEGG: pfl:PFL_0128 methyl-accepting
FT                   chemotaxis transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18546"
FT                   /db_xref="GOA:D1B8E3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8E3"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACZ18546.1"
FT                   /translation="MTMRQRLYAILLMAVLALGGMGFLAYYNGRRILEAHIMSGGELAA
FT                   ESAAASVRNWLDGRTDIVLTAAMNSQYLWLNYGMAGQLLQPYMEGLTKEYSNKGFMDIY
FT                   IGLETGRFVDGSGWTPPDGWDPKTRPWYQEAVRKDGPVITMPYVDANTGKMIVTIATPL
FT                   KGYGDRLLGVLGADMAIDTLIQMVSSQRIMGHGYGILLAPDGTFVAHPKKDLVLKENIA
FT                   KESRFVSKELSKIGQDILSGKYGLYRYRSVDGDVRLIFTRPLNLGWTLALVVSEKEIFS
FT                   PLSGLAMKQLLMALVAMALLAVLVLSVIRGLMRPIQCLMSVSGEAAKGDLSVSACFAGN
FT                   DEMSQLGRALDTVISSQREIFRRFKGESDRILQQARVLEDVSDRTVETLVDMREQAEVL
FT                   VRMATDNSEAVEAANAGIEEVASASQGAAQAASDASSYAESLKSNAEGARDLIVKTSDR
FT                   VMEMASSFRGVADAVVKLNDQASQIGSIVNTISQIADQTNLLALNAAIEAARAGEAGKG
FT                   FAVVAEEVRKLAEESNQAAKSIGELAGAIISGTSYAVKTATSGVSVAQAAEEETRAMRE
FT                   QIDGVLNAIGEIVSQIQNVAATAQEQSASAQEMAASIDRLAVGIGSLKDVAARISQVVD
FT                   QISRNSDLLKASSDDLYRFSEEFTRAIQGFKIDSDGPLALKG"
FT   sig_peptide     329698..329772
FT                   /locus_tag="Taci_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.889) with cleavage site probability 0.437 at
FT                   residue 25"
FT   gene            331815..332891
FT                   /locus_tag="Taci_0310"
FT   CDS_pept        331815..332891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18547"
FT                   /db_xref="GOA:D1B8E4"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8E4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18547.1"
FT                   /translation="MEERNQGGIDWYVRDLMVYMFGVPPEDLDGLVEQYASSGGTPDPA
FT                   GLFKFLSVNGRKYRVLWAAFPVGDLISILFAAVFGPDRQMIWRKSSVLPLGSDSGALRL
FT                   WNRVLELASGIGVQEDRRVSETDLWSAEQVHRALIRHWDQWAPMFLAEVEEWINATGQS
FT                   VGEGQVIESSEINSRLSVDVSKEIREAVGRSVPLGAVRYAVTSLPELRDMGLEVTSLQA
FT                   TLDSYVGAALPSRPVSQEGTLDVPQGVMEVRPSVDPLHGVALSLMRPGDPVVVEPAREV
FT                   ELPGTIYMIRLLKNGQYEVHGQFDRDGSFFKFISPGELKIKTPAAEALEARESFPVAYA
FT                   AVAGVLALAAVVLYLMLS"
FT   gene            complement(332883..333368)
FT                   /locus_tag="Taci_0311"
FT   CDS_pept        complement(332883..333368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18548"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8E5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18548.1"
FT                   /translation="MAWWFPFLHPSALEIHRMGQEVICALREGERLPDQIPGVMAEGGI
FT                   RGIYSATVRAAEEADLSDMVLWVKPPRDASNLLDLSEGDWRRAFEALEEGLEALRCALP
FT                   YLLGEGSPKLVLLLPRPQGLISSAIRGALSALASSFEAEARDLGLSVICREEDQPLG"
FT   gene            complement(333372..333662)
FT                   /locus_tag="Taci_0312"
FT   CDS_pept        complement(333372..333662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0312"
FT                   /product="TrpR like protein, YerC/YecD"
FT                   /note="TIGRFAM: TrpR like protein, YerC/YecD; PFAM: Trp
FT                   repressor; KEGG: bha:BH0639 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18549"
FT                   /db_xref="GOA:D1B8E6"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013368"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8E6"
FT                   /inference="protein motif:TFAM:TIGR02531"
FT                   /protein_id="ACZ18549.1"
FT                   /translation="MGSQWKDSLTDQLCRAFLCLENEDEVYRFLEDVATIAEIRSLAQR
FT                   LEVARRLMEGETYPSISKETGASTATISRVKKCVDYGSDGYKLVLERLKGK"
FT   gene            333882..335318
FT                   /locus_tag="Taci_0313"
FT   CDS_pept        333882..335318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0313"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="KEGG: scl:sce3768 prolyl-tRNA synthetase; TIGRFAM:
FT                   prolyl-tRNA synthetase; PFAM: Prolyl-tRNA synthetase, class
FT                   II-like; tRNA synthetase class II (G H P and S);
FT                   Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18550"
FT                   /db_xref="GOA:D1B8E7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8E7"
FT                   /inference="protein motif:TFAM:TIGR00408"
FT                   /protein_id="ACZ18550.1"
FT                   /translation="MAKNVTPRSSDFSQWYLDVIRAAELADYAPVRGCMVIRPTGYALW
FT                   ESIQRHFDEAFKETGHVNAYFPLLIPNSFLEREAQHVEGFAPECAVVTHAGGDELEEPL
FT                   VVRPTSETVIGHMYSKWVQSWRDLPILINQWCNVMRWEKRPRLFLRTSEFLWQEGHTAH
FT                   ATREEAMEETLRMLGVYETIMKDVLALPVVTGEKSEGERFPGADNTFTCEAMMSDRKAL
FT                   QAGTSHFLGQNFAKAFDIRFQDRDGEVKYAWTTSWGVSTRLIGAIIMTHSDDDGLILPP
FT                   RVAPVKVALLPISTDQDLISSSLEPKAMELKAAIEDRIGPRTVALDRQYHLRPSDRFFS
FT                   HLQKGVPLRIELGQKELENRTVRLVCRDNGERIDVPMEGAPERVAEVLNQIQARLYDRA
FT                   LKFRRDNTHRVSSIEEFKEVMESKGGFVEAHFAGTPEDERAIKEATGATVRCFPSGDRS
FT                   VGRCFYTGREGRLAIFAKAY"
FT   gene            complement(335376..336728)
FT                   /locus_tag="Taci_0314"
FT   CDS_pept        complement(335376..336728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0314"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /note="TIGRFAM: tRNA modification GTPase TrmE; small GTP-
FT                   binding protein; PFAM: GTP-binding protein HSR1-related;
FT                   KEGG: bsu:BSU41020 tRNA modification GTPase TrmE"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18551"
FT                   /db_xref="GOA:D1B8E8"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8E8"
FT                   /inference="protein motif:TFAM:TIGR00450"
FT                   /protein_id="ACZ18551.1"
FT                   /translation="MRDEQVIAAISTPFGQGGIAVIRLSGRGSAQVVDRVFRGRSPLSS
FT                   SPPWTMRHGHLVDPRGNPIDEVLAVHFKAPKSYTGEDSAEVHCHGGPLVAQMCLEALIS
FT                   AGARLAERGEFTRRAVINRRMDLSAASAVMALVSGQSPKAVEAAMGSLSGATRRAMEEL
FT                   MRDLTRACSHLEATLDMPEDEIPPLDWERLREDLSRIARGIRDLHQRGLAGMALSQGVQ
FT                   VTLVGRPNVGKSSLLNSLSRQARAIVTPIPGTTRDVVEAAVIHRGVPIKLLDTAGIRDS
FT                   NDPIEALGVKLARETMLTADLRVLVLDGSSPPHREDLELLGSLDMPAAAALNKADLGTD
FT                   PSWDQVLRDARVPNVTLSALSGKGVEELKDLMVRSICSNPAVDGAVTMFRHQLDALSRA
FT                   AEALDGALSSPYLDATAQLALEAQRHLASALGLDPTEEVLEAVFRNFCVGK"
FT   gene            complement(336729..337940)
FT                   /locus_tag="Taci_0315"
FT   CDS_pept        complement(336729..337940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0315"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   mxa:MXAN_0212 aminotransferase, class I and II family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18552"
FT                   /db_xref="GOA:D1B8E9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8E9"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACZ18552.1"
FT                   /translation="MSSFFQGLYGERVKDLRPSPIREMLHLVRRPGIISFAGGMPDPEA
FT                   FPVELFYQAAGIIKSQGKDVLQYGTTEGYAPLKDFLIQWTAPRMGRKLEHDEMLITAGS
FT                   SQVSDLLCWALIDKDDLILMEEPSFLGVFLNMHNHGAKFLTVPCDDEGMMVDLIPEKVE
FT                   RAQREGKKVKLCYTIANFHNPLGTTLSLERRRKLIEYAHRYGFAIMEDDPYGYVRFEGE
FT                   HLPTLFSLDDRGVVIYAGSFSKILAPGTRVGWCCGHKDIIRKMAIFKQGVDVCTSLVAQ
FT                   AMVYEYCRLGHLDSFLPKIIDHYRKKRDAMEDAMRRHLPLEKLHWVKPQGGYFYWVKMD
FT                   GIDCDRLFQVAVDKQVAFVPGKAFYPNRDGGDQEIRLCYTFASPEQTDQGMRRLGEAMR
FT                   EMIR"
FT   gene            complement(338066..339193)
FT                   /locus_tag="Taci_0316"
FT   CDS_pept        complement(338066..339193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0316"
FT                   /product="putative diguanylate cyclase"
FT                   /note="KEGG: hch:HCH_03148 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18553"
FT                   /db_xref="GOA:D1B8F0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8F0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18553.1"
FT                   /translation="MRWITSPPIISVPLVALLLALGSGPTEGLPLPLWGLFLVAYGAAT
FT                   AFHSMNLSTRRGGLAFFTNLTAQGLVLAFVSPAVGVTPIVSWLGLALASSGMVGLVSLG
FT                   ISKGPSGQRQPISPEQISISDIQQELKSLETELDIPSMIPLPALWGQGGVILKANREAK
FT                   LLLGTNDLEGKELDKMINPSLHELELGGTGWLVFRRSLEGEDLVLLSPKGEGSGGDDSD
FT                   FVDPKTGLYSDRYARRRGEEEIERARRYRRWLSMALLKLELESLSQGPIPRSFQEEAYN
FT                   RLIATVKKTIRTSDLAFHLKDDCVLLLLPETPSSGARTLFDRIKAQLNKLFEEGEAAPY
FT                   RPRLMGGFSFYGGNGTTSYGQMLEEAYSNMALNED"
FT   sig_peptide     complement(339107..339193)
FT                   /locus_tag="Taci_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.950 at
FT                   residue 29"
FT   gene            339320..340321
FT                   /locus_tag="Taci_0317"
FT   CDS_pept        339320..340321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0317"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: glo:Glov_0049 metal dependent
FT                   phosphohydrolase; TIGRFAM: metal dependent phophohydrolase;
FT                   PFAM: metal-dependent phosphohydrolase HD sub domain;
FT                   nucleic acid binding OB-fold tRNA/helicase-type; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18554"
FT                   /db_xref="GOA:D1B8F1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8F1"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ACZ18554.1"
FT                   /translation="MGRDELMTVEAVLRLRPGESFKGVYAVRDLQANRDRGGGTYWSVT
FT                   VMDPTGAMEGKAWSSARWLDRREGEPLSEDQIQSLKGMSVGVVGQVKDYRGSLQVDFRE
FT                   LYRLDQDKYPPLDLVPRSPFPQEELEERFWRIVGSCGEELRGFLEGIFVGDLRDRFFSY
FT                   PAAVSNHHAYRAGLLEHTVHVAEAALGMCGPYRDVSLEVVAAGALLHDLGKVRAYRMSP
FT                   LPEVTVEGSVLDHVAMGYALFEELVRDRGLRGELAVHLGHIILSHHGQKEYGSPVVPQT
FT                   LEALIVSAADELDFHLFCCREGLRWLRDGQAVSDFNRSTQRRFWTGELPQRP"
FT   gene            340318..341226
FT                   /locus_tag="Taci_0318"
FT   CDS_pept        340318..341226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0318"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: aeh:Mlg_1429
FT                   ribosomal large subunit pseudouridine synthase C"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18555"
FT                   /db_xref="GOA:D1B8F2"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8F2"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ACZ18555.1"
FT                   /translation="MRTYRIPPDQEGRRLDRLIREWWPEVNMGLRMGAIRRGQVRLDGR
FT                   RVPCSQRLLEGQELTVPWDQEPRRSGSGTPCPAEGRELPRWVIHWDRRLLVANKPAGWI
FT                   CQPGGGRGTSLPEEVWRLLGVDRGPVPSHRLDVNTTGVVLVPLDGALGRELHRLFREGT
FT                   IRKLYWALVRGTCVGEALVDLPLSKDGRGNVTPSPSGQPARSVVRPLAVRGGFSLVEVE
FT                   LLTGRQHQARVHLAHLGLPILGDVRYGVRFRGVGRTMLHARRVLLPFGESLGDLAGAAF
FT                   EAPLYPDMAEAARRLGLGDFT"
FT   gene            341424..342698
FT                   /locus_tag="Taci_0319"
FT   CDS_pept        341424..342698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0319"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   ppd:Ppro_1713 Glu/Leu/Phe/Val dehydrogenase, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18556"
FT                   /db_xref="GOA:D1B8F3"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8F3"
FT                   /inference="protein motif:PFAM:PF00208"
FT                   /protein_id="ACZ18556.1"
FT                   /translation="MAVTKRTSSNVLLDTALKNFYAAAEEMGLDEGLIEILSRAERKLC
FT                   VSIPVTMDDGTVKVFEGYRVQYSTALGPAKGGIRFHPDVTLEECEALACLMAWKCSLAG
FT                   IPYGGGKGGVACNPLELSTAEKERISRTFAARIEPLVGAWTDVPAPDVNTGGQEMVWFM
FT                   DTISKMRNRLEPAIFTGKPVSLWGSKGRTEATGAGVATCVREVLKAAGRDVKGATAIIQ
FT                   GFGNVGTHCALTLVDMGAKVLAISDITGGYYCPDGIDVKKAFDHVTNHPKHLLEGYEQP
FT                   GLQKIAGEDILYLEADVLCPCALEGVINGDNAHKIKAKFIVEGANGPVTPEGDAALPKD
FT                   VLVVPDFLANSGGVVGSYFEWVQDLMGFFWTKEEYNQRLLTLMADNFWRVWNYSKEHNV
FT                   SMRKGAFMVAIKRVADAVKMRGVFL"
FT   gene            complement(342777..344543)
FT                   /locus_tag="Taci_0320"
FT   CDS_pept        complement(342777..344543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0320"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; KEGG: bcz:pE33L466_0379
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18557"
FT                   /db_xref="GOA:D1B8F4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8F4"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACZ18557.1"
FT                   /translation="MSSWLRDMSIKGKMWVLIGVGLLGLGVASATGYRFLSQSNRNLED
FT                   MYQDQLLPIRWLIDTKANAALIKGLVSEIIVADSDAERDELVQRIGELVKANDSNLELY
FT                   GKTKLESFEVEHLRKVHEAMTDWRAKWRKVLELSKEGLKEQAEDYFKAEAIPAIKRLIG
FT                   EIEALANFNVEFAEKVKDQNDQSAARALYLLVVMSIGSLLVMALLGAVISQRIAGSVRS
FT                   ALSALERVRDGDLTLSRDQIGAQGRDEMGRLGDALFEAVLQIRSTIEQVLRQASDVASR
FT                   AEDFSALAEESSASAQESRASVDEVASRMNELGAASQEINASVEEVASGAQAVAQRSTD
FT                   IAAEVDQARSAGEEGARAVAKAASSIAKVAEEASRSAEMVASLGEMAHQIQSFVGQIGQ
FT                   IADQTNLLALNAAIEAARAGDAGKGFAVVAEEVRKLAEESNQAASRIAELADGIGRELG
FT                   TVISASQRNAQESQSSKELAEETRATIERIMDSLGRISNATQDLAAVAEEQAASSQEIA
FT                   SAVQDVASKVLQAANASEVVRSQVAEVSAAAERIAQGSEDLVKTSEALREAVRHFKVDD
FT                   MSSPVHLPPSLA"
FT   sig_peptide     complement(344451..344543)
FT                   /locus_tag="Taci_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.915) with cleavage site probability 0.678 at
FT                   residue 31"
FT   gene            344765..346036
FT                   /locus_tag="Taci_0321"
FT   CDS_pept        344765..346036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0321"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="KEGG: mca:MCA1933 enolase; TIGRFAM: enolase; PFAM:
FT                   enolase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18558"
FT                   /db_xref="GOA:D1B8F5"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8F5"
FT                   /inference="protein motif:TFAM:TIGR01060"
FT                   /protein_id="ACZ18558.1"
FT                   /translation="MSSVITNIRALEILDSRGNPTVRVRLELECGIRVSASVPSGASTG
FT                   ENEAVELRDGDKGRYGGKGVLQAVANVNDVIAPAVIGMDCRDQAAIDRAMIELDGTPNK
FT                   GKLGANAILGVSMAAAKAAAEYCDLPLYAYLGGPGAVTLPVPMMNILNGGKHAENSVDF
FT                   QEFMVFPLGASSFREALRMGAETFHALKGILKKKGYAVGVGDEGGFAPDLKSNEEACDV
FT                   IVEAIRAAGYEPGKDICLALDPAASSFFSGGSYMLDKSGQGKKSTDEMIDLFDRWCSAY
FT                   PIASIEDGLDENDWDGFAKMTARMGHRVQIVGDDIFVTNPDFVRRGIKAKAANAVLIKL
FT                   NQIGTVTETMETIELCRRAGWGYVISHRSGETEDTFMADFTVAMGGGQIKTGSACRSER
FT                   IAKYNRLLEIEEDLGRLARFGRIS"
FT   gene            346139..347323
FT                   /locus_tag="Taci_0322"
FT   CDS_pept        346139..347323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0322"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bbr:BB4088 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18559"
FT                   /db_xref="GOA:D1B8F6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8F6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACZ18559.1"
FT                   /translation="MERILRFLAINRSTGAALIMVIFMGLGEKMSERFLPVYLMALGGS
FT                   YWSVGFLNGMDNLLSALYSLPGGMASHALGPKKSLILFSLVAVLGYLLVLTLGTWWSVL
FT                   PGAALFISWSAVSLPAMMDLIGRSVPKTKRVMGVSMHSLVRRIPMALGPVIGGYLMTRM
FT                   GNVEGIRAALVVAAAVGGISVWLMWRMVPGDAIGELEGVSVRSSLGLIRGDLRMLLVSD
FT                   VLIRFAEQIPYPFVVLWALDRGVTPAQFGLLTALEMAVAMLVYIPVAAMADRHGKKPFV
FT                   LMTFCFFTAFPLMLPFCRGFWPFAAAFVVRGLKEFGEPTRKALIMDLAPEGAKGAAFGA
FT                   YYLLRDVVVSLAAFASPALFYISPQVNFLTAFAFGVLGTLWFALKGRDVASGGI"
FT   gene            complement(347391..349463)
FT                   /locus_tag="Taci_0323"
FT   CDS_pept        complement(347391..349463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0323"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   SMART: chemotaxis sensory transducer; KEGG: bcz:BCZK1821
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18560"
FT                   /db_xref="GOA:D1B8F7"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8F7"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACZ18560.1"
FT                   /translation="MRDLSIAKKLTLLGIGVTVLLGLMVAMVALQSHSILNDQVNTLGM
FT                   EMIANNANQVDQYFSELKTLTLGIASGTAELLETGQAVTDDDLESVMARYFNATAKDLN
FT                   ILDMYVGLESTGKVGTGGDWVEKPDYDARKRPWYIQAVQEDKVILTAPYVDANTGGLVI
FT                   TVATPVKSTSGKLLGVAGIDVDLKTLSDMITSYKVFGKGYGFLLDREGNTICHPKSEMI
FT                   MKENITKPSGLITPELAEAGRKMISGSPGFVDYSFQGELRRTFFSPTRSGFVLGVVFPA
FT                   SDLNAMVRSLAIRQLLLGLVTLILVGAMLYGLSRSVVAPVKRITDSLKKLGQLDLTQDQ
FT                   NDQWLREVGHHRTEIGLMAQSALVLKETLRQAISDIASQSDRTAAAAENLAALSEESVA
FT                   SVEEIKASVDQVASLMESNSASLQETNAGIEEVSSGAQQAANSATDGAEAASKMSHLSE
FT                   QTVRQVEEVVKAITHVGDESKRTFERIQKVADSVASISGFVATIRSIADQTNLLALNAA
FT                   IEAARAGEAGRGFAVVAEEVRKLAEESAQAAKEVEDLIAPLQANTEESLRATEQSQRSM
FT                   DDTVRRAHEAQGKLAEVLGQIRVINDAMQNIAATSEEQAAAAQEIAQGIDNATQGTINV
FT                   VNSVEMIRHSSEETAKASEAVAQEAQALSHTAEQLKALIAKFRYQSSSLSLGDGR"
FT   sig_peptide     complement(349377..349463)
FT                   /locus_tag="Taci_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.344 at
FT                   residue 29"
FT   gene            349826..350482
FT                   /locus_tag="Taci_0324"
FT   CDS_pept        349826..350482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0324"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: ppd:Ppro_2543 class II aldolase/adducin family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18561"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8F8"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ACZ18561.1"
FT                   /translation="MDVIQAKRAVVRYGALLEERGLVFGSGGNLSVRAEGGLWALKPSG
FT                   RPCGALREQDVTVLDMEGRVLEGLKPSSEWRMHLGVLRARSDVGAVFHTHSRFAVTMGC
FT                   LKWEVPPIHYYMAAFGDQIIPVVPYRPFGSQELADLVAETLREPLKGAILANHGAVVAG
FT                   SSPQEAMDLAVNLEFLCEVYWRVRCVGNPATLSEEEFRRALADFGAYSPGSSGGL"
FT   gene            complement(350424..350750)
FT                   /locus_tag="Taci_0325"
FT   CDS_pept        complement(350424..350750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18562"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8F9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18562.1"
FT                   /translation="MEGLKGLGAPSDLRGDGVPEEMPPSAREALMEAEKARDRALDRVV
FT                   LTHQRTVARSMEDYKVKMKKKLLELERRKRREQDLELLSRAVAQTINHRNYLESRRRSP
FT                   LRPV"
FT   gene            350827..351798
FT                   /locus_tag="Taci_0326"
FT   CDS_pept        350827..351798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0326"
FT                   /product="peptidase M19 renal dipeptidase"
FT                   /note="PFAM: peptidase M19 renal dipeptidase; KEGG:
FT                   sil:SPO1542 renal dipeptidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18563"
FT                   /db_xref="GOA:D1B8G0"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8G0"
FT                   /inference="protein motif:PFAM:PF01244"
FT                   /protein_id="ACZ18563.1"
FT                   /translation="MEWVDLHCDVLYEVSRRRRMGERDVIRRIMLQDLRSSGVKVLVCS
FT                   LFVDDQGVHRALQEALHQVWCLLEEEREAREDLMVIRDRDDLRRCLSSRRIGLVLSMEG
FT                   AEPVQDDPELLRFFRSMGLSFLALTWSRRNRLADGVDLTRTVRSPGGLSAQGVSALETA
FT                   RSLGLALDLSHLNDPGTEDVIRSGVPILATHSNCRSLCDHPRNLADPHLEAIGRRGGVV
FT                   GFNAHGAFVGSDDPVEGMYRHISHLALVAGEAACALGLDLCDRFDAFFHGERRDLFMSH
FT                   REASQALQVLGGRLGARSMGRLLMDNPIRVLEGALPSSVPSV"
FT   gene            complement(351795..352793)
FT                   /locus_tag="Taci_0327"
FT   CDS_pept        complement(351795..352793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18564"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8G1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18564.1"
FT                   /translation="MLSLVRGGPKVLMLETTRSGEDLAELEAFLAALCPSSSADPMGAV
FT                   ETASEEATLVIFMASGEEPAMRVYSTHLPPEDLLCQLINRRLCEKVDNLCPSPGTAVMR
FT                   LVGTPEGLNLAMERIASDLNGTVGERPHNFVCPAGSRTVIYFTQNPLNRPLRMEDLSPR
FT                   AVLVDRPCGEVLSHLRENAMDYLSLAMGGPDWNQVDIRIYDAEGRYDLHYRRLMGAIEG
FT                   IDAGLVLSEAWGRDQAFILMSVPVYVVRLFTPLDPSEIKRMCMGLEYSPKGERWVDLDV
FT                   ICSGKKVSWTGLEHPGTRDSLGEAMRRELLGRMNQGGLKRLLEAEGELMGG"
FT   gene            complement(352827..353465)
FT                   /locus_tag="Taci_0328"
FT   CDS_pept        complement(352827..353465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18565"
FT                   /db_xref="GOA:D1B8G2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8G2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18565.1"
FT                   /translation="MRGIGPGSSIVNTAKRGVREALVAMGFLPPEMDGGGCILHVSDTP
FT                   SSTYGYLVRAVRSMGPSVLVHTGDVADEVKLGLWPQLIDEYRRKVGKLARLLDGCGCRL
FT                   IVTCGNHDDPEVLKEALPWGEIYPRWANLDARGRSISAAHRFKDLERLGDVNLFGHDLE
FT                   VTTSTEGDRLILNGIERMNLVDPAAMRVRFVRYPPGTDDERTLKRRRGL"
FT   gene            353547..354458
FT                   /locus_tag="Taci_0329"
FT   CDS_pept        353547..354458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0329"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: acp:A2cp1_0693
FT                   Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18566"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8G3"
FT                   /inference="protein motif:PFAM:PF02541"
FT                   /protein_id="ACZ18566.1"
FT                   /translation="MRAAVMDLGTNSFKLLVAQGGEGGVLFIQDVQEVVRLGDGLALTG
FT                   RFSDASMERALETLGDFLERCEDMQVDVVMAVGTMGFRRASNGEELLAAIRDRFGLQVR
FT                   IISGEEEAELSFQACGGEGPRVVADVGGGSTELVFGDDGIRGAVSVEVGALFLTDRFLD
FT                   PSRIPSKDQLDMALLEARRSVREGVAKLPGPLPPDLWGVGGTFTTLASVALGLERYDQD
FT                   RVHRLSIPVQEVERQLWLYASMTGEERKTIRGMHPKRAHVALGGAVAALAVIRELGAQG
FT                   VTISARGLRHALMLRLMGDRGL"
FT   gene            354455..355981
FT                   /locus_tag="Taci_0330"
FT   CDS_pept        354455..355981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0330"
FT                   /product="Na+/Picotransporter"
FT                   /note="PFAM: Na+/Picotransporter; KEGG: rme:Rmet_1777 Na/Pi
FT                   cotransporter II-related"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18567"
FT                   /db_xref="GOA:D1B8G4"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8G4"
FT                   /inference="protein motif:PFAM:PF02690"
FT                   /protein_id="ACZ18567.1"
FT                   /translation="MIGPGLTLLGGICLFLFGVEESSKASRRALGERERALMARFASGS
FT                   VGALSLGALLSFVSQSSSVATSFAMGLVDIGALSFGSSIVTMMGSSIGASLMTFVLSMD
FT                   VSLLGPGFVTLGTLWGAVSNPLSRYGPLIRGMGIVLVGMYMIKAGVSPLMEMGGVMDLV
FT                   GHLAGRPWSLALLAFLATAAFQSSSAVVALGIAMASTGALGLDGAAWLVVGAHGGSFAP
FT                   VVLASLGKKLSARRLAVATGIYKVIGALMGVFLVGLFTQRLGAMPPQRGIPVFMGFLTV
FT                   VNGVVMLPLTGLLADLSARLVSGGLAPGETAYIDDALVGFPEVAFKLLEKELARLADLE
FT                   DRLLGQLAQLAESRDGAVDGPAMDGLVDLADSCVRYLEAIEDPTPEGVERKKWLAKVAL
FT                   CLRSMAQVMTRDLHPAILRLKGVPVPGLGRAMGEVEEIFSASVGAWVLGDRYFAVRALG
FT                   RYEPISHRGLGLSAGEGAQELFRLMDLERALVELLRGAVDLARMVIEEGS"
FT   gene            355986..356663
FT                   /locus_tag="Taci_0331"
FT   CDS_pept        355986..356663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0331"
FT                   /product="CutC family protein"
FT                   /note="PFAM: CutC family protein; KEGG: bcb:BCB4264_A3091
FT                   putative copper homeostasis protein CutC"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18568"
FT                   /db_xref="GOA:D1B8G5"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8G5"
FT                   /inference="protein motif:PFAM:PF03932"
FT                   /protein_id="ACZ18568.1"
FT                   /translation="MFVEVIAVSPWEAELVEACGGDRVEFVLDLSCGGLTPSVPEVAAA
FT                   VRGVSIPVNVMIRPRPGGFQYSPGEMDQMRRSAQAMAEVGARGLVMGFLKDGAVDLDAL
FT                   KSALTWCPGIDFTFHRAIDEASDPVEAARVACGAGVTDLLTSGGPGPIEGNLDRLRRMV
FT                   EAAGSVRVMAGGGITGENAPRVILHGGVPAVHLGRSVRRDNSPTEPIDSQLLRRMVELV
FT                   KGV"
FT   gene            356666..356965
FT                   /locus_tag="Taci_0332"
FT   CDS_pept        356666..356965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0332"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system lactose/cellobiose-
FT                   specific IIB subunit; KEGG: bat:BAS5064 PTS system,
FT                   cellobiose-specific IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18569"
FT                   /db_xref="GOA:D1B8G6"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8G6"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ACZ18569.1"
FT                   /translation="MKIVLVCFAGMSTSLLVTKMKKAAEERGLQVQIEAVSTADMRESL
FT                   EGAQVVLLGPQARYMLGEVREAVDGAVPVEVIDSKLYGAMGGAGVLDLAMSLGA"
FT   gene            complement(357008..358468)
FT                   /locus_tag="Taci_0333"
FT   CDS_pept        complement(357008..358468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0333"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   mag:amb3969 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18570"
FT                   /db_xref="GOA:D1B8G7"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR022489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8G7"
FT                   /inference="protein motif:PFAM:PF03976"
FT                   /protein_id="ACZ18570.1"
FT                   /translation="MLEKVDLDRKLSKEEFKSLWPPLREKLGEAQRMTKELGIPVMIVF
FT                   EGWDGAGKGTLMNELIQALDPRGFEVHNVKPDQERLWPPMRRFFQTTPPRGKIGIYNRS
FT                   WYRRILDGEESDRVFDEITSFERQLAQDGYCIIKLFLHISKKEQRKRLKALEENHATSW
FT                   RVTQEDWENHRRYDEIAQRVERMIHRTDKGHAPWTLVESHQREYATIKIAQTVLEGLER
FT                   AVKEAQGRAQSPRVVSSGLGVERALKTSIFKSLDMDQSLSEETYKKELKECQRRLRDVQ
FT                   YSLYKVRRPLVIVFEGMDAAGKGGCIKRLTQNLDPRGYQVVPTSAPNDWERAHHYLWRF
FT                   WESFPKGGHVGIYDRSWYGRVLVERIEGFCSEEEWRRAFGEINEMERQWADFGAIIVKF
FT                   WLHVTPDEQLKRFKERQEDPLKRWKITDEDWRNREKWGLYEEAAEEMFMRTSTPEAPWV
FT                   LVEGNCKRLARVKVLKEVLKRAETLLNI"
FT   gene            358524..359195
FT                   /locus_tag="Taci_0334"
FT   CDS_pept        358524..359195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0334"
FT                   /product="Protein-L-isoaspartate(D-aspartate)O-methyltrans
FT                   ferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate) O-
FT                   methyltransferase; KEGG: azo:azo1088 protein-L-isoaspartate
FT                   (D- aspartate) O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18571"
FT                   /db_xref="GOA:D1B8G8"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8G8"
FT                   /inference="protein motif:PRIAM:2.1.1.77"
FT                   /protein_id="ACZ18571.1"
FT                   /translation="MIVWRDFARRMVEVVRMNGVRDGEVLRVLGEVPRHLFIPSLRGPC
FT                   EAGDQGALRTAYGDHPLPIGFGQTISQPTMVGRMTELLSPEPPVRVLEVGSGCGYQCAV
FT                   LARMGCSVVGVERIRDLADWSREVLGGLGMEVSIIHGDGRALGGDLGPFDGIVVSAGCS
FT                   REDAEGIFGAFGGDGCRMVAPVNVGGGLQRVLVLEMEGGEVRESWQDLCRFVPLLGGVE
FT                   G"
FT   gene            359345..360043
FT                   /locus_tag="Taci_0335"
FT   CDS_pept        359345..360043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0335"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   gur:Gura_4161 GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18572"
FT                   /db_xref="GOA:D1B8G9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8G9"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACZ18572.1"
FT                   /translation="METGLKSIDPSLMVPIRDVVYENLRQAILDGAMQPGERLVEGELS
FT                   EKLNVSRMPIREAIRKLEAEGLVEHIPRRGVVVKGFSEEDIIEIYTLREALEALAAVQA
FT                   VRRATREDIRQIEVAMMEVERLASMGDQADPREVFEANHRFSQLIIEACHMPRLIQIVS
FT                   TYMGYLERFRRVTMGDPSRREVVIREHRMIFQAIKDGDEARAEALTREHVRGGLEAYLR
FT                   SFRGRGRSSR"
FT   gene            360146..361138
FT                   /locus_tag="Taci_0336"
FT   CDS_pept        360146..361138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0336"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   maq:Maqu_2897 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18573"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8H0"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACZ18573.1"
FT                   /translation="MSKVLRRFLFVALTLAVASLSVAGTALAAYPTRPFECIAPAGPGG
FT                   GWDTTMRMVTKVLTEKKIVPVPMPVVNKPGGGGGVALAYLQKKAGKDDTIAVYSPPLLL
FT                   IHLTGASPFGYKDVTPIAMLINDFGAFAVPKNSKYKNIKEIMEALKKDPKSVKVGGTSA
FT                   MGSMDHIQFLAAAKAAGVKDLRSIQYIAFQGGEGLAALMGGHIDLLSTGMAETVGPMQS
FT                   GDIRVLAITAPKRVKSGPLMTIPTLREAGINAEFVNWRGIFGPKNMPDYAVKYLEDALR
FT                   KMVNTSEWKEITIRNGWTPSFMGATDFAKFLDKTNEEYKSLLAEVGILK"
FT   sig_peptide     360146..360232
FT                   /locus_tag="Taci_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 29"
FT   gene            361216..361665
FT                   /locus_tag="Taci_0337"
FT   CDS_pept        361216..361665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0337"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mms:mma_1292 small permease component of
FT                   tripartite tricarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18574"
FT                   /db_xref="GOA:D1B8H1"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8H1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18574.1"
FT                   /translation="MRPNLLVGVVSVLIGATYTAQAFMLPKAMVGNPWAPLYFPIGLGL
FT                   LMIALGTLLIVLEVRKAVKGVDDYKRPKFTASSIKLIAGTSAACVTYALIFEDLGFIPS
FT                   SFLFLGSLLSMINGLKAWKINGVITLGFTFGAWFTFVKIFQINLP"
FT   sig_peptide     361216..361284
FT                   /locus_tag="Taci_0337"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.635 at
FT                   residue 23"
FT   gene            361684..363204
FT                   /locus_tag="Taci_0338"
FT   CDS_pept        361684..363204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0338"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112
FT                   transmembrane; KEGG: mms:mma_1293 tricarboxylate transport
FT                   protein TctA"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18575"
FT                   /db_xref="GOA:D1B8H2"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8H2"
FT                   /inference="protein motif:PFAM:PF01970"
FT                   /protein_id="ACZ18575.1"
FT                   /translation="MEVLGYLAQGFLVAMTPVNLVWMVAGSALGTVLGMLPGLGPSTGI
FT                   ALLLPLTFGMRPETALIAMCAIYYGAMFGGSRSSILLNVPGDGAAVASAFDGYPMACKG
FT                   QAEAALAISAIASFIGGLLSTIAFVLVALPVARFALRFGPPEYFCLMIFALAATAAISK
FT                   EALLKGMISLVFGLMLSTVGLDFQSGVPRFTFGSQELQMGIDFVVVIIGIYGISEVFVN
FT                   LEHIADNVAKPVQSKFGRIWITMEQWKKSIGPILRQTPVGFLIGVLPGAGGTIAALMAY
FT                   NNEKQISKHPEEFGKGAIEGLAAPEAANNACSVGALIPMMTLGVPGSGTTAVMLGALLI
FT                   LGLQPGPLLFEQHPDVAWGIIASMFLGNVVCALINIPLAGALVRVLSVPPKLLYPLVVV
FT                   LAFLGVYTINFSVMDFYLLTILGLVGYLMKKFKVPTAPLILASVVGASMESSFRQSLML
FT                   SNGSLAVFFRSWICLVLLLAAAVSVAWPFISDWRSKRNQGEAVDVPVD"
FT   gene            363282..363548
FT                   /locus_tag="Taci_0339"
FT   CDS_pept        363282..363548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0339"
FT                   /product="citrate lyase subunit gamma"
FT                   /note="KEGG: rfr:Rfer_2409 citrate lyase subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18576"
FT                   /db_xref="GOA:D1B8H3"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8H3"
FT                   /inference="similar to AA sequence:KEGG:Rfer_2409"
FT                   /protein_id="ACZ18576.1"
FT                   /translation="MIVESRAGTLESSDCLVCVYPSDRVEVRLKGVCARMYPERTRALV
FT                   EEALCRMGITGALVEIHDQGAILPTLRARLKTALSRAVGGVEG"
FT   gene            363545..364423
FT                   /locus_tag="Taci_0340"
FT   CDS_pept        363545..364423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0340"
FT                   /product="Citrate (pro-3S)-lyase"
FT                   /EC_number="4.1.3.6"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: gbm:Gbem_3859
FT                   HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18577"
FT                   /db_xref="GOA:D1B8H4"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8H4"
FT                   /inference="protein motif:PRIAM:4.1.3.6"
FT                   /protein_id="ACZ18577.1"
FT                   /translation="MRPVRSMLYVPGNSPGMLQHCATFGADSVLLDLEDAVALSEKDAA
FT                   RDLVCEMLKVLDFGSVVVTVRVNGADTEFFQEDLRAVVPLRPHAVRIPKCSSPEDVILA
FT                   DRLMGRIEEEHGLPVGSVRIHAMLETARGVVNALEIGRSSPRVEALTLGGQDLTADMGV
FT                   SKTREGWELFVARSQVALAARSLGLQALDTVWADVDDHQGLYEEARRVVGLGFTGKAAI
FT                   HPSQIEWIHRAFVPELSEVERARRIVDAARRAHAEGKGVVSVDGRMVDAPVVRRAENTL
FT                   RLWEMGEVEGL"
FT   gene            364420..365976
FT                   /locus_tag="Taci_0341"
FT   CDS_pept        364420..365976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0341"
FT                   /product="citrate lyase, alpha subunit"
FT                   /EC_number="4.1.3.6"
FT                   /note="KEGG: ppd:Ppro_1084 citrate lyase, alpha subunit;
FT                   TIGRFAM: citrate lyase, alpha subunit; PFAM: Citrate lyase
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18578"
FT                   /db_xref="GOA:D1B8H5"
FT                   /db_xref="InterPro:IPR006472"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8H5"
FT                   /inference="protein motif:TFAM:TIGR01584"
FT                   /protein_id="ACZ18578.1"
FT                   /translation="MRFVENAIGRPVPLEVPGFGAVIPYGGPFCRLGEEVPRVSPPMRG
FT                   YPARRDKVTHDVEEAIRRSGLESGMTVSFHHHLRNGDEVLCRVLEACERLGIRDLTLAP
FT                   SSLTDAHEEVSGFVRRGVVRMIHTSGVRGEVGKAISRGELEVPVVIHSHGGRARAIEEG
FT                   SIRIDVAFLGAPKCDRMGNFTGMLGRSACGSLGYAQQDARYARHVVAVTDDLSEDPLGV
FT                   VSVPQYLVDQVLVVDSLGDPRKIATGAARITRNPVDLKIARDAFRLILASGLMEDGVSF
FT                   QVGAGGASLAVARYVREHMSAKGIRGSFGCGGVTGYMAQMLEEGLFRVLYDVQSFDASV
FT                   TGSMLRNRNHVEIDQSWYANPLNRGCVVNHLDVVVLAALEVDVDFNVNVLTGHDGVLRG
FT                   ASGGHCDTAAGSKLSVVVLPSFRGGVPSIRERVGCVVTPGETVDAIVTERGVCVNPRCG
FT                   ELAESARRMGLCVKDIRELKEEVERLTGVPREVEEDRSRVVALVEYRDGSVIDTVFRVD
FT                   C"
FT   gene            366167..367504
FT                   /locus_tag="Taci_0342"
FT   CDS_pept        366167..367504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0342"
FT                   /product="electron transport complex, RnfABCDGE type, C
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   C subunit; PFAM: Respiratory-chain NADH dehydrogenase
FT                   domain 51 kDa subunit; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; KEGG: mgm:Mmc1_0688 electron
FT                   transport complex, RnfABCDGE type, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18579"
FT                   /db_xref="GOA:D1B8H6"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8H6"
FT                   /inference="protein motif:TFAM:TIGR01945"
FT                   /protein_id="ACZ18579.1"
FT                   /translation="MALPTFRKGVHPPHGKGHTEECPVQWIDPGSELVFPMAQHIGAPC
FT                   KPLVKKGDRVLVGQKIGDNDAYVSAPIHSSVSGIVKEVSQRLVASGAMDTCVVVENDGQ
FT                   YELDPSISPRPDWEDLPADEIRRIIREAGIVGMGGACFPTAVKLTPPPDKKVDHVIING
FT                   AECEPYLTCDDRLMRERGDRVLLGLQIALKLFPQGVKGVVALEDNKPKAIEAMRGYLDR
FT                   LAIQNVTVQPVRTKYPQGAEKMLIYAVTGREVPAGGLPADVGCIILNVRTAYAIWDAVV
FT                   NRMPVIDRIVTVSGDAIKEPKNLGVRLGMSVRELIEACGGFSVEPLKVIMGGPMMGVAL
FT                   SDLNVPVVKGTSGILAFSEALARLGEEENCIRCGKCVSTCPMGLLPYQLNAEVLRRNYD
FT                   EFERLGGMNCIECGCCAYACPARRHLTQSCRDGKRTILARRRKGGA"
FT   gene            367506..368453
FT                   /locus_tag="Taci_0343"
FT   CDS_pept        367506..368453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0343"
FT                   /product="electron transport complex, RnfABCDGE type, D
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   D subunit; PFAM: NQR2 and RnfD family protein; KEGG:
FT                   pca:Pcar_0262 NADH:ubiquinone oxidoreductase, RnfD
FT                   subunit-like"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18580"
FT                   /db_xref="GOA:D1B8H7"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8H7"
FT                   /inference="protein motif:TFAM:TIGR01946"
FT                   /protein_id="ACZ18580.1"
FT                   /translation="MNRLLVVSSSPHARDELTVRKIMGLVLIALLPAGVAGVYFFGLHA
FT                   FWVIAVCVASAVGAEALWQRLNGRKVTVSDLSAAVTGLLLAYNLPPDISLFMAAAGSAF
FT                   AIIVVKQLYGGLGKNIVNPALAARAVMLTSWPVPMTTWSLHGVTGPTPLALLKGVEGTG
FT                   SLPPLIDLLVGNVGGCIGETSAALLLLGGLFLMWKRVITWHIPVVYIGTVAVLTAILHR
FT                   PSGISMGPLYEILAGGLFLGAFFMATDYATSPMDHSGQMVFAFGCGLITTLIRFYGGYP
FT                   EGVSYSILIMNLTVPLIDRYFTPRIFGAKREVKS"
FT   gene            368453..369010
FT                   /locus_tag="Taci_0344"
FT   CDS_pept        368453..369010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0344"
FT                   /product="electron transport complex, RnfABCDGE type, G
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   G subunit; PFAM: FMN-binding domain protein; KEGG:
FT                   pca:Pcar_0261 NADH:ubiquinone oxidoreductase, RnfG
FT                   subunit-like"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18581"
FT                   /db_xref="GOA:D1B8H8"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8H8"
FT                   /inference="protein motif:TFAM:TIGR01947"
FT                   /protein_id="ACZ18581.1"
FT                   /translation="MNEKVRLGAILFVITAVTGLVLGGVQQITAGPISKTKEAQRQEAF
FT                   RRTLPEADSFVPAKAPSIQGVVDVQEARKGGSPVGYAITVSVKGYAGPVVFVTGVSSGG
FT                   VVKGISILSQSETPGLGAKAGDPSFAGQFAGRKAQEFKVVKSTPSKDDEILAISGATIT
FT                   SRAVTEGVNLAIKAFQQMGGAK"
FT   sig_peptide     368453..368524
FT                   /locus_tag="Taci_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.911) with cleavage site probability 0.862 at
FT                   residue 24"
FT   gene            369013..369732
FT                   /locus_tag="Taci_0345"
FT   CDS_pept        369013..369732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0345"
FT                   /product="electron transport complex, RnfABCDGE type, E
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   E subunit; PFAM: RnfA-Nqr electron transport subunit; KEGG:
FT                   pca:Pcar_0260 SoxR-reducing system protein RsxE"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18582"
FT                   /db_xref="GOA:D1B8H9"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8H9"
FT                   /inference="protein motif:TFAM:TIGR01948"
FT                   /protein_id="ACZ18582.1"
FT                   /translation="MASFIERIRGGLAKENPVFVQAIGLCPTLAVTTSAVNGLGMGVAA
FT                   TAVLMGSNVVISMLRRFIPNQIRIPAFIVVIAGFVTIIQFLVSAYAPVLDKSLGIFIPL
FT                   IVVNCIILARAEAFAFKNGVIPSLFDGIGMGLGFTVALMILGSIREIIGAGTLFGFHVL
FT                   PGYVQPALVMILAPGGFLTMGLIMGFLNYRRDLARRRRPGGTDLIDADSDADRLEKQTA
FT                   CAGCQICSVLRTEDDGR"
FT   gene            369729..370304
FT                   /locus_tag="Taci_0346"
FT   CDS_pept        369729..370304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0346"
FT                   /product="electron transport complex, RnfABCDGE type, A
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   A subunit; PFAM: RnfA-Nqr electron transport subunit; KEGG:
FT                   pca:Pcar_0265 NADH:ubiquinone oxidoreductase, RnfA
FT                   subunit-like"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18583"
FT                   /db_xref="GOA:D1B8I0"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8I0"
FT                   /inference="protein motif:TFAM:TIGR01943"
FT                   /protein_id="ACZ18583.1"
FT                   /translation="MSLIAIFLGAVFVHNIILSQFLGCCPFLGVSSRLETAKGMGMAVI
FT                   FVVFMASLITWLLYHFVLVPMGLQYLYTLSFILVIASLVQLVEMALKKLNPALYKSLGI
FT                   FLPLITTNCAVLGVAVINMNKGYGLISSMVNAVGASVGFLLALILMAGLRERIDASDTM
FT                   PRCMRGLPIALVTASLMAVAFMGFAGLI"
FT   gene            370317..371126
FT                   /locus_tag="Taci_0347"
FT   CDS_pept        370317..371126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0347"
FT                   /product="electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   B subunit; PFAM: Fe-S cluster domain protein; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   sfu:Sfum_2694 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18584"
FT                   /db_xref="GOA:D1B8I1"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8I1"
FT                   /inference="protein motif:TFAM:TIGR01944"
FT                   /protein_id="ACZ18584.1"
FT                   /translation="MGMEGTLFPAAVLGGLGLAFGLLLAVAAEKFRVQVDPRVEMVRDA
FT                   LPGANCGACGYPGCDGYAEAVVSGEAKPNMCAPGGASVATAVAAIMGLSAEDVVKRVAF
FT                   VKCKGSPDVAKTRYIYDGVMDCREAVVLPGSGPKACVFGCLGLGTCVAVCPFDAIHIEN
FT                   SLARIDENRCVGCGLCVASCPKGVIELVVQDKRVRVACNSHHRGLDVKNVCQLGCIGCG
FT                   LCSKVCPEGAITMEDNLPVIDQSKCTQCGKCVEKCPTKSIIRLESSY"
FT   sig_peptide     370317..370400
FT                   /locus_tag="Taci_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.854 at
FT                   residue 28"
FT   gene            complement(371127..371660)
FT                   /locus_tag="Taci_0348"
FT   CDS_pept        complement(371127..371660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0348"
FT                   /product="Heptaprenyl diphosphate synthase component I"
FT                   /note="PFAM: Heptaprenyl diphosphate synthase component I;
FT                   KEGG: tgr:Tgr7_2908 heptaprenyl diphosphate synthase
FT                   component I"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18585"
FT                   /db_xref="GOA:D1B8I2"
FT                   /db_xref="InterPro:IPR010898"
FT                   /db_xref="InterPro:IPR014535"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8I2"
FT                   /inference="protein motif:PFAM:PF07456"
FT                   /protein_id="ACZ18585.1"
FT                   /translation="MNWTGYPSRRLAVNGLLTALAICVNQLEGMFPHPLPGVKLGLANA
FT                   LGLAAFGLFDFKDAVMVSTLRVITVGLTFSGLGLSFGCSLAGVGCSMVVLLLLGRLWPE
FT                   RLSLWALGQAMAMGFNLGQLAVVAWAVSSPSLFLSYLPIMAGSSLVTGFATGTMAGWLM
FT                   RKAGASKSPGRGPI"
FT   gene            complement(371635..372003)
FT                   /locus_tag="Taci_0349"
FT   CDS_pept        complement(371635..372003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0349"
FT                   /product="protein of unknown function DUF1312"
FT                   /note="PFAM: protein of unknown function DUF1312; KEGG:
FT                   dar:Daro_0069 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18586"
FT                   /db_xref="InterPro:IPR024045"
FT                   /db_xref="InterPro:IPR038690"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8I3"
FT                   /inference="protein motif:PFAM:PF07009"
FT                   /protein_id="ACZ18586.1"
FT                   /translation="MKVLDAAVVLTIAALGLSPLVMGVSPSVSGPLVVRISSPTLNRTI
FT                   RLDPSTHLTIRVQSRDGGFNLVEVQGLKVRVSDANCPDRECVKRGWLTSPGDQAVCLPH
FT                   RLVVRIEGDGDELDGLSQ"
FT   sig_peptide     complement(371932..372003)
FT                   /locus_tag="Taci_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.926 at
FT                   residue 24"
FT   gene            complement(372000..373019)
FT                   /locus_tag="Taci_0350"
FT   CDS_pept        complement(372000..373019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0350"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: pca:Pcar_0035
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18587"
FT                   /db_xref="GOA:D1B8I4"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8I4"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ACZ18587.1"
FT                   /translation="MRRSYLLTAVLALLALAGLAISGARRDLPWEEREVFAMDTLMRLK
FT                   VQSDDPKVLDRMEEEIRRLEGLLSAHVPTSEVSILSSTGALKASPETEQVLRLSIQVAQ
FT                   GTHGAFDPTIGALSRLWGIGTEEARVPSREEILRALETVDYRTLRYLGDHRFSLSAGRL
FT                   DLGGIAKGFAGDRLVELLASMGIRRAVMDLGGNVVVFGPPPKAVWRIGIQHPDRPRGEV
FT                   LGVLELPERRAAVVTSGVYERYFERDGVRYHHILDPSTGEPARSGLMAVSVACSSSALA
FT                   DGLSTALFVAGPERGMEILSRHRCQAIFVTEDRRVLITPQLAPRFSLRDRSFRVEVLR"
FT   sig_peptide     complement(372951..373019)
FT                   /locus_tag="Taci_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.433 at
FT                   residue 23"
FT   gene            complement(373061..374410)
FT                   /locus_tag="Taci_0351"
FT   CDS_pept        complement(373061..374410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0351"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   dimerization region"
FT                   /note="PFAM: pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region; FAD-dependent pyridine nucleotide-
FT                   disulphide oxidoreductase; KEGG: gme:Gmet_1148
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18588"
FT                   /db_xref="GOA:D1B8I5"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8I5"
FT                   /inference="protein motif:PFAM:PF02852"
FT                   /protein_id="ACZ18588.1"
FT                   /translation="MAKRRVLIVGADAAGMSAASQLRRLDRDVEILAFERGSYTSYSAC
FT                   GIPYLVAGLIKDPRRLISRTPEEFASSGIEVRTLSEVVQVDPEARRVTVQHRGGTYQED
FT                   YDQLLIATGAKPLRPQVEGIDSPGVFGVNTLDSGIELMRAVEDRRPRRAVIIGGGYIGL
FT                   EVAEALNCHRGIQVTVVERARTVMGTLDPDMGELVGKALEDVGIQLRAQEALSSVESSG
FT                   GWVKGVWTDRGFIEADLVVLGLGVVPNSDLAERSRIPLGVRNSIQVDLTMRTAVDGVWA
FT                   AGDCAQNYHMLTKRPFYVAMGTSANKMGRVAGMNLAGRHQEFQGVLGTAVCKICKYEVG
FT                   RTGLSEREAAELGLDFVAASAADETRAGYYPGSGDITVKLLALRGSGAIVGGQIVGIEG
FT                   AAKRIDVIATAIRGGLTAEDLVAMDLSYAPPFSPVWDPVQVAARVLLKHL"
FT   gene            374524..375414
FT                   /locus_tag="Taci_0352"
FT   CDS_pept        374524..375414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18589"
FT                   /db_xref="GOA:D1B8I6"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8I6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18589.1"
FT                   /translation="MPDYAVLSGVVDGKNDRGQRVQILFCALGDSKKLAWVKTAGVSDE
FT                   VPVPEGWRERAALIDSLQRDDQSLASYGALQVRLFIQDNQAVQRAILQGNVKPLEYDLV
FT                   RFAMDRLALKAVTVARMDEISEDEARSEFEAVERRSQAEAQEEALSGGEGAPYKPQVPH
FT                   LVMLTCQPVLDPVGGIPLQALSEGDEILAALPQDSFFFDIFKSKIPDFDGVVSARVMSV
FT                   KKTETGSTQVDLFLSEGLVGVLRLSGNVRVKRSVAEVQEKEPIGAAPPPSPMVMIGVGV
FT                   ALALAAGVAFYLFFR"
FT   gene            complement(375396..376061)
FT                   /locus_tag="Taci_0353"
FT   CDS_pept        complement(375396..376061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0353"
FT                   /product="Deoxyribonuclease V"
FT                   /EC_number="3.1.21.7"
FT                   /note="PFAM: Endonuclease V; KEGG: xac:XAC2875 endonuclease
FT                   V"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18590"
FT                   /db_xref="GOA:D1B8I7"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8I7"
FT                   /inference="protein motif:PRIAM:3.1.21.7"
FT                   /protein_id="ACZ18590.1"
FT                   /translation="MVRKGPVGPFEGAAELQRRLAQEVRLCPLAGEPRLVAGVDCSERD
FT                   RTIRAAAVLLSWPELTPAAEALFEGPCRVPYVPGFLSFRELDSMVRALEGLGMPFDLVM
FT                   VDGCGIAHPRGLGIASHLGVALNVPSLGISKSLLVGSFEEPGPDPLSIGPIWLNRSQVG
FT                   WALRSRRGARPIFVTPGHMIDLDGALDVTLRALRGYRLPEPTRLADLLSKGPCQRKKR"
FT   gene            376160..378061
FT                   /locus_tag="Taci_0354"
FT   CDS_pept        376160..378061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18591"
FT                   /db_xref="GOA:D1B8I8"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8I8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18591.1"
FT                   /translation="MSARCSRALGAALFMCLILWCSHGWAGEVRVSLGDMGYPSGVMIP
FT                   GPRGEVSLLLPVPGSSPGGRIELSYVCPPGVSGGALGIAVDGVDGGTIPIGPGSGRASF
FT                   RLPGASAKGRILVRLRASLAGPGALWDDPTAENLGLKLGADSEMVLDGPVTPPKGISQW
FT                   IGSLSGSVAVVVPDKPKDEELSAAFGVLGMLVRRLPHRNVSLIRSSEEVSAVDSLRIRI
FT                   QMDPGRAEGALVGGGGRWILINGSSRESLVMLCSRLFDPKFQGVLQGAEATNLQGGGTG
FT                   GAPSWRYEPISRSWSSSWGVERGILSFVGAVPRRVRVSLRGVVPASVRDPEVALDLYIN
FT                   GDLVGSVKLGSGGFSKDLSVPEWVRIYPRNKVAMVFRGAGGPPSVGVDSVAIGDLRESP
FT                   FDLADLPAYLEGASLLVDRDLRWTGVKGAGSIFAWLASYLPDGYPAFPRVTTYESTFSP
FT                   PKGIMISVSSRIPETMSDRLRVLVSDGGVKVKAPRVEANLSDRSFSLMGQALDGDGGMA
FT                   VLVTSAVEALPRAAVALMDTPQRDLAGDVFFYSDGGGVKIWDLEEPQRRSLLAGLCGWL
FT                   RRLDPKVRLPFQWPLDGRLTICVLGGAAVLLGVLALWLTRSWDTRRRRRNRIRKRYI"
FT   sig_peptide     376160..376240
FT                   /locus_tag="Taci_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.991 at
FT                   residue 27"
FT   gene            complement(378076..379470)
FT                   /locus_tag="Taci_0355"
FT   CDS_pept        complement(378076..379470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0355"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase"
FT                   /note="KEGG: rbo:A1I_03790 response regulator PleD;
FT                   TIGRFAM: diguanylate cyclase; PFAM: response regulator
FT                   receiver; GGDEF domain containing protein; SMART: response
FT                   regulator receiver; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18592"
FT                   /db_xref="GOA:D1B8I9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8I9"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACZ18592.1"
FT                   /translation="MGVANMLDPNNHTILLAEDSQTQGRGLKSLLEAEGFKVYWFKNGE
FT                   DTLRWALSSDEMPSIIISDVMMPRMDGFELCRRIKEDQRTHNIPVILLTALTDPVEVIN
FT                   GLKAGADNFIVKPSTPDNIIKQVLSLINYYLTRPSGNEAQVVLEINVGDQVHKITAQKM
FT                   QIVNLIFSLVDSSSQSARQLNDLLTRQEELERDARNLRDNLYNTMAMVDDGILVASTSG
FT                   EVLYVNPAGEMILRSAGWTGGMIPFATNEEEKTELHVTLPSGDAMVLDVKIGITSWGSQ
FT                   EARVITMRDVTELCLLRDQLKLQAITDPLTGLLNRRGFIGQAREVLSETRKSGETCFMA
FT                   YMDLDGLKRINDTHGHFEGDRILKLMGKIMMHSFRGADLMCRWGGDEFVIMVHGYEGIS
FT                   GFELFDNFVMRFQSTMAFTEEYGTPVGLSFGFEELSPTDTRDLEEIIDELDRKMYAHKQ
FT                   GKEAQR"
FT   gene            complement(379473..380525)
FT                   /locus_tag="Taci_0356"
FT   CDS_pept        complement(379473..380525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0356"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; SMART: response regulator receiver; KEGG:
FT                   gme:Gmet_2711 response regulator receiver (CheY-like)
FT                   modulated CheB methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18593"
FT                   /db_xref="GOA:D1B8J0"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8J0"
FT                   /inference="protein motif:PFAM:PF01339"
FT                   /protein_id="ACZ18593.1"
FT                   /translation="MGLNVLVVDDSPTFQRYLKRGLSAMGEVSSVTLAFSGEEAEEIIR
FT                   ISGDHFHLVTMDIEMPGMGGIQACQRIKALRQLAIIVISSVWSPSELALTFRALEMGAD
FT                   DIMAKPGPGTTPEAFAKEVLWRALPIINRIPHAAPPKPSPEVPPPSMVERTPHPIEAVA
FT                   IGASTGGPKSTLELLKSIPSPCPVPILLVQHMFKGFEEGYARWLGDGSGHVISIASRGE
FT                   RLSGGKVFLCPSGLHMKVRNGSVDLSEEPPEHGVRPAVSVLFRSMLKEYGPRWAAVLLS
FT                   GMGTDGSLEMAEARGAGAFTMAQDQASSVVWGMPGEAYMLGGVTLLAPPAELGSRLASL
FT                   VTRTERDVRE"
FT   gene            complement(380539..382626)
FT                   /locus_tag="Taci_0357"
FT   CDS_pept        complement(380539..382626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0357"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: response regulator receiver; CheW domain
FT                   protein; Hpt domain protein; ATP-binding region ATPase
FT                   domain protein; SMART: response regulator receiver; CheW
FT                   domain protein; ATP-binding region ATPase domain protein;
FT                   KEGG: gme:Gmet_2710 CheA signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18594"
FT                   /db_xref="GOA:D1B8J1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8J1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACZ18594.1"
FT                   /translation="MTQDFMEELWQDFILEAGEYVSMVRDVLGDPAAVRDPKRLEEAYR
FT                   ALHNMKGASQAVGYLKVSTLCQAMESVVSAAKRGGLSLETPHILTLGSALDSLSRLIQG
FT                   EELNVGDLLKALKDLAEGRQVDVPSPSAPRAPQGETPPPGEPVAPADQPDRQPSPPAPQ
FT                   GSDTVRVRFSQVEELSMLLEDLIPLVLYAARKAEDLNQAAKGQAGNLRHLRELTKGLLE
FT                   DVGSIDRSVKNLLDKVRQLSMLSASGLLRYLKEAASSLAIKTQKELWVSVSGGDVRLDR
FT                   NVMESLKEPLVHLVRNSVDHGIEPPQDREASGKPRVGNLEIEISASGSVGILTVRDDGR
FT                   GIDPRRLKQRALKDRLITPEEAEAMSDQEATELIFRSGFSTADRVTDVSGRGIGMSIVK
FT                   ETVERLGGSIRVESQVGHGTCFTLEFPVTMRTYQGVLVAAGGHLFSLPSSSVECSIRIE
FT                   RSPHPGMIRVKDRHLPLVPLGDLLSLKDGTSSKGSRPVAVVISSSGSSVAIQVDQVLGV
FT                   HEGILKPLGEFLGKVRFFQGGVLLGNGSVVPVLNPSDLADSSPHGSSAGQGAQADQGPK
FT                   RILVVEDSVTSRALLRNLMTSLGYQVTTAADGQEAWEVISRDPHHLVITDVEMPRMDGF
FT                   ELTRRIKGSPALRSIPVILVTSLESPEDVQRGIEAGADAHVPKGSFDQGRLTSLVSDML
FT                   G"
FT   gene            complement(382636..384315)
FT                   /locus_tag="Taci_0358"
FT   CDS_pept        complement(382636..384315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0358"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: gme:Gmet_2709 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18595"
FT                   /db_xref="GOA:D1B8J2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8J2"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACZ18595.1"
FT                   /translation="MSFRPSIRSRLTVFVLALLLMLGGLGAFVFLLKERISYSIRHAQD
FT                   LASMSVLADEINYRRLQVRVNFLNSMATLSTSRMGEDEARRLVSDKSSAIDQVGRQVAQ
FT                   LSRMAGAKGGDLAQVGTQLEESYSVWREGHAQLDRAFLEAARALATRRGREELARLDQH
FT                   ISRMVAVSDAFGVLSERTADRFGQEETSALESVDRMYNEFAHRSLLVIGLIILLTLLTG
FT                   YWVTSSISRIVGLASEAMARLEAGELDVQLDPGLLQGDDEMGVMARSIRSTADRIRGQV
FT                   LETRAVAKGIESLSVTASAVASQLAASAEENYASLAESSTSMEEIKATAKTTAKKMEDA
FT                   SELTKRGLELVIATHEAATALLDAIERIRERMGFLSDTIVTLNDKTREIMDVADTVEDL
FT                   AEQSNLLAVNAAVEAAKAQEAGRGFAVVASEIKSMAEQSKAQAKEVKRKLGEVQRATSA
FT                   AVMATEQGVKATNEASRHTEPVRSAMDQMARHLGEIAQMSTQTLRANQDLFLGVDQVNQ
FT                   AMEQIRSTSRDNTEAIKELESATLDLKAASYNLTKVLEVYRI"
FT   sig_peptide     complement(384226..384315)
FT                   /locus_tag="Taci_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.579 at
FT                   residue 30"
FT   gene            complement(384373..384834)
FT                   /locus_tag="Taci_0359"
FT   CDS_pept        complement(384373..384834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0359"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; SMART: CheW domain
FT                   protein; KEGG: hch:HCH_03849 chemotaxis signal transduction
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18596"
FT                   /db_xref="GOA:D1B8J3"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8J3"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ACZ18596.1"
FT                   /translation="MVSQGSGVNARLLERARRLAAESHERSDWEELMVFRRGSSLLAFR
FT                   PDSWGEVVRLKGYTPIPTLPPHVAGVFNLRGSIVPLLDLSYPLKIEAPGPLRVAMVTLN
FT                   RHGQFGIGFDSLEGTMRVPREDVTETPPDHPLEGMAGDVMIVRMEALAL"
FT   gene            complement(384875..386185)
FT                   /locus_tag="Taci_0360"
FT   CDS_pept        complement(384875..386185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0360"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /note="KEGG: mrd:Mrad2831_2183 TPR repeat-containing CheR-
FT                   type MCP methyltransferase; PFAM: MCP methyltransferase
FT                   CheR-type; SMART: MCP methyltransferase CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18597"
FT                   /db_xref="GOA:D1B8J4"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8J4"
FT                   /inference="protein motif:PRIAM:2.1.1.80"
FT                   /protein_id="ACZ18597.1"
FT                   /translation="MNQGSDGLEQLARRLSRSISLAFGIQMEGREGDLTKALEDWCREK
FT                   GILPGQLERLGMDRLVAIGGELMRVGETFFMRQRASTEDFLVALSNRRNLKIWCPACSS
FT                   GEEPYSMAILLMNMGKEDFHIIGTDISPSAIAKAMRGVYSRWSLRGMDGTSPVRTYFDE
FT                   TPDGLFQLKERYRRNVTFHVGNVFQPPEGAFHGVSCRNLFIYFTEEAIRRALEVFHRIL
FT                   LEGGLLTVGYAEAPSVASLGRDLFAPAGHSTFQAVLHWHPQAPGGHNPKDRTGPTPARP
FT                   PAPSPRASAPKGKPPVEGPQGAQGTPSPHRTVEEITRMADGGDLEGALAACRAAQETHV
FT                   KDPRFPFLEGVVLMDMGLDQEAMRALSRAVFIDPLFPEAHYCIMMLAASRGDLSLANRH
FT                   ARLLLSSIQGMDDDGHTLLGESVRVRDMRRAAQGVIT"
FT   gene            complement(386182..386565)
FT                   /locus_tag="Taci_0361"
FT   CDS_pept        complement(386182..386565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0361"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: sat:SYN_00435
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18598"
FT                   /db_xref="GOA:D1B8J5"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8J5"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ACZ18598.1"
FT                   /translation="MTRYMVLAVGARRLAVPLDMVIRALPAAALSPEGRCGTVAGTLKV
FT                   GSQVIPVADPRGPMEQDAKEMKTSDAIVLVTTDRGTVGLWVDQVEGIFEPLSQAQSPGG
FT                   LVIQYGHERDQMATVLNPGDLLG"
FT   gene            complement(386584..387324)
FT                   /locus_tag="Taci_0362"
FT   CDS_pept        complement(386584..387324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0362"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: pca:Pcar_0631 Sir2 family NAD-dependent protein
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18599"
FT                   /db_xref="GOA:D1B8J6"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8J6"
FT                   /inference="protein motif:PFAM:PF02146"
FT                   /protein_id="ACZ18599.1"
FT                   /translation="MGLKALASALEGARRIVVLTGAGISTASGIPDFRGPNGIYRQLGA
FT                   EAERIFDIDHFMVNPSTFYGFHRRFLEMVEAVRPSFAHRFIAKLEETKDLAVITQNVDG
FT                   LHQRAGSRNVIEIHGGIGENSCLTCGRTYSLGDLKAMMEEREVPLCSCGGLIKPHVVFF
FT                   GEGVRDLDRCMELSRDCQVMLVVGSSLTVTPAASLPSLCKGTLAVVSRGEIYTGHVRRP
FT                   IDIMIEEDIDPFFMRLAAEMGLKP"
FT   gene            387426..389339
FT                   /locus_tag="Taci_0363"
FT   CDS_pept        387426..389339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0363"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="KEGG: sfu:Sfum_3451 glycogen branching enzyme;
FT                   TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM: alpha
FT                   amylase all-beta; glycoside hydrolase family 13 domain
FT                   protein; alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18600"
FT                   /db_xref="GOA:D1B8J7"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8J7"
FT                   /inference="protein motif:TFAM:TIGR01515"
FT                   /protein_id="ACZ18600.1"
FT                   /translation="MSRAVPGISLMSDYDVYLFKEGRHFRLYRCLGCHPMEVDGQPGAL
FT                   FALWAPNAEWVSVAGDFNGWDPDSHRLYPRWDGSGIFEGFVPFAKAGDVYKYVIRSRVT
FT                   GETYEKTDPFGFLFECPPRSGSVVWDLSYSWGDGEWMEGRGAKNWLESPWTIYEAHLGS
FT                   WQRVPEEGNRPLYYREAAERLGNYLRETGFTHLELLPVMEHPFYGSWGYQTLGYFAPTS
FT                   RYGSPQDFMCLVDHLHRLGIGVILDWVPSHFPKDGHGLGFFDGTCLFEHQDPRKGYHPD
FT                   WKSGIFNYDRPEVVSFLGSSAAFWCDVYHADALRVDAVASMLYLDYSRPPGEWVPNRYG
FT                   GRENLGAIEFLRAMNAELYRSFPGVETIAEESTSWPMVSRPAFLGGLGFGMKWNMGWMH
FT                   DVLRHMSRDPIHRRWHLEELTFGLWYNYSENFVLPLSHDEVVHGKGSLWGKMWGDPWQR
FT                   AAALRLLYGWMYCHPGKKLLFMGGEFGQEAEWDHDRSLDWHLIAQSDLHRGVFQWVKDL
FT                   NRFLRERPCLYQLDFQREGFQWVDCDDRDNVVLSCIRFSRDGGMVLGIGNFTPVTRRGY
FT                   VVGVPRGGFWREALNSDGACYGGSGEGNLGGVWARDQGSHGRPFSLELTLPGHSFIFLE
FT                   PA"
FT   gene            389354..390838
FT                   /locus_tag="Taci_0364"
FT   CDS_pept        389354..390838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0364"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="KEGG: tgr:Tgr7_2071 4-alpha-glucanotransferase;
FT                   TIGRFAM: 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase family 77"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18601"
FT                   /db_xref="GOA:D1B8J8"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8J8"
FT                   /inference="protein motif:TFAM:TIGR00217"
FT                   /protein_id="ACZ18601.1"
FT                   /translation="MFLERRRGVLLHFTSLPGPYGAGDLGPVARSVAEGMAAQGWTIWQ
FT                   MLPLNYPNPAMGFSPYASYGALPLNPTVISLDDLAEEGWIPGEELRNLQVRLPDPWRAD
FT                   LQGAFRARRAGVALAFQALKRGHMRDRYLEFRQREWEWLEGWGVFMALKDSLGGSHWVH
FT                   WPERFRSLERALAHWDEGLEEGAELYRFEQFLARRQLDRFRAHCEALGVRLLGDMPIYV
FT                   AHDGMDPWACPYLFELDGEGNPVEVAGVPPDYFSETGQRWGNPLYRWEAMGEDRYLWWR
FT                   VRLRKALEWFHAVRLDHFRGFAGYWAIPAEEMTAVRGRWRPGPGEALFDALVEDLGGDP
FT                   SGEGPSLPIVAEDLGVITQDVTRLRLRYRLPGMRVLQFAFSGGDDNPHLPFNHEGLGLA
FT                   YTGTHDNDTTLGWWLSASAEERRGLFRYVGRPLTAEEAVREMVRLALNSPSRWRIVPLQ
FT                   DLMLLGSRHRMNTPSSREGNWVFRAMRVELDGLLGG"
FT   gene            390901..391887
FT                   /locus_tag="Taci_0365"
FT   CDS_pept        390901..391887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0365"
FT                   /product="Ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin; KEGG:
FT                   bce:BC0906 ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18602"
FT                   /db_xref="GOA:D1B8J9"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8J9"
FT                   /inference="protein motif:PRIAM:4.3.1.12"
FT                   /protein_id="ACZ18602.1"
FT                   /translation="MRLIRGGVLKRVLPMSEAVKGVKRALSAWSSGSCQVPVRERLSLK
FT                   LGDVLFMPASVDHVVETAGVKVISVFPGNLAQGKPSITSLMVLISSETGEVEALLDGTE
FT                   LTRIRTGAVTACGTELLAREDARIGALFGTGGQAMTQLEGMLHARSLEEVKVYDQFRER
FT                   IMAFIEAARPMAEARGCRLVPAEDPEEAVANAMVVTTVTTSSTPVFPGAMLPMGAHVNA
FT                   IGAYTPSARELDTETLTRADLVFVDNLKAVMEEAGDLLIPISEGAFGPERITGELGEIL
FT                   LGLKQGRSSSAQITVMKSVGFGALDVVCARRALDLALKMGLGEELEI"
FT   gene            complement(391889..393097)
FT                   /locus_tag="Taci_0366"
FT   CDS_pept        complement(391889..393097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0366"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: afw:Anae109_1028 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18603"
FT                   /db_xref="GOA:D1B8K0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8K0"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACZ18603.1"
FT                   /translation="MFKPYKLALTIMLAVILLGGQAWGEEVPFGAFRGYNLIYIQMESI
FT                   QQFLIGSRVDGREVTPNLNRLHSSGVSFSRCYAQTGMGNTSDAELLAMCSILPLPDGAA
FT                   FKDISKPMRSLPRALKEAGYHTYAFHGNSPSVWNRKKVYPLIGIDRYYHQGALVNDQLV
FT                   GLGISDLSLSRQLIHTLSRGLLREPFFALVMTLSSHHPYKVDKVWDFDSGKFQGTTLGD
FT                   YLQSANYTDHAVGLLVDWVTRSPLGRRTIIALYGDHRAPGIGDTEELNRFLEMNSMERL
FT                   TREPHRQRDFGRVPMILLIPSREGYLRLQVDRPVGQLDLAPTVAHLLGIPFEGAGQNVL
FT                   GEGTDLVPFPQDEIIYRDYWSAFGGKRVVDLTLNASAPPVLNPQWREAERVKALSRRML
FT                   GLP"
FT   sig_peptide     complement(393023..393097)
FT                   /locus_tag="Taci_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            393200..393610
FT                   /locus_tag="Taci_0367"
FT   CDS_pept        393200..393610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0367"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN- binding"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18604"
FT                   /db_xref="GOA:D1B8K1"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8K1"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ACZ18604.1"
FT                   /translation="MAKLKDMYDFLAKNPFGFLATWSEGGPRVRPFMFQFEDRGCPLFC
FT                   LSNDKEVYGQLKADPRCEVAFCTPDWSVTLRIRGKAEFFPGLEQKKRILDGNETLREMY
FT                   GTPDNPRFEVFRLVDFEAFFWDFSGRKDPVER"
FT   gene            complement(393638..394993)
FT                   /locus_tag="Taci_0368"
FT   CDS_pept        complement(393638..394993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0368"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: cco:CCC13826_1827
FT                   branched-chain amino acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18605"
FT                   /db_xref="GOA:D1B8K2"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8K2"
FT                   /inference="protein motif:TFAM:TIGR00835"
FT                   /protein_id="ACZ18605.1"
FT                   /translation="MDLLRFVQEVNRVLWGYLLIFLLCGTGLFLTFKLRFVQIRLFGRA
FT                   FRKAFGELNLFGQRAGREGMSSFQALATAIAAQVGTGNLAGAATAIAMGGPGAIFWMYL
FT                   AAFFGMATNLAEATLGQLYKTQDDRGNVTGGPAYYISQGLHMPRMAAFFSIAIIAALGF
FT                   MGNMVQSNSIADAFKTAFNVPPLVTGLALGAVGAFVFIGGIGRIAAVTEKMVPLMAGIY
FT                   ILGSLYIIVTYIPQLPHVIWSILLGAFDPMAATGGVVGATIREAARYGIARGLFSNEAG
FT                   MGSTPHAHAVAKVSHPAEQGLMGIVGVFIDTFVVLNMTAFAILCTGVLDGKTTGIALTQ
FT                   RAFTAAMGPMGNAFVATCLLFFAFSTIVGWYFFGEANVKYLLGTRGLTPYKLAVVGFII
FT                   LGSTLKVDLAWELADTFNGLMVLPNLLALIMLAPQVIKALKDFETQDPNHRG"
FT   gene            395361..397247
FT                   /locus_tag="Taci_0369"
FT   CDS_pept        395361..397247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0369"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: afw:Anae109_1028 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18606"
FT                   /db_xref="GOA:D1B8K3"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8K3"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACZ18606.1"
FT                   /translation="MKFRGNPGGIRGLAGHLIWPLAVWTVSSFKFLALCDSMRGGSQWW
FT                   PQVLWSTILGALALSGLPLLLPRRVRPLGFVAVSALVSALCLADLLYYRYYTDLFTVRS
FT                   LSLAGQLGDVWDSVRSLFSMGDLLFLMDLPVLLAVALLDLRSRERDLRFRFRAAGTCLC
FT                   LLGLLPFGFQTGIVRLRVPGYVRAMWDRPAVMFTLGPVGYHLADLINASSDLFASRAVA
FT                   AQDEEALLDWAVKRRQQVPVSQRDSLHGAGKGLNLIVVQVEALQGFVMNLKVGGQEVTP
FT                   NLNRLARRSLYFPNVYNQTGAGNTCDAEFMVQTSLFPSATGVAYVRFSGNYFESLPRIL
FT                   QRNGYETLSMHGNRASFWNRHRMHPALGFQEFFSKERLRSDEEIGLGLSDRSFFEQGAR
FT                   ILSERKGPFYAFMVTLSSHHPFSFQGIPRTLKLDGSLEGTFLGDYLNAIHYADAQIGRF
FT                   LQDLRRRGILDRSVLVVYGDHTAIPNANGSELEVLLEQDLKDPLRWRALQKVPLMIRLP
FT                   KGRGARVVETTGGHVDIGPTVASIMGVNMPLAFGQDLLTARVGTVVFRNGTFIRGGVFV
FT                   DPTARMAWSMGTLSEVPFDAYRDLAEGASEALRLSDLLLEKDMAQRVCERLP"
FT   gene            397356..398672
FT                   /locus_tag="Taci_0370"
FT   CDS_pept        397356..398672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0370"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bcy:Bcer98_1099 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18607"
FT                   /db_xref="GOA:D1B8K4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8K4"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACZ18607.1"
FT                   /translation="MSGEEMFYFSVWWGWWLVQCCLYLLFGLLIADGIYQFVVSFRGWW
FT                   TPKAPPKASRYRRFAVLIPAHNEARVIGPLLESLKEQDYPKDCYRVFVSCDNCTDHTAQ
FT                   VAALHGAVPLIRTDTTKSGKTWNVRWALTQIPMDEVDALVMFDADNLASRDFLSRMNDY
FT                   MEAHPEAEAVQGVLDVKNPDDNWLTKAYALAYWYTNRFWQLARSNWGLSCTLGGTGLVI
FT                   RSSTLRRIGWNLESLTEDLEMSTRLILSGSRVHWNEHAVVYDEKPLDYRISVRQRTRWM
FT                   QGHYWVCWRYGMEALKMFFRTRRLQYLDLFLYLLAPAKACISLLAMFAGMAYTVINNAI
FT                   LFPTLESKAPTTPLEWMAFVGLPVAMILAHCLFVALVGPSMHRRRLCLGYVKDVFGYFL
FT                   FGLSWIPILFKAAFLAKDQGVWVKTEHTRSISIGQVTNR"
FT   gene            398840..399829
FT                   /locus_tag="Taci_0371"
FT   CDS_pept        398840..399829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0371"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family; KEGG: pmr:PMI1056 TRAP-type transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18608"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8K5"
FT                   /inference="protein motif:TFAM:TIGR02122"
FT                   /protein_id="ACZ18608.1"
FT                   /translation="MKRGRIAVAVALMVCLLGATSALAAGKFITIVTGTTGGTYYPVGT
FT                   ILANHFNSVLGSKGYKWSAQSSGGTAENLEMMRKKEAEMAIAMANLTGFAYTGTVRYEG
FT                   KRIENLRYVMGLWPDVTQFVVREDAKISTWKDLKGKKVAVGPAASGTEFSSRVILKAVA
FT                   GLTFDDIVPERVGYTEASQALQNGQIHAFNAEAGVPVGAVSELLAGRTKVKFLEFSDED
FT                   LQRLRKEGPYYYRVVVPAGTYPKQDKPLNLAGIKSALIVDKSVPDQVVYDMLKVIYDNK
FT                   DRMAKEHGAFAKIDYEKPLDGLFGAPLHPGAIKFFMDRGIKIPPRLLP"
FT   sig_peptide     398840..398914
FT                   /locus_tag="Taci_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            399895..401805
FT                   /locus_tag="Taci_0372"
FT   CDS_pept        399895..401805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0372"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /note="TIGRFAM: TRAP transporter, 4TM/12TM fusion protein;
FT                   PFAM: TRAP C4-dicarboxylate transport system permease DctM
FT                   subunit; KEGG: bha:BH2945 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18609"
FT                   /db_xref="GOA:D1B8K6"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8K6"
FT                   /inference="protein motif:TFAM:TIGR02123"
FT                   /protein_id="ACZ18609.1"
FT                   /translation="MNQILKLLSPFESLPNRSFSGRLKLAVGLYAVAVSLIHCWMNTMG
FT                   VMMTIKMNALHLGTLMGLTFILCPAMPWSPKDRPSVLDLILAGFSLFSAAYMIVRYDQL
FT                   LALNMEPSAMDLWLGALMVAVLAEASRRSVGIPLTLLSLAFLGYTRFGPYFPGLFAHRG
FT                   FNWERILVRMIFTDEGIYGTTLTVSATYVFMFILFGAFLAATRTSEFFNDLALALAGRY
FT                   RGGPAKVSVIASALMGTISGSAQANVATTGAFTIPLMKKIGYPDYFAGAVEASASTGGI
FT                   LMPPIMGATAFIMSSFLGIPYVKIMLAGFAPAILYFLGIMFMVDLQAKRQGMRGLPPEE
FT                   VPSLSKTMAERGHMLIPLAFIIYMLVAGYTPLFSAMAGLVAIIVVSSLRPSTRMSLKDA
FT                   LRALEDGAVSSAPVAVSCAIVGFIVGSVGMTGLGQVIALNIMHLSGGMLWASLLLCMVA
FT                   SIVLGMGLPSTACYIVVATIAAPALQGMGVPSLAAHFFAFYYGTLSGVVPPVALTSFTA
FT                   AGLSGGRPTKVALTGLFLTSSGLILPFFFVYNPVLLLIDFSWVSFLGVFGLTALGILCL
FT                   SGAFIGTGLTDMGWVERLAFLVAGVVLVYPKGAGLALSLGAFLGAFALHLIMSRRRTVP
FT                   A"
FT   gene            complement(401846..402661)
FT                   /locus_tag="Taci_0373"
FT   CDS_pept        complement(401846..402661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18610"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8K7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18610.1"
FT                   /translation="MRRLLTLALLLGVLIPCSAQGAMLPPHKRIAVMIFESASGLFRDN
FT                   LAVDTASTVITQALIENGYPVVNDAQVKKIKADKRSELLRSGDAKAIKALGKTYDVRIF
FT                   LVGKATLAEAVRNDFGTYTATATVTIQGYSTQDGKYLLSQMASSKQLGGTPDEASQKAL
FT                   EAASRELAQRLISGQGQTIHGSYPTSYRYRDVTVTITGAQDFQQVNAILQKVQSHPATR
FT                   QAMVTSYSSGNATIGASFGGDVKEILSLIRDTVQPRNVRTGPNSIWVDL"
FT   sig_peptide     complement(402596..402661)
FT                   /locus_tag="Taci_0373"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.974 at
FT                   residue 22"
FT   gene            complement(402676..403593)
FT                   /locus_tag="Taci_0374"
FT   CDS_pept        complement(402676..403593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0374"
FT                   /product="Curli production assembly/transport component
FT                   CsgG"
FT                   /note="PFAM: Curli production assembly/transport component
FT                   CsgG; KEGG: sus:Acid_5438 curli production
FT                   assembly/transport component CsgG"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18611"
FT                   /db_xref="GOA:D1B8K8"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8K8"
FT                   /inference="protein motif:PFAM:PF03783"
FT                   /protein_id="ACZ18611.1"
FT                   /translation="MRTRTLTALLALGLILAMGSPSLAKARIAVLSFQDSSGAGAPAAA
FT                   IADMMTTELFNTGLFSVVERSRIDQIAMEQRMSAQGLTSPSSAVQMGQLLGAEYLMTGS
FT                   ITQYRYEASGGVIPLPFGGLSGVAVGSETAYVTLDVRLINAATGEVITTARAEGAANQT
FT                   QGGLAYDSAVFGTGKAGGLLGQATYKAVTKIVEQVKGKVGSSIGVKPFNVLSEMAKVVT
FT                   IDGGSNHGVQAGQLFMVYGEGAPVLGLKGEILDVEKVNLGLVRITEVNPNYSKGTLIKG
FT                   IDVRRGDKVIPYTGDVESFRVGIR"
FT   sig_peptide     complement(403519..403593)
FT                   /locus_tag="Taci_0374"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.952 at
FT                   residue 25"
FT   gene            complement(403708..403881)
FT                   /locus_tag="Taci_0375"
FT   CDS_pept        complement(403708..403881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0375"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dol:Dole_0181 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18612"
FT                   /db_xref="GOA:D1B8K9"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8K9"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACZ18612.1"
FT                   /translation="MAKAVVDKDTCVGCEACVGVCPTSAISMVDGKAEVNPDACVECGA
FT                   CVATCPVSAISQ"
FT   gene            404184..405086
FT                   /locus_tag="Taci_0376"
FT   CDS_pept        404184..405086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0376"
FT                   /product="Phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; KEGG:
FT                   bcy:Bcer98_2860 phosphate butyryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18613"
FT                   /db_xref="GOA:D1B8L0"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8L0"
FT                   /inference="protein motif:PRIAM:2.3.1.19"
FT                   /protein_id="ACZ18613.1"
FT                   /translation="MLRSYDQVLDRVRSGGRVTLAVASAEDMEVLRCVAMAREEGICDA
FT                   LLVGDPSKIGPMAKELGLSDLPVIADPDPASAAVTAANEVREGRAQVLMKGLVNTSDFM
FT                   RGVLNPDKGLRTGSLISHLSVFQIPGEDRLVFHTDGGINIAPDLEAKRGILRNALSALW
FT                   ALGYERPNVAVLCANEQVNPKMQATVDAAALVEEWGRGEFGSCVMEGPIALDVAISPEA
FT                   AHHKGIESRISGQVDLFLMPNIETGNVAGKSLIYYAKAQMAGLVLGAKAPIVLTSRAET
FT                   ARGKLYSIAMACLVSQGAR"
FT   gene            405145..406923
FT                   /locus_tag="Taci_0377"
FT   CDS_pept        405145..406923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0377"
FT                   /product="indolepyruvate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /note="TIGRFAM: indolepyruvate ferredoxin oxidoreductase,
FT                   alpha subunit; PFAM: thiamine pyrophosphate protein domain
FT                   protein TPP-binding; 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; KEGG: indolepyruvate ferredoxin
FT                   oxidoreductase, alpha subunit ; K00179 indolepyruvate
FT                   ferredoxin oxidoreductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18614"
FT                   /db_xref="GOA:D1B8L1"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8L1"
FT                   /inference="protein motif:TFAM:TIGR03336"
FT                   /protein_id="ACZ18614.1"
FT                   /translation="MAGKAILTGNEAIARGAWEAGLHVAAAYPGTPSTEILENMSQYRE
FT                   IYSEWSTNEKVALEVASGASIGGARALAAMKHVGVNVAADPLFTMAYIGVNGGLVLVSA
FT                   DDPGLFSSQNEQDNRWYAPHAKIPMLEPSDSQECKDFMKAAFEISERFDTPVLFRVTTR
FT                   VCHSKGVVELGERQEVPIREYHRDIRKTLMAPSSAKARHYVVEERLAALRDYSNDCPFN
FT                   RIEWGPDRRIGVIASGIGYQHAREAFGDQASYLKIGFSHPLPDRLISVFARSVDRVVVV
FT                   EENEPYIENFVRQLGIDCVGRELLPAVDELSPAVVRRAFVSSEEPKVARPDCPVPGRPP
FT                   VLCAGCPHRGIFYAMSRIKDKVVTSDIGCYTLGAMEPLNVGDTVICMGASVSAGVGFQK
FT                   VQQLAGRKGKVFGVIGDSTFFHSGITGLIDSVYNKVPLALVIVDNRITAMTGHQENPGT
FT                   GRTLMGEETVSLDIEALCVACGVKRENLVVVDPYDYKACEAAVKAAEASEEPFVIITRR
FT                   PCALIKEVQRARAGVHCVVDHSKCVKCKSCIRPGCPAIAMKDGVIVIDTAQCNGCGLCL
FT                   QLCPKGAISREGEVNE"
FT   gene            406916..407497
FT                   /locus_tag="Taci_0378"
FT   CDS_pept        406916..407497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0378"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: glo:Glov_1857 indolepyruvate ferredoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18615"
FT                   /db_xref="GOA:D1B8L2"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8L2"
FT                   /inference="protein motif:PFAM:PF01558"
FT                   /protein_id="ACZ18615.1"
FT                   /translation="MSRNSTNSILLVGVGGQGTILASKVLSEGLMKMGYDVKMSEIHGM
FT                   SQRGGSVTTHVRYGEKVYSPVISEGEADILVAFEKLEAARWLSYLKEGGTLVVNDYEIY
FT                   PVPVLLGKDSYPEGLDEMFRRKVRDLKIFDAGKVAQELGNVKAQNVVLLGALIRSMGLD
FT                   TIDWSQVLADVVPPRFLELNVKALKAGMEL"
FT   gene            complement(407579..407734)
FT                   /locus_tag="Taci_0379"
FT   CDS_pept        complement(407579..407734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18616"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8L3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18616.1"
FT                   /translation="MTKFMRLIGRIYVLKGGSVERLFDADRASAFHRRCVTLEDLMSCG
FT                   DPSRAA"
FT   gene            complement(407804..408109)
FT                   /locus_tag="Taci_0380"
FT   CDS_pept        complement(407804..408109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18617"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8L4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18617.1"
FT                   /translation="MDRRVEAVNGVNPVEPVRPKRGPKGEPGRVRRRWEDFLEEESRQG
FT                   GGNQPHQEARDREPLHQDEPPEDPREALRRVKERPTSLLEAHSPKDTRGVIIDSKG"
FT   gene            complement(408187..409584)
FT                   /locus_tag="Taci_0381"
FT   CDS_pept        complement(408187..409584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0381"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="PFAM: sodium:neurotransmitter symporter; KEGG:
FT                   dde:Dde_2371 sodium-dependent symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18618"
FT                   /db_xref="GOA:D1B8L5"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8L5"
FT                   /inference="protein motif:PFAM:PF00209"
FT                   /protein_id="ACZ18618.1"
FT                   /translation="MSDGKKREGFSSGLAVFFATLGSAVGLGNIWKFPYLTGVNGGGAF
FT                   LLVYFICIALVGIPVMTGEFIIGRRGRGNAVGSFRNVTGNPATPWRFVGVLGVLSAYLI
FT                   MFFYTDVAGWVYFYFFKAATGQLAGITKEQVGPLFKAVVGAGATSLRGAMSPVLWQWIV
FT                   LALVGSAISLGVRSGIERITKTLMPLLFVLIILCDIRALTLPGAKDGIRFLFNVDFSKL
FT                   TPSVILAALGLAFFKLSLGMSTMITYGSYFTDDNRLINTAVRVAASDTLVSLLAGLAIF
FT                   PTVFSFGMEPSAGPGLLFMTIPLVFSQIPLGNLLLAAFFLLTCFAATTAMLSIMEVPIA
FT                   FMVEELKLKRPLAALLNCIIIGSIGATATLSADGSSYLGGIHILGRTFFDLYDHLSSNI
FT                   MMPIGGLLTAVFVGYVLKSGIVEEQLSNGGTLNNRGLIAAYRFVLRYITPALLLLVFLS
FT                   TAGVIRL"
FT   sig_peptide     complement(409510..409584)
FT                   /locus_tag="Taci_0381"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.706) with cleavage site probability 0.433 at
FT                   residue 25"
FT   gene            complement(409774..410415)
FT                   /locus_tag="Taci_0382"
FT   CDS_pept        complement(409774..410415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0382"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: dde:Dde_2524
FT                   nitroreductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18619"
FT                   /db_xref="GOA:D1B8L6"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8L6"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACZ18619.1"
FT                   /translation="MDVREAIRSRRSINFFDPGRRIPEGVLEEVIEEANLAPSSFNLQP
FT                   WEVVVVKDPEDKRRLRECAFNQPKVEEASAVLIVASDPMAVERHIDRVLKSMVELGYMK
FT                   AEDVERTRPMPFNLYGEMDSERRRLFAVKNASLFAMSLMIAAMGHGLSTHPMDGFNESK
FT                   VKEAFGIPGRFVIPMLIAVGYLRDGVTLLPRGLRRPLEEFVHLGRFSPKD"
FT   gene            410516..410827
FT                   /locus_tag="Taci_0383"
FT   CDS_pept        410516..410827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18620"
FT                   /db_xref="GOA:D1B8L7"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8L7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18620.1"
FT                   /translation="MEEDLKEVLRRLEALEARLPAVEEEERQEDRIRQYLGEFKAYVDE
FT                   MRERVLDRIAKGAGAISEPASAAIHRATSVVGESPLAVAALAFGAGLLLGALVRHHRD"
FT   gene            410838..411113
FT                   /locus_tag="Taci_0384"
FT   CDS_pept        410838..411113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18621"
FT                   /db_xref="GOA:D1B8L8"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8L8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18621.1"
FT                   /translation="MEPIAKFVLGVLDAIEAEMRLLLALSARWALGMFLSISFLVLGIA
FT                   FGAYGASLWLRPRVGGPLAFGLVGLALALCGWGCCLWASGSRRRGS"
FT   gene            411080..411325
FT                   /locus_tag="Taci_0385"
FT   CDS_pept        411080..411325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18622"
FT                   /db_xref="GOA:D1B8L9"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8L9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18622.1"
FT                   /translation="MGFGVSEERELTRAREALLESSRGADRWVREHRLGIWLSALALGA
FT                   GVGFLGPRRAMGIARGLISLLVLPGRGPGEGVPSPK"
FT   gene            411534..412259
FT                   /locus_tag="Taci_0386"
FT   CDS_pept        411534..412259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18623"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8M0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18623.1"
FT                   /translation="MEPSYFDKTSDYPCGSPDNRYLLSIQNCGVTLDSTGRRVPVMEDV
FT                   RNGNGRAIKSRLWSPDRVDRIDDPLDAVFWIMKDPVLGAAMGATLATKRSSAERLASGV
FT                   DPEALVFEPFANPFRAYPLREDYEKFKGIFGRGVRCFVLNTGHFMGRKVPKDLTLQVLL
FT                   DVVEGRCGFQGLVGGMDYLPIDGFEPPVDDPGYREVLRRSLEARIRFLGEREECTGGYD
FT                   SLPDECVHAIGDLVAELGV"
FT   gene            412385..412588
FT                   /locus_tag="Taci_0387"
FT   CDS_pept        412385..412588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0387"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: pca:Pcar_0201 cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18624"
FT                   /db_xref="GOA:D1B8M1"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8M1"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACZ18624.1"
FT                   /translation="MATQGTVKWFNATKGYGFITTDEGRDVFCHFSAIKMDGYRTLEEG
FT                   QRVSLDVEMGPKGEQAANVVKL"
FT   gene            413086..413253
FT                   /locus_tag="Taci_0388"
FT   CDS_pept        413086..413253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18625"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8M2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18625.1"
FT                   /translation="MPCGSSIFTAAFIPRITGNLVDKVACCVLVALILPKLPARIHAMS
FT                   GTPFFRGKGE"
FT   gene            413260..413871
FT                   /locus_tag="Taci_0389"
FT   CDS_pept        413260..413871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3949 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18626"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8M3"
FT                   /inference="similar to AA sequence:KEGG:Sfum_3949"
FT                   /protein_id="ACZ18626.1"
FT                   /translation="MERSYRLVVLCHCILNANAIVDGEARYPGAMGEFLAPLVAEGTGI
FT                   IQLPCPESTFLGLRRCPMGVEQYDSPAFRRHCSRILEPFMDQIQDALQNGVQVLGVVGV
FT                   KGSPSCGVTATCTGRMSPDTRKVVDFAVRYGSAGVFIQVLRRELLARGIDLPMTDVDNG
FT                   DPSSASWKAAREELTAEAAEAPARGGSNIFVPPLHISSGF"
FT   gene            413955..415241
FT                   /locus_tag="Taci_0390"
FT   CDS_pept        413955..415241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0390"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   ccv:CCV52592_1033 proton/sodium-glutamate symport protein
FT                   (glutamate-aspartate carrier protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18627"
FT                   /db_xref="GOA:D1B8M4"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8M4"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACZ18627.1"
FT                   /translation="MSGSNGSKGLLGFYFGTSLVARILVATALGAAVGLALGPQAAAVK
FT                   PLGDLLLRLLRMIVVPVVFFSLVVGASSVSPSRLGSVGIKLIAYYTITTALAVTVGLLF
FT                   ANLLKPGLGLVLEGTGGATLSATPPSLVETLLNVVPTNPVEALAGGNMLQIIFFALLLG
FT                   IGISTLSESQDPRLSSAGQAVFKVCEGGAEAMYKITKWIMEYAPIGVFALIATVFSQQG
FT                   SKVAGPLAMALGTVYLAFGAHMVVIYGAALKAFGLSPLGFFRRAREAMITAFVTRSSSA
FT                   TLPVTMEVSEEMLGVSKGIFSFTLPLGATINMDGTAIYQGVCVMFVANCMGQALSLSQQ
FT                   LTVILTATLASIGTAGVPGAGAIMLLMVLNSVGISVSEGTAAAAAYAMILGIDSIMDMG
FT                   RTLLNVTGDMVGTVVVAKGEGELDGSKWD"
FT   sig_peptide     413955..414080
FT                   /locus_tag="Taci_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.778) with cleavage site probability 0.289 at
FT                   residue 42"
FT   gene            complement(415290..416180)
FT                   /locus_tag="Taci_0391"
FT   CDS_pept        complement(415290..416180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0391"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   dds:Ddes_1865 cobyrinic acid ac-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18628"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8M5"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ACZ18628.1"
FT                   /translation="MNPLEIAVVSGKGGTGKTTVSSALAAALKGDCVLCDADVNVPDLW
FT                   ILLRPRILEREDFMGQEKAEMRRHLCEGCGRCAAACRFDAIWLEDGEVRLDRRRCEGCG
FT                   ACAVVCPTGAISLSPSIQGDVFRSETDLGPFWHARLHPGGENSGRLVQLLRDRARKTGR
FT                   ELGKRWVLVDGPPGVACPAASAITGCQLALAVTEPSRSGLHDLRRLGELASRLRVPMAV
FT                   VLNRSDLSEEGAQAVRRTCDEMGWPLLAEIPFDQEIARDLAMARIPSAPLAKAIQAIKE
FT                   GMEDLLGEDAVEEGE"
FT   gene            complement(416177..417037)
FT                   /locus_tag="Taci_0392"
FT   CDS_pept        complement(416177..417037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0392"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: pca:Pcar_1585 MinD family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18629"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8M6"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACZ18629.1"
FT                   /translation="MPSLGDRPMAIAVVSGKGGAGKTSFSASLVLSRRGVTAVDADVEE
FT                   PNLALLLGNPPMATMNATIPTPQVVDDLCARCGTCSRTCRFGAVFSFGQAPPVFNSLCH
FT                   GCGACVLACPRGALYQVDRPVGVIGRGVAGDAILVEGRLLVGNPNPVPVIHRAIEVGLA
FT                   EGRDAVIDSPPGAACPMMAAVREADAVILVTEPTPFGRADAEVAAQVLVELGKPTALVV
FT                   NRSGILEEDPPLGGILGTLPELARISFSRRVAEGYAVGVPPSAVDPSWAMAAESAWRWV
FT                   MEVTG"
FT   gene            complement(417025..417399)
FT                   /locus_tag="Taci_0393"
FT   CDS_pept        complement(417025..417399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0393"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: dde:Dde_3202 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18630"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8M7"
FT                   /inference="protein motif:PFAM:PF02579"
FT                   /protein_id="ACZ18630.1"
FT                   /translation="MKIAVPMEGGLVCPHFGHAPEFLVVATDEDKPVAREVYENPGHEP
FT                   GRLPRWLADLGVKTILAGGMGDRAVSLFKANGIRVCLGVSGPAEEVVDAFLSGRLEEGE
FT                   SLCDHQPGSVCGHGDGGCHH"
FT   gene            complement(417804..418637)
FT                   /locus_tag="Taci_0394"
FT   CDS_pept        complement(417804..418637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0394"
FT                   /product="polysaccharide export protein"
FT                   /note="KEGG: xfa:XF2301 polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18631"
FT                   /db_xref="GOA:D1B8M8"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8M8"
FT                   /inference="similar to AA sequence:KEGG:XF2301"
FT                   /protein_id="ACZ18631.1"
FT                   /translation="MSENACGNCAQRGACDSTPEACGVSKGPKRSIGRIVAIGSGKGGV
FT                   GKSSVSALMAVALARKGLKVGILDADITGPSIPKLMGISSMPMGSPLGIIPPKSPTLGI
FT                   SVMSINLLLEDATKPVIWRGPIIANTIKQFYEEVLWGDLDALLIDLPPGTSDAPLTVMQ
FT                   SIPLDGMVVVTSPQELANMVVEKAMHMATMMNTEILGLVENMAYAICPHCGQRWDVFGP
FT                   SSLDQLASKWSVERVATLPMDTSISKLGDMGRIEEYHNLELLDPIIQAFIGPQET"
FT   gene            complement(418688..419011)
FT                   /locus_tag="Taci_0395"
FT   CDS_pept        complement(418688..419011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0395"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: pca:Pcar_0749 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18632"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8M9"
FT                   /inference="protein motif:PFAM:PF02579"
FT                   /protein_id="ACZ18632.1"
FT                   /translation="MIAVAAEGREPSARPAERFARAPWFLIFDPSGSFVQAMDLAVGEH
FT                   GAAAAAVGLLSAKGVSVVLAPRLGPNAASALKAANMRAYLAEGATAADCVARYLSGEAI
FT                   PLD"
FT   gene            complement(419106..419633)
FT                   /locus_tag="Taci_0396"
FT   CDS_pept        complement(419106..419633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0396"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: dvm:DvMF_1364
FT                   ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18633"
FT                   /db_xref="GOA:D1B8N0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8N0"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACZ18633.1"
FT                   /translation="MAEGARGDLRQRTERYLEALARKGCRRTGPRRLIIETLLESQGEH
FT                   LSAREIMERVQSKDPSVGFATVYRTLMVLSQVGLVHAVDRGEGFSRFHLAEGGTHLYVL
FT                   CSRCGRIQHLDDQEAKVEALRDWAGKVGYRLMPQTIQILGICPQCGDDPPPEGIDHRYV
FT                   SCCGRRRRRCTP"
FT   gene            complement(419626..420063)
FT                   /locus_tag="Taci_0397"
FT   CDS_pept        complement(419626..420063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1967 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18634"
FT                   /db_xref="GOA:D1B8N1"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8N1"
FT                   /inference="similar to AA sequence:KEGG:Pcar_1967"
FT                   /protein_id="ACZ18634.1"
FT                   /translation="MAKVIAVCTSGERREPKTARQRAVFVEGKGTQEDSHFGLVERQVS
FT                   LLRLEDIRAAEAGFDFPPGSLAENLVIEGLPEGLSPGQVLAVGPSVRLRVVERGKKPGE
FT                   PHTYDYRGWCLLPTKGYFLSVERGGPVSPGDRVTVEDGDLG"
FT   gene            420235..421071
FT                   /locus_tag="Taci_0398"
FT   CDS_pept        420235..421071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0398"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cco:CCC13826_1746 putative
FT                   molybdenum ABC transporter, solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18635"
FT                   /db_xref="GOA:D1B8N2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8N2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ18635.1"
FT                   /translation="MNRAKGDQIGYENYDPDPRRATSGSPVLWGPGAVIAGALLALWWI
FT                   GSRMGLWTSYILPSPSAVGAAFLDLVYSGRLREHLLSSLTRIGMGFTMSSAVALPAGIL
FT                   MGLRPRLRRAISPLLEFMRHVPPLALLPLLILWFGIGEGSKLAVIALASFFPAFINAME
FT                   GVMGCDRSLVEVGHAFGLSEREIIGRIVLPYSLPYVLAGLRLALGYSWRSLIGAELLAA
FT                   SSGLGYMIQDAQAMSRPDVALVGIFVIGLVGIASDGLFRVITSSLLVGRRWGDDAH"
FT   gene            421058..421807
FT                   /locus_tag="Taci_0399"
FT   CDS_pept        421058..421807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0399"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pen:PSEEN0180 alkyl sulfate ester ABC transporter
FT                   AstC, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18636"
FT                   /db_xref="GOA:D1B8N3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8N3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ18636.1"
FT                   /translation="MTPIDLILEGVGRRFTTPGGALDALKDVRLGIPWGTMTAVVGRSG
FT                   CGKTTLLRLIAGLDSPTTGTIRFASRHGGELDRDHVRFGMVFQEPRLMPWLSVEGNVAF
FT                   PLVGRFGRAEISRRVDGALEMTGLTDFRSAMPHQISGGMAQRVALGRALAYDPDVVLMD
FT                   EPFASLDYFTRRVMQREVLRIRQRTGKTFILVTHDIDEALAMGDSVVVLRDGEVAGTFH
FT                   VPHLLDDSIHAELSQIKREILMSIGEV"
FT   gene            421812..422762
FT                   /locus_tag="Taci_0400"
FT   CDS_pept        421812..422762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0400"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /note="TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; KEGG:
FT                   cco:CCC13826_1743 nitrogenase cofactor biosynthesis protein
FT                   NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18637"
FT                   /db_xref="GOA:D1B8N4"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8N4"
FT                   /inference="protein motif:TFAM:TIGR01728"
FT                   /protein_id="ACZ18637.1"
FT                   /translation="MNVKLSRIFWALCVALALVGGPVGRSMAGDRVNITYVKAPLNVPS
FT                   IVERHLGLFEKAFAPLGYRVDFPELTTGPQQTQAMAAGSVQVAHCLGGTSALLAAAGGV
FT                   DLKIVGIYSRSPKAFVILVKDPSIRTVKDLKGRTVVGPKGTVLHQLLVAALRVHRLEQR
FT                   DVEFLDMGIPNGVAALMAGRAHAALAAGPSVTRAVKEGARILTDGNGLVEGTTVIAMSG
FT                   SFVREKPKLARLFLKTHRDALAWIRAHPMEAEEMTAKETGLSPQEVRSALPLYDFDPTI
FT                   RASDLDELERTQDFLLDSGLMWRRVDLRTLVLRDL"
FT   sig_peptide     421812..421898
FT                   /locus_tag="Taci_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 29"
FT   gene            complement(422749..423651)
FT                   /locus_tag="Taci_0401"
FT   CDS_pept        complement(422749..423651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0401"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: aha:AHA_3991 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18638"
FT                   /db_xref="GOA:D1B8N5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8N5"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACZ18638.1"
FT                   /translation="MNKGISRRAVLLADGAILMAAAFWGVGFAVLKDTLDYLPPFTVLV
FT                   VRFLIGGLMLGLVFLRHFRGLSRTSLKDGLITGILLFCAFSLQTVGLMWTTAGKQAFLT
FT                   ATYVVLAPLVSWGISRVFPGLRAMVASLTCLTGIWALSSADAVVLNRGDVMTLMSAFFY
FT                   ACHLIAVDRFTKRTDPVALAAMQMVVLGLISLPFAAFEAPSFHMPLRGWMSLLYMILFS
FT                   TVGAFTIQNVAQKYTSPTHAALLLSTEAVFGAVSGVMILGERFTLQMVLGGSLVMFAIL
FT                   LVEMPWPKALSSQGEATDP"
FT   sig_peptide     complement(423562..423651)
FT                   /locus_tag="Taci_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.795) with cleavage site probability 0.413 at
FT                   residue 30"
FT   gene            423759..424175
FT                   /locus_tag="Taci_0402"
FT   CDS_pept        423759..424175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18639"
FT                   /db_xref="GOA:D1B8N6"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8N6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18639.1"
FT                   /translation="MVLIKFLVGFLTWGAILWMVYGRYGVPFLGSLRGSAREIPGGRLF
FT                   VPFFLLGEVLIQGLWVAYCASRSMAFVEVLGKPTAYGLGFLACQVPLAMVARSQGAGEI
FT                   YHVLRSVIPMGLFPAFVLHPQYMAIYAWALGRMG"
FT   gene            424303..425568
FT                   /locus_tag="Taci_0403"
FT   CDS_pept        424303..425568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0403"
FT                   /product="protein of unknown function DUF1576"
FT                   /note="PFAM: protein of unknown function DUF1576"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18640"
FT                   /db_xref="GOA:D1B8N7"
FT                   /db_xref="InterPro:IPR011470"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8N7"
FT                   /inference="protein motif:PFAM:PF07613"
FT                   /protein_id="ACZ18640.1"
FT                   /translation="MVEEQRKEFRRYWIVASFMFAVAIYGMYLCDGQVDELLAGLTRII
FT                   TSPSTLITDYVLLGGPSAAFVNAGMLGLSALGVCAVAGVGLTGPAIAAVFTVCGFGFFG
FT                   KNLFNVWPIIFGVALHSRFKGLPFKDHLLIALFGTSLAPLVSELAFGGHLSPMGNGPFS
FT                   LVMAVLGGLAVGFFLPPLAKHFLVVHQGYNLYNVGFSCGFLGLVALGTLRALGIPLEGG
FT                   FYWFHGGHDLFFVPLLLFFSGMIITGFIICPDFRRGLAELYSSSGRLVSDFVQYAGFGP
FT                   SLVNMGTLGLVGLLYLKFTGGDINGPTIGGLMTLSGFGGFGKHLRNVLPVALGTWFAGA
FT                   ISVWPVNNPGATLAVLFSGCLAPVGGAFGPAAGFAAGFLHLIVVMTVGGIHGGLSLYNN
FT                   GLSGGIVAAMLLPVLESLREED"
FT   gene            425574..425918
FT                   /locus_tag="Taci_0404"
FT   CDS_pept        425574..425918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18641"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8N8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18641.1"
FT                   /translation="MKGQWAKAIHASGELVAYLIRRGARDIDNHYRFLDGVLHVEIRSK
FT                   DLVLSDEDLSRLRRRLIHPQQREIGEYYWGLAGGEHKGTELEVVGNATEVLSVESSPDE
FT                   GTVILLRRRD"
FT   gene            complement(425915..427891)
FT                   /locus_tag="Taci_0405"
FT   CDS_pept        complement(425915..427891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0405"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMC domain protein;
FT                   SMART: AAA ATPase; KEGG: sat:SYN_00466 ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18642"
FT                   /db_xref="GOA:D1B8N9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8N9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ18642.1"
FT                   /translation="MANQRLEGSDLIILEGVSLRYQDRVILDGADWVVPGGEKVALVGP
FT                   NGCGKTSLMRLIAGEESPHGGSVKVRGGRIGYLPQDIAQVGPGTVMEFLTARCGLSQAM
FT                   EELKRLEGRMGEAGLDQGEALALAREHDRLHGLILRLEGYSFEARARRVLWGLGFREGD
FT                   HERDCGRFSGGWKMRILLASILLSEPDVMLLDEPTNHLDTESIEWLEGYLRQFEGTMVA
FT                   VSHDRRFINAVTSAVAEIRGGRVRTYRGSYEDYLAARRSEEEAARRRAREVQRIREDTM
FT                   EFVQRFRCKASKASQVQSRLKQLERLEDVQLEASRREVRIRIPSCPRGPELVLEAKGLG
FT                   VLYDRWILRDLDFELHRGDRVALVGYNGSGKSTLMRLMASQQVPTEGQVRLGQGVVTGF
FT                   FSQDSSENLDYRGTVFKEARSGSDQLTDQEVKSVLGAFLFGPDHWDLPVEVLSGGEKSR
FT                   LALAKILMSPVNLLLLDEPTNHLDEDTLEIFAEALDAYQGTLVVVSHHRDFLDRICNRV
FT                   FEVRDGCLHQYVGNYSRFIERRREQERERERERERELGSSQAPQRREGSSLREERRREA
FT                   EERNRLYRLRKAVEDRMAPVERAIEEAEGRKSQVESMLCDPEVLSDSALVQELMVELSG
FT                   LSSSLEGLYARWEELAAELDSIG"
FT   gene            427991..429205
FT                   /locus_tag="Taci_0406"
FT   CDS_pept        427991..429205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0406"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   afw:Anae109_1720 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18643"
FT                   /db_xref="GOA:D1B8P0"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8P0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACZ18643.1"
FT                   /translation="MRTLRFCSDRRWLSWVLQDVGNSAFATTVMAVMYPLFYREVLGRG
FT                   GPNELVLAMWGYGTAVGMLLTALMAPPLGAWADLRGLRKRLFIAFSLVGVASSIAMGFL
FT                   GEGQWMLGLGVFVMGSLGFSFNNVFYDSFLPHLAREEDRAYLSSAGYAMGYLGGGVLLL
FT                   VNAIMAARMGEAGFRLSFVSVGLWWAVLLVPFALWVGEPPVEPHGGLGPWERPLRTLRE
FT                   LPRTPNVMWFLFAFWLYNDGIGTIMRMGVLYGSTLGIDQRTLLFSLVATQFVGIPLTMI
FT                   WAKVAEAFGDKATLMVTLGVYLAICLMVPFVRTPGHFWAMALSIGSVQGGAQALSRSLF
FT                   SRIVPKERSAELFGFYDLSSKFAGVLGPMAFGVISQLTGSFAVGGPLLAGFFLLGMAFL
FT                   SRVRA"
FT   gene            complement(429195..430757)
FT                   /locus_tag="Taci_0407"
FT   CDS_pept        complement(429195..430757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0407"
FT                   /product="transcriptional regulator, CdaR"
FT                   /note="PFAM: purine catabolism PurC domain protein; KEGG:
FT                   bsu:BSU32420 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18644"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8P1"
FT                   /inference="protein motif:PFAM:PF07905"
FT                   /protein_id="ACZ18644.1"
FT                   /translation="MIAADLLRHHLFPDFELLGGSGGLNRALTSVSVIDAPDVDRWMRG
FT                   GELLVGSGYIFREDPGAFVDFLTRVNERNVAAVGIKLDRYHHQLPPGMVNLADQLALPL
FT                   LSIPMHYRWTDIIEGVQTFILQERHRASCSLDEVGSFLEEGLDIKRILSTFASRLQRTL
FT                   TVQCSQLGICNNFLPDGSVEDSEEAMRFIKTPVVQERGLPKRGQVLVNLELRNSGTLQW
FT                   SASYRFLSDTPLTVHLWLSEGETVPSARQDRMVLRAMTLVRASALELAAISNRSAMKKE
FT                   RFFEALCLDIYNDPSIVEANMRELGIVLPKRGCVVMVSSADGSSPRWTPQNSVMSYRLA
FT                   DMWTGLVPVGDLEQMKREWDQKGQDLRVYVAVGGPVRNMEDVTRSYHEAKRTFTWLREF
FT                   GLEPGAYAHDDLSLYALLDNLFRLPEAKGVYQRFFEPLLEDGPSSSRRSMPLKDLVRSL
FT                   VSSDFNAKQCAKGLHLHYNTVRNHLDDLEEILQVDLSNPHHRLGLTLAFHIGNSYQKRG
FT                   IKP"
FT   gene            431033..431920
FT                   /locus_tag="Taci_0408"
FT   CDS_pept        431033..431920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0408"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: atc:AGR_pAT_799 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18645"
FT                   /db_xref="GOA:D1B8P2"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8P2"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ACZ18645.1"
FT                   /translation="MRSFVAAAVQFAVEPMNVKENLSRAEGWIDRCVKESGAHLVVLPE
FT                   SFTTGFTPVGGAEDLWDAVSEIPGPLTDQGVRWAREMGIYIVFPTYERGSQRGVVYNSA
FT                   ALIGPSGILGVYRKTHPFPTERLEGGGWTTPGYEPFCVETELGKIGIVICYDGDFPELA
FT                   RVTTLMGAEVICRPSAFMRTFDHWNITNLARAYDNHVYWIATNSVGRDASGAYFFGGSM
FT                   IVHPSAMKLAQARASDEYVWARLEPDPIRRVFPNSSAEQWFDHVEDRNLRSYKGLLDQG
FT                   RCPFEPARRIPYGR"
FT   gene            431926..433116
FT                   /locus_tag="Taci_0409"
FT   CDS_pept        431926..433116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0409"
FT                   /product="Formyl-CoA transferase"
FT                   /EC_number="2.8.3.16"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: bpt:Bpet0367 acyl-CoA
FT                   transferase/carnitine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18646"
FT                   /db_xref="GOA:D1B8P3"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8P3"
FT                   /inference="protein motif:PRIAM:2.8.3.16"
FT                   /protein_id="ACZ18646.1"
FT                   /translation="MKMPLEGLVILDLTRVLAGPFATMMLSDMGARVIKVENPAGGDDS
FT                   RAFAPMLNGESAYFMSINRGKESVAINLKDPKGKELLLELVKKVDVLVENFKPGTMDKL
FT                   GLGYEVLSQVNPRLIYAASSGFGQYGPYSHLPAYDLIIQGMGGLQSITGPDPEHPTKVG
FT                   SSMADILAGIFTVIGILAALRAREVTGLGQMVDVAMLDCLVATLENAIARYVVTGSVPR
FT                   PAGNDHPSIAPFATFESADGFVNIAAGNDSLWRKLCDALGIGELAEDSRFLTNSDRLAN
FT                   WPELKAIINEHTRTKPTDHWVKVLREAQVPCGPINTVDRVMADPHVLARDMIVSLVHPV
FT                   AGELKVPGVPIKFSKTPGEIKGPAPLLGQHTRSVLQEMLGLDQEAIDELKEKGAIA"
FT   gene            433113..433796
FT                   /locus_tag="Taci_0410"
FT   CDS_pept        433113..433796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cko:CKO_04287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18647"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8P4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18647.1"
FT                   /translation="MRILGASSDLKSSTLRVREVHRRALNLEGPLGERYSLVTGPSMMG
FT                   PRSALVDRLPVLPEGEMVKLEGGWDATYDPSLAGLRPRGRWRPLWLEWLELMDDPDLEV
FT                   LRGPVRSGELMGLVGLGPGHTPAGDDLITGWLAARWTLGDLESTSRFLEGFDPGLTTWL
FT                   GGDQMTWAARGFAWAPLKGLLSALSSSDPEGILDALGELEAVGHTSGRSCLVGLALGLE
FT                   GAMEV"
FT   gene            433802..435355
FT                   /locus_tag="Taci_0411"
FT   CDS_pept        433802..435355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0411"
FT                   /product="FdrA family protein"
FT                   /note="PFAM: FdrA family protein; KEGG: ecp:ECP_4036
FT                   YahF/FdrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18648"
FT                   /db_xref="GOA:D1B8P5"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8P5"
FT                   /inference="protein motif:PFAM:PF06263"
FT                   /protein_id="ACZ18648.1"
FT                   /translation="MEVMGLQRLEVVERTYYDSVTLMRVAKEIGGMEGVSSASLSMGTD
FT                   ANLRILAAAGFDVSNLSATPNDLIIAVMGEQDVLDLAVAKAKEYLSNPPWRQGQDGGES
FT                   YKPRSLDGALTVMPEANLAVISVAGRYAGDVAMDCIAKDLNVMLYSDNVPLEKEIEVKR
FT                   AAAEKGLLVMGPDCGTVVIRGVAIGMANSCPTGPVSIVAAAGTGLQEVHVQLARRGVGT
FT                   LHGIGTGGRDVKSQVGGIMVEMASRLLLEDHEVQVLVIVGKPPAPEVEERILHLARGSS
FT                   KPVVLGFVGGKAKGDQHPVYICRELEETAAVAAALAKGEDVPQVRAAMDAQVEELKALA
FT                   KRIGPRKGYLRGLYSGGTLCYEAQLIARDILGPIHSNTPLEEHLKLEDSLRSVEHTIVD
FT                   FGEDEFTQGRLHPMIDVSLRASRFQEEVKDPEVGVVLFDVVIGYGCHPDPATGLVEGIR
FT                   KAKEICGDRVVFVASVCGTPDDVQDADRQRRILEEAGVVVMDSNAKASRLASFLLSLSE
FT                   "
FT   gene            435368..435544
FT                   /locus_tag="Taci_0412"
FT   CDS_pept        435368..435544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18649"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8P6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18649.1"
FT                   /translation="MNQKLRSLLKEGPRAVNIGVEQFAQDLAAQGVKVVQMDWRPPQAG
FT                   SDLLSKLRKLKRQ"
FT   gene            435593..436849
FT                   /locus_tag="Taci_0413"
FT   CDS_pept        435593..436849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0413"
FT                   /product="protein of unknown function DUF1116"
FT                   /note="PFAM: protein of unknown function DUF1116; KEGG:
FT                   ecp:ECP_4035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18650"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8P7"
FT                   /inference="protein motif:PFAM:PF06545"
FT                   /protein_id="ACZ18650.1"
FT                   /translation="MVDIDKANQEALSRLLSAQPVLVDMGLAKDVVPGMGERTLLHAGP
FT                   PITWERMSGPMRGAVMAACLYEGWASTPEEAVELAASGEITFDPCHHHSAVGPMAGVTS
FT                   PNMPVFVIENKDRGNRAYCSMNEGLGKVMRMGAYDDEVIERLKWMRYTLYPNLHAGVRR
FT                   AYEVQGGIDIKNIIAQALHMGDEMHNRNKAGTSLFLRAIVPFMIEAAPNCRDLAEVVRF
FT                   IDKNDHFFLNLAMAAAKASTEAAHDVEGSSLVTIMARNGTEMGIQVSGLGRRWFTCEAA
FT                   LPDVLLFPGFTKDDVNRDIGDSAIMETLGIGGFALAAAPAIVQFIGGTPADAAKYTLEM
FT                   YEITLGENNVYSIPSLNFRGTPTGIDVLKVAETGITPVLDTGAAHKEPGRGQVGAGIVR
FT                   MPSEAFIKAAEAFVERYAE"
FT   gene            436892..437695
FT                   /locus_tag="Taci_0414"
FT   CDS_pept        436892..437695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0414"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: pat:Patl_2320
FT                   putative cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18651"
FT                   /db_xref="GOA:D1B8P8"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8P8"
FT                   /inference="protein motif:PFAM:PF04199"
FT                   /protein_id="ACZ18651.1"
FT                   /translation="MSSNWELKNWGNIKVYDLTIPISHLTPAWPTYEPLQVKFFKRLAP
FT                   NGANGQLLTHSNHVGTHLDGPLHFCTHGCDIASLELKDFLVGPGVVVDISDIAEDYGIY
FT                   TSKDIEERAEIHDGDILIINTGYHRYGWDQPEADEVRYMVMHPGPTNEFAQWCKKRKIK
FT                   WIGVDCGSADHPMNTKIREWMPYHAKMADKHLREKYGKGLDDFFPPEDYQLMHIDLFPH
FT                   NIIHAECLGGDIDLLSGKRVTIGCFPWRFEGGESCISRIVAFAEE"
FT   gene            437761..438615
FT                   /locus_tag="Taci_0415"
FT   CDS_pept        437761..438615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0415"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG:
FT                   smd:Smed_4005 molybdopterin dehydrogenase FAD- binding"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18652"
FT                   /db_xref="GOA:D1B8P9"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8P9"
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /protein_id="ACZ18652.1"
FT                   /translation="MLSFELERPSTLAEAMKLLEREGAWAKNGGTDLLVWMKKHAIQPK
FT                   LVVDLSLIEELHRIHFDPKEGLTVGACVTLNDLANFKEARELYPALVEAAMSHSDHIIR
FT                   NKATYVGNLCSSVPSGDMIPPTVVYQGVLHLASHHGERAVPIMEFIVGPRRNVLKPGEV
FT                   VTRVTLPVPDGPSAGRYIKLGRRNALDLAQVGVACVVTDGPSGRRYRLSYGAVSPVPVR
FT                   ATKAEALLEGVKSPDGALLERVAEEAKLSVNPITDVRASREYRLSMVGELTKRAIAECL
FT                   ERL"
FT   gene            438629..439108
FT                   /locus_tag="Taci_0416"
FT   CDS_pept        438629..439108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0416"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: [2Fe-2S]-binding domain protein; ferredoxin;
FT                   KEGG: rce:RC1_1076 carbon monoxide dehydrogenase small
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18653"
FT                   /db_xref="GOA:D1B8Q0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Q0"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ACZ18653.1"
FT                   /translation="MSKKTISFTLNGRPVSMDVEPRTTLLRALRDYGVTSVKRGCEEGE
FT                   CGTCTVILDGKLQKSCMVLAQEAEGREVLTAEGLVSRDGKLHPVQQAFIEEGAIQCGFC
FT                   TPGMVLAVYDLLKRNPNPTDEEMKVALSGNLCRCTGYEGIFRAVRKAAKLMSAGA"
FT   gene            439124..441541
FT                   /locus_tag="Taci_0417"
FT   CDS_pept        439124..441541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0417"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead; KEGG: rle:pRL80025 putative
FT                   dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18654"
FT                   /db_xref="GOA:D1B8Q1"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Q1"
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /protein_id="ACZ18654.1"
FT                   /translation="MKQTVTNHGVGKWVTRKFDEEKAAGTLRYADDLRFGPELLHARAA
FT                   RSTIAHGEIVSIDVSEAMKVPGVVKVITGDMFVHHFGLYLQDRTPLAVGKVRYVGEPIA
FT                   LVVAETEEAAEEGMLKVKATYRELPAVFDPVKAATDNSVLVHPELGSYAHVPYLTPQPG
FT                   TNIANWFRIRRGDVDKAFAECEHIVEEAVTCPQIAHGFLEPHCCICQEDPATGNLTIWS
FT                   SAQSAFAVREIIAKGLGYPLHKIRVIAPPIGGGFGGKAGMTIEAMCLAAAMDPDIKGRP
FT                   VKLHIPREEVLISSWVRQGYVAKIKLGIDKDGKIQAIKNTFFFDTGVSAEYGANPVRSA
FT                   GYTSTGCYYVPNVWTDSYAVYTNKPFGGAYRGFGLPELMGAMEVVIDIAANKIGMDPIE
FT                   FRLKNMLKPGLPTCTGMPMHNHALDKIVSKVVDKIRLREKEEPKRPGWKRGKGFALAIK
FT                   APAMPADAASSAIVKVLGDGNVEVLAATMDMGQGAYTAYAQMVCEELGVPIESVKCYFP
FT                   DTQSHPYDWQTVASRSCWSMGMAVKRAAVDAREKILALFSRYWQVVPEEITIEHGVVKC
FT                   RKLGKAEKLDERIQNGFHMPDGEHVGGPVIGTGTFVPPDVVYPDPETGQSPKSVVHFTV
FT                   GAVGIDIEVDPATGEVCVNNVVAGYDVGKAISPINVRGQIEGGTIQGISAGLLEGMYYD
FT                   EHGKLLTPDFTDYKMSTTMDLPDNMEIFWEETPEELSPYGNRGIGEHSMISPAPAIDNA
FT                   LYNALGVRIHSYPFSKERVYKAVQMAKAGETDLWEYPYVQEQNYRKAIKEWL"
FT   gene            441697..443091
FT                   /locus_tag="Taci_0418"
FT   CDS_pept        441697..443091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0418"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18655"
FT                   /db_xref="GOA:D1B8Q2"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Q2"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /protein_id="ACZ18655.1"
FT                   /translation="MARKKIVYGLTDKPPLPIMILAGAQHVLTLFGATTLVPLIFGPAM
FT                   GMDALQIGAFISCVYFAMGVATIIQTDPRMGTGLPIVQGSSFSFIPSIMTIIGAYKAMG
FT                   PNVVMQYVGGGLIAGGLVLSFIGYSRIVGVIRRVITPVVIGPVIMAIGFSLAPVAIQFN
FT                   AANYWPISLLVVALIMFFSLISKNRYANIFAILGSIIIAYLICLGASLAGIFGPGHPAY
FT                   IDLSKVANAPWFRFNVVFPWGMPKFSLLAFGALLAGFFAVMIESIGDYHSCSYVAGLDD
FT                   PTPEMISRGIGAEGLNCALAGVFGAVGTTSYTENIGLIGLTGVASRYVVRTGAVLLILL
FT                   SFVGKLGGLIATMPSPVIGGAYISLFGVIGALGIQTLMRADMGSQRNVVIVGFAFLMAL
FT                   GLPGWIEKNQELFMNPAYGQLISTLGGMIWAILKTPMAVAGICAAICDSIIPGTPEERG
FT                   IGVRME"
FT   gene            complement(443136..444425)
FT                   /locus_tag="Taci_0419"
FT   CDS_pept        complement(443136..444425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0419"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; KEGG:
FT                   rce:RC1_2674 CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18656"
FT                   /db_xref="GOA:D1B8Q3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Q3"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ACZ18656.1"
FT                   /translation="MAGSGTVSLLILFMFLFLLSAFFSAAEMAFSSVNRIRMKRFAEEG
FT                   RPGAKRALDLLQDFQRTISTILVGGNIVDILMTSIASTIFALLFGPIGVLYATVLMTVL
FT                   IILFGEVLPKSYVKDVSEPFALASAPVVALLVRLLKPIAWVISSISSILDRWRSTGRRM
FT                   EPSVTHDELLHILETMLDERVLPQPEKELIENAVNFNELQVWEIQTPRVDLFALNVHED
FT                   PRRIREMLLKNQYSRVPIYEGSLDNVIGILHFKDYMRRAFETDNPDVRAIMKRPVLIAG
FT                   SASLMDALKIMRANRTHMAIVLDEYGGTSGIITVEDLLEELVGEILDEHDDVKDYFTQL
FT                   EDRVYLVSGDVYLEDLFYSHLEMDRMPDSESSTLSGWLYEQFKTLPEQGAWVDWEGIRF
FT                   SVAKVAGQRILKVRIEMPPEQQDRNPSKDI"
FT   sig_peptide     complement(444336..444425)
FT                   /locus_tag="Taci_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.528 at
FT                   residue 30"
FT   gene            444753..445388
FT                   /locus_tag="Taci_0420"
FT   CDS_pept        444753..445388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0420"
FT                   /product="YheO domain protein"
FT                   /note="PFAM: YheO domain protein; KEGG: ypb:YPTS_3612 YheO
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18657"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Q4"
FT                   /inference="protein motif:PFAM:PF08348"
FT                   /protein_id="ACZ18657.1"
FT                   /translation="MGSEELIKMVKPMVDFLAEVLGDLAEVVLHDLRDPEHSIVAIRNG
FT                   HISGRNVGDSLTDYALEILRESKDLPYKVNYKGLLDDGRPIRLSSFFIRDPSGEPVAML
FT                   SINLDISRVQDAYKVMGSFLNIGKNGEESTPPHPVHFTSIEKLMHQQMDQVLAMRGMPP
FT                   SRMTPEEKKSVVEELDRKGIFLLKGAVAEAARRLEVSEQTIYRYLRGN"
FT   gene            445408..446640
FT                   /locus_tag="Taci_0421"
FT   CDS_pept        445408..446640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0421"
FT                   /product="diaminopropionate ammonia-lyase"
FT                   /note="TIGRFAM: diaminopropionate ammonia-lyase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: dde:Dde_1266 diaminopropionate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18658"
FT                   /db_xref="GOA:D1B8Q5"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR010081"
FT                   /db_xref="InterPro:IPR019871"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Q5"
FT                   /inference="protein motif:TFAM:TIGR01747"
FT                   /protein_id="ACZ18658.1"
FT                   /translation="MEEIRYVVNGPERGMQGRASVESFSEDEMRKVVGFHSTMPGYSPT
FT                   PLASLPSLAKRLGLGSIHVKDESHRFGLKAFKVLGGCYAIAMHLAQKLGKDISELPFQV
FT                   LTSDQVKQQLGDVTFATTTDGNHGRGVAWTARMLRQKAVVYMPKGSAVFRLEKIRGEGA
FT                   QAEILDMNYDDAVRYTDQQAKKHGWVVVQDTAWEGYTDIPLWIMQGYGTMVVEALEQMK
FT                   ARGEERPTHVFIQAGVGSLAGAVQGVLRARFGQDAPKVVVVEASAAACYYESAVAGDGK
FT                   PRAVGGDLFTLMAGLACGEVNIIGYEILRDYAAAFVSCPDYVAARGMRVLGNPLEGDQK
FT                   VISGESGAVTTGLLAYLMDRPELKGLREALDLNESSRVLLFSTEGDTDPDRYRSVVWDG
FT                   EFPTVGHLSRP"
FT   gene            446653..448005
FT                   /locus_tag="Taci_0422"
FT   CDS_pept        446653..448005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0422"
FT                   /product="selenium metabolism protein SsnA"
FT                   /note="TIGRFAM: selenium metabolism protein SsnA; PFAM:
FT                   amidohydrolase; KEGG: Amidohydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18659"
FT                   /db_xref="GOA:D1B8Q6"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR017700"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Q6"
FT                   /inference="protein motif:TFAM:TIGR03314"
FT                   /protein_id="ACZ18659.1"
FT                   /translation="MSPNLGVREMLLVGNGAVITRDPSRPFIRDGAVLCDGGLIREVGT
FT                   WADLGARYPEAQFLDAKGGLIHPGLINAHMHYYSALVRGFGGKGGEPAADFVQVLERLW
FT                   WRLDKALTLEDVKVSAQVCLLEAIRCGCTCMLDHHASPNAITGSLFAIAEAVEEMGLSA
FT                   CLCYEVSDRDGEDKALEGIRENRDFIQHASKGDGRRMAGTFGLHASLTLSDKTLDMCAS
FT                   SGDYQGFHVHVAEGQTDEPLCRERHGLSIVDRFRRFGLLGPKSMAIHCIHVDQEEMEIL
FT                   KDTRTAVVHNPESNMGNAVGAAKVLEMNRMGILMGLGTDGYVCDMLRSYAMANALVKHS
FT                   AGHPNVGWGEIPTMLFQRNYEIANRYFSVNRGMLKEGWAADLVVFDYDPPTPLSDANVN
FT                   GHLLFGPLTGHVVHTVADGKVLYKDRAFTSVDPKAIMARARELAVKVWERF"
FT   gene            448024..451251
FT                   /locus_tag="Taci_0423"
FT   CDS_pept        448024..451251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0423"
FT                   /product="selenate reductase YgfK"
FT                   /note="TIGRFAM: selenate reductase YgfK; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: ecp:ECP_2872 putative selenate
FT                   reductase subunit YgfK"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18660"
FT                   /db_xref="GOA:D1B8Q7"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017701"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Q7"
FT                   /inference="protein motif:TFAM:TIGR03315"
FT                   /protein_id="ACZ18660.1"
FT                   /translation="MRDYMRPLTFEEHLDWILGEYGTRRSIYGIPEAMFYRPDPSSPMV
FT                   SRLFGDSLHTPIGPAAGPHTQLVQNILSAWLCGARYMELKTVQIMDELVIERPCIDMED
FT                   EGYNVEWSQELKLERSAAEYARAWVLVHAMPRLLGWDDVTEGTIFNMSVGYNMEGILTP
FT                   RMQQFMASMEDASDEIGRCLEVLADRLPEMEDLTVPSRISAGCTLSTMHGCPPDEIEKI
FT                   ASYLINRGLHVFVKLNPTLLGAETVRSILNDKLGFKRLHVPDSAFEHDLKYPQAVEILR
FT                   NLSDLARRKGVTFGVKLTNTLAMENWKGRMPGGEMYMSGRPLFPLAVNLFNKIRSDFPD
FT                   LPVSFSAGADQENVARLFACGVKTVTIASELLKPGGYGRLLSCVNSLERAMRERGCSSL
FT                   EEFAKDGAMALKDLAADSLTNPRYRYVPVTPPKSPTPLGMFDCVEAPCSAACPVNQEVP
FT                   LYARRIAKGDFDGALEAVLRRNPMPGVTGHVCPHGCQDRCTRSQIDEPVAIRALKRAAE
FT                   RYGSFEPTRVEPGDIKVAVIGAGPSGLAAARELAQVGFKVTVMEAKDRPGGMMSLAPSF
FT                   RLPADALAGDVERVQALGVQFLFNHPVTQSPESLLGEYGAVYVATGFPVDSPLGLEGEG
FT                   AKGVFGALGFLDSVARGERVDLGDRVLVVGGGNTAMDAARTAMRLGASVKVVYRRTRDQ
FT                   MPAEPEEVEAFLSEGGTILELASPEGLVVSDGTVKGLVCRRNRLGDPGPDGRPRPVPTD
FT                   ETFTLEADSVIAAIGQAQANVIFDASALRIEGGKVRVFDNLSTQVPGVYAGGDLVRGPK
FT                   TVIAACADGISAARSIARAFGVQVPCQEVPESLTEEEIGQIKLRRIAKVPSAREPRRTQ
FT                   RDFDLFELPLSREEAVEEAKRCLSCDVVCDKCVDVCPNRANVSVLVTPGAGLAPAFRCD
FT                   GDRVAWVRSVPVQVRQDRQIVHVEDLCNRCGNCETFCVHQDGKPFEQKPRLFFCEEGVV
FT                   REEENALWAAEGEVVWKQGGIRCSLVRSAYGWIYEDPFIRVELTGSFRPVTFEAKGHFQ
FT                   GERSLEMAFQMKVLLEGMEESAPFLLA"
FT   gene            451276..452517
FT                   /locus_tag="Taci_0424"
FT   CDS_pept        451276..452517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0424"
FT                   /product="M20/DapE family protein YgeY"
FT                   /note="TIGRFAM: M20/DapE family protein YgeY; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; KEGG:
FT                   aha:AHA_2163 peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18661"
FT                   /db_xref="GOA:D1B8Q8"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017706"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Q8"
FT                   /inference="protein motif:TFAM:TIGR03320"
FT                   /protein_id="ACZ18661.1"
FT                   /translation="MGLSRKEMFRVELDYGKIRELAKKYEPDMTRFLRDMIAIPSESCQ
FT                   EEKLIQRIKQEMEKVGFDEVVIDPMGNILGYMGTGERLIAFDAHIDTVGIGNRDNWTFD
FT                   PYEGFEDAERIGGRGASDQEGGMASMVYAAKIMKDLGLLEGLRVVMVGTVQEEDCDGLC
FT                   WQYIVKEDKVRPEFVVSTEPTDGRIHRGQRGRMEIMVKTKGVSCHGSAPERGDNAIYKM
FT                   APILQELRALHANLKDDPFLGKGSLAVSEIFFTSPSRCAVADSCWISIDRRLTAGETKE
FT                   LALQQIRNLPSVASSGAEVSLYTYERPSYTGLVYPTECYFPSWVLEEDHPVTKSMVDAF
FT                   KGVLQKEPVVDKWTFSTNGVAIMGLLGIPCIGFGPGHEDQAHAPDEVTWKSELVNCAAV
FT                   YAALPRIYADRYGR"
FT   gene            452561..453565
FT                   /locus_tag="Taci_0425"
FT   CDS_pept        452561..453565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0425"
FT                   /product="aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain protein"
FT                   /note="PFAM: aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; aspartate/ornithine
FT                   carbamoyltransferase Asp/Orn-binding region; KEGG:
FT                   bha:BH2894 ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18662"
FT                   /db_xref="GOA:D1B8Q9"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Q9"
FT                   /inference="protein motif:PFAM:PF02729"
FT                   /protein_id="ACZ18662.1"
FT                   /translation="MQSFFRGRHFINLEDFSREEVETMLEVSFDLKKKFAMGEPTPYLV
FT                   NKTMFLIFFEQSTRTRNSMEAGLAQLGGHAGYLDSSTMQVSHGESAKDTAIILSSFGHA
FT                   IACRYCNWGYGNKYLTEMAKWAKVPVMNLQCDLYHPFQALADLMTMKEKFGKLERLKVS
FT                   IIWAYAESHKKPISVPVSQVLLFPRYGMDVVLAHPKGWELPDWVIAQAKANAEKYGGTV
FT                   TVTDDEEYAYRNAHIVIPKNWGNWVTDQTGLTAAGAVKVVDEKLMAHKSWKCTEEKMAL
FT                   ADKDVVYMHALPADRNNEVEDAVIDGPHSIVYDEAENRLHTAKAVMTLLMGGR"
FT   gene            453672..455048
FT                   /locus_tag="Taci_0426"
FT   CDS_pept        453672..455048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0426"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: dps:DP1412
FT                   xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18663"
FT                   /db_xref="GOA:D1B8R0"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8R0"
FT                   /inference="protein motif:TFAM:TIGR00801"
FT                   /protein_id="ACZ18663.1"
FT                   /translation="MPSKKGSAVVGGGKDLVYQLHGRPSLLVALPLGLQHVLAMFTGNL
FT                   APIFVVAGILSLSKPDMIVMIQGAMIVSGLTTLVQLYPIGKRNWVLPRIGGELPIVMGT
FT                   SFAFVPTSITVGQMYGIQGILGGALLGSLVEFLMGIFIRPLKRFFPPLVVGSVLLALGI
FT                   KLLAVGVNYFAGGVGSKDYGSPQNLMLGAIVLVTVLLLQRFGRGMLKVSSLLIAILVGY
FT                   AAAVAMGRIDFSPVASAAWFSVPKPFHFGFSFHLDAVLSFAAVYIVSGLETIGNTSGIT
FT                   IAAFNREATAEETSGAIMGDSFGSALAAVFSALPNTAFGQNAGLVAMTKVVNKWCIATG
FT                   AMVLIAAGLFPKIGAVISVMPSSVLGGAVITVFAMILINGVKMLSKSGFSDRNLLVLGV
FT                   TFGIGMGFSMVPQLLEHLPKVLQYLFRDTVTSVCIVSIVANILFPDEDSKDKKFVIEVE
FT                   "
FT   gene            455110..455670
FT                   /locus_tag="Taci_0427"
FT   CDS_pept        455110..455670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0427"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   dvu:DVU0066 cytidine/deoxycytidylate deaminase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18664"
FT                   /db_xref="GOA:D1B8R1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8R1"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ACZ18664.1"
FT                   /translation="MKFRTPSTIKPEEIHKMLDVVEGRILPLTEEFVRKGHNLFGGAVL
FT                   DPVTLEPIVVGSNRRSDNPVFHGEVETLLRFYQLKDRPKAEDLVFLATHEPCCMCFSAL
FT                   AWCGFKEAWYLFDYTETDKDFNMPDDLIMLRELFGSQDIRRNNSYLNLYSVKEAAKLSS
FT                   DAEALMARIEALKSKYKALPVVL"
FT   gene            455673..457394
FT                   /locus_tag="Taci_0428"
FT   CDS_pept        455673..457394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0428"
FT                   /product="adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /note="KEGG: dde:Dde_0136 adenine deaminase; TIGRFAM:
FT                   adenine deaminase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18665"
FT                   /db_xref="GOA:D1B8R2"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8R2"
FT                   /inference="protein motif:TFAM:TIGR01178"
FT                   /protein_id="ACZ18665.1"
FT                   /translation="MSLRHLLPHALGERPCDLLIRGALVANVLSMEMERVDVAVKDGVI
FT                   VGLGDGYEAVSQVDARGLVLIPGMLDGHVHIESSWMVPSRFAQAVVPRGTTGVFADPHE
FT                   IANVLGPQGVIGMYESSRGLPLDVYLGCPSCVPASPFESCKVPMGVEELEGLRDGGYCQ
FT                   HLGEMMNYPGVLSGDLEVWGKLEAFRGMPLTAHAPGLSGRELCAYILSGCDGDHEATTL
FT                   EEGLEKLRRGMWVMMREGSAAPDLEALVPLVKDVPSRCSRCMVVSDDLDARTLMERGHM
FT                   DHKVRKLCALGVDPLVAVRMVTLSPAEYFRIPRLGALAPGYRADLVLVDSIPDMNVVMV
FT                   FKDGRLVAREGEMVEDLSGHPVSPRLAERGPDLGEVDLGSLSVPAEGDRIRVIGFTPGS
FT                   LLTRELEMAPPVLDGQVVPSREPDLAKLVCRERHRGTSRMGLGFVKGLGLKEGAFGGTV
FT                   SHDAHNAIVAGMDDRSIKTVLDRLNHLGGGVVVAKGDRVLAELALPFGGLMADLPARDL
FT                   ARLQEEVDLTVASLGVSGPHPCMALSFLSLSVIPELKLTDRGYINLARGGIVPIWV"
FT   gene            457484..458791
FT                   /locus_tag="Taci_0429"
FT   CDS_pept        457484..458791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0429"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: pen:PSEEN4779 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18666"
FT                   /db_xref="GOA:D1B8R3"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8R3"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /protein_id="ACZ18666.1"
FT                   /translation="MEWLERTFKLRERGTDVKTEILAGITTFMTMGYIIFVNPGILSKT
FT                   GMPFGPLLVATCLSAALATVLMAFLANYPFALAPGMGLNAFFTFSVVLGMGISWKVALA
FT                   AVLVEGVIFILLTLTRIREAVVNTIPVTLKMGIAAGIGLFIAFIGLQGAGIIVNNDAVL
FT                   VQLAGLKGNLPALLALGGLIFMVVMEHYHVKGGVLWGIIAVTVAAIPLGVAKMPDGIVS
FT                   MPPSLSPIFMQMDFSQITSSTFWVIMFTFFFVDFFDTVGTLVGVASRGGMLDSEGRLPK
FT                   AREALLADAIGTTAGAILGTSTVTTYVESASGVEQGGRTGLTALVVAVLFLLATFFSPL
FT                   VSIVPACATAPALILVGIYMMMGLKELKTDDWTEFAPAMLAFFMMPLSYSISVGIEAGI
FT                   VSYVVLKLITGKAKDVNPVMIGLALLFVVARVFGIH"
FT   gene            458852..460237
FT                   /locus_tag="Taci_0430"
FT   CDS_pept        458852..460237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0430"
FT                   /product="dihydropyrimidinase"
FT                   /note="TIGRFAM: dihydropyrimidinase; PFAM: amidohydrolase;
FT                   KEGG: scl:sce6399 dihydropyrimidinase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18667"
FT                   /db_xref="GOA:D1B8R4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8R4"
FT                   /inference="protein motif:TFAM:TIGR02033"
FT                   /protein_id="ACZ18667.1"
FT                   /translation="MGTVFKGGVIALPDGPVRADLRIEGELVHSIGEDLERDGDMVVPC
FT                   QDRILLPGGVDPHTHFDLPAGEFRTADDFATGTAAALAGGTTTIVDYATQFRGQSLRQG
FT                   VEEWHRLSIGKCHCDYAFHLAVTDWNDGIEAEVPQIVAEGIPSFKMYMAYKGLLQLDDG
FT                   SIMRMMEILRDLGGLLCLHCENGDLVHWLSQQLAQEGKLSARYHPASRPGFVESEAVFR
FT                   ALTMARAVQAPLYLVHLSAGESMDHVNLFRQRGSTVFAETCIQYLLLNEGRYSLPQGDA
FT                   MAYVCSPPLRSQADSDRLWEELRRGNVDVVATDHCSFNLMGHKDRGMNDFRRIPNGLPG
FT                   VENRLPLLYSEGVAKGRISLETFVKVTACNPAKIFGLYPMKGTLVPGSHGDVVVFNPRY
FT                   RWTVRAARQLQNVDYNPYEGWEVTGSVESVFLRGAEVFRDGRILGQEPAGRYLRRRGRK
FT                   EEA"
FT   gene            460238..462805
FT                   /locus_tag="Taci_0431"
FT   CDS_pept        460238..462805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0431"
FT                   /product="selenium-dependent molybdenum hydroxylase 1"
FT                   /note="TIGRFAM: selenium-dependent molybdenum hydroxylase
FT                   1; PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; ferredoxin; [2Fe-2S]-binding domain
FT                   protein; aldehyde oxidase and xanthine dehydrogenase a/b
FT                   hammerhead; KEGG: mag:amb1483 aldehyde oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18668"
FT                   /db_xref="GOA:D1B8R5"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017697"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8R5"
FT                   /inference="protein motif:TFAM:TIGR03311"
FT                   /protein_id="ACZ18668.1"
FT                   /translation="MYVFKVNGVEHQEERDRNLLEYLRKELQITSAKEGCGEGACGTCM
FT                   VLVDGKKHRACLLKLSQLDGKEVITVEGLSEREKQVYTWAFASTGAVQCGFCIPGMVIS
FT                   AKALLDQNLNPTRKDIKEAIRGNICRCTGYVKIEDAIEKAAWAFRENYVPVEEDRAWKV
FT                   GEAMPRVDAKDKVLGVAKFVDDLSLPGMLYGAVLRSPVPRGLVKKIDVSEAKAMEGVEA
FT                   VITWRDIPGKRIVGHLVQDWPVLVAEGEETRYVGDALALVAARDVHIAREAVKRIKVDI
FT                   EELKPLLTPEEALAPDAPKIHPWGNKVEVKTHVKRGDVDEALAKSAHVVTRVYKTQRVD
FT                   HAFMEPESALAEVVDDGIVVYTGGQGVYDENRQISAMLGIPAEKVRCITAMVGGGFGGK
FT                   EDMSVQHHAALMAWITKKPVKLTWTREESLRVHPKRHPMTIEITSGCDEEGRLTAHRIR
FT                   ITSDTGAYSSLGGPVLQRACTHAGGPYKVPNIDIEGVGVYTNNPPCGAFRGFGVTQSAF
FT                   AVEGNLNLLAEKVGISYWEIRWRNAIEPGDVMSNGQIAGPDVRLKETLMAAKEAFESSP
FT                   YAGIACGMKNSGLGVGVPDVSRVRLEVRNGVVHIYTSAACMGQGIATMTTQIVSHVTGL
FT                   PVSKIKHMPADTKLTPDAGTSTASRQTVFTGEATRRCAELLRQDLLDAGSLEALEGKDY
FT                   YQEFDFKSDPMGSDKPNPVSHIAYGYATHVVILNQEGKLERYVACHDSGQPINIKSMEG
FT                   QIEGGVVMGMGYALTEEFPTPGGYPVKKYGTLGLWRATDVPPIEVKLCYAKGGDVVFGA
FT                   KGVGEISLVPPAPAIALAYKRFDGVERTELPLVGTPYDKRKQA"
FT   gene            462866..465127
FT                   /locus_tag="Taci_0432"
FT   CDS_pept        462866..465127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0432"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead; KEGG: scl:sce5895 putative
FT                   xanthine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18669"
FT                   /db_xref="GOA:D1B8R6"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8R6"
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /protein_id="ACZ18669.1"
FT                   /translation="MKCKVVGTSVPRKDGIEKATGKAPFVADMRVPGCWEGAVIGSPVP
FT                   HGILKGFEKDPSFDWSKVVFLTAKDLKGKNFVHMIRDDFPILAEERITYATQGLALVAA
FT                   PDEETLKGALKAVKPIIEPLTPVLSIEDSLTKVAVIWGEDNILDEYRIDRGDLEKGFAE
FT                   ADLIVEGTYRTGLHEHVYLETQGMMAIPKEDGTLEVVGSMQCPYYVHGALVQSLGWEPE
FT                   RVRVRQAATGGGFGGKEDFPSAIALWVANLSLASGKPVRLIYDRSDDLKGTPKRHPSRT
FT                   RIKAGVKKDGTLTALQIEFILDGGAFTTMSRVVLQRGTLHAHGCYRVPNVSIHSMAVAT
FT                   NMVPSGAYRGFGAPQSLFAIERHMDKIADLLGMDPLDVRLKNVLKAGDYMPCGQELKLP
FT                   VFAEDVLLKAAELSDYRRKRAEYAKGTGRVRRGIGISLAMHGGGFTGAGETNMGTMVKI
FT                   DFDGERFNVHASSTDMGQGIATVHPMIAAEALHVPYDVVFSPRPDTSVTPNSGPTVASR
FT                   STMYVGRVVQEAAKNVIAELGDFLKAKHGQATFSDGFFETPNGRFSVLEAAKACFGERG
FT                   EFKVLGTLPPGCTGEWDQDAFRGEAYKDYSWIAQAIEVEVDTDTFEVQPVKATVVAEIG
FT                   KAVHPVLVEGQVHGGLLQAIGWSHIEDMTLTSEGHISAEHLNAYLIPTTIDTPEWNVEI
FT                   LEPATCQVGPHGAKGLGELPMDGGAPAFVAAVQSAVGVFGTEVPLTGEKLFKLLEEKGC
FT                   "
FT   gene            465140..466492
FT                   /locus_tag="Taci_0433"
FT   CDS_pept        465140..466492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0433"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; [2Fe-
FT                   2S]-binding domain protein; CO dehydrogenase flavoprotein
FT                   domain protein; ferredoxin; KEGG: sit:TM1040_2704
FT                   molybdopterin dehydrogenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18670"
FT                   /db_xref="GOA:D1B8R7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8R7"
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /protein_id="ACZ18670.1"
FT                   /translation="MRIQMTVNGKVMEADVHPLRPLLRVLREDLGLTGTKEGCGEGECG
FT                   ACSIMMDGLLVNACCVPAIQAAGSEIFTIEGLGDDANPDQLQVSFVDEGAVHCGFCTPG
FT                   MIMASRALLEEVPEPTLDQVRVALSGNLCRCTGYEKIYRAVDKAVKLGYTKTFKPRTNR
FT                   CDKREPQFSKEEEGRYFSPRSLSEALNVLAEHPDCRLLAGGTDILPDIKNGKGEPRKVL
FT                   NLFGVPELHGVELEGDVIRIKACTTNGEIIRSSLCREHLPALVEASARSGAPAIQNRAT
FT                   VGGNLANASGAADLPVILLALDARVRLASAKGTRTMTLKEFMPSYRKNACEAGEILESI
FT                   EIPVPARGSRQRYFKRGSRKALTLSRVSLAMYLEEEDGVVKTFRMAAGSMSPLPMRLHK
FT                   TEEAVIGKPLSQVVELASKAAYDEVNPRKSPSYRKRITSNLVRRFFEELQA"
FT   gene            complement(466547..467155)
FT                   /locus_tag="Taci_0434"
FT   CDS_pept        complement(466547..467155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0434"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; KEGG: hha:Hhal_0052
FT                   AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18671"
FT                   /db_xref="GOA:D1B8R8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8R8"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ACZ18671.1"
FT                   /translation="MRTMVYYLTKAFLWIYFHAYHRLRVQGLDNVPASNVILAPNHCSY
FT                   LDPPVVGVAFPRRITAIAWEGLFRSKPFALLITALGAIKVSQSDAVGAASVLKLSVELL
FT                   KSGKDLLIFPEGRRSLTGELLPLEGGVALLSLKTGKPVVPVRIEGAFEALPPSGSFPKP
FT                   HRIRVTFLPPIWPQAFEGQDQKVAREMLLRRLTEALKGR"
FT   gene            467243..467860
FT                   /locus_tag="Taci_0435"
FT   CDS_pept        467243..467860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0435"
FT                   /product="protein of unknown function DUF502"
FT                   /note="PFAM: protein of unknown function DUF502; KEGG:
FT                   wsu:WS0356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18672"
FT                   /db_xref="GOA:D1B8R9"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8R9"
FT                   /inference="protein motif:PFAM:PF04367"
FT                   /protein_id="ACZ18672.1"
FT                   /translation="MDGANGSSRSFRRLLLRVRLALSSLVKTFGTGLMVFFPLIVTILV
FT                   LNFVFASVEAILVWLFGLTNSVEATAGIMLVTLAIIFYGGYKIRRQEKWFMSRVDRFLA
FT                   ALPVVGSWYKVMRDLVDRLAGKDQKDMYLGVVEVPVGEGHVLAFVTRRDVMPDGTAMLT
FT                   LFMPTSPNPTSGIVMFFPEDKVRKSHLSSDAAFAKIISLGLK"
FT   gene            468038..468727
FT                   /locus_tag="Taci_0436"
FT   CDS_pept        468038..468727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0436"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: regulatory protein Crp; KEGG: gme:Gmet_0092
FT                   Crp/FNR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18673"
FT                   /db_xref="GOA:D1B8S0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8S0"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACZ18673.1"
FT                   /translation="MGRFDLYGDLFDPASQGRMRAFFLNDVAPLGVIRDYARGTSIDHL
FT                   SMRASMGVVVRGCVAKSLVSYGGREKLLYFLRPGEVFGEMDLLDGGSFPFVLQARERSS
FT                   VSFVSKRDVEALLDRRPDRYGLFVHSMTRKFRIVSLQLANSVFNGSLGQVAEALLRLAS
FT                   CSDPSGDGPVVLRLTQQELASNIGCSRVAVARALRELIEMGVIERRGREMVLRDLGRLS
FT                   GLRDGVR"
FT   gene            468753..469424
FT                   /locus_tag="Taci_0437"
FT   CDS_pept        468753..469424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0437"
FT                   /product="protein of unknown function DUF969"
FT                   /note="PFAM: protein of unknown function DUF969; KEGG:
FT                   vfi:VF_1372 permease"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18674"
FT                   /db_xref="GOA:D1B8S1"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8S1"
FT                   /inference="protein motif:PFAM:PF06149"
FT                   /protein_id="ACZ18674.1"
FT                   /translation="MIKLVGVVIVVVGLLLRFNPLLVVLVAGFATGLVGGMGPMEVLEA
FT                   LGNAFVTNRYMSLFVLTLPVIGVLERHGLKEQAERFVSSLKGATAGRVMMLYMLFRQLT
FT                   CAVGLQLGGHPTFVRPIVAPMAEGALSKGGELDPDLSDRVRAMAASAENYGNFFGQLIF
FT                   IASGGLLLIKGVMDQAGHPVDLMRMGMYAVPTAVCAFAMAALRFHLFDLSAKRDLERGG
FT                   N"
FT   gene            469427..470338
FT                   /locus_tag="Taci_0438"
FT   CDS_pept        469427..470338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0438"
FT                   /product="protein of unknown function DUF979"
FT                   /note="PFAM: protein of unknown function DUF979; KEGG:
FT                   vfm:VFMJ11_1452 permease"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18675"
FT                   /db_xref="GOA:D1B8S2"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8S2"
FT                   /inference="protein motif:PFAM:PF06166"
FT                   /protein_id="ACZ18675.1"
FT                   /translation="MKLTVDHMYLLTGLVLLAFSARSFLDGGNRKRLGNGLFWGVYGLT
FT                   FLLGGLVPNRVIGFMVVLLAALGSFDMMGRGSYGETTREERMARAAAMGNRIFLPALII
FT                   PLVTFGVAKFTSLGALVGLGLGTVVGFVAAALMLREGPLVSVEEGRRLIDAISWSAILS
FT                   QFLAALGFLFDKAGVGAVVAGMVSSVVPHGSRLAAVVAYCVGMALFTMVMGNAFAAFAV
FT                   ITTGIGIPMVVMQGADPSVAGVIGMLSGYCGTLMTPMAANFNVVPAALLEIRDKNRVIV
FT                   AQVPVALAMLVANVVLMYTLAF"
FT   sig_peptide     469427..469504
FT                   /locus_tag="Taci_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.856) with cleavage site probability 0.677 at
FT                   residue 26"
FT   gene            470364..471011
FT                   /locus_tag="Taci_0439"
FT   CDS_pept        470364..471011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0439"
FT                   /product="pyrrolidone-carboxylate peptidase"
FT                   /EC_number="3.4.19.3"
FT                   /note="KEGG: spe:Spro_1260 pyrrolidone-carboxylate
FT                   peptidase; TIGRFAM: pyrrolidone-carboxylate peptidase;
FT                   PFAM: peptidase C15 pyroglutamyl peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18676"
FT                   /db_xref="GOA:D1B8S3"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8S3"
FT                   /inference="protein motif:TFAM:TIGR00504"
FT                   /protein_id="ACZ18676.1"
FT                   /translation="MRHVLLTGFDPFGGERVNPALEAVRCLDGRVIAGAVVRAVEVPTV
FT                   RFKCVERVRSAIAELDPLLVISVGQAGGRAEITPERVAINVDDFRIKDNEGNQPVDEVV
FT                   DPKGPAAYFSTLPIKAMVDAMRRAHIPASVSNTAGTFVCNHLFYGLMRHLHLEGNVRRG
FT                   GFVHIPYLPEQAARLSGQPSMGLDCVLTGLEAGIAAALECGEDKPITGGTEC"
FT   gene            complement(471067..471725)
FT                   /pseudo
FT                   /locus_tag="Taci_0440"
FT   gene            471909..473471
FT                   /locus_tag="Taci_0441"
FT   CDS_pept        471909..473471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0441"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="PFAM: 5'-Nucleotidase domain protein;
FT                   metallophosphoesterase; KEGG: mmw:Mmwyl1_4357 bifunctional
FT                   UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18677"
FT                   /db_xref="GOA:D1B8S4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8S4"
FT                   /inference="protein motif:PFAM:PF02872"
FT                   /protein_id="ACZ18677.1"
FT                   /translation="MRRRFLRPVWGVAVLLLLLLGVMAEASQLTILHVNDTHGHAWPFD
FT                   VSDGPSVGGFAPLSTLVDRIRREVESKGGHVILLHAGDFNTGVPESDQSDAMPDIVAMN
FT                   MIRFDAATLGNHEFDKPREVLKRQLDFARFPVVNANLVDSMGFNPLKPYVVKDFGDVSV
FT                   AIYGLLTPETAQLEPVHLKGWTLEDPVGVSRRLVPRLKNRARVVIALTHLGWSDDPSLP
FT                   GTSRALAEARIPGLDVIVDGHSHTLFKEAPTIGHTTVVQAGDWGRYLGRLDLTIEDGRI
FT                   TRRSWRAIPVNLKRAVGPGGGKRVFEFLEGEIPSDPKVEAALDYFKRVGRERLDAVVGR
FT                   TRVLLDGERERVRSMDTNLTNLVADAMRWKVGADVALLNGGAVRASISPGDVTYRDVLT
FT                   VLPFGSTLYVVELTGEQLKRVLDFAVTVPAGKGGWPHFSNLTLRRGASGAQDVRVGGKP
FT                   LDMGARYRLVTFNYLALGGDGYQVLKELKGYDTGFVDAAVLAEFMGTQGEISGWDGSQR
FT                   YVP"
FT   sig_peptide     471909..471989
FT                   /locus_tag="Taci_0441"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.809 at
FT                   residue 27"
FT   gene            473527..474681
FT                   /locus_tag="Taci_0442"
FT   CDS_pept        473527..474681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0442"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   bha:BH3008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18678"
FT                   /db_xref="GOA:D1B8S5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8S5"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ACZ18678.1"
FT                   /translation="MKAIVNGRIWTMSAGEIPGGTILLDRGRIVAVGSSVEVPPGAEVI
FT                   DVSGAVVTPGFIDAHTHAGICEEGVPEDPDPVNDATDPITMGLRALDAINPSDEAFRNA
FT                   LSSGVTCVNVVPGSANVVGGTGAVVKTWGSTMEDMLVLSHSGMKAALGENPMRVHGRKD
FT                   RLPSTRMGNAYCLRKALQDAVDYRERKRSAAEKGEHFSLDLGFENMLPVLEGRVPLRVH
FT                   CHRADDICTAVRVCEEFKVPFTLEHGTEGHLVVELLASKGVSVAVGPTQSSKSKIELRN
FT                   KGWETLVAFSRAGVRFCMITDHPVIPIETLQVAVSLAVRHGLEPLEALRAVTIRAAEHL
FT                   GLAHRMGSIQEGKDGDLVVWDGDPTDVRVAPRMVFVEGRLVYEA"
FT   gene            475150..475317
FT                   /locus_tag="Taci_0443"
FT   CDS_pept        475150..475317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18679"
FT                   /db_xref="InterPro:IPR005906"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8S6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18679.1"
FT                   /translation="MSGVCVVCEGSVSVPEGCCVGEILVCPDCGVELEVLSLEPLELGE
FT                   APEVQEDWGE"
FT   gene            475332..476150
FT                   /locus_tag="Taci_0444"
FT   CDS_pept        475332..476150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0444"
FT                   /product="lysine biosynthesis enzyme LysX"
FT                   /note="TIGRFAM: lysine biosynthesis enzyme LysX; alpha-L-
FT                   glutamate ligase, RimK family; PFAM: RimK domain protein
FT                   ATP-grasp; KEGG: mpt:Mpe_A2610 SSU ribosomal protein S6P
FT                   modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18680"
FT                   /db_xref="GOA:D1B8S7"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8S7"
FT                   /inference="protein motif:TFAM:TIGR02144"
FT                   /protein_id="ACZ18680.1"
FT                   /translation="MIYTRLRVEEKLLHQRAQELGVPSRLVDATHWVLGGDLDVPSGGV
FT                   ALCRAISHGQNETIARCLESRGIRVSNPPEVMARCGNKMLTALALDAEGIPQPRWRVAL
FT                   SPEGAMEAVGDLGFPAVLKPLCGSWGRLLAKVNDRDALEAVVEHKHQLGVNHQTYFIQE
FT                   YVEKGGFDVRAFVVGGRPVAAIRRSSPHWITNTARGGEASNVPVDVEMYRLLEGVQRAI
FT                   GGDFLAVDLFRSDRGWLVNEVNDGGEFKNSIGPTGVDIPGLIVRHLLDLK"
FT   gene            476163..476285
FT                   /locus_tag="Taci_0445"
FT   CDS_pept        476163..476285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18681"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8S8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18681.1"
FT                   /translation="MDLDRLKRKPFGADGSLEANGTFDIDFQMGGAMRRPGGSS"
FT   gene            476358..476513
FT                   /locus_tag="Taci_0446"
FT   CDS_pept        476358..476513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18682"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8S9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18682.1"
FT                   /translation="MVIELYERGRLIITLELTADLEDPREGVGRVIEDAPTLDDPGHLG
FT                   RDGEWW"
FT   gene            476504..477226
FT                   /locus_tag="Taci_0447"
FT   CDS_pept        476504..477226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0447"
FT                   /product="Citrate synthase-like protein"
FT                   /note="KEGG: sus:Acid_3102 citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18683"
FT                   /db_xref="GOA:D1B8T0"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8T0"
FT                   /inference="protein motif:COG:COG0372"
FT                   /protein_id="ACZ18683.1"
FT                   /translation="MVVALATRVAPDRIEIDGEPIGEFIRRGDPAEMWFRMIQGRTPSQ
FT                   EESAVFGAILCSMADHGDTPPSTQAARLVASSGSPMQCSLAAALLAFGDHHAGAIERAM
FT                   ELFSSCVRDREIPSVVADRFISRGRRVPGFGHRVHREDPRVRPLVEVGSALTHRPHLSF
FT                   FLGVQDHLRSAKGIVGNVDGVCGALLLDLGFPPSAGRAVFFCGRIPGLVSWILREGELG
FT                   PFRPYRLVPSEEVAPCIA"
FT   gene            477214..478269
FT                   /locus_tag="Taci_0448"
FT   CDS_pept        477214..478269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0448"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: maq:Maqu_0691 N-acetyl-gamma-glutamyl-
FT                   phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18684"
FT                   /db_xref="GOA:D1B8T1"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8T1"
FT                   /inference="protein motif:TFAM:TIGR01850"
FT                   /protein_id="ACZ18684.1"
FT                   /translation="MYRVAIMGASGLAGGEILRILANHGGFRVSLVTSASSTGRPVRQA
FT                   HPHLAYAYRDLTFSPEEAVLEGEWDLIFLALPHRKSAPWIRRLMPLLEGGRRLVDLSGD
FT                   FRLRDTEAHRRWYGEDPAEDLRGAFVYGLPELHREEIRFASLVSGVGCNATAATLAALP
FT                   LVRSGLSEAVLQWWFECRVGSSEGGSVPNEGGMHVFRSRTMRVVSCFSHRHLGEVSQEL
FT                   RIPEEAMSLTVTSVEMVRGVQCLLSAPLREPLTEGDLWRALRSAYGTEPFVDLCPPRPG
FT                   HMRLPDPRLVLGSNRALVGFSLSDDRRRLLVGCAIDNLMKGAAGTAVQCANLMFRLPEE
FT                   QGLIMPPAYPA"
FT   gene            478296..479114
FT                   /locus_tag="Taci_0449"
FT   CDS_pept        478296..479114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0449"
FT                   /product="aspartate/glutamate/uridylate kinase"
FT                   /note="PFAM: aspartate/glutamate/uridylate kinase; KEGG:
FT                   predicted protein; K00930 acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18685"
FT                   /db_xref="GOA:D1B8T2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8T2"
FT                   /inference="protein motif:PFAM:PF00696"
FT                   /protein_id="ACZ18685.1"
FT                   /translation="MLGVVKIGGARGNRYDHLVRELSARVLRGERWILVHGASGRMEEL
FT                   CASRGVEVRIVCSPSGYTSRYVGPVEREIFEEAAFHMSHLVSSMLRSSGVEPAIVTPAE
FT                   GERKDCLRSVEGGRVRILRDNYSGRVTRVDPQPIRRLLELSKVPVIPPLAMCQGLFINV
FT                   DGDRLAAQVAAAVGAQGLVILSNVPGLMRDLEDPNSVLPMASLEEWDLVESLAAGNMKR
FT                   KVLAAREALGAGVQRVILADGRLEEPLAGALEGRGTVLCSAPCTVAAASS"
FT   gene            479075..480190
FT                   /locus_tag="Taci_0450"
FT   CDS_pept        479075..480190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0450"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG: bce:BC4127
FT                   acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18686"
FT                   /db_xref="GOA:D1B8T3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8T3"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ACZ18686.1"
FT                   /translation="MLSSMYGSRGVQLVSGRLGRVVDREGREYVDWFTAHGAALFGHQD
FT                   PQLVQALKGAAEGLWTVGAGFDHPSRRALEEEVERCLPGRRFFVCNSGTEAVECALKLC
FT                   IALRPGRTRLIAARRAFHGRTLGALSLTFNPKYRSKFDPFLCRVEHLPPERIPEAIDDR
FT                   VAAVFLEPVQGEGGVHPLDAELGRRITRAAAEHQAILVADEVQTGMGRCGRMMASHLVG
FT                   LEPQVVCLAKGLAGGFPCGMVLWDRDLGDFSPGLHGSTYGGNPLACSLAALSMGRIRSG
FT                   EHLEACRIMEAFRRELAGAGLDVQVRGLGTMTGVEVPVDSSGIVKSLQSAGLLALQAGP
FT                   RVVRFLPSIKVTGEDAEMALDLFIRSLRGAS"
FT   gene            480190..481230
FT                   /locus_tag="Taci_0451"
FT   CDS_pept        480190..481230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0451"
FT                   /product="N-acetyl-ornithine/N-acetyl-lysine deacetylase"
FT                   /note="TIGRFAM: N-acetyl-ornithine/N-acetyl-lysine
FT                   deacetylase; PFAM: peptidase M20; KEGG: rsh:Rsph17029_3430
FT                   peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18687"
FT                   /db_xref="GOA:D1B8T4"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010175"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8T4"
FT                   /inference="protein motif:TFAM:TIGR01902"
FT                   /protein_id="ACZ18687.1"
FT                   /translation="MDPVSFLSDLIRVPSPSGDEGPAAEVLAEALLGLGWERSWIDPAG
FT                   NVLASRGDGLSRVALFGHLDTVPGGPEPMIRGDQVWGRGSVDAKGPLCAMAVAGSRVEL
FT                   PPGVGLVLVAAVGEEVDSRGARHALASGQLEGVRGVVVGEPTGTDGVALSYRGRVLLRL
FT                   SDSDGGAHRSCDSGPLTRVLMGASRVVSHVSHLEGFSSAVVHMEGEESGGRSARVTLDL
FT                   RVPVGASALALAEELVPMASGVRVELLEVVEPHSVGAGDPVVSCLRGSIRGVGRNPRLL
FT                   AKLGTCDFNVLAPLGVPMGVYGPGDPRLDHSDQERLDVGDYLRSIEVLSDAIPRIVSRV
FT                   CNPQGR"
FT   gene            complement(481202..481756)
FT                   /locus_tag="Taci_0452"
FT   CDS_pept        complement(481202..481756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gdj:Gdia_0267 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18688"
FT                   /db_xref="GOA:D1B8T5"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR030949"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8T5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18688.1"
FT                   /translation="MKEARRFSTRDVAIMGLLIGMNIVLTRVASLRIAIGSVEGIRIGF
FT                   GQLPVVFGSLYLGPLAGAVIGGLGDLVGYWVNPMGPYMPHFTVTSTLSGLLPGLIYHLI
FT                   PSNRRGLWTMGISIALPHLAISCVTVPLLIQHLFSLPIGVTMPPRFIAAAFTIPAYTLV
FT                   CRMLIARLSGATVTFLGGCRP"
FT   gene            482001..482921
FT                   /locus_tag="Taci_0453"
FT   CDS_pept        482001..482921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0453"
FT                   /product="phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /note="KEGG: bcb:BCB4264_A4276 phosphate
FT                   butyryltransferase; TIGRFAM: phosphate butyryltransferase;
FT                   PFAM: phosphate acetyl/butaryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18689"
FT                   /db_xref="GOA:D1B8T6"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR014079"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8T6"
FT                   /inference="protein motif:TFAM:TIGR02706"
FT                   /protein_id="ACZ18689.1"
FT                   /translation="MKQLRSLTELLDYAKEVGPLKVSVACAEDAEVLEAVEEARKAGIA
FT                   EAILVGNGEAIASVASKLGIDLSNYEVVDERGGEAAAALVAVEQVSSGRAHILMKGMVK
FT                   TANFLKAVLNKEKGLRTGSLLSHVYIHDVEGYDRIFFITDPAFNMYPDLPAKVSIVENV
FT                   VKVAHSFGISCPKVAALAAVEVVNPDMPPTLDAAALVQMNRRGQIKGCVIDGPLALDNA
FT                   VSEEAARHKGIVSDVAGHADILMVPDIEAGNMMAKAIIYFAKGKTAGLVVGAKAPIVLT
FT                   SRSDSAETKLLSIASAVAMAAFGKK"
FT   gene            482983..484062
FT                   /locus_tag="Taci_0454"
FT   CDS_pept        482983..484062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0454"
FT                   /product="butyrate kinase"
FT                   /note="TIGRFAM: butyrate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: bcy:Bcer98_2858 butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18690"
FT                   /db_xref="GOA:D1B8T7"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8T7"
FT                   /inference="protein motif:TFAM:TIGR02707"
FT                   /protein_id="ACZ18690.1"
FT                   /translation="MSYPLILSVYPRHLSTDVALFRGPVRVFVSSRSHRREELVRFVRV
FT                   RDQLPIRIRAVEDVAVEHSLDLSSVEAFVACGGLVGPVRGGFYRVDRAMEEVLGDGTFG
FT                   EHVYNLGGLMVHRLSRSYGGVPLVGDPVSTFELCPEARLSGMVGCHREPVFHALSQRSA
FT                   ARFAAGRLGRAYRDCRLVVAHLGYGISVGAHLDGLVVEVNDALHGEGPFSLERAGSLPT
FT                   LGLLELAYSGRHDMEDLRGMITRDGGLARHLGCRDFMGVEALVRRGDQRALEVFDAFVS
FT                   GISKEIAARATVLRGEVDAVVLTGPMVAWDRLVSQLEDRCGWIAPVITVKGQDELADLA
FT                   MGALEVLSGRVEPLVLGDR"
FT   gene            484075..484881
FT                   /locus_tag="Taci_0455"
FT   CDS_pept        484075..484881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18691"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8T8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18691.1"
FT                   /translation="MNVVDRLRTVYLDGSFGDRKVHLHLFTPDQPFRDLVVVFHGVHGN
FT                   ATPEEGNKYGDLGRMIAQRGAAAAVVETSRLRRDRQAFEGDKNRWAVEAFSGKTFAQEI
FT                   QDLAWAVRGATEEVEAPRLWLWGFSLGGIGAMLIASGLCSSLGVDSPASEVEGVVVSGT
FT                   GDVLRDTADLGMLKLPILNNLPDRSLLQDAARNLKASFFASFRGTEDDLFGVASCRRLV
FT                   DLVPLPEEDKFMQELPGVDHSFRMMNGQPSREPLRLMVDRVRLRWG"
FT   gene            484878..485567
FT                   /locus_tag="Taci_0456"
FT   CDS_pept        484878..485567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0456"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG:
FT                   pca:Pcar_0659 negative regulator for pho regulon and
FT                   putative enzyme in phosphate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18692"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8T9"
FT                   /inference="protein motif:TFAM:TIGR02135"
FT                   /protein_id="ACZ18692.1"
FT                   /translation="MKLFGRSQETGGFDRRDRELLMGMLVSMGALVRDNLSAVLGRLSG
FT                   PLDDWGMPPDEPVDSMEVRVEQECLRLMALRQPLREDLRFCFAVLRIAKDLERMGDEAQ
FT                   NVYEELSNLKGPVDLAEWGELPLMGSRCLEMMDDAMDSMVRLDGQLAVEVFRRDDQVDQ
FT                   LWGSLRLRAAEAIGDRCGSGRDWAMGLLSLLAVGRHLERVADHCANVAELAYFVITGRR
FT                   LRGEEIP"
FT   gene            complement(485592..486056)
FT                   /locus_tag="Taci_0457"
FT   CDS_pept        complement(485592..486056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0457"
FT                   /product="Xanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: dde:Dde_1506
FT                   xanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18693"
FT                   /db_xref="GOA:D1B8U0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8U0"
FT                   /inference="protein motif:PRIAM:2.4.2.22"
FT                   /protein_id="ACZ18693.1"
FT                   /translation="MSDERYVKTYSVSWDQLQRECRQLAAELSRLRRWNRLIAVARGGL
FT                   VPAALMAQELQIKLVDTVCISSYTLKSQGDLTVLKRPDLEGVDENCLIIDDLVDTGKTA
FT                   QVVREMFPQAYFATVYAKPEGRPLVDKFVTEVSQNTWIIFPWEPSHSPIL"
FT   gene            486269..487189
FT                   /locus_tag="Taci_0458"
FT   CDS_pept        486269..487189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18694"
FT                   /db_xref="InterPro:IPR032388"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8U1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18694.1"
FT                   /translation="MRKPLRIALAVLALALLWGSSCLAQVVGADDRYMKIRIASPIHNL
FT                   TSVRVWRSRYDPSDGLPDRMTQYFHNLLKSAPMVEATLLDKEIGAGWPVRGFGPNDVVV
FT                   KLNLEDLRIEKKDLVGSRMRAYASVRMTVYGATSKDPIYTWVANSELERWTPEYRDLKE
FT                   PYFWRDFEGTVCWSAVRDALDRCAEELMSVRRGYRVLGRIVAVARPAEGLKWDRDVKRF
FT                   HVNLGKDETLQEGDLLAVVRSTVTRTVDGEEPVMIYPQKVATVKVVYLSDRDGVVQVVS
FT                   EPKDYPVQVGDVVLMPLTTPRKGRF"
FT   sig_peptide     486269..486343
FT                   /locus_tag="Taci_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.946 at
FT                   residue 25"
FT   gene            487218..487631
FT                   /locus_tag="Taci_0459"
FT   CDS_pept        487218..487631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0459"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; SMART: Tetratricopeptide domain
FT                   protein; KEGG: tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18695"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8U2"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ACZ18695.1"
FT                   /translation="MNFAKMLCLGLAAVTFGVAPWQPQAEAKVKVRAVKSPVATRARDP
FT                   LMAEAWRGGQQLVMEGKLNSAVRYLRRYVTVMPRSADGWFWLGRAYLAMGDHQRARNAF
FT                   NRALAVDPYYPSLQPDRLDQSGMPLWPEITSPM"
FT   sig_peptide     487218..487295
FT                   /locus_tag="Taci_0459"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.722 at
FT                   residue 26"
FT   gene            487743..488753
FT                   /locus_tag="Taci_0460"
FT   CDS_pept        487743..488753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0460"
FT                   /product="Proline racemase"
FT                   /EC_number="5.1.1.4"
FT                   /note="PFAM: proline racemase; KEGG: bce:BC2835 proline
FT                   racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18696"
FT                   /db_xref="GOA:D1B8U3"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8U3"
FT                   /inference="protein motif:PRIAM:5.1.1.4"
FT                   /protein_id="ACZ18696.1"
FT                   /translation="MRLRRMVSVVDTHTGGEPTRIILSGGPILKGRTMLDRWEEFASAH
FT                   DAFREFVMREPRGHGDMFGVMITPPCSDEAHCGVIFMDTGGCLTMCGHGSIGLARTLLE
FT                   LGMVTGESPCADVVLDTPAGIVRVTVDIREDGRIGEATLMNVPSFLYAEDLKVRLSDGT
FT                   DVTLQVAFGGNFFAIVPAQQLGLSIVSDEARRIQALGLEIRDLVNRKLEASHPEDPRIC
FT                   GVELVEFSLKTGERSARNCVVFGQGSLDRSPCGTGTSAKMAVLAALGELKPGEEFVHQG
FT                   IVGSTFRAFYRPGPVIGGFDSIIPYIKGTSSVTGFNLLLEQDGDMFPRGFLLGRA"
FT   gene            488801..490924
FT                   /locus_tag="Taci_0461"
FT   CDS_pept        488801..490924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0461"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: pmy:Pmen_1816 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18697"
FT                   /db_xref="GOA:D1B8U4"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8U4"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ACZ18697.1"
FT                   /translation="MTVLRRSTLALFVGISLLIHLATPSAIMGSQGDGVVLVLSGGGTK
FT                   GLAHIGVLKVLEEAGVRIDGIVGTSMGAIIGGLYACGYSAHDLERLVMENSILDLLYDR
FT                   TPQDIPDASLNRLPKGRSGLFDFHFDKDHNRVGPMGGMSATRLVSFLSRVTGERFQGGD
FT                   FDRLRIPFAAVATDLETGETVVLRRGNLAYAMRASMAIPGIFDPWMVDGRLLVDGGLVA
FT                   NLPVSIARELFPGRKVLAVNLSDMGVKNRREIRTLYDVVAQSLNIITAPSIRSEASKAD
FT                   LLVEPDVGRFGLLDPGGYDRIIAAGVEAARGLGDRIAALSPRDGAPPASPALLAKEPPV
FT                   VMSVQVEGLPPEMARDVEEHLRPWVGKGLDMEAVLREADRLSRREDFVSVNGYARPRDD
FT                   RGVDVVMSFQRRPPIEVSVGGYATNLHSQRWMSLSGVKRDLISQGDVMEGQFRLGDHWG
FT                   WVLRYFSPYDDDSQWGMALTAREDEISPSGMSQERWKRYGLRALRYSDNGRTRFGWGVL
FT                   VENVDLKDSRTLTGPYLYLYHDGTDSKQHPTRGYALEVNVWSPNLDRVISRTVFNRYVP
FT                   WGDRYRVVISGGLETGDREDPPHRAYLGDQEELYSLGDSPLAGDQAAWLRVGISGTVMQ
FT                   TWWGRLDAELFGTAGMVMNRWTRTNDSWEVGLALSIPGQFFNGRLMTVYDKGGNLTFGF
FT                   SVGDPIWWNSPLP"
FT   sig_peptide     488801..488890
FT                   /locus_tag="Taci_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.538 at
FT                   residue 30"
FT   gene            complement(490934..491845)
FT                   /locus_tag="Taci_0462"
FT   CDS_pept        complement(490934..491845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0462"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: sfu:Sfum_2753 2-dehydropantoate 2-reductase;
FT                   TIGRFAM: 2-dehydropantoate 2-reductase; PFAM: Ketopantoate
FT                   reductase ApbA/PanE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18698"
FT                   /db_xref="GOA:D1B8U5"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8U5"
FT                   /inference="protein motif:TFAM:TIGR00745"
FT                   /protein_id="ACZ18698.1"
FT                   /translation="MTRVLVVGLGALGGRIACQLSAAGVPVMALERSTQGTRSLTYVGR
FT                   DGIEIRANIRSTSSPCAARDFAPLVAFVTVKAYKTWEAAEALSQALPGEALAVTLQNGL
FT                   GNLETLASVLGEHRTAAGVCTYGAHREGDRIFWGGDGQIRIGSPWGASVSIPIEVLKAG
FT                   GFDAHESHDIRRDIWTKAAVNCCINPLTALLRVRNGELRSSPWAMEIIRSVIQETVQAA
FT                   GLQGVALDPEEVRRTVESVMEATGGNRSSMLQDVEARRPTEIGSLSLKVAEICRDGGLS
FT                   APVSAALGELVRALEDLSIPKG"
FT   sig_peptide     complement(491777..491845)
FT                   /locus_tag="Taci_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.781 at
FT                   residue 23"
FT   gene            complement(491846..492679)
FT                   /locus_tag="Taci_0463"
FT   CDS_pept        complement(491846..492679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0463"
FT                   /product="3-methyl-2-oxobutanoatehydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="KEGG: mxa:MXAN_2055 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; PFAM: Ketopantoate
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18699"
FT                   /db_xref="GOA:D1B8U6"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8U6"
FT                   /inference="protein motif:TFAM:TIGR00222"
FT                   /protein_id="ACZ18699.1"
FT                   /translation="MDRPKVTIPALREMKARGEKIVMHTAYNHWQAQMAELAGADTILV
FT                   GDSAGMVEHGFTSTVPVTMEMMLLHCAAVVRGSRSPFIIGDMPFMSYEVSIQEAVRNAG
FT                   RLVKEGGVDAVKLEGGTSRAQTIEAIVRAGIPVVGHVGLTPQSATQLGGFKVQGKDRER
FT                   ARQVLEDAMAVQEAGACMVVLECVPTPLAKVITERLSIPTVGIGAGPHCDGQVLVFHDV
FT                   LGIFDAFKPKFVKRYMNCRDAMIQALREYTQEVRSAAFPGEEHGFSMDEDQLEGL"
FT   gene            complement(492680..493525)
FT                   /locus_tag="Taci_0464"
FT   CDS_pept        complement(492680..493525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0464"
FT                   /product="pantoate/beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: gsu:GSU1706 pantoate--beta-alanine ligase;
FT                   TIGRFAM: pantoate/beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18700"
FT                   /db_xref="GOA:D1B8U7"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8U7"
FT                   /inference="protein motif:TFAM:TIGR00018"
FT                   /protein_id="ACZ18700.1"
FT                   /translation="MIIAKTPEEVRDALKGTGTVGLVPTMGYLHDGHLSLVRRSVAENQ
FT                   TTAVSIFVNPTQFGPHEDLSRYPRDLKRDLELLEPLGVDLVFTPEPEAMYHRDHSTWVE
FT                   EVNLARGLCGASRPGHFRGVCTVVLKLFNIVKPNRAYFGEKDYQQLKVIQRMVRDLNLD
FT                   VQVVGCPIAREEDGLAMSSRNVYLSPEERSLALCLSRAVNRAQAEASRGVSDPASIVEA
FT                   ALSEIPDHPSITVDYIKLVDCDTLEELETLKSAGRILLAVRVGSTRLIDNGMVKPNGGV
FT                   "
FT   gene            complement(493542..493919)
FT                   /locus_tag="Taci_0465"
FT   CDS_pept        complement(493542..493919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0465"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: cju:C8J_0273 aspartate alpha-decarboxylase;
FT                   TIGRFAM: aspartate 1-decarboxylase; PFAM: aspartate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18701"
FT                   /db_xref="GOA:D1B8U8"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8U8"
FT                   /inference="protein motif:TFAM:TIGR00223"
FT                   /protein_id="ACZ18701.1"
FT                   /translation="MFLKMCRSKIHRATVTEANLHYVGSITIGKDLLELSGILPGEAVQ
FT                   VVDIDNGNRLETYVIQGPEGTICLNGAAARLVQPGDKVIIMAFCWMTPEEARDHRLKVV
FT                   LVDQDNRPTEVTDREDHGTIF"
FT   gene            494088..494444
FT                   /locus_tag="Taci_0466"
FT   CDS_pept        494088..494444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18702"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8U9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18702.1"
FT                   /translation="MAAMLAVLVAGSAFAGPRVGYGGGWGWDGQCGPGGRRGHQMMMGP
FT                   YGFMGPVDPKDVPKEVQDLMREAERLHLQMRMAFTEEKVDRAKVLGLHDKLHDLHGKIA
FT                   RWRLEEAIKRANAK"
FT   sig_peptide     494088..494135
FT                   /locus_tag="Taci_0466"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.685 at
FT                   residue 16"
FT   gene            complement(494507..496420)
FT                   /locus_tag="Taci_0467"
FT   CDS_pept        complement(494507..496420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0467"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: pzu:PHZ_c2015
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18703"
FT                   /db_xref="GOA:D1B8V0"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8V0"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ACZ18703.1"
FT                   /translation="MRPRSALPIRPWILLLGLLLAFVPSPSPCAEKRSPNAGGLDPREF
FT                   NSFVRGFLEGAMRTCHVPGAVFVAVADDRVIASFGVGMADLESKRPMTEETVVRTASIS
FT                   KVITALTALSLEQRGRLSLDQDVNRYLKHIQIPPVQGWRPITIRDLLTHSGGFEDRWIG
FT                   TEAQDALEELSFSRALKKMAPRRILPPGEVYSYSNFGLALVGSAIEGATRRSFHSTVKK
FT                   NVLDPLKMTKSGFVSDQAMDRDSAAGYYSAPDPYPAQYAYFLEAPAISFNSCGRDMAKL
FT                   IRALLKDGILDGRQALHPKAVRELLTPAFHNHPSLPGATLGMYQTSVRGLTVLEHGGDL
FT                   DGFTSLLVLVPQRSFGFFLAMNGDVPQIRDRLKEALVERYLAPPAIKPQGEPSSPVPAH
FT                   LEGRYRHIRRPRTTVDAAYLMFDQPIEVYANQDGTVSVSYPEDWDRPTSTWIPLSQDLL
FT                   ISLDGTERMALRRGPDGKVKFLFIREPYETYEPMHPLDGPTASRAFLWSFGVLGTASAL
FT                   IWAAGALGRLKPRYDEPSEWPTKWGFISLHWLTTWAFLAGLYLADRLMGYQLRIGIPWQ
FT                   VKALFALPFAGLVPLGISLYHLARPQGRGIPLDTLAFLLSLAGALGGLWFLNHWNLLGF
FT                   RF"
FT   sig_peptide     complement(496328..496420)
FT                   /locus_tag="Taci_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.857 at
FT                   residue 31"
FT   gene            complement(497040..498428)
FT                   /locus_tag="Taci_0468"
FT   CDS_pept        complement(497040..498428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0468"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase; KEGG:
FT                   afw:Anae109_0166 phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18704"
FT                   /db_xref="GOA:D1B8V1"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8V1"
FT                   /inference="protein motif:PRIAM:5.4.2.8"
FT                   /protein_id="ACZ18704.1"
FT                   /translation="MPKVPSHIFREYDIRGLAEEELTSHNVRLIAQAYGTFLRSRGVGT
FT                   ATVGGDVRHSTRRIMDAAIGGLTEAGVNVIDLGTVATPCFYWSLHHFGVDGGIMVTGSH
FT                   NPKEFNGLKLAFGKVTLYGDEIQEIRRIIEEDRIQIPGGASVRREDIKEAYISMLASKI
FT                   TLGSRKLKVVVDSGNGTGGLFAPEMLRRIGCEVIELFSEPDGTFPNHHPDPTKRENLPK
FT                   LIETVRAHGADAGVGFDGDSDRIGVVDDQGEVIWGDRLMILYWSEILPKHPGAEVIVEV
FT                   KSSMALPEEAQRMGGRPLWWKSGHSLIKAKMKEISALFAGEVSGHMFFADEFYGFDDAF
FT                   YAAGRLMRILSNTDEKLSQIMSRIPKYPSTAETRVDCPNDQVKFQVVERVVERALKEKL
FT                   QTITVDGVRIIYPNGWGLVRASNTQPVLVTRCEGRTQEDLDTICKDMKARLLEAGLGEF
FT                   EWEF"
FT   gene            498561..499382
FT                   /locus_tag="Taci_0469"
FT   CDS_pept        498561..499382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0469"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: gme:Gmet_2382 metal dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18705"
FT                   /db_xref="GOA:D1B8V2"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8V2"
FT                   /inference="similar to AA sequence:KEGG:Gmet_2382"
FT                   /protein_id="ACZ18705.1"
FT                   /translation="MWSDAMVEAFNRELSSSFDRYASSFRVQGELPYLLDLKLRHSYRV
FT                   REEAMSIARHSDQVPPHQHPLAFAVGLLHDLGRFQQYRLHGTFNDSASVDHGDLGARIL
FT                   ESDLSHLSALMPQRWWHLLTLSIGLHNKRRVPQGLDPDEELWVRLARDADRLDVYRVIT
FT                   GHLERGTMIKIIPRLVDQDSPPSDLIVEEILSTHTADYSMVRSLADLLLVQISWAYDMS
FT                   FPWSMAEVLRRGVVERISRFVPKTSGAKRVIQDVKAWLVSSTRSPAVQAGV"
FT   gene            499527..499997
FT                   /locus_tag="Taci_0470"
FT   CDS_pept        499527..499997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0470"
FT                   /product="NADH dehydrogenase (ubiquinone) 24 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone) 24 kDa
FT                   subunit; KEGG: gme:Gmet_2081 NADH dehydrogenase
FT                   (ubiquinone), 24 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18706"
FT                   /db_xref="GOA:D1B8V3"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8V3"
FT                   /inference="protein motif:PFAM:PF01257"
FT                   /protein_id="ACZ18706.1"
FT                   /translation="MSADHHDDRLKEILHRYPRHPRFLLAFLQDVQREFKHVPREAMEA
FT                   SSERFMVPMSRVYSVATFYRALSLVPRGRKTIKVCMGTACHLRGAPRVLETIEEALQVR
FT                   CGGTTQDGEFSVEAVNCLGACALAPVVMVEDRCYGSMTAAKVREMLEEERGR"
FT   gene            499994..501856
FT                   /locus_tag="Taci_0471"
FT   CDS_pept        499994..501856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0471"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase domain 51
FT                   kDa subunit; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: NADH dehydrogenase (quinone); K00335 NADH
FT                   dehydrogenase I subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18707"
FT                   /db_xref="GOA:D1B8V4"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8V4"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ACZ18707.1"
FT                   /translation="MRLSSPEDLELYREQLLRRVKPQRWVRVCAGTGCLAGGSQGVYEA
FT                   LVEEARRIGLDSPVKFQARCSGCHGFCEEGPLVVCGMGDSEVLYRKVRREDALEILLAL
FT                   ADDRVVERLLYRDGREVYREERHIPFYALQRRKVLERCGKVDPRDVDHYISLGGYASLA
FT                   RALSMSPEEVIDWVTRAGLRGRGGGGFPAGQKWASCRSASGPQKFVLANGDEGDPGAFM
FT                   DRSLMEGDPHSILEGMIIGAHAVGASKGFIYVRDEYPLAVENLAHAIREARRLGLLGRR
FT                   ILGSDLSFDVDICRGGGAFVCGESSALMASIEGRPGEPRVKYIRSTERGLWECPTVLNN
FT                   VETWANVPIIIREGVDGYRSLGTKDSPGTKVFSLVGKVRRSGLVEVPMGTTLREIIFEI
FT                   GGGVMGRNRFKAVQTGGPSGGCLPESKLDLPVDFDRLTREGSMMGSGGMIVMDHRSCMV
FT                   DVARYFVKFLEGESCGKCAPCREGLKAMGEILEDLCSRRGRPGDVEMLLFMGNALTDTA
FT                   LCGLGQTAANPVLSTLRHFMEEYREHQDQGFCRAGVCRGMFVARVEADLCVSCGACAKV
FT                   CPFDAIHRDPSGKFAVDRRCEGCGACLDVCPMGALLPSPRGVRE"
FT   gene            501853..502575
FT                   /locus_tag="Taci_0472"
FT   CDS_pept        501853..502575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0472"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; KEGG: sat:SYN_00151 2Fe-2S
FT                   iron-sulfur cluster binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18708"
FT                   /db_xref="GOA:D1B8V5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8V5"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ACZ18708.1"
FT                   /translation="MKIWVDGRELDVERDVLLYDAMVSAGVEVPALCRHGGLPHEGTCR
FT                   VCMVEVDIRGKRRLVASCMYPARDQGLKVYTSTRRVEVARRFVIGLLLRRNPASPAIRA
FT                   LADRWGAMDTSRLSPVEGKDLCIRCGRCVRACATFGARAISFANRGWDREVCTPLKEPT
FT                   LSCVGCLSCAEVCPTGHITYRESQGERQIWGRTFQLVRCSRCGDPFATREQLELVRDRG
FT                   DVCPRCLREEEGLALRDG"
FT   gene            502632..503108
FT                   /locus_tag="Taci_0473"
FT   CDS_pept        502632..503108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0473"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: aeh:Mlg_1298 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18709"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8V6"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACZ18709.1"
FT                   /translation="MDKVLLVTPERCIGCGSCELACSFNKSGQFKPSVSRVGVHRFEKG
FT                   QNVPMMCFQCDEAPCAKACKPQALHKGTSGLVEFDKDKCIGCRMCVMACPFGNVSYDRS
FT                   AKELVKCDQCGGDPQCVQFCPTKAIEYLPAESAVLNKKRRFAKRISDALEEVKD"
FT   gene            503109..504917
FT                   /locus_tag="Taci_0474"
FT   CDS_pept        503109..504917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0474"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="KEGG: gsu:GSU0910 aldehyde:ferredoxin
FT                   oxidoreductase, tungsten-containing; PFAM: aldehyde
FT                   ferredoxin oxidoreductase; Aldehyde ferredoxin
FT                   oxidoreductase; SMART: Aldehyde ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18710"
FT                   /db_xref="GOA:D1B8V7"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8V7"
FT                   /inference="protein motif:PRIAM:1.2.7.5"
FT                   /protein_id="ACZ18710.1"
FT                   /translation="MKGWIGRVLRVNLSEGTYRSEPLNEEWAREYLGGRGLGTRYYFEE
FT                   VGPSVDPLSEGNNLYFATGPLTGTLAASAGRFNVVAKSPLTGTIGAANSGGYLGPEMKF
FT                   AGWDMIVIEGKAPKPVYVYVNNDQVRIEDASSLWGTETHEATDRLLEMTDPEAKVAVIG
FT                   PAGENLSLIANIINDKHRAPGRGGMGAVMGAKNLKALVVRGTKGVSVADREAFMRAVKV
FT                   AREKLAQHPVTGSGLPLYGTNVLVNILNQNGGLPTRNFREGVFEGADKISGEAQREGRL
FT                   LRNKGCFGCSIGCGRVSFAEGYDHHGEGPEYETSWSFGADCGVDDIDAVAMANYRCNEL
FT                   GLDTISMGSTIACAMELYEMGLITKEMAGLELRFGNKDALVPMVEAAAHKRGKIGELLS
FT                   MGSYRLASHFGHPELSMTSKKQEMPAYDPRAIQGIGLNYATSNRGACHVRGYTISPEIL
FT                   GVPQKLDPQSTEDKPTWDKVFQDLTAAVDSVGMCLFTTFGIGAEEIADQLSAATGIDYS
FT                   VDALMKAGERIWNMERLFNLKEGFTSADDSLPPRMTQEPLPHGPHKGKVSRVPEMLPRY
FT                   YDARGWTSDGVPTEDKIRELGLQWAR"
FT   gene            504925..505191
FT                   /locus_tag="Taci_0475"
FT   CDS_pept        504925..505191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0475"
FT                   /product="MoaD family protein"
FT                   /note="TIGRFAM: MoaD family protein; PFAM: thiamineS
FT                   protein; KEGG: gsu:GSU0908 MoaD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18711"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010038"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8V8"
FT                   /inference="protein motif:TFAM:TIGR01687"
FT                   /protein_id="ACZ18711.1"
FT                   /translation="MKVLFFATIRDLAGRKEDQASAGTVRELLSLLSDRYGPAFRRAVL
FT                   EGGAMSPNVIVLVNGHHVAHLKGEDTPLQEGDQVSIFPVIGGG"
FT   gene            505292..505600
FT                   /locus_tag="Taci_0476"
FT   CDS_pept        505292..505600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18712"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8V9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18712.1"
FT                   /translation="MSLRSFARWLVLASVLWWAPSPSAEGAGWDRYAGGLLSTEGRNVL
FT                   VYQRRSDSFRTVTLPVGTYVLNAGWDNVKLVINCLDPEGHPIRYVYLTPERFHLERR"
FT   sig_peptide     505292..505372
FT                   /locus_tag="Taci_0476"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.605 at
FT                   residue 27"
FT   gene            505809..507113
FT                   /locus_tag="Taci_0477"
FT   CDS_pept        505809..507113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0477"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /note="PFAM: Na+/H+ antiporter NhaC; Citrate transporter;
FT                   KEGG: wsu:WS0129 putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18713"
FT                   /db_xref="GOA:D1B8W0"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="InterPro:IPR032813"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8W0"
FT                   /inference="protein motif:PFAM:PF03553"
FT                   /protein_id="ACZ18713.1"
FT                   /translation="MLTNPVVLSVLVMIVLCLLNLNIILALLISALVAGVSAGMSLGDT
FT                   MGVLIGGMGGNSETALSYVLLGALAVAISQTGVASLLSAKLSKVVGNRKAFLLILIASV
FT                   SCLSQNLIPVHIAFIPILIPPMLALFNRLKMDRRGVACALTFGLKAPYIVLPAGFGLIF
FT                   HGILSDQMAANGVNVAKGDMWNYTWILGVGMVIGLLLAIFVTYARDRVYDDKPVIGMEG
FT                   VHEAQSLTKEHYITLAAVLVAFVIQLKTSSLPLGAIVALGLMAAGGVIRWRKLDDVMAG
FT                   GIGIMGMIAMIMLVAAGYGSVIRETKAVDALVNSLVTLVGGSKFYGVLLMLLVGLLVTM
FT                   GIGTSFGTIPVVAAIYCPLGIKLGLTPGALACVMAAAAALGDAGSPASDSTLGPTSGLN
FT                   ADGQHNHIWDTCVPTFIHFNIPLIIAGLIGAMMLY"
FT   sig_peptide     505809..505940
FT                   /locus_tag="Taci_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.853) with cleavage site probability 0.532 at
FT                   residue 44"
FT   gene            complement(507206..507279)
FT                   /locus_tag="Taci_R0001"
FT                   /note="tRNA-Gln2"
FT   tRNA            complement(507206..507279)
FT                   /locus_tag="Taci_R0001"
FT                   /product="tRNA-Gln"
FT   gene            507429..509147
FT                   /locus_tag="Taci_0478"
FT   CDS_pept        507429..509147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0478"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; RNA-
FT                   metabolising metallo-beta-lactamase; KEGG: gme:Gmet_0366
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18714"
FT                   /db_xref="GOA:D1B8W1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8W1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACZ18714.1"
FT                   /translation="MGKESGGSSPSKPNRRRGKGKPSNRGKELKWIPLGGMGEIGKNIS
FT                   ALQYGDEMIVIDCGLKFPEEDMLGIDLLIPDVSFLEQNRGKIRGIFITHGHEDHIGGLP
FT                   YVLPKLDVPVYATRLTIGLIKNKLAEVCPRYKPVFHEIGAGDTVDLGSFSVRAIAVCHS
FT                   IPDALAYGIRTPAGVVLHTGDFKLDAQPIDGRTTDYGAFAELGREGVLLMLSDSTNVER
FT                   EGFTQSERTVGRTFEQLFRLHKDKRIVIATFASNLHRAQQVFNIAMRYNRKVALVGRSM
FT                   IAYVDLARKLGYVSAPDDLFIPAQEADGMQPNRVVVLTTGSQGEPFSGLVLMSKGEHRQ
FT                   IKLGNRDLVVISATPIPGNEKLVSRTINMLFSCGCEVVYERDQAIHVSGHASREELKMM
FT                   ISLVNPRCFVPVHGEYRHQVRHAQLARDLGVPAKGVFVMSNGDVLSLSQGGKGSVEGRV
FT                   QAGTIMVDGLAVGEFQGSLLKERRELAQDGILTIAVALGPDGSVRGVDMDSRGFLHRQD
FT                   AKDLYGELERAVVKALEAPMGDDAMRTAIRKSAREVLSRYTKGYPAIVPLLVRQG"
FT   gene            509239..510855
FT                   /locus_tag="Taci_0479"
FT   CDS_pept        509239..510855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0479"
FT                   /product="Na/Pi-cotransporter II-related protein"
FT                   /note="TIGRFAM: Na/Pi-cotransporter II-related protein;
FT                   PFAM: Na+/Picotransporter; PhoU family protein; KEGG:
FT                   bha:BH1407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18715"
FT                   /db_xref="GOA:D1B8W2"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8W2"
FT                   /inference="protein motif:TFAM:TIGR00704"
FT                   /protein_id="ACZ18715.1"
FT                   /translation="MKMSLKVLLQLVGGIGMLIYGIKVMGDSLQNLAGDRLRRLIAKLT
FT                   GTPVKGVLVGTAVTTIIQSSSATTVMTVSFVHAGLMTLYQAFGVIMGANIGTTVTAQIM
FT                   AFKITDLAYISVAIGAFVFLLAKNKRQREIGAGLAGFGVLFIGMHMMGDAMSFLKERQD
FT                   LFMPFRYHPLWAVLAGTAVTMVIQSSSATVGLTMAMAAQGFMPLNVAIAFIMGDNIGTT
FT                   ITAVLASLGANRSAKQAATCHVMFNVMGTLILLPFLPWYSEFISHTSSDISRQVANAHT
FT                   LFNVGNTLLFLPFTRPFVNLVRRVVPDDGMVKVYGAAFLDRNLITASPAAALDALKKEM
FT                   VRMARFAKSMLEGCRAAIVNGSDLEAREVLNTEKIVNELTHEIVAYGTLIGQKGLSEDL
FT                   SFILNSCINGVGDIERMGDHATNLVEMYEYMRDHNLKFSDQGIREFEEMFSLVHQAVAM
FT                   SIEALDREDLDLANQVMALEDRVDEMEKRLRARHIDRLNHGKCSPGAGVVFIDILSNLE
FT                   RVGDHAHNLACVVMDLAKVRG"
FT   gene            510861..511670
FT                   /locus_tag="Taci_0480"
FT   CDS_pept        510861..511670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0480"
FT                   /product="Bacitracin resistance protein BacA"
FT                   /note="PFAM: Bacitracin resistance protein BacA; KEGG:
FT                   dol:Dole_1174 bacitracin resistance protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18716"
FT                   /db_xref="GOA:D1B8W3"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8W3"
FT                   /inference="protein motif:PFAM:PF02673"
FT                   /protein_id="ACZ18716.1"
FT                   /translation="MSSTLSLIILGAVQGLAEFLPVSSSGHLALMQIFMGMKGPQMSLD
FT                   LALHVATLLAVFAYFGRDMATLLQQFIRGFRSPEARRSDGWRYGWSILAGTAVTAALGI
FT                   PLKPVVEMASQNSLWVGCGLVITGAVLILSRYVPQRDRRVGLLVGMMVGLAQGLAVMPG
FT                   VSRSGMTIVAGLIMGLAPVEAFRFSFLLSVPAIVGATLLEWLDLEGAFMAYLPQGWVFG
FT                   FATASLLGLASLVVLKRVSLFRAWWVFGAYCAVVGLGVVGFSLLGVY"
FT   gene            511673..511930
FT                   /locus_tag="Taci_0481"
FT   CDS_pept        511673..511930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18717"
FT                   /db_xref="GOA:D1B8W4"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8W4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18717.1"
FT                   /translation="MAKVGALSPRVPGWMLVLLCLMMGTFLGKLLQIFSLSAPLFRDLL
FT                   YFGVDTGRVDLMAFSVGFSFRMDFNLGTFIGGVIGVWIAK"
FT   gene            511915..512520
FT                   /locus_tag="Taci_0482"
FT   CDS_pept        511915..512520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0482"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: psp:PSPPH_4169 Maf-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18718"
FT                   /db_xref="GOA:D1B8W5"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8W5"
FT                   /inference="protein motif:TFAM:TIGR00172"
FT                   /protein_id="ACZ18718.1"
FT                   /translation="MDRKVTLVLASGSPRRRDLLRGVTEDFRVIPSSVDETPLDGETVE
FT                   DMVLRLSLAKARDVFVREPLSWVIGADTAVEVDGRILGKPRDRSEAFEMITALQGREHR
FT                   VLTGVSVVSPHGEESRVERTLVRFRPLTEEEAWAYVDTGEGDDKAGAYAIQGKGSLLVE
FT                   SIEGCYFNVVGLPMVCLSRMLHNLGFPLYLQLGVKAHE"
FT   gene            512513..514402
FT                   /locus_tag="Taci_0483"
FT   CDS_pept        512513..514402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18719"
FT                   /db_xref="GOA:D1B8W6"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8W6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18719.1"
FT                   /translation="MSRPSLSKLSAALMLAALVISALALIPRVRSEMGDRNVGLVCDYR
FT                   DLTSLAREGTLSPGALLRELKGLGLGGILVSELTGKDLLAGLSPVRLSPVRDLPFKFPQ
FT                   GLPQDRAVLFGPAEDRGVQLIARYLEAKFPASSRISSGANLAVVLPLGMSEASDGGLVP
FT                   DVEGLEFARANGLPIIFRPSPCVGVGGSSVAMAVEGLMEAYPIRGILPAGLSVAGYPDL
FT                   EPLGALIRGNGLFLAQTEFVKQVGMSNLVKESFPRVIPIHSVVKDEVFSKNITREQLVE
FT                   RMVRAVHERSVRLLLVRPYDLYPADRLGSFREDLRHLSSSLEARRYHLRFPSPKGDVPR
FT                   SWLGALGAALALLGVWLRLRARFAPHFPRLLGRLGSMGILAALGTLGLLAIPFGGLPMR
FT                   LLGALLGALGASEGALTALEEENPLRGAMRGFAVTAVAGLAIGAMYGFSFYMLRVGVFS
FT                   GVKLTLVVPPAAVLLNDLLKRVYPEGREMLSRPPMWGELLVASGLLLALAFMAIRSDNT
FT                   ALVPQWELTLREWLERALLVRPRTKELIGYPCLFLYGWLSRRGLGGRFGEVLRIGSSLA
FT                   FASALNSFCHLHTPLFLTLLRGLNGLWVGSLLGFAGCLALSLSLPLLKGVDRP"
FT   sig_peptide     512513..512587
FT                   /locus_tag="Taci_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.971 at
FT                   residue 25"
FT   gene            514399..515409
FT                   /locus_tag="Taci_0484"
FT   CDS_pept        514399..515409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0484"
FT                   /product="polysaccharide pyruvyl transferase"
FT                   /note="PFAM: polysaccharide pyruvyl transferase; KEGG:
FT                   bat:BAS0840 CsaB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18720"
FT                   /db_xref="GOA:D1B8W7"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="InterPro:IPR019896"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8W7"
FT                   /inference="protein motif:PFAM:PF04230"
FT                   /protein_id="ACZ18720.1"
FT                   /translation="MRELDVVLCGYYGFGNLGDELLAKALVELLCLSGVDRDRIGVLSA
FT                   SPDQTAGELGVRSEDRWSPRSVFRFLSSSRTLLLGGGGLFQDVTSLKSPLYYWGVTFMA
FT                   RRAGAVPWAFGQSLGPLSSSLGRRLATRSLGACKVRVLRDAPSVKLAQSMGIGAVMMAP
FT                   DPVLALRPNVGERTGAFIGVNVRPTRSVSLKKVAYCIRDLVLKEGLPVVGLALAEEDLL
FT                   ALRDLETFGVRMGDVRLMRSLRDFEAVAGSLRGTVSMRLHGVVLSVASRIPCVAIPYDP
FT                   KVEAFAGQFLVPMSSGDRPMEFGDPVDVSALDEAQGALREAMGLAVSKLGIGGGS"
FT   gene            515406..516239
FT                   /locus_tag="Taci_0485"
FT   CDS_pept        515406..516239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0485"
FT                   /product="Transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="PFAM: Transketolase domain protein; KEGG:
FT                   gsu:GSU2919 transketolase, N-terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18721"
FT                   /db_xref="GOA:D1B8W8"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8W8"
FT                   /inference="protein motif:PRIAM:2.2.1.1"
FT                   /protein_id="ACZ18721.1"
FT                   /translation="MMDPVRSRELGTLAKEVRKDVVRMIGLSKVGCLGVSLALVDLLVF
FT                   LYWELMRVDPADARMAERDRLVLSKWRGSPALYSVLARRGFFSREELWSFGRLGALLQG
FT                   SPDCRRVPGVDAPSGPSGMGLGMAVGLSIALRMDGLPSRVFCLMGDGELRDGLSWEAAF
FT                   SASFHRLDRLVAVINVTDHGGEPWGPADDPESMGRKLATFGWAVSQGDGHDFPSMETAF
FT                   AQVMGANAPKAVILRTLEGGGVPLPRGGDALSRGDVDSVIGQIEYEGRGPLDDRT"
FT   gene            516226..517167
FT                   /locus_tag="Taci_0486"
FT   CDS_pept        516226..517167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0486"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase domain protein; Transketolase
FT                   central region; KEGG: pca:Pcar_2719 transketolase,
FT                   C-terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18722"
FT                   /db_xref="GOA:D1B8W9"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8W9"
FT                   /inference="protein motif:PFAM:PF02780"
FT                   /protein_id="ACZ18722.1"
FT                   /translation="MTGPSPMWHGYEEALCRSALDVPHLVVVDSREGTLGGEFRDRFPH
FT                   RFFVAGTSEQEVVLTAAGLALGGKKVFASWSSPFLVGRSYDLIRSAIAIPALSVVLVSP
FT                   FGWLDRGPSGAHHQLVEDLGLMTAMPGMPVLVPSDGVSARCLIERLARSEGPAYVRLTA
FT                   GNVPGVYQDDDGDFPLGGARFLTRGDGVTICACGIMVHEALKAARVLSSQGIEAEVIDC
FT                   YSVRPLAEQVVLSSVRRTGCCVVAEEHSLHGGLGSAVCQCLSSRYPVPVGMVCADDRFG
FT                   QSGSPEELREFYGLTAGRIVSSAVQVFSMRRR"
FT   gene            517174..517869
FT                   /locus_tag="Taci_0487"
FT   CDS_pept        517174..517869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0487"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bsu:BSU35260 cell-division ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18723"
FT                   /db_xref="GOA:D1B8X0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8X0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ18723.1"
FT                   /translation="MDIRLSGVTKIFHPDITALEDIYLDIPKGEFVYLVGPTGSGKTTL
FT                   MRTITREVLPTRGQVMVGSYSLRKIGRVDLSLFRREVGVVYQDFCLLPHLNVFENVAFV
FT                   LEVLGMPPREVKERADEVLERVNLWRRRFLYPPQLSGGEQQRVAIARAIVNSPSILLAD
FT                   EPTGNLDLHTAEEIMQLLLSINAMGTTILMATHNQYLVDSYRQRVVELKMGRIVRDEKR
FT                   GRYEIDGEL"
FT   gene            517856..518740
FT                   /locus_tag="Taci_0488"
FT   CDS_pept        517856..518740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0488"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   acp:A2cp1_0702 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18724"
FT                   /db_xref="GOA:D1B8X1"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8X1"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACZ18724.1"
FT                   /translation="MGSFRYSVRDGLRLVFRHWGLSFLTLFTSAAVFYLMGASILFVLN
FT                   TRHVVRNLEGELSIQAYMTPRADLEAVAKRIRSMPHVRAVEVITPAKALDRLKARLGSQ
FT                   VQAVTLLGENPLPPSVEVWVDKAASVPVVARELLTVEEVQDVVYAGKLAEKLSKLSRFA
FT                   GRFSLGVLLVAIAASGVVLFNTIRIAVYSKEEEIAIMLMVGATPTFVAMPFIIQGVLLG
FT                   SLGALLSSGMLAMSYKAAIERLKDFLPFLEFLNDPMLLLRLTGVLVAGGAVVSFISSFM
FT                   AVERFIRRALKPL"
FT   gene            518756..519970
FT                   /locus_tag="Taci_0489"
FT   CDS_pept        518756..519970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0489"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: gsu:GSU1773 M23/M37
FT                   peptidase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18725"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8X2"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ACZ18725.1"
FT                   /translation="MSRLGRFHLRLTLSVLCLLALGIPGWCSTSDLDRRLKQEEKRLNQ
FT                   VQGQISYHRKKVQEMEGKERNVISEIESLAQQMAVTEQRISVINLRREKVKERMRQLTE
FT                   EIKHTSSRIDYVKDLLRARLVAIYKYGGVAEFNLLLSAPGAMDALSTSYLLGKIADQDR
FT                   RLITELSDRKARLDMAHRELKEQRALLERQNQELQENKLKLRVATDRRNDLLKRVRSEK
FT                   SLHLAELREYERMEQEINSTITRLMAEKRRRLAEARAKAAKAQGTAPQEVVYYKGGRLA
FT                   WPLVGQIRSSFGVRVHPVFRTRIMHTGLDISGSTGDPVRAAESGEVLYAGWLRGYGQVI
FT                   ILDHGRDLTTVYAHLSKIEVNEGEKVSRGEQIGRVGSTGIATGPHLHFEVRVNGKAVNP
FT                   MGYLK"
FT   sig_peptide     518756..518845
FT                   /locus_tag="Taci_0489"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.915) with cleavage site probability 0.665 at
FT                   residue 30"
FT   gene            520000..521202
FT                   /locus_tag="Taci_0490"
FT   CDS_pept        520000..521202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0490"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: carboxyl-terminal protease; K03797
FT                   carboxyl-terminal processing protease; TIGRFAM:
FT                   carboxyl-terminal protease; PFAM: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; SMART: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18726"
FT                   /db_xref="GOA:D1B8X3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8X3"
FT                   /inference="protein motif:TFAM:TIGR00225"
FT                   /protein_id="ACZ18726.1"
FT                   /translation="MRRLLSFMKRFRDVFLGVAIGALAVTGMMAAVANDGSQPDSLKPP
FT                   FSVRNMAILRQARAIMELYHVDADKLPGEQKLFYGAMKGMVSAAGDPYTRFVDPSQLKE
FT                   ESIEMEGQYGGVGMYVGQRDGKVLVISPMEGTPAHRAGLKPMDEIVKVNDKVVVGMAQD
FT                   EVVNMLRGQAGTKVTVWVRRKGKDEILKFNLVREIIKVKSVRYSLLEEGYAYVRLAHFT
FT                   QTSGQEMREAVSWARSKGAKGMVLDLRNDPGGLLNAAVDVASCFLNDGDLVVSTRGRVE
FT                   RANEAMYASGGVKYPGPLVVLINEGSASASEIVAGALRDHKRAKLVGTKSFGKGSVQTL
FT                   FNLPDGAGMYVTIARYYTPSGKMIDKVGLEPDVKVRGEPNENPKKDVQLKRALEVLKKG
FT                   R"
FT   sig_peptide     520000..520101
FT                   /locus_tag="Taci_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 34"
FT   gene            521207..522184
FT                   /locus_tag="Taci_0491"
FT   CDS_pept        521207..522184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0491"
FT                   /product="protein of unknown function DUF610 YibQ"
FT                   /note="PFAM: protein of unknown function DUF610 YibQ; KEGG:
FT                   ppd:Ppro_2408 protein of unknown function DUF610, YibQ"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18727"
FT                   /db_xref="GOA:D1B8X4"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8X4"
FT                   /inference="protein motif:PFAM:PF04748"
FT                   /protein_id="ACZ18727.1"
FT                   /translation="MRLSRWGLWALVLVALGVGLWSMGIASRSPMPGPLEKMVSADLTG
FT                   EEPPAEAPGTPPEAPPSGEGRVEGTPKGDEPQGHPKAGLKRPPVERPALPGGRGRPWLA
FT                   IVVDDMGYDLSAARRLAALRIPMTWAIIPGAPRASQVAEIARAHGIPYLVHLPMQALSD
FT                   PDGGESVIHVGMDAKDMRARVRRAFDSLPGAVGVNNHRGSAATSDSKTMGDFVKVLAEL
FT                   RPGWFFLDSATSPRSVARKEALRRGIRSLRNGYFIDSVPGREDRALAAAVKGALKSGGA
FT                   VAIGHPRPGTLEALSRLAAGRAELPVRLVALPEAMGDSGGGEAR"
FT   sig_peptide     521207..521275
FT                   /locus_tag="Taci_0491"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.876) with cleavage site probability 0.381 at
FT                   residue 23"
FT   gene            522181..523467
FT                   /locus_tag="Taci_0492"
FT   CDS_pept        522181..523467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0492"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="KEGG: dde:Dde_0176 adenylosuccinate synthetase;
FT                   TIGRFAM: adenylosuccinate synthetase; PFAM:
FT                   adenylosuccinate synthetase; SMART: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18728"
FT                   /db_xref="GOA:D1B8X5"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8X5"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ACZ18728.1"
FT                   /translation="MKRGAEVIIGAQWGDEGKGRVVDAIADRVDLVVRYQGGANAGHTV
FT                   ITGDEKFVFHLLPSGMLYPGKVCVIGGGVVVDPDQLLAELSELREKGRDRARLVVSRNA
FT                   HVVMPYHKMLDVLSERERSASQRIGTTSRGIGPCYVDKFARVGIRIGDLMDEEVLREKL
FT                   TLNLESKNMVLTRIYGEKPLALDELLEKGLQWGRSLSPFVGDAYLEVNNALDQGKGVLF
FT                   EGAQGTLLDVDFGTYPYVTSSSPTSGGACTGTGVGPNRIDRVIGVAKAYCTRVGEGPFP
FT                   TELSDPIGDRLRSVGNEYGATTGRPRRCGWLDLVALKFSVMVNGLDCIALTKMDVLSGL
FT                   EEIKVAVEYQLDGQRISHFPLDHRSLSRVTPVYRTLKGFGEDISACRSFDDLPKAARDY
FT                   VAFIEEYCGVPVALLGVGPAREATIIRGL"
FT   gene            523473..523940
FT                   /locus_tag="Taci_0493"
FT   CDS_pept        523473..523940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0493"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   tbd:Tbd_1724 SSU ribosomal protein S18P alanine
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18729"
FT                   /db_xref="GOA:D1B8X6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8X6"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACZ18729.1"
FT                   /translation="MIIADIRPCQAGHVPELERIDSLCGSPAWGRGPFLHHVASDAGGM
FT                   VLGAFLKGELRGFLAWEMRGEEAWILRLGVHPEFRRLGLASQLICALEVLALSQGCARL
FT                   CLHVRSWNHPARALYLSMGFRSMGVQEGYYSDGEAGELMTASLPLEVLEDL"
FT   gene            complement(523871..524464)
FT                   /locus_tag="Taci_0494"
FT   CDS_pept        complement(523871..524464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18730"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8X7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18730.1"
FT                   /translation="MNTLFSQSFSIQDPAALARRLHVPPSRPQVKMLSRLRFLVRWILG
FT                   PVRLELPGLEGTLGLGLLATAQSQGTEVGGGLVMDLLMGGAVMEALAVPLRSLQLAADL
FT                   RLGENRILIPGEDLPISAQVDLWRSLGGPSIGVGCSPEGQLTPLQSLSALAVRGCGTGA
FT                   HRCGSCPLARCPYRSSRTSRGREAVISSPASPSE"
FT   gene            524570..526237
FT                   /locus_tag="Taci_0495"
FT   CDS_pept        524570..526237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0495"
FT                   /product="Uncharacterized metal-binding protein-like
FT                   protein"
FT                   /note="KEGG: gsu:GSU0608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18731"
FT                   /db_xref="GOA:D1B8X8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR027980"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041414"
FT                   /db_xref="InterPro:IPR042259"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8X8"
FT                   /inference="protein motif:COG:COG3894"
FT                   /protein_id="ACZ18731.1"
FT                   /translation="MIPFDPGASLRDVLASCGLSLGTCGGRGTCGGCQVSVSGHLPPRD
FT                   PREDRLPSGRRFACLTRPLGDVEVRLDEPGGARVVPLELRVEPRALPFQVELDRGSLGD
FT                   FRDIRGAIGGLASKGGLHVREVSLPALRGALELLGMRRSHAMGWVLGGRVVLVAPQGVV
FT                   PVGIAADLGSSNLDLAAVDLVSGVVMGRVRVENLQRRVASDLVSRLALALEGGLEELRS
FT                   LLVRSFQVGLEKLLGVSGVEPRQVVAVYCGCNPVVGDLLAGLPPSGLAESPFIPSDFGV
FT                   RRLCARALGLGLDCPLVILAGMGGFVGSDALALLYGTRDLDRVPCLLMDLGTNGEVVLD
FT                   LGDRVLGASTAAGPAFEGYGISCGVPAGEGAVTAVRGSIGDMELEVQGGGEPMGICGSG
FT                   LISLVSFLLREGLMDGSGKLKGPQFFELRPDPPLRVTQRDLRQFQLAKGAVRAAAELLL
FT                   MEAGLSPHRVVRWVVSGLLGSSVGVDDLVRVGLMPFGVEERVEVEPNGVLVGLARALAS
FT                   GEDGLREVEDLSGMCRVVRLDGARHFNRVLMDSLGYQG"
FT   gene            526261..528972
FT                   /locus_tag="Taci_0496"
FT   CDS_pept        526261..528972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0496"
FT                   /product="processing peptidase"
FT                   /EC_number="3.4.24.64"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   saz:Sama_3596 pseudouridine synthase, Rsu"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18732"
FT                   /db_xref="GOA:D1B8X9"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8X9"
FT                   /inference="protein motif:PRIAM:3.4.24.64"
FT                   /protein_id="ACZ18732.1"
FT                   /translation="MKHAIPLLVMGFLLVSWAPAFGAARVKAEPSIGGVTEYQLGNGLK
FT                   VLLIRDPGASNVTVNVVYRVGSSDERDGQRGLAHLLEHLLFKGTPSHPDIPSEIAARGG
FT                   RANGTTWTDRTCYFQTLPATMENLRWALSLESERMTSARITAEELERERGVVINELVRG
FT                   ENDPVSVLLNRLSSVAFDWHTYGNSTIGNRRDLETVSLDEVLGFYRSFVRPDNGVLVIA
FT                   SPFEDREVLGEVEARFGSIPRPSHPVPRRVSQELGKDGDRFVRLRQPGQFRAVGALYHG
FT                   PAGSSPEAAAFQVLMEVMGLEPSGGLYRELVMKGLAGAVWAGSFLFRDSSMGLVLAQLP
FT                   MDGNPDRAAEVMLSVLEDPSRIDQRDVEQAKQRLMKKMDLKYANPDDLAVELTEWISRG
FT                   DWRLFFAHRRRLEMVSVEDVRRVASRYLVRDNRTWGIFEPSDRRVLISTDGPRDVEPGE
FT                   LSALGGLQEQGEAVGPSPEALEARTSRFRVSGLKGAVINKRTRGGWVYGRLGLNFGNLS
FT                   DLEGRSVIGEVLSRYLGRGAGDLSREEVQREFDRLRASVSFSGSATGVTVDLKVPVENL
FT                   EGVLALVARCLREPRFDEGELRVLKLEMRSEIEDQLDDPSVLAEEELDRAFNPYPVGDV
FT                   RRPVPMAERLRAIDSVRLRDLRDFHRRFFGLVDGELAVVGPVEEGALMGMMSSLFGGWV
FT                   PRATYERVPYPFVAVEGGRRRVEVPGKPNATVAAWAPLRLTQDSPDYPALLVAVNVLGG
FT                   GWLDSRLARRIRHQDGTSYGVRLSLNAFDPDESARLEFWAIAAPGDVERVRESFYDEVR
FT                   RALEGGFTAEEVSRAKAFILEGVKVDRSQDGKLVRRMERDLYLGRDFGWHRRMEEAVGA
FT                   VTSDSALEALRRHLRGPEAFLLVEVGSFEGRP"
FT   sig_peptide     526261..526329
FT                   /locus_tag="Taci_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.774 at
FT                   residue 23"
FT   gene            complement(529035..530417)
FT                   /locus_tag="Taci_0497"
FT   CDS_pept        complement(529035..530417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0497"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; glucose-
FT                   inhibited division protein A; fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein; HI0933 family
FT                   protein; KEGG: sat:SYN_02917 FAD-dependent dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18733"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Y0"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACZ18733.1"
FT                   /translation="MYDVIMVGAGPAGILAARELVKAGKRVAVVDKGRDIGSRHCPLKE
FT                   GKVNRCVQCNPCNVVCGWGGAGAYSDGKLTLTPEFGGNLESYCGREELVRLIGQVDRVY
FT                   VEHGASQELFSPDSNLAMSVMDRARRSGLQVIPATIRHMGTDRSKDILSSIMRELEGGA
FT                   DIILGKAVSEVLVEDGQVLGIRLSDGTELRSRMVMLAPGREGAPWMEEAVRRLGLEIES
FT                   LPVDIGVRVEIPAAWAKEITDQFYEIKAILDTPTFDDKVRTFCMCPNGEVTTEYQTHHG
FT                   ILTVNGHSNRDEDKKTENTNFAILVSTQFTKPFKDPNGYGSHIARLANMLGGTVLVQRL
FT                   GDLKRGRRSTHDRIARGLVRPTLKTAEPGDLSFVLPYRHLKGIMEMIEALDSLMPGING
FT                   NHTLLYGVEVKFYSLKLALSKDLETNIRGLYAAGDGAGVTRGVIQASASGIWAARAMLR
FT                   KL"
FT   gene            530636..531118
FT                   /locus_tag="Taci_0498"
FT   CDS_pept        530636..531118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0498"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: bca:BCE_A0172 transcriptional
FT                   regulator, MarR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18734"
FT                   /db_xref="GOA:D1B8Y1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Y1"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACZ18734.1"
FT                   /translation="MKKDIPGHVDAVRRLRADLRQLLRLLGVLDREEARCCGMSLAQCN
FT                   ALLEVASCPGLSVSDLAERLLLDRSTASRLVDRLVSLGLLKRELSPEDRRRVTLTPSEE
FT                   GWELVGGVERSMDEWFESALTLLSEDERRMVFCGLKLLLKVLDGTSPEGCHVRGPL"
FT   gene            531164..531958
FT                   /locus_tag="Taci_0499"
FT   CDS_pept        531164..531958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0499"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   rpa:RPA3562 arsenite S- adenosylmethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18735"
FT                   /db_xref="GOA:D1B8Y2"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Y2"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACZ18735.1"
FT                   /translation="MGDIRDEVRRKYAEAIAGGCCCASGGCCSGGGPDVITGGNYRPED
FT                   LPPLLRDMDVPTFGCGNPIAIGSLKPGEVVLDLGSGAGLDVMLAALKVGPSGRVYGLDM
FT                   TDEMLARAEENRRRAGLENVIFIKGHMEEIPLPDRSVDVVISNCVVNLSPDKGRVFREA
FT                   FRVLRHGGRLAISDVVLLRPLPEAVLRSVSAWTGCIAGALPVEEAERQVRIAGFEDVDV
FT                   RVVKVYSFSPSEARGLFPHLSDDELPLVDGAAGSALITGRKG"
FT   gene            532299..533723
FT                   /locus_tag="Taci_0500"
FT   CDS_pept        532299..533723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0500"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17 leucyl aminopeptidase domain
FT                   protein; KEGG: scl:sce2580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18736"
FT                   /db_xref="GOA:D1B8Y3"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Y3"
FT                   /inference="protein motif:PRIAM:3.4.11.1"
FT                   /protein_id="ACZ18736.1"
FT                   /translation="MDFVCFSGSTLPDGVKGVLVLVREGEAPAFPGCPAFASALASAET
FT                   LKGKPKDRALGLSPEGLWVAMAGVGGASSVEVMTSVAEGLRSLAAKGCESVAVVSSFMD
FT                   RERSVSVAEGAVLGLYRFDRYKAKDPDERFKLPSRVHVMAGDHQAMAEGAVLGAAQNYA
FT                   RDLANEPGNVITPSELARRALELAERCGCEARVLDEVQMREMGMNAILAVGAGSANPPR
FT                   LIHLVRRVDSPKAKVALVGKGLTFDSGGLNIKPGDSMRTMKGDKSGACTVLGAFLAACE
FT                   LDLPVELHVVVAAVENMPDGGSYRPDDIIRTYSGKTVEVVNTDAEGRLTLADALHYACS
FT                   QGVDHVVDVATLTGACVVALGENTAGLFTPDDLLSSQLEVAFRSCGERVWRLPIDDEQL
FT                   KEELKSPVADMTNCGSRYGGAITAALFLKEFVSDSVKWAHLDIAGVDAVKKTRGVLVEG
FT                   ASGFGVRPLVRWVKGL"
FT   gene            533769..535382
FT                   /locus_tag="Taci_0501"
FT   CDS_pept        533769..535382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0501"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: bsu:BSU29550
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18737"
FT                   /db_xref="GOA:D1B8Y4"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Y4"
FT                   /inference="protein motif:PFAM:PF07969"
FT                   /protein_id="ACZ18737.1"
FT                   /translation="MDRGATIGIINAVVYPLAPPGRATALFARDGIVELVGSDQEVIAR
FT                   CDHRTPLLDLKGAFVFPAFGDTHLHLMEYGRSLSSLDLRMVRSISQLIGLGRRRVEEVG
FT                   SGWIIGWGWDQEMLEEMRFPNRHDLDLISRDLPIFLERACGHVGVLNSAALRALGLMDA
FT                   PAVAGPFVEVDRSGVPTGVVSEEALMWVRSRLPEPSEEELRGYLKEACGALLSRGVTWV
FT                   QSDDLSVFGSFKRMVEFYLGEDKEGRLPLRIDPIFRVSSLGDLEDLEEALRLFQAFKPR
FT                   WCHPGPVKLVLDGTIGARTAALREPYSDAPSEMGFLAFDHRDLRSLMAQADRLGLQVAC
FT                   HAIGDRALEQAVECFEAVGVGSASGLPPRILHCQVGDPDLYSRMAQMGVTADIQPLFLA
FT                   NDWKIILGRLGPHRARNSYAWKDMMERGVAMAGESDAPYGPSDPLEGMRIAVTRMDSHM
FT                   EPEHGWMPHQRLDISEAFWLYTGGAAKVCGRWRRRGSLEVGKAADFVALMEDPFRVDPN
FT                   QVGRIQVGLTVCGGRIRHLV"
FT   gene            535405..536700
FT                   /locus_tag="Taci_0502"
FT   CDS_pept        535405..536700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0502"
FT                   /product="protein of unknown function DUF1063"
FT                   /note="PFAM: protein of unknown function DUF1063; KEGG:
FT                   dvm:DvMF_1488 protein of unknown function DUF1063"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18738"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Y5"
FT                   /inference="protein motif:PFAM:PF06354"
FT                   /protein_id="ACZ18738.1"
FT                   /translation="MVISIKSFLRREVRPALGCTEPGAVALSVARACEELSDREHVAAV
FT                   RVTVSTSIYKNGMAVGIPGANGAKGNALAAALGAIVGRSSYGLEVLKDTTEAHVERARG
FT                   WVDEERVSVVCDPGRSGVYVLSAVFTPTHKAVCLVSGSHDRIAKVMLDGRTVYEAQSEG
FT                   SSQESVEELPSSYDEAFGMVDHLDSEDEDFLLRGVEMNMAVARVGLSGDGRSLGLGRSL
FT                   MEVSAGGDVGLKIRAYCTAAADSRMWGVQMPVMSSAGSGNHGITAILPVAILGEELMAS
FT                   RSQVARALALSHLSTSFIKRRLGRLSPVCGCSVAAGAGAAAGMCLLMGGGLEEVKEAMG
FT                   MVLANLAGMLCDGAKESCALKVGTGSYEAYLAARWAVQGIKMFKPQGVLSDLFEESVEN
FT                   VARVNSEGMRDVDKVMIHIMDRYPLGSRGGEA"
FT   gene            536701..538848
FT                   /locus_tag="Taci_0503"
FT   CDS_pept        536701..538848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0503"
FT                   /product="helicase, RecD/TraA family"
FT                   /EC_number="3.1.11.5"
FT                   /note="KEGG: sfu:Sfum_1909 helicase, RecD/TraA family;
FT                   TIGRFAM: helicase, RecD/TraA family; SMART: AAA ATPase;
FT                   Helix-hairpin-helix DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18739"
FT                   /db_xref="GOA:D1B8Y6"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Y6"
FT                   /inference="protein motif:TFAM:TIGR01448"
FT                   /protein_id="ACZ18739.1"
FT                   /translation="MLQRLEGEVLEVSYRDQVTGYTVASVVVSDGQVVTVVGAFPLPMA
FT                   GERLVMEGRWTVHRRYGRQFCAEDVRMAMPSSLEGLVRYLSSGVIPKVGPSTARRIVEH
FT                   FKEETLDVLDNRVERLLEIPGIGPKRVEEVRLHWEEHRRRRQAVLQLLDFGIGSALADR
FT                   IVRIYGDLAAEVVRSNPYQLAYDVAGIGFVTADRIAQRVGICRDAPERLDAGILFSMRR
FT                   AVEEGHSMLPWDELLQRSRRLLAVDSGVEDRLELLCTLGMLEAEELGGLRCVYLPGLRR
FT                   AEAASAGAVRDMAASSGARLGWELEGMITALEGQFGIRLEEPQRRAVKGALSHRIFVIT
FT                   GGPGTGKTTLLRFTVRLCQMMGLRVLLAAPTGRAAKRMAEVTRVEAYTLHRALEYDPRS
FT                   NRFGRGRSRPLEADVVIVDEFSMVDLPMFHRLLSGIGEDASLVLVGDSNQLPSIGPGSV
FT                   LKDLISSGSVPKVELKEIFRQAQRSLIIRNSYRILEGGTLELPPLSQGLDVAFVEEDDP
FT                   SLAAEAVVDLVGYEIPRCTGLSPWDVQVLTPMHKGEAGARNLCLRLQEVLNPSGERLRR
FT                   GEGGFRRGDKVIQLKNDYDLEIYNGDIGVVEGQVDQGLLVDFEGRRVQIRREAEVNLAL
FT                   AYALTIHKSQGSEYPAVVVPLLDQHFVMLKRNLLYTALTRAKRLAVLVGSRRAIERAVS
FT                   TQEGNARYGALRWRLAKREEA"
FT   gene            538852..540207
FT                   /locus_tag="Taci_0504"
FT   CDS_pept        538852..540207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0504"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oca:OCAR_5226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18740"
FT                   /db_xref="InterPro:IPR025515"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Y7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18740.1"
FT                   /translation="MEPKGKFRVGSVFALLVLCLGLMICGAAQGAEEAGTLSQFAVRFE
FT                   ATYGELAELADSKLPLRIDGRETYSQGPLSGNVRYVVTRKGRPVVRRMGDRVAMDVPLY
FT                   FSVTFSSGVGIPVSANADGELVATVISRPRLTPDWRVATDPEVRIAWRKPPAVNMMGFR
FT                   VSFQPVADRVLNDWVAQRKGRLDVILNEKLNLRRRADELWRALSKPVPIGEGDILWLVA
FT                   RPERFWASPLQVTSKGILMSAGLDARMRVVGGAFPGRPSVAPLPNLSSGAGDGTFRVIL
FT                   PATIHYAFVNSLIAKNWTPRDIRMPDGGVARLERFGMTGRQDRFVLGAQLIGTDSKGSP
FT                   FDSVVNFVGRPSYDVATRTVAIEDLQVESDGALAFLNDSVAPALRDVLRFPIGDQLDQL
FT                   SQGLQGALSGLSYGGARLDFRPTSFGVIGVSADSQGMHAKVQAQGTVTVSLK"
FT   sig_peptide     538852..538944
FT                   /locus_tag="Taci_0504"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 31"
FT   gene            540257..541174
FT                   /locus_tag="Taci_0505"
FT   CDS_pept        540257..541174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0505"
FT                   /product="protein of unknown function DUF62"
FT                   /note="PFAM: protein of unknown function DUF62; KEGG:
FT                   aha:AHA_0746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18741"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Y8"
FT                   /inference="protein motif:PFAM:PF01887"
FT                   /protein_id="ACZ18741.1"
FT                   /translation="MMRLGKGIRGLVLSFLLVALLACAGEAKTALVFQTDFGLKDGAVS
FT                   AMKGVAFGVDQDLPMFDLTHEIPAFSIWDGAYRLYQTLEFWPKGTVFVSVVDPGVGTER
FT                   KPVVVRTKSGHYVVTPDNGTVTLIMDSIGIDQVRTIDETKHRLKGSERSYTFHGRDLFA
FT                   YTGAKLASGKISFEEVGPLLKGQPVRIPYQRAEIKDGAALGTIPVLDVQYGNVWTNIGA
FT                   DLFDSFKPSKGKLYEVRILKEGKEVYRGTVPFADTFGDVPEGKPLLYYNSLMNLSLALN
FT                   MDSFADKHKVSSGPEWSVVVRPVK"
FT   sig_peptide     540257..540331
FT                   /locus_tag="Taci_0505"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.807 at
FT                   residue 25"
FT   gene            complement(541218..542228)
FT                   /locus_tag="Taci_0506"
FT   CDS_pept        complement(541218..542228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0506"
FT                   /product="Homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="PFAM: homoserine dehydrogenase; homoserine
FT                   dehydrogenase NAD-binding; KEGG: rlt:Rleg2_5063 homoserine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18742"
FT                   /db_xref="GOA:D1B8Y9"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Y9"
FT                   /inference="protein motif:PRIAM:1.1.1.3"
FT                   /protein_id="ACZ18742.1"
FT                   /translation="MEQRIALLGCGNVGKALIGILNRKGRHLEGAYGVRMRLVYVGDPR
FT                   VGAAADSQGLDPGAVLEMLDRGALPEAFRGDVSEVVKSMGATVVADATPTDLRTGEPGL
FT                   SNARGALSSGAHFVTTSKGPLAVAARELEEMARERGLKFLYEGAVMSGTPLISLIRNGL
FT                   AGCSISRIEGILNGTTNYMLTRMAQGLSYPEALEEAQDLGYAEADPTADVEGFDPAVKL
FT                   CILAWVAFRREIGVDQVDRTGISGLTGEQVERAARSGRSVKLVASLWTQGESIMAQVKP
FT                   QELEADHPLHGIGGAVNAATIWTDHLGKVTVSGPGAGRDETAQALLTDIISIGRD"
FT   gene            complement(542251..543450)
FT                   /locus_tag="Taci_0507"
FT   CDS_pept        complement(542251..543450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0507"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: dvu:DVU0896 NLP/P60
FT                   family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18743"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR027017"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR039439"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Z0"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ACZ18743.1"
FT                   /translation="MRHMLKLIPLALLLCTLTSPVALGNEVRSNGPAGAFLERYFRPWT
FT                   QEAREENWTGWYQEILNGQHLGSNLRPVDRSTKEAWLNRALSAAAVNLKGISIKEAHLR
FT                   VLPTEEPLFEPPGGPKTSYPFDRLQNGTVHPMEPLSITRRGEGWLLVTTPWASGWVRED
FT                   AVAIVDPPLMTRIMSMPMLAVVRDRTVITYTSGISALEAHIGALIPMGEDGEPMVVRWD
FT                   PSEGTASLVPARAPEGTLKPFPLEPSRELLSQIASSMLGQPYGWGGQNWNRDCSSTTRD
FT                   IFTPFGSWIPRNSRGQGDLPGVDLSNLGRTAKARIIVERGVPFMTILYMRGHVMLYTGS
FT                   QGLNPTVLHNIWSVKRGGQEEVIGRCVVTDLNIGEPPLIDRVIKMVFPWFPPGVCYTSP
FT                   "
FT   sig_peptide     complement(543376..543450)
FT                   /locus_tag="Taci_0507"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 25"
FT   gene            complement(543509..545185)
FT                   /locus_tag="Taci_0508"
FT   CDS_pept        complement(543509..545185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0508"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; DbpA RNA-binding domain protein;
FT                   SMART: DEAD-like helicase ; helicase domain protein; KEGG:
FT                   afw:Anae109_2913 DEAD/DEAH box helicase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18744"
FT                   /db_xref="GOA:D1B8Z1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Z1"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACZ18744.1"
FT                   /translation="MNTNKRFDQYPLRDELLSALRRKGFEHPMPVQVSMLEDPTLVDGD
FT                   LIVQAKTGSGKTLAFALPLLNRMEFGERSPKVLVLSPTRELALQTAREFQWLGYDLRIR
FT                   VASLVGGMDMERQVKALREGAAVVVGTPGRVLDHIRRGTFRADLVESLVLDEGDHMLDL
FT                   GFKDELEDIMAAMTQVERSWLFSATMPEEVVTLAKQYLDAPRKISLVEDAAKHDDIVQR
FT                   AYIIPARRRFEGLANVLLFERPRRGIVFCATKLQTQELAERLCDEGFKASALHGDMTQR
FT                   ERNMALENLRRGRSQILVATDVAARGLDISGVSHVIQFGLPGCLETFIHRSGRTGRAGQ
FT                   EGRNLILLTAREAGEFRGMIRGTSLEVEWLPAPDAEELESLTRAEIERWCLENPAEGED
FT                   YMDWAEEILQREDAQLIVAGLLSRSFEGIPKGYSIQEDVQAEMARSRRADRPKARDQRP
FT                   LRKLVSGSVTMRFSSGREDGWEVGPLLGALCRGLGIRREDVGNIKLKDRCAFVELSPYA
FT                   ASQIERRRDNLAREGLDGFSRSEPRQNHGTQRPRTPSRNRY"
FT   gene            complement(545458..546171)
FT                   /locus_tag="Taci_0509"
FT   CDS_pept        complement(545458..546171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0509"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azo:azo0239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18745"
FT                   /db_xref="GOA:D1B8Z2"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Z2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18745.1"
FT                   /translation="MLCSSCGYNNSSSARFCILCGSPLAAEGVKDPDPKVCPSCGELNE
FT                   GHAMFCASCGADASTAPRRSAIAQEPEDLPIPEADDQGELPEDLGQEATLPEGPKADEP
FT                   SAEEIDRILSGAPQVENFEDGDRLEAPDAAPELDQALTEASSAEAMEEMTPAQEGADAS
FT                   SGPEEVDPRQGSAAGVMDRIKGLLGGLRLPRPSMPNVRSLLPASPTTILIRIAALLALL
FT                   ALGVAIGAGAIFVLR"
FT   gene            546268..547605
FT                   /locus_tag="Taci_0510"
FT   CDS_pept        546268..547605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0510"
FT                   /product="peptidase M18 aminopeptidase I"
FT                   /note="PFAM: peptidase M18 aminopeptidase I; KEGG:
FT                   dvl:Dvul_0481 putative aminopeptidase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18746"
FT                   /db_xref="GOA:D1B8Z3"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Z3"
FT                   /inference="protein motif:PFAM:PF02127"
FT                   /protein_id="ACZ18746.1"
FT                   /translation="MGEDRKDRRGYRSWDFLKGLGEDHLEGALGFMSRCKTEREAVRHL
FT                   ASALAQAGFGQDGQVTQRGTFVNLKGRAIGAYRPGRRPAREGVRIVASHGDSPRIDIKP
FT                   KPLYEDKGLLMGDCHYYGGIKQYQWVNVPLELRGEVHLKDGTAVELDGSQFRLVIPDLA
FT                   PHLDRNMDARKASETIKGEDLDVILGHRPGDSDVKGAVLGLLKDRYGFGEEDLVSADLA
FT                   LVPQGDAFLGGVDGSLLISYGLDDRICTYTSFEAFMGARDLEQGAVFLCLDREEIGSEG
FT                   VGGAQGALIRLLLSYVLEAEGASGPFDLERALAASEAISADVTEAYNPMYKDAFDHNQL
FT                   PVAGDGPAMMKFTGVKGKYDASESRGEFVARVRARLYGASVPWQVGSLGKVGTGGGGTV
FT                   AKYLARYGMDVLDLGPAVISLHAPYEIMSAADVTATVAAYRAFYER"
FT   gene            547694..548491
FT                   /locus_tag="Taci_0511"
FT   CDS_pept        547694..548491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0511"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: glo:Glov_2382
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18747"
FT                   /db_xref="GOA:D1B8Z4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Z4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACZ18747.1"
FT                   /translation="MLILKDVQLHYEVHGSEGPPLLMIAGLASDVSSWQSVLPELSKRF
FT                   RVILVDNRGVGRSKPEDPEISIGLMADDCAALIDHLGYGPVHVLGHSMGGMVAMDLAIR
FT                   HPQKARSLVLAATGDRVSGRNAMLFSDLADRYDRGGDLSDFYRTILYWILSPPFFEDRG
FT                   MVDEAVDYLLAYPYKQSPRSFRGQVEAITSFRGLDLGRIQCPTLVLAGERDLLFPLEEA
FT                   RDLARRLRGAQIRVLAGAAHSVHEERPAEFVAAVEGFIKGVDR"
FT   gene            548488..549072
FT                   /locus_tag="Taci_0512"
FT   CDS_pept        548488..549072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: glo:Glov_3561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18748"
FT                   /db_xref="InterPro:IPR041494"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Z5"
FT                   /inference="similar to AA sequence:KEGG:Glov_3561"
FT                   /protein_id="ACZ18748.1"
FT                   /translation="MNIRKYIYVDYENLPGVQLESIDDAKIFIFLGENQKKIPAETIKR
FT                   IQPMGDRVEWITISGVGRNALDFHIAYYLARNHKDPSACHYIVSMDAGYDPLIRHVATF
FT                   GQRVKRIISLEDIKERPALREDLVPKYGKVKEILRKQDKSRRPKSRKTLASSIETLFQG
FT                   QVSKEDVELMVEHLFRERFMEEKNRRITYLD"
FT   gene            complement(549104..549658)
FT                   /locus_tag="Taci_0513"
FT   CDS_pept        complement(549104..549658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0513"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: atc:AGR_C_1138 lemA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18749"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Z6"
FT                   /inference="protein motif:PFAM:PF04011"
FT                   /protein_id="ACZ18749.1"
FT                   /translation="MVLLIALGVLGVLLLWFLGIYNRFVKLRNMVDEAWSGVDVQLKRR
FT                   WDLVGNLVETVKGYAAHEREIFEEVARLRNQLTSASSVSERAQVENGLTQTLRTLFAVA
FT                   EAYPQLRASENFTELQRTLGELENDIQLARRYYNGTVRDYNIMVDAFPSLLVARMMGYG
FT                   KRDFFQLEDPAERSAPRVSFS"
FT   gene            complement(549697..551616)
FT                   /locus_tag="Taci_0514"
FT   CDS_pept        complement(549697..551616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0514"
FT                   /product="membrane-like protein"
FT                   /note="KEGG: swi:Swit_4521 membrane-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18750"
FT                   /db_xref="GOA:D1B8Z7"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Z7"
FT                   /inference="similar to AA sequence:KEGG:Swit_4521"
FT                   /protein_id="ACZ18750.1"
FT                   /translation="MRRSFGAMILGLALAAVLGFGSMAVASEAILSFGSLVRISEKGEL
FT                   TVTETIVVRAEGNLIRRGIYRDFPTTYRDREGRTVRVPFKVERVFRDGKPEAWHTEGVS
FT                   NGVRVYIGSKDVILPPGRYRYDVTYRTARQVGFFDRHDEIYWNVTGNGWALPIASAACR
FT                   IYLPKGGHFTKLDAFTGPMGSTGRDAKFKIDDDGSALFWTTKPLGPYEGLTVAAAFPKG
FT                   IVRNVPPKVLGLTARLWRALSYALGALAVGFLFITWYRVGRDPERGTVIPRFYPPEGLS
FT                   PPMARALIRMGFDHKCLACAIVDAAVKGFVTIDRAGRNYLITLKAEDMRSLPRELAVVL
FT                   ANLFTMGTKEISLVQGEHQRLRNALTALKGLAEDQLEGTYYRSNTLPWLGGVLLSLLSV
FT                   GAIMASALDVQEGLGLFMGLWLTGWTVGIMVLGMNVIGAWRGFRSYRSFRSFFKALFLT
FT                   LFFLPFLAGELFGIYILQSVLGPVPTGQIILLGTLCGVFKGLMKAPTREGRRLMDELEG
FT                   FKMFLAITEKDRLDRLNPPEMSLQTFESYLPYAMALDVENRWSERFSQMAQEAASRGEV
FT                   SHAYVPLWYHGNLMDLGRDFGESLSSGLASSIASASTPPGSSSGFGGGGSSGGGGGGGG
FT                   GGGW"
FT   sig_peptide     complement(551536..551616)
FT                   /locus_tag="Taci_0514"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.928 at
FT                   residue 27"
FT   gene            551745..552518
FT                   /locus_tag="Taci_0515"
FT   CDS_pept        551745..552518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0515"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; SMART: regulatory
FT                   protein LacI; KEGG: mmr:Mmar10_0276 LacI family
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18751"
FT                   /db_xref="GOA:D1B8Z8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Z8"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ACZ18751.1"
FT                   /translation="MATMKDVAALAGVDKGTVSRVLNGDPRISAATAERVWEAVRALNY
FT                   RPDKVASGLSRGTSGLVALVLANASAWWVGPLLEGMARSLGLKGRGILVLGQGWFRSIP
FT                   EELASRRVDGAVWMGPVEGEVEVSFPLVCWGLDVGPHSVGFSLDRLQGSILEAVGPFRY
FT                   VGYGWSPFSQLEGAADPSASAAVVDLASGPFPPGQVLGGDVVLCGPPPGVRGRLWVPFS
FT                   PMEVGTALGRTLLLASRASARPLRVRLEARLEAQG"
FT   gene            complement(552528..553895)
FT                   /locus_tag="Taci_0516"
FT   CDS_pept        complement(552528..553895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0516"
FT                   /product="H(+)-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /note="PFAM: H+transporting two-sector ATPase alpha/beta
FT                   subunit central region; H+transporting two-sector ATPase
FT                   alpha/beta subunit domain protein; KEGG: noc:Noc_2082
FT                   V-type ATP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18752"
FT                   /db_xref="GOA:D1B8Z9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1B8Z9"
FT                   /inference="protein motif:PRIAM:3.6.3.14"
FT                   /protein_id="ACZ18752.1"
FT                   /translation="MATAEFKGLNRITGPFIFMDPVPGVGYGELVEVTGADGSTRRGRV
FT                   VLVSQKAITVQVFEGTQDLVPSSTSVRFLKRPLEMPLSRQVLGRTFNGIGEPIDGCGPV
FT                   YGGKRVSVNGLPLNPVARRYPRNFIHTGISAIDTLTTLIRGQKLPIFSGNGLPHNRLAV
FT                   QIATQSRIVGDESFAVCFAGIGIKHDDAAFFMRELSQRGRNANMVTFLNLADDPVIERI
FT                   ATPRMALTTAEYLAFELGMHVLVIITDMTNYCEALRELGVAAGEVPSRKGYPSYLYSDL
FT                   ASLYERAGVLKDRPGSVTQLPILTMPNDDITHPIPDLTGFITEGQIVLSRELNSKGIYP
FT                   PIDVLTSLSRLMKDGIGKGYTREDHPNLASQLFASYSRVQDVRALASVVGEEELSPADK
FT                   QSLTFGTAFEERFLRQGQEEDRDISESLDIGWEILKLLPRSELTRVTLTEINQRMK"
FT   gene            complement(553902..555686)
FT                   /locus_tag="Taci_0517"
FT   CDS_pept        complement(553902..555686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0517"
FT                   /product="H(+)-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /note="PFAM: H+transporting two-sector ATPase alpha/beta
FT                   subunit central region; H+transporting two-sector ATPase
FT                   alpha/beta subunit domain protein; KEGG: noc:Noc_2083
FT                   V-type ATP synthase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18753"
FT                   /db_xref="GOA:D1B900"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D1B900"
FT                   /inference="protein motif:PRIAM:3.6.3.14"
FT                   /protein_id="ACZ18753.1"
FT                   /translation="MSELKMGFVTMVNGPVIRGSSMGSFGMREMVHIGSLGLLGEVIRL
FT                   EDDEALIQVYDDTQGLKVGEPIRGTGRSLSITLGPGLIGGFFDGIGRPLERLMESQGIY
FT                   ITPGAQVEQLDLDARWDVTVTARRGQMVSPGTVVAEVQETPLMVHRIMVPPGVEGEVVE
FT                   VQPSGSLRTRDWVVKVADGSGRVTPVHLAQSWPVRMPRPYRERLLPNEPLVTGQRVIDG
FT                   LFPIAKGGTAAIPGGFGTGKTVTQHQLAKWSEAQVVVYIGCGERGNEMTDVLEEFPVLE
FT                   DPRSGRPLMERTILIANTSNMPVAAREASIYTGITIAEYFRDMGYHVALMADSTSRWAE
FT                   ALREISGRLEEIPAEEGFPAYLPSRLAEFYERAGRVITLGGETGSVTIIGAVSPPGGDF
FT                   TEPVTRHTKRYIRCFWGLDKSLANARHFPAISWLDSYSEYAREVEDWFAAQVDPRWKDL
FT                   RTRASQILAEDNKIQQIIRLVGEDVLPDEQKLVAFTAFLIKNGYLQQSAFGPDAYSPPS
FT                   KGFAILDRIIYFHDRCEGLIKKGVPLSLIKGHESVEAMAHLRELPADDIRAFDDHKRRL
FT                   DAHIERVARERTAASTGR"
FT   gene            complement(555699..556310)
FT                   /locus_tag="Taci_0518"
FT   CDS_pept        complement(555699..556310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: noc:Noc_2084 H+-transporting two-sector
FT                   ATPase, E subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18754"
FT                   /db_xref="GOA:D1B901"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="InterPro:IPR038495"
FT                   /db_xref="UniProtKB/TrEMBL:D1B901"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18754.1"
FT                   /translation="MTTGDDKLSALKELLLDQAEAQRHRILQEAREELQGWLREQEDRL
FT                   AKEEEMILDDARRRAEEVRLRQVINAEREDSLETLRYQNRLISEALAMLREELVKLRER
FT                   DDYPMILAGLAMEGIESAGMEGAYLIRLSANDSSLGDQVAWLVKTNMPDARVSFDPEPA
FT                   PILGGLWLASQDGRREVRLDWQARAQELSEKLAERLLQLL"
FT   gene            complement(556307..556606)
FT                   /locus_tag="Taci_0519"
FT   CDS_pept        complement(556307..556606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0519"
FT                   /product="Vacuolar H+transporting two-sector ATPase F
FT                   subunit"
FT                   /note="PFAM: Vacuolar H+transporting two-sector ATPase F
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18755"
FT                   /db_xref="GOA:D1B902"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/TrEMBL:D1B902"
FT                   /inference="protein motif:PFAM:PF01990"
FT                   /protein_id="ACZ18755.1"
FT                   /translation="MSDNHDSLVAMRLAGIEGVVVHGREATEEAIDRVIREMRDVGILL
FT                   VTELAAKAAPEKVRQLRQSGELPLLVEIPDRHGTRRGEDFLTRYVQEAIGVNMG"
FT   gene            complement(556623..557042)
FT                   /locus_tag="Taci_0520"
FT   CDS_pept        complement(556623..557042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0520"
FT                   /product="H+transporting two-sector ATPase C subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase C subunit;
FT                   KEGG: noc:Noc_2086 H+-transporting two-sector ATPase, C
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18756"
FT                   /db_xref="GOA:D1B903"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:D1B903"
FT                   /inference="protein motif:PFAM:PF00137"
FT                   /protein_id="ACZ18756.1"
FT                   /translation="MIGLMITVSAPVGLVLVGLALIRRVPRNPRGVLRAAVGVSALLVL
FT                   TGAALALMEGGAMASSGAAAGPGTQSGLGFIGASLSTGLACLGAGLAVSGVGAAALGLV
FT                   GEKPQMLGTTLIYLGLAEGIAIYGVIVSLLIMGKM"
FT   gene            complement(557078..559009)
FT                   /locus_tag="Taci_0521"
FT   CDS_pept        complement(557078..559009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0521"
FT                   /product="V-type ATPase 116 kDa subunit"
FT                   /note="PFAM: V-type ATPase 116 kDa subunit; KEGG:
FT                   noc:Noc_2087 V-type ATPase, 116 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18757"
FT                   /db_xref="GOA:D1B904"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:D1B904"
FT                   /inference="protein motif:PFAM:PF01496"
FT                   /protein_id="ACZ18757.1"
FT                   /translation="MAVMRMLALTIVGPKEEMELVAREMVLSGGFQPMPLDYLISDGSI
FT                   RAKVTTRRDNPYDELLTGLSSLWSAAGEEMPEPFPVTVDQSLSLDRLREEVERVTSTVR
FT                   VWRDRLEALEDRLEHMEASLILASALEEAGRSVDDVTGTRFLRVVMGSASNENFKRLLD
FT                   SIEESPIIAREIRSQGGRTWAMVMTFPEYEGNMRKLLNSIYFKEYPPLPLGVDQLEEQI
FT                   SKVRRAMEALKGASRRRLSENRDYYERLFSRVYTMQRIYDLCQGRGEISGLFVLSGWIP
FT                   EDTFQDVKDRVQALAPRSIFSVQDMPMRGDAHWAPTMLRNSRLVRAFQDVVALYSVPSY
FT                   GEIDPSLAVAITFCLFFGFMFGDVGHGLMLMAGTWLMRRRGIMRRSFATVLYYAGASSI
FT                   IFGFLYGSAFGVEGLLPSLWLSPMHDMDRLIGTAVTVGMLMVTTGMVFNMVTQYRRGDF
FT                   GRLLFDGGGLAGLVFYWVAATVLYASFRGVALPVPSWVISLGLTGLVAVMVLRDVLARV
FT                   LLKSKTSHQEPLYLQAFEALHGIMSFLSNTASFVRLAAFALNHVGLSLAVMMLSDMVKD
FT                   LPGGLFFRGLILVAGNLLIVGLEGLIVFIQTLRLEYYEFFSKFYRGGGRTFKPIGWDNP
FT                   RVRIGGGL"
FT   gene            complement(559000..560091)
FT                   /locus_tag="Taci_0522"
FT   CDS_pept        complement(559000..560091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0522"
FT                   /product="H+transporting two-sector ATPase C (AC39)
FT                   subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase C (AC39)
FT                   subunit; KEGG: noc:Noc_2088 H+-transporting two-sector
FT                   ATPase, C (AC39) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18758"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR035067"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/TrEMBL:D1B905"
FT                   /inference="protein motif:PFAM:PF01992"
FT                   /protein_id="ACZ18758.1"
FT                   /translation="MRLASKGESISCGVKARVMLSNLLGDQDLWEVLNADGVDDIAQRL
FT                   SHHEGYRDHLSKLPMGEVHRQDLESALKHIPLSETGDFIGRLTGPRRDLLVHWGWRKDG
FT                   DNIKSVLRRILWGRRDPSPGVERMFQVPLSRVRLEVLVSASTFQEVLEALKGTCYHQPL
FT                   RQPLQRLQEGEVRDLFNAEMALDLTTEGNLYKALGRLDRDDRRHIGPLLGERWDLFNLY
FT                   TIYRGRFILSMGAEEIMGQLLPHRHRLQLGFLRALAKAERPSSFAEELQRTPYGHVFNP
FT                   KVMGDDMGLERNLKRHLFIKAAGILRRTPPSFGSVFCYIYIRELEVEDLITAIEDVRYD
FT                   YDRRSAALYLSRPLIARGDSLWQ"
FT   gene            complement(560088..560432)
FT                   /locus_tag="Taci_0523"
FT   CDS_pept        complement(560088..560432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0523"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="KEGG: mca:MCA0008 ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18759"
FT                   /db_xref="UniProtKB/TrEMBL:D1B906"
FT                   /inference="similar to AA sequence:KEGG:MCA0008"
FT                   /protein_id="ACZ18759.1"
FT                   /translation="MISLEETLAVLLGADGEARRIVQEARDEAESMIARGQEEFMRQRD
FT                   MRISAAKQRAAALIDNAQRAAQAEAEEILNNGRARRERMRKAFEENGRRVASAIALEEA
FT                   EALLSGRRGA"
FT   gene            complement(560429..561055)
FT                   /locus_tag="Taci_0524"
FT   CDS_pept        complement(560429..561055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0524"
FT                   /product="V-type ATPase, D subunit"
FT                   /note="TIGRFAM: V-type ATPase, D subunit; PFAM:
FT                   H+transporting two-sector ATPase D subunit; KEGG:
FT                   noc:Noc_2081 H+-transporting two-sector ATPase, D subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18760"
FT                   /db_xref="GOA:D1B907"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:D1B907"
FT                   /inference="protein motif:TFAM:TIGR00309"
FT                   /protein_id="ACZ18760.1"
FT                   /translation="MSSKMAPTRGNLSKVLRVLDLAKKGHDLLERKRQVLMMELMRHME
FT                   AAKQVQAEMKALFEEAYDSLKRANVSLGIDTVEELANSVPIADQITIRLRSIMGVDIPE
FT                   VDPIDETPSPSYSLIGTSCAMDRAYVNARRVLALVARLAEVENSVYRLAVQIKKTHRRV
FT                   NALKKVIIPYNREAARFISDALEEMDREDFVRMKAAKEGQGGERR"
FT   gene            561195..562205
FT                   /locus_tag="Taci_0525"
FT   CDS_pept        561195..562205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0525"
FT                   /product="Nicotinate-nucleotide-dimethylbenzimidazolephosp
FT                   horibosyltransferase"
FT                   /note="PFAM: Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase; KEGG: abu:Abu_2184 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18761"
FT                   /db_xref="GOA:D1B908"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:D1B908"
FT                   /inference="protein motif:PFAM:PF02277"
FT                   /protein_id="ACZ18761.1"
FT                   /translation="MFFLFIGASDLCKIPGLSAAGANPEVIPFTAAADADVVYFGRPRV
FT                   VDAVPVDPQGHPTPALITRACLELAGFPFVTVRCGSYLPPACPHLDLGCAPAQDPTQGP
FT                   AVRDAVDIFERAAELGRSMGGLDTYVLGESVPGGTTTALLVLRALGVEGMVSSAGPVNP
FT                   ISLKEDLWRRASTRAGAFLGSLKGDPLRAVMELGDPMQAAVAGFVSGLPSTSRVVLAGG
FT                   TQMLAVAAVLRALGHRGHLTVATTKYVAMDPSCAFLPMADRIGVEAYWAPLDFSGAPRG
FT                   LADYERGFVKEGVGAGGAVWYAVHRGVSVEAVCRRVEGIYAEMMGLEVEGEVEPR"
FT   gene            562192..563166
FT                   /locus_tag="Taci_0526"
FT   CDS_pept        562192..563166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0526"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   dps:DP0215 Fe(III) ABC-transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18762"
FT                   /db_xref="GOA:D1B909"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D1B909"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACZ18762.1"
FT                   /translation="MNPVRMRCLVLSLCLVVLALLGLLAGAAVGDWSMSWGELADAILS
FT                   GPSSELGGSYVVWNLRLPRTLCAFLAGASLSCAGVLFQGVLRNQLAEPYTLGVASGGAF
FT                   GAAMSIALGLGASGGAMVGAVGSLGLVMLLGRGGSASEMIMAGVVVSSLLSSGLALIKA
FT                   LVGEKVSAIVIWLMGSFSGAGWSSTAICLLGASASLAAVLLLSKELDIFASGADPTSLG
FT                   VNERAVRTVALSAASICAALVVGQFGIIGFLGLVSPHGARLILGPANLPVGIVSFLGGG
FT                   VLLMWSDLICRLLGELPVGVLTSLMGGPVFILLVWRGSRAAGP"
FT   sig_peptide     562192..562284
FT                   /locus_tag="Taci_0526"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.489 at
FT                   residue 31"
FT   gene            563150..563908
FT                   /locus_tag="Taci_0527"
FT   CDS_pept        563150..563908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0527"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ade:Adeh_3466 ABC cobalamin/Fe3+-siderophores
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18763"
FT                   /db_xref="GOA:D1B910"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1B910"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ18763.1"
FT                   /translation="MPLVLDNVTVRLGGRAVVDGVSVEVGEGITGIIGPNGSGKSSLMR
FT                   ALGGMVPFEGRISLDGVSLMDRNRRDWFKLVSLMPQSVRFDQPFTVRQAVLMGLYPLLG
FT                   PFKPYGRREEAMADRVIREVGLEDLADRRVWDLSGGEAARVALARSMARDPRLLLLDEP
FT                   TAALDPRHAMEVMDLLDRGWRGRYGLVVLHDVNLAMSWCSRVLVMRGGRVIASMDRGRP
FT                   DLKALREAYQVEFVRLQGPRGTVAVMPVRS"
FT   gene            complement(563889..565046)
FT                   /locus_tag="Taci_0528"
FT   CDS_pept        complement(563889..565046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0528"
FT                   /product="tRNA pseudouridine synthase D TruD"
FT                   /note="PFAM: tRNA pseudouridine synthase D TruD; KEGG:
FT                   afw:Anae109_1378 tRNA pseudouridine synthase D TruD"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18764"
FT                   /db_xref="GOA:D1B911"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:D1B911"
FT                   /inference="protein motif:PFAM:PF01142"
FT                   /protein_id="ACZ18764.1"
FT                   /translation="MTYALKSVPEDFQVTELLVPGFLSSRGPIRVYSLWKRDLGTQEAL
FT                   EALARANRIPVHRIRAAGRKDRRAVTEQFVTCDLSTELRPPQDARLRLTPVGFSREHVS
FT                   PSHILGNRFSITVREVEDPEAVRARLASLPREGFPNYFDDQRFRSVPTSGEMFAERLVK
FT                   GHLNGALRLLLTEAPWEGAPEHSERMSQLRGAWGDFDRCLSLASTPLERRILESLAQDS
FT                   SKRGLKGALRLIPRDTLSMLFSAYQSFLWNCTASLLIHQACPDGTWVPLRAGRVFMPSR
FT                   RPQGHPLKVPTPSYKMPPMDENVERAMDQVLAERGVKRSDFNLRFIRSVHFGSFERPTW
FT                   VTPGDLRAGPMVEHRPGRFKVELEFTLPRGSYATMLIRHLMTGPA"
FT   gene            complement(565043..566806)
FT                   /locus_tag="Taci_0529"
FT   CDS_pept        complement(565043..566806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0529"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; nucleoside recognition
FT                   domain protein; Miro domain protein; Ferrous iron transport
FT                   B domain protein; KEGG: gme:Gmet_2444 ferrous iron
FT                   transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18765"
FT                   /db_xref="GOA:D1B912"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:D1B912"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ACZ18765.1"
FT                   /translation="MSCHRELKEGAPEGPARRLLLIGNPNVGKSAIFSRLTGLNAVSSN
FT                   YPGTTVGFLEGTVVCDGEAYRLIDVPGAYTLNATNEAEEIARRIVDEGAHRAIIVLDAT
FT                   ALERNLVLALEVLERGIPSIVALNMVDEARHKGINIDVGALEAALGVPVVPTVAVTGQG
FT                   IRDLLSRLNEAARSPIEPSSKEDRWRRIGAIVTSVQRVEHRHHTWLDTLEDMSVSPLAG
FT                   GILGILILGLCFYLVRLVGEGLISYVFDPAFELLRGPLEALAHTLGEGPIRDVLIGKLF
FT                   NGAIDFELSFGLLTTGLYVEFAMVLPYIIAFYGVLSLLEDVGYLPRLAVLFDALLHRMG
FT                   VHGYAVIPTLLGLGCNVPGILATRVLESKRERFIASTLISVAVPCTSLQAMIVGALGDS
FT                   PWHMGTVYLALLASWVIIGRILHKTLPGFSPELIVEIPPYRLPSPSALWVKMRLRVMDF
FT                   ILEATPLVLGGILLVNLMEAIGVMDLLSRLLGPGLGTLMDLPAGAAGPIVMGLFRKDVA
FT                   VGMLMPLNLTLNQMTVAVTVLAMTFPCIATFIVLLRELGPRDTARALAIMGASAVAMGT
FT                   AMNLILRALPL"
FT   gene            complement(566803..567060)
FT                   /locus_tag="Taci_0530"
FT   CDS_pept        complement(566803..567060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0530"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: ank:AnaeK_3366 FeoA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18766"
FT                   /db_xref="GOA:D1B913"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D1B913"
FT                   /inference="protein motif:PFAM:PF04023"
FT                   /protein_id="ACZ18766.1"
FT                   /translation="MDVSLLRVKDGGWCVIRRMPSGEAALRLEALGLRPGKRIQKISGM
FT                   PFHGPVTVCVDGRQVAIGHGVAARISVDTNLQGGSEEVCL"
FT   gene            complement(567150..567512)
FT                   /locus_tag="Taci_0531"
FT   CDS_pept        complement(567150..567512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0531"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: bha:BH2444 two-component response
FT                   regulator involved in modulation of flagellar"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18767"
FT                   /db_xref="GOA:D1B914"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D1B914"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACZ18767.1"
FT                   /translation="MARIMIADDAEFMRLVLRKMLEKGGHEVVGEADNGRDAVYLYTML
FT                   HPDLVTLDITMPFLSGLDAAQRIKENHPDARILMVSAMGTRESVERANSIGVKGFIVKP
FT                   FQEEQVLTAIDKALEG"
FT   gene            567657..568748
FT                   /locus_tag="Taci_0532"
FT   CDS_pept        567657..568748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0532"
FT                   /product="GTP-binding protein YchF"
FT                   /note="TIGRFAM: GTP-binding protein YchF; PFAM: Protein of
FT                   unknown function DUF933; GTP- binding protein HSR1-related;
FT                   KEGG: bsu:BSU40920 translation-associated GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18768"
FT                   /db_xref="GOA:D1B915"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="UniProtKB/TrEMBL:D1B915"
FT                   /inference="protein motif:TFAM:TIGR00092"
FT                   /protein_id="ACZ18768.1"
FT                   /translation="MLHCGIIGLPLSGKTTIFNVITRAGAEVKPYAGGKTDPNRAVVPV
FT                   PDRRFDALAEHHNPKKRTPAQVEFVDLAGLSRDASKGAGLGNSFLSFVAEADALLHVVR
FT                   GFSNPSVEHPEGSVDALRDYKIINLELVYRDLGVIENRLSRLGAKKKLTPEEQVERELL
FT                   ERCQESLLSEVPIGKMGLSADELRLLRGFAFLSAKPQMVVLNLDETQRGPQDVKGGAEL
FT                   AEELGSEVPLVCAYGQLEMDLLDLSPEEAQEFTRDLNISEPGRERIISGAYSLLGLISF
FT                   FTCGPDEVRAWTLKDGASAVDAAGAIHSDLARGFIKAQVVSYEDYASHGFSITACREAG
FT                   CLRLEGKDYRVKDGDVIEIRFNV"
FT   gene            568785..569786
FT                   /locus_tag="Taci_0533"
FT   CDS_pept        568785..569786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0533"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18769"
FT                   /db_xref="GOA:D1B916"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1B916"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ACZ18769.1"
FT                   /translation="MRLTDPVCIKGFKLPNRLVASPVASATASVEGGPTEATFRRVEAI
FT                   LSSRAGLVVMEHHAVHPWGRVRRSQMMLHSDQMVPLHRPLAEMIREAGSVPLVQLNHGG
FT                   SAIAEADLMDLPDFRCVAPSAVPHPAKDGRVVPREMTPEEISELPSLFAAAFERGHQAG
FT                   YCGVQVHACHGYLLGQFLSPITNRRTDRYGGDLRNRARVLLEVVEALAERAGDSILAVR
FT                   LGVADFFPGDDPRGLTPEESCWVARELAALGVDLIGVSGNLCGPDAPQGFDPYSKLIME
FT                   AVGDRCLVECTGMVRSAERAQTMLSSRVCHLVGVARPLLSDPSSLAGWVVGS"
FT   gene            569783..570556
FT                   /locus_tag="Taci_0534"
FT   CDS_pept        569783..570556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0534"
FT                   /product="D-aminopeptidase-like protein"
FT                   /note="KEGG: mrd:Mrad2831_3239 peptidase M55 D-
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18770"
FT                   /db_xref="GOA:D1B917"
FT                   /db_xref="InterPro:IPR007035"
FT                   /db_xref="InterPro:IPR027476"
FT                   /db_xref="InterPro:IPR036177"
FT                   /db_xref="UniProtKB/TrEMBL:D1B917"
FT                   /inference="protein motif:COG:COG2362"
FT                   /protein_id="ACZ18770.1"
FT                   /translation="MRLLVSVRPEGFPVWDVRSPDLVVGSYVEPLCEMLSYGDHQVMVH
FT                   DPFDLIDDRSLLGRCSVVRSRVPLISLLHVLAQCDGAMLLGYPAMWGAEKGALPREGMG
FT                   KVSALWVNGRRVGPLGLDAMSCSFLGVPVMMVAGDDFLCHEAEALFEGPRPVTCEIKSS
FT                   LGADSFVALAGGAGALMDGAKMSLLGVADGTLPSVGGLEGDVLVRISLSSPSLADAVSL
FT                   IPSSRRTGPMDVSFTAQDPFEMRRFVATALSLIGG"
FT   gene            570561..571451
FT                   /locus_tag="Taci_0535"
FT   CDS_pept        570561..571451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0535"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: gbm:Gbem_1326 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18771"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D1B918"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACZ18771.1"
FT                   /translation="MECSLRIAVDVGGHTVTVGLVDAGSFQVLGHVSHPTPEGGSVAPL
FT                   ARLIRREASRLCGDAGVSIPDQVRMAVPGMLSRERDRILKAPNVPGLDGVWLRQVRSAL
FT                   EGEMGGPVRVLWENDANCYALGEWARGVARGMGDLVLFTLGTGIGCGIILGGRLLIGSR
FT                   GMAGEAGHLVVRDGGRCGCGGVGHLEAHSGTGAVEALGGGDFRSLWEEFRAGVSRTEVE
FT                   SFLDGLARGMASVFHLLDPQAVVLGGGASRAEGLLEELLPRMGAYLAEPFRGSVRVLIS
FT                   QLGDLAPLIGAAALG"
FT   gene            complement(571453..572337)
FT                   /locus_tag="Taci_0536"
FT   CDS_pept        complement(571453..572337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0536"
FT                   /product="protein of unknown function DUF161"
FT                   /note="PFAM: protein of unknown function DUF161; KEGG:
FT                   bcr:BCAH187_A0253 YitT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18772"
FT                   /db_xref="GOA:D1B919"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:D1B919"
FT                   /inference="protein motif:PFAM:PF02588"
FT                   /protein_id="ACZ18772.1"
FT                   /translation="MSNVKWQGLRLTAVIKQELRAIGTITIGCIIITLGIMGLTVPYKL
FT                   PDSGLTGLAVLGKYAFGLSPAWVVGLGNVALLIWSWRELSPRFVILTTYGVALLTVLLK
FT                   LAESLPHPVIDDTMLVAILAGVIKGIGGGIVFRCGASLGGTDIIVMVLRKRLGVEVGKY
FT                   SFYINLVILALSALVVGIEGALFGLVSVYANGVVTDNVLSSFDRRRLVFVVSREHKTIS
FT                   RFIIEEMNRGVTELLGKGGYSGEDRPTLMCLLTPKQAMDLKRFVAQVDPKAFMVISEAS
FT                   EVLGRGFKAWKSL"
FT   gene            572472..572909
FT                   /locus_tag="Taci_0537"
FT   CDS_pept        572472..572909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18773"
FT                   /db_xref="UniProtKB/TrEMBL:D1B920"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18773.1"
FT                   /translation="MAMPMQISLEEVLSMLLARVDSLAINDENNKTKFNIVLRVLYKKG
FT                   IVTDQDILDSVREEHRMLKELGLINGDPPEDMVKAMAEGILQWVKGDVEALKRSLKEYE
FT                   RKLQEYAAQEAKKPSIAVASSNVLQQLDKMGGPKGGGKLII"
FT   gene            complement(572969..573448)
FT                   /locus_tag="Taci_0538"
FT   CDS_pept        complement(572969..573448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0538"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: gur:Gura_3645 UspA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18774"
FT                   /db_xref="GOA:D1B921"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D1B921"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACZ18774.1"
FT                   /translation="MDFTEGVINMPKKMLVAVDLSKLGESVVRYGVSLSKRLDIEATFL
FT                   HVIPYIWRGYEPWLPPEINQEVQEIAQKKLSYYLKKAQEQGGYQELPPHKVEILFGEPG
FT                   EQIIEYAKKESMDLIVLGYKGHSALENIIVGSTASKVARYAPCSVLIYRPGHEPI"
FT   gene            573494..574216
FT                   /locus_tag="Taci_0539"
FT   CDS_pept        573494..574216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0539"
FT                   /product="2-phosphosulfolactate phosphatase"
FT                   /EC_number="3.1.3.71"
FT                   /note="PFAM: 2-phosphosulfolactate phosphatase; KEGG:
FT                   cbs:COXBURSA331_A1552 2-phosphosulfolactate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18775"
FT                   /db_xref="GOA:D1B922"
FT                   /db_xref="InterPro:IPR005238"
FT                   /db_xref="InterPro:IPR036702"
FT                   /db_xref="UniProtKB/TrEMBL:D1B922"
FT                   /inference="protein motif:PRIAM:3.1.3.71"
FT                   /protein_id="ACZ18775.1"
FT                   /translation="MRVELFPVPSRVEGIFEGCFVVDMLRATTQISVLLEMGCREIRLV
FT                   SRVEDARALRGALGDTWALLGERGGVPPEGFDGGNSPWEVLSAGEAPLRVVMCTTNGTG
FT                   ALVRALEVGARAYPFCMRNLSAAALRVLSHRGSVAVVCAGHEGESSYEDLVCAGGLLDR
FT                   VIRLDPLVELSDRARGALELYRSVAGDVRGAILEGSSHARYLVELGFGADLDVACLVDA
FT                   TEVVCPAEAAEWGGVIRR"
FT   gene            complement(574259..574960)
FT                   /locus_tag="Taci_0540"
FT   CDS_pept        complement(574259..574960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0540"
FT                   /product="protein of unknown function DUF500"
FT                   /note="PFAM: protein of unknown function DUF500; KEGG:
FT                   pca:Pcar_3108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18776"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:D1B923"
FT                   /inference="protein motif:PFAM:PF04366"
FT                   /protein_id="ACZ18776.1"
FT                   /translation="MRSTKPRSTIKLLLAAIICLMAITLPCQSWASTEGRIRDCARAVR
FT                   EMSRERDSDTMRDLLRSSHGVAIFPSVVKAGLGIGGKYGEGILLRHDPHTDRWYGPSFV
FT                   NVAGLSWGLQIGVQSTALVLVINNRPGIEAFEGDKITLGADVAVAAGPVGRRAEAGTDS
FT                   SLKASIYSYSMSKGLFAGLSLEGAVISTEHDTNRAYWGRKMSVQEILSHRASGSKMAPL
FT                   LKVLREVSRPR"
FT   sig_peptide     complement(574865..574960)
FT                   /locus_tag="Taci_0540"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.914 at
FT                   residue 32"
FT   gene            complement(574995..576284)
FT                   /locus_tag="Taci_0541"
FT   CDS_pept        complement(574995..576284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0541"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate adenylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: vpa:VP1023
FT                   glucose-1-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18777"
FT                   /db_xref="GOA:D1B924"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1B924"
FT                   /inference="protein motif:TFAM:TIGR02091"
FT                   /protein_id="ACZ18777.1"
FT                   /translation="MIFGKYGRVLGIVLAGGKGERLMPLTRYRAKPAVPFAAKYRIIDF
FT                   ALSNMVNSGLFSIYCLVQFKSQSLNEHIEQGWQFGNALRGRDYFITAVPAQMWTGERWY
FT                   QGTADAVYQNLHLITLFDADRVCIFAADHIYKMDIEQMLQFHVDTKADVTIAANTVPSS
FT                   EAHAFGCMDTDPSGRVVSFVEKPKNPPEIPGKPGFSYVSMGNYIFERHVLEEAIIEDSS
FT                   MESSSHDFGKDILPRIYSRCRVMAYDFKSNVLPGIDRPYWKDVGTIKAYHEAHMDLLQH
FT                   PSDLTLYNPLWPIRTVSYSDPPGFTYPDKGQGCSVVGTLRAEGSRVLGAIVHRSVLSRN
FT                   CVINAGAVLEECIVGQGVVIGENCKLRRVILDAYNVIPPNTVIGYNHDVDRERYHVDPE
FT                   SGVVVLGMPKIQLRRTLGLPQDGDDPLSAL"
FT   gene            complement(576329..577801)
FT                   /locus_tag="Taci_0542"
FT   CDS_pept        complement(576329..577801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0542"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /EC_number="2.4.1.21"
FT                   /note="KEGG: afw:Anae109_0139 glycogen/starch synthase,
FT                   ADP-glucose type; TIGRFAM: glycogen/starch synthase,
FT                   ADP-glucose type; PFAM: Starch synthase catalytic domain
FT                   protein; glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18778"
FT                   /db_xref="GOA:D1B925"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:D1B925"
FT                   /inference="protein motif:TFAM:TIGR02095"
FT                   /protein_id="ACZ18778.1"
FT                   /translation="MAEAIKKPRILHVTPEMSPLVKMGGLGDVVGSLPRALNELGCDCR
FT                   VLIPNFKGLMDRANQMGLKVTRCKARIHVALNWRVYSAGLLRTEVGGVKTYILDQPELF
FT                   GDLEVYPKALTCETAMPFVFLGAAGLEIGDATGWRPQVLHLHDWPASTAASLLKWHRHY
FT                   HRCSGSYETVLTIHNLAHQGIVSPAGMDGWGFNKNSFSIDGMEFYGHVNLLKGAIMASD
FT                   YVTTVSPRYSWDIQTKEGGMGLDGVLYAHRDKLKGILNGVDYSVWNPATDRVIAANYTV
FT                   QDISGKWTCREDLFKMAGWEDRGEVLVCFVGRLVEQKGIDLILGAMDRLMLEPVKLLIL
FT                   GSGHPLFQERVLSEARKHPDRIWASTAFDEELSHRIYAGSDLLLMPSLFEPCGLSQLIA
FT                   MAYGTIPVARATGGIADTVIDADGAQDGTGFLFIDYSPEEMMRALRRAIGAVTDINRRL
FT                   NIMRNCMTSDFSWKSSASSYREIYMDLMGRLA"
FT   gene            complement(577803..579539)
FT                   /locus_tag="Taci_0543"
FT   CDS_pept        complement(577803..579539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0543"
FT                   /product="alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: pca:Pcar_1731 glucan phosphorylase; TIGRFAM:
FT                   alpha-glucan phosphorylase; PFAM: glycosyl transferase
FT                   family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18779"
FT                   /db_xref="GOA:D1B926"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011834"
FT                   /db_xref="UniProtKB/TrEMBL:D1B926"
FT                   /inference="protein motif:TFAM:TIGR02094"
FT                   /protein_id="ACZ18779.1"
FT                   /translation="MTIMTYGDNIGNSMLKTLEHDPVFRSVAYFSMEIAIRPEIPTYSG
FT                   GLGVLAGDIIKSAADLGVPMAAVTLLYRKGYFIQHVDQEGYQRESPVEWKPEEYLTLLP
FT                   NEISVMLEGRPVKVRAWVYDYVGQSGYPLPIYFLDTDFESNAPADRNLTWHLYGGDQRY
FT                   RLCQELILGVGGLRMLRDLGYRNIKTFHLNEGHAGFITLELLREQGYEDYDKIRDKVIF
FT                   TTHTPVPAGHDHFSYELIDKVMDPVFVHHIKRMMGPEGVSMTELGLRYSRYTNAVSIKH
FT                   AEVSRNMFNSANIDAVTNGVHSTTWTCPGFAKLYDRYIAGWRNDPSRLIQALQLPDEEV
FT                   WKAHQAAKMKLLARVLEETGRELDADVLTIGFARRAAAYKRADLLFSDVKRLIDVCSGQ
FT                   VQFIFAGKAHPHDEPGKAMIKRIHQMAKEIGSAVPIVFLENYDMSLASLLTSGVDLWLN
FT                   NPRRPREASGTSGMKCTHNGVMNFSVLDGWWIEGWVEDVTGWSIGPDPEEAELVEYDEM
FT                   QDAMDLYNKLEDKVIPTYYQHREKWIWMMKHAIALNASYFNTHRVVKEYCEKAYGVVFR
FT                   GL"
FT   gene            complement(579576..581948)
FT                   /locus_tag="Taci_0544"
FT   CDS_pept        complement(579576..581948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0544"
FT                   /product="glycoside hydrolase family 57"
FT                   /note="PFAM: glycoside hydrolase family 57; KEGG:
FT                   aba:Acid345_4705 glycoside hydrolase, family 57"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18780"
FT                   /db_xref="GOA:D1B927"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR021923"
FT                   /db_xref="UniProtKB/TrEMBL:D1B927"
FT                   /inference="protein motif:PFAM:PF03065"
FT                   /protein_id="ACZ18780.1"
FT                   /translation="MRGICVHAHFYQPPREDPWLEEVLLDPTAAPSHDWNSRITDECYR
FT                   PNRAARLVDPSGKIVHVVNNYLHMSFNIGPTLHRWIFRKDPILEYHICEADRTSERSLG
FT                   CGNAMAQCYNHMIMPLANHRDRRTQVIWGIQDFKARFGRAPLGMWLPETAVNLATLEEL
FT                   ARNGIQFTILAPHQCAAVRPMGDGAWMGTPGGIGLDVTRPYRQHLPSGRHLDVIFYHGG
FT                   TSQAIAFGGLLDNGDRFAHHLMDLLPRDDEPRLIAIATDGETYGHHHRFGEMALARAFQ
FT                   LISERREVFITNPAAFLRAHPPTWECQVAENTSWSCAHGIERWRSDCGCHTGGQVGWHQ
FT                   RWRGPLREALDHLRDRIDQVYEDRIRDLMDPWELRDLFAKALLDVRDERHSPLRKRQEF
FT                   LREVLPGLSPERGVEVLSLLEAQRMRMFMYTSCGWFFNDVAGIETRQILSYAERALELT
FT                   REATGVDPSGDFYSILKTAEGNQRDLPNALEVLEKTVFPRRRSLKDMAASSLLAKRSGS
FT                   FYSTFCSTRLRQESSGGITLKVGEVTVTDQRTGTTWSGSGAVISTGGLDDRCWLSPSQV
FT                   DQAKLIKDFIRQDIIAFSDTLRRQFPIGPLGPEVLPEDERAELGVMRAREVEDGYFETA
FT                   RDILEDNRRLISQLGDLGLPLPPLISASADLVMRRQIEELSKGADPIMLVGPSSPLGRI
FT                   LEEASDMGLKPRLDILAPSVASALHDLVRSVRTGNSEEDRLRDVIEALRRCRELKIPIN
FT                   PWRLQNEVWRKLESSEERPGPGWIELARELGFAMPGD"
FT   gene            582055..582612
FT                   /locus_tag="Taci_0545"
FT   CDS_pept        582055..582612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0545"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   afw:Anae109_4457 multi-sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18781"
FT                   /db_xref="GOA:D1B928"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1B928"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACZ18781.1"
FT                   /translation="MLDDLSHHFLDIAENGVNAGARTVELGLHADSGLDVLRIRVRDDG
FT                   RGMSPEVVSRAVDPFYTTRTTRRVGLGLPFLKQSAELCDGAFRIDSKVGEGTLTEASFR
FT                   LSHIDRPPIGDLGSTMMVLLSGHPEVRWRLEVDVDGRIFTFDSREVLEVLEDPELFKTP
FT                   DVCLWVRDTVRQGVEEVLGGLI"
FT   gene            582662..582843
FT                   /locus_tag="Taci_R0002"
FT   ncRNA           582662..582843
FT                   /locus_tag="Taci_R0002"
FT                   /product="6S RNA"
FT                   /note="6S / SsrS RNA as predicted by Rfam (RF00013), score4
FT                   4.24"
FT                   /ncRNA_class="other"
FT   gene            582895..583854
FT                   /locus_tag="Taci_0546"
FT   CDS_pept        582895..583854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0546"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: vha:VIBHAR_05409 phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18782"
FT                   /db_xref="GOA:D1B929"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D1B929"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ACZ18782.1"
FT                   /translation="MMIDPPFWHPAHCSAFIFDWDGVLVDGPLDFSPLRDRYFGGRRVM
FT                   LLEEAERMEEPLRSRFLADLEDLEVSGASSCVPVDGALDLIAHLESRGIPWAVVSRNCR
FT                   RAMEAASLAARVPLPEVTLSRDDFHPPKPDPAPLLHAARLLGTQPHECAFVGDFVYDLL
FT                   GGRRARMRSILVNRLEEKWLPLADLSLPTLRDLLAVLGDPTPLVPWEYSSLARSVGEEE
FT                   LKRRFVTVALVEARPGFWEDAFLAASLGCGGFVTLDLEVDASMWALSPSMPVGALGRPL
FT                   GEVLGAALRETFPLVRVLDDWPDPVPVTDLLVRWTHGG"
FT   gene            583844..585109
FT                   /locus_tag="Taci_0547"
FT   CDS_pept        583844..585109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0547"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; magnesium
FT                   chelatase ChlI subunit; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   gsu:GSU2067 recombination factor protein RarA"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18783"
FT                   /db_xref="GOA:D1B930"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:D1B930"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ACZ18783.1"
FT                   /translation="MEDRPSLMTPLPERMRPRSLDEYVGQEHLLGEGGPLRLLISSNSL
FT                   RSCILYGPPGVGKTTLVRLMATTTGRELLEINAVTSKLSDLRALADRAASLTSMGFEPP
FT                   IAFVDEIYHFNSQQQNVLLPFVESGQMVLVGTTTENPWFEVNKTLLSRMLVYELKPLED
FT                   RHVIQVLVRALEDFDRGLGRLGLSVTDDALAALAASSQGDLRQALVRLETVASAVAASG
FT                   GRVMGEEQVAAFAGRAFKRYDRKADQHYGVISAFIKSVRGSDPDAAVYWLARMLESGED
FT                   PRFIARRICILAAEEVGLADPMALVVAQAAASAFDRVGLPEGDMILAEAALYIAAAPKS
FT                   NRVYRAIRDAREAVAKGDVLEVPEHLLPGSPNYRYPHDSPSGWVPSSYLPEPRRFYRPS
FT                   DRGGELKIRDRLRRLWRRFSEG"
FT   gene            585127..586839
FT                   /locus_tag="Taci_0548"
FT   CDS_pept        585127..586839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0548"
FT                   /product="response regulator receiver and Hpt phospho
FT                   transfer protein"
FT                   /note="PFAM: response regulator receiver; Hpt domain
FT                   protein; SMART: response regulator receiver; KEGG:
FT                   asa:ASA_3480 hybrid sensory histidine kinase BarA"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18784"
FT                   /db_xref="GOA:D1B931"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:D1B931"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACZ18784.1"
FT                   /translation="MDNSMLKSLMHSVKTAISERDLIRAFLEGMCEIMGSTASAVWFND
FT                   GEDQAFFFNDGVVKSLRDFGSDEAHRLWLYLKSIESPSDAPAVRDGSNPLCFPGWSCLD
FT                   RGALAPFRGRDLSGWLGVFGRDDNYTSSDLMAMWLLGDVFSLSMEVLKGRSRLGEIEQW
FT                   GHYLRTPLWTMSLALEDLKESYSPQSASLAFGAARVLASQIDTFLCEIELESQRFGSMI
FT                   PLSEALESLGSLGQGWNRMEGREFELEVQGDDPGRYLIKYGALQALMGALNMYYVDRMA
FT                   RKVSVGLAIEEGSAMVMVEAWSLSQGATDSLRRVVEYLAERYLEGVKFFSSVGAEGVEM
FT                   SIKVQPVRSPGISTLDRPPKVLVVDDSLVSRKSLSMMLEKMGVQVFSAADGLEALEVAM
FT                   REDPDLVFMDLLMPRMGGVEAASKLREMGFGKPILALTAGGESDLVGALEAGMDETLFK
FT                   PISANLLMDVISQWTGWNPEGRGDDQITARAREDFLEEVDQLASLLVGAIDRGDLEEAA
FT                   KLAHRIKGDSALGGFMELSQMMGQLEGDIRTGADLSRHRDYLASDLRSRLMTR"
FT   gene            complement(586797..587585)
FT                   /locus_tag="Taci_0549"
FT   CDS_pept        complement(586797..587585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0549"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   afr:AFE_2571 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18785"
FT                   /db_xref="GOA:D1B932"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:D1B932"
FT                   /inference="protein motif:PFAM:PF02698"
FT                   /protein_id="ACZ18785.1"
FT                   /translation="MSTLFFLYKLAGALAVPPGIFVLACLLMALCCLRQPRRWGLLLAC
FT                   LATGIAIYSASCDWSARLITGPLEDMYESHPLPTDDGVIVLLGGGVRYDRDLKPYQLGN
FT                   YTSVRVLKALQLHRDTGWPIVCCGGNPRLDPDPEASEANLMAQTLMDMGATQVYREGRS
FT                   RTTWENLVNALPILRRLNRRNVVIVTSSFHMPRAIMTARAVLKGFDVYPHQAGRLTDRS
FT                   PMDPISFLPLSMSETCLGLREWVGMGAYRVMSLLRRSDAR"
FT   gene            complement(587616..588497)
FT                   /locus_tag="Taci_0550"
FT   CDS_pept        complement(587616..588497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0550"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: gbm:Gbem_3934 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18786"
FT                   /db_xref="GOA:D1B933"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D1B933"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACZ18786.1"
FT                   /translation="MGTLVGMGLALSAAAVWAMAPVLYRRGIEKVSYTGLGALRCLGYI
FT                   VSAALYALLTGGTSVLTPPSLSLLGVIWSSSIAWLVVGDLCYFGALHKLGVSIGVPVTS
FT                   SFPIVALVMSHVFIGEPLGPSIVLSVLLTLGGLFLLNKAQGTDSPRELRMGLLLALATM
FT                   VCWSVGVVTNKVLIGRMDVAKLELWRSIGVTLGSVAVFLLKNPREVLDLRELSYRDVLE
FT                   MAVAGAMGLTIGNLLFSYSLRHISVALATCLACARPFLAALFATVVLREPLTLRKTLGI
FT                   ALVVGGVTVMSL"
FT   sig_peptide     complement(588441..588497)
FT                   /locus_tag="Taci_0550"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.992 at
FT                   residue 19"
FT   gene            complement(588501..589160)
FT                   /locus_tag="Taci_0551"
FT   CDS_pept        complement(588501..589160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0551"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   rme:Rmet_5040 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18787"
FT                   /db_xref="GOA:D1B934"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1B934"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACZ18787.1"
FT                   /translation="MKDHPLSPARNRDLRQIVYDKIKDAIVNGLIPPGEKLSEFDLSQQ
FT                   LEVSRTPIREAIRQLAQTGLVKLVPRKGAFVALPTPKEAEDLYEIRVALEGLALEKICP
FT                   SPPREELLRYRDMFLSVGPGWTSQQYLERDREFHSFISVQSGNGFLETVLHNVNDLIQL
FT                   CRHYSVEGVPLKRSSEEHVALIDAILEGNVEMAKERLRRHLKNAVASLTGYIMSKG"
FT   gene            complement(589261..589773)
FT                   /locus_tag="Taci_0552"
FT   CDS_pept        complement(589261..589773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0552"
FT                   /product="ATP/cobalamin adenosyltransferase"
FT                   /note="TIGRFAM: ATP/cobalamin adenosyltransferase; PFAM:
FT                   cobalamin adenosyltransferase; KEGG: kpn:KPN_03215
FT                   propanediol utilization: B12 related"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18788"
FT                   /db_xref="GOA:D1B935"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:D1B935"
FT                   /inference="protein motif:TFAM:TIGR00636"
FT                   /protein_id="ACZ18788.1"
FT                   /translation="MPDLIITTKGGDRGETSLCNGQRVPKDHPLVELYGTVDECQAHVG
FT                   MARATCPFDEVAQWLLKLEENMSYAMGSLAKCDDLPEPDTALLEEIVDKVTSEHRGPFR
FT                   FVRPGDSVSGAALHVARTVARRAERVAVGLYRRGEITEAQYVYLNRLSDAIYALSLWVD
FT                   GLCRERC"
FT   gene            complement(589784..590257)
FT                   /locus_tag="Taci_0553"
FT   CDS_pept        complement(589784..590257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18789"
FT                   /db_xref="InterPro:IPR021219"
FT                   /db_xref="UniProtKB/TrEMBL:D1B936"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ18789.1"
FT                   /translation="MGYKHLKILNGGMGMASIVVAHYGIGDGDCGCFKRTRENLLHVLE
FT                   RMAPKFAALGIEISAEHREMEDSTENRTMHNLITLESPGEMDETSLESLLGLEVEMLPC
FT                   DDGGSCRAIVMEGAKEGAKFQEVPTGLIMDGLIRASMKLLGGHHQCGSCGCCH"
FT   gene            complement(590247..591320)
FT                   /locus_tag="Taci_0554"
FT   CDS_pept        complement(590247..591320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0554"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   bha:BH1589 aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18790"
FT                   /db_xref="GOA:D1B937"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1B937"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACZ18790.1"
FT                   /translation="MIHGGLVRWLHLDPKEVLDFSSNVNPFGPPKGAVKAAREALSYTH
FT                   IYPDREQARLRRAFARWLGIDESAVCFGNGASDVMGAAIMAFRPGRIVTFSPTFGEYRQ
FT                   WGERLRVPTREIPLVAPNFAPSLGDLESTLSHGDLLVICQPNNPTGRVWTQEEMEQVLE
FT                   LCSRQGAILMVDECFVNLTWPPAPSAIEHLPRGNLLILRAFTKDFSAPGLRIGAALGHP
FT                   DAVARIRHCLQPWPINCAGEAFATWCCENPEPFISDSRHRLAKERKYMMRNLRRLGFQP
FT                   VEGDSNFILTRCPVPAWALAKELLKRRILIRTCRSFGLGDDHARLAVKDRRSNRALFNA
FT                   LEDALRALMDKDLEYGI"
FT   gene            complement(591317..592252)
FT                   /locus_tag="Taci_0555"
FT   CDS_pept        complement(591317..592252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0555"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   cobalamin biosynthesis protein CbiB; KEGG: glo:Glov_3553
FT                   cobalamin biosynthesis protein CobD"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18791"
FT                   /db_xref="GOA:D1B938"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:D1B938"
FT                   /inference="protein motif:TFAM:TIGR00380"
FT                   /protein_id="ACZ18791.1"
FT                   /translation="MLPLTLALAVAMDLAVGDPQWRFHPVRLVGMLAERVESACRSLPV
FT                   NPKVQGGIFLAVTLLAAVLPLMVFLEILQVLRLGWLGGAITIYFCLGGKSLATEVTRVL
FT                   SHLRSRDLDGAAEGLKFIVSRDVEGMDQGYLVRSAIETLAENFSDAVTSTLLYGALGGP
FT                   VLAWIHRVVNTLDAMVGYRDERYSDFGSASARLDDLLNFLPSRMSALVVAAAGQIMGGN
FT                   FKDAWEGAKEDAPKDESPNSGWPISAFAHALGVTLGGQTSYSGQWSLNPIMGKGPSPEV
FT                   EHLERAISIYWVSYMISALVSLGIGGLMSL"
FT   gene            complement(592847..592932)
FT                   /locus_tag="Taci_R0003"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(592847..592932)
FT                   /locus_tag="Taci_R0003"
FT                   /product="tRNA-Leu"
FT   gene            complement(593184..595256)
FT                   /locus_tag="Taci_0556"
FT   CDS_pept        complement(593184..595256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0556"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   SMART: chemotaxis sensory transducer; KEGG: bcy:Bcer98_1516
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18792"
FT                   /db_xref="GOA:D1B939"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D1B939"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACZ18792.1"
FT                   /translation="MRDLSIAKKLTLLGIGVTVLLGLMVAMVALQSHSILNDQVNTLGM
FT                   EMIANNANQVDQYFSQLKTLTLGIASGTAELLETGQAVTDDDLESVMARYFKASAKELN
FT                   VLEMYVGLESTGKVGTGGDWVEKPDYDARKRPWYIQAVQEDKVILTAPYVDANTGGLVI
FT                   TVATPVKSTSGKLLGVAGIDVDLKTLSDMITSYKVFGKGYGFLLDREGNMICHPKSEMI
FT                   MKENITKPSGLITPELAEAGRKMISGSPGFVDYSFQGELRRTFFSPTRSGFVLGVVFPA
FT                   SDLNAMVRSLAIRQLLLGLVTLILVGAMLYGLSRSVVAPVKRITDSLKKLGQLDLTQDQ
FT                   NDQWLREVGHHRTEIGLMAQSALVLKETLRQAISDIASQSDRTAAAAENLAALSEESVA
FT                   SVEEIKASVDQVASLMESNSASLQETNAGIEEVSSGAQQAANSATDGAEAASKMSHLSE
FT                   QTVRQVEEVVKAITHVGDESKRTFERIQKVADSVASISGFVATIRSIADQTNLLALNAA
FT                   IEAARAGEAGRGFAVVAEEVRKLAEESAQAAKEVEDLIAPLQANTEESLRATEQSQRSM
FT                   DDTVRRAHEAQGKLAEVLGQIRVINDAMQNIAATSEEQAAAAQEIAQGIDNATQGTINV
FT                   VNSVEMIRHSSEETAKASEAVAQEAQALSHTAEQLKALIAKFRYQSSQLHLKDGR"
FT   sig_peptide     complement(595170..595256)
FT                   /locus_tag="Taci_0556"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.344 at
FT                   residue 29"
FT   gene            complement(595455..596789)
FT                   /locus_tag="Taci_0557"
FT   CDS_pept        complement(595455..596789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0557"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: gur:Gura_0712 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18793"
FT                   /db_xref="GOA:D1B940"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1B940"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACZ18793.1"
FT                   /translation="MGRYLRYASLAGFLGFMTYVAYRHQVVGGGPSGVPPVDALCPFGG
FT                   LESLYSYLKHGTFLRRVAMSSLLLFGTVAASTLLLGRTFCGWICPLGALGEAAGALGRR
FT                   LGFKVDQRRIPHTARHVKLLILGVVLAGSWATGTLVFRPYDPWVAWAHLGGGLDEIAAN
FT                   PWGFAVLALLVILAGMGISRFFCRYLCPLGGGLWILQKLSLTRVERHPDRCVNCGACDR
FT                   ACPMGITVSTAGRLSNGDCISCGECVESCPAKGALDFRALGRKLSPLAVGIIGLGLFLG
FT                   AYGVAKVSGGWRTFSPTSLEAKADPAEGIFGWMTVEEAASKVALPVEEFMNAAGISPDS
FT                   PRDVPLKRMEGVDDEAVKAKVGAYLKARETSRDAKAPNPEEIKGSQTLAEVAEIYRLKP
FT                   EEILETAGWPVEMAKEAENPLKEMAARVGSEVSAIRAAVRKLKSR"
FT   gene            complement(596932..597819)
FT                   /locus_tag="Taci_0558"
FT   CDS_pept        complement(596932..597819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0558"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: psb:Psyr_2155
FT                   carbohydrate kinase, PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18794"
FT                   /db_xref="GOA:D1B941"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D1B941"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACZ18794.1"
FT                   /translation="MARITVVGSLNLDMVMRAERLPMRGETLTGGVFSTAEGGKGGNQA
FT                   VACARMGASVRMVGKVGNDPFGDRLVESLLREGIHAMVGRSGGHTGVAQVTVFGDDNAI
FT                   IVAPGANLDLKPWDLQEDHFKDATSAVFQLEIPVDTVSRGLRMARDMGCLTFLNPSPLK
FT                   PLPDEVIGLVDYLVLNQVELTQLGGTDDPDLSMGRLLGLGVKGVVLTMGSRGARFLSVE
FT                   SSGSVEASRVEVVDSTGAGDAFMGAFAVMISEGHSMEEAVRFGVTAGSLACLKAGAQPS
FT                   MPTREEVEGAMGRL"
FT   gene            597964..598977
FT                   /locus_tag="Taci_0559"
FT   CDS_pept        597964..598977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0559"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: aav:Aave_4199
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18795"
FT                   /db_xref="GOA:D1B942"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D1B942"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACZ18795.1"
FT                   /translation="MVTMKDVALLAGVSVSTVSHVLNGTRNVAPETRDRVMRAVDALGY
FT                   RPNMMARGLRRKGIFLLGLVVPDATNPYFAEVARAVEDRCYERGFSLMVASSGGIPERE
FT                   ARAVEAMGLHRVGGIIMVGLGFPEEQARILSGLEIPVVMVDRKIGDLPVDSIQSDNVGG
FT                   GRMAARHLLDLGHRRIGCVTGPMGLGPSEDRLRGFMEEIEEARVDRSWVSVIHGDFGCE
FT                   SGYRAARGMLSRPDRPTAIFAMNDLMALGVMGAARDAGLSVPSDLSVVGFDGISMGRFF
FT                   VPSLTTVAQPIASMGHGAVDRIVDRMMGDVEGEIMARILPCSLIQRGSSAPLGCGG"
FT   sig_peptide     597964..598029
FT                   /locus_tag="Taci_0559"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.780) with cleavage site probability 0.630 at
FT                   residue 22"
FT   gene            599097..600137
FT                   /locus_tag="Taci_0560"
FT   CDS_pept        599097..600137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0560"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG:
FT                   dds:Ddes_1947 basic membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18796"
FT                   /db_xref="GOA:D1B943"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D1B943"
FT                   /inference="protein motif:PFAM:PF02608"
FT                   /protein_id="ACZ18796.1"
FT                   /translation="MSLKRKLICALMVACLALVMALPAMAANKPMKVALILSGFLGDKS
FT                   FNDSAHQGLLRAKKDFGIDLKVLESKNPADWEANLLSMASAKYDLIVGSSTQIAELIKK
FT                   HAASFPDVKFGVIDGAVKAPNVMSIIFAQNEGSFLAGAAAAMFTTKTNIPGVNDKKIIG
FT                   WVGGMDIPVLQDFLTGYKQGAKYIDPSVKVLVSFAGSFSDPLKGKELAMAQFEQGADIV
FT                   MNVASTTGNGILEAAKEKGRYAIGVDMDQDGIYPGHILTSMIKRVDVATYKLVKDVKEN
FT                   KFKGNTVIEMGVADGGVGLTDMSVMKKALGNKFPNDILVKIKQLTADIRSGKIKVEQYK
FT                   GFQRGI"
FT   sig_peptide     599097..599177
FT                   /locus_tag="Taci_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            600219..601739
FT                   /locus_tag="Taci_0561"
FT   CDS_pept        600219..601739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0561"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcr:BCAH187_A3838 sugar ABC transporter, ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18797"
FT                   /db_xref="GOA:D1B944"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1B944"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ18797.1"
FT                   /translation="MEPIVLMKDIVKDFPGVRAVDGGFFDLMPGEAHALIGENGAGKST
FT                   LMKILYGVYQPDSGVITVKGETFPHQSPGEAISRGIGMVHQEFMLVQQLTVLENVILGF
FT                   EPRVGMGKIDFKAAEERISAIMDGYGLKVDLRKKVNDISVGEAQRVEIVKALYRGAEVL
FT                   ILDEPTAVLTPQEAEGLFQVIRSLTSLGKSVIFISHKLNEVMEVASRVTVMRQGRHIGT
FT                   VEKSATSIPELARLMVGRDVFLGVQRSGSAKAGDVALEVRDIYVPSSTEHSKIRGVSFQ
FT                   VRRSEILGIAGVDGNGQSELAEAIAGLRPVERGQVIIDGVQVQNLTPLQVRQAGLAHIP
FT                   EDRNTRGLNRTMTVKENLAGLAFRKPPISKGLAIVEGALKEFAERLISAFDVRPPLADA
FT                   PVTGFSGGNAQKIVVAREVDSNPKVLLACQPTRGVDIGSIENIRKELVKVRDRGTAIVL
FT                   ISADLEEILSLSDRIAVMYEGRITGIIDADEADEERLGLLMTGGAVNG"
FT   gene            601732..602754
FT                   /locus_tag="Taci_0562"
FT   CDS_pept        601732..602754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0562"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   smd:Smed_3656 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18798"
FT                   /db_xref="GOA:D1B945"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D1B945"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACZ18798.1"
FT                   /translation="MGRYLNGLLTAALALGIGAAAIALMGQSPVEAYVELLKGAFVGKF
FT                   NLGGTLEKFVPLLLTALAFAVASKASVFNVGVEGELYLGAMAAAWVALSVKSVPAPIHL
FT                   LLCFGAAILAGGLWAAIPGALKAHYGVNEVCVTILANYVAIFFTSYLVNYPLSSGLGAP
FT                   QTTPVPDHLMLSRIMPPSMANSGLFIALAILVGTYWVVHKSTLGYRLRAVGENRHYAEH
FT                   VGIDAKATMLWAMVASGAFGGIAGAIQVLGVFGCFVDNFSPGLAFDGMLASLIARNDIR
FT                   LIPILSFFLAALKAGALGMERFTGVPKALVDTVIALFILLASMEGLFKFKMGSRPARRG
FT                   "
FT   sig_peptide     601732..601830
FT                   /locus_tag="Taci_0562"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.471 at
FT                   residue 33"
FT   gene            602760..603728
FT                   /locus_tag="Taci_0563"
FT   CDS_pept        602760..603728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0563"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   smd:Smed_3657 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18799"
FT                   /db_xref="GOA:D1B946"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D1B946"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACZ18799.1"
FT                   /translation="MIESLGDLMDNLSLVVDYTLIRSTIRSSMPIIYAAMACVITQQAD
FT                   ILNIGVEGIMLCGAFAAVAVSYFSGSWLLALGASVLVGILLAAFMAVAHIKYKSDIFVA
FT                   GMGINMFALAITKLLLNKMLNESGSFMSPDIVPMPRIDVPVLASNDVLNSLFNNYSIME
FT                   PLGFVLVLVLQYLLYRTIWGLRLRCVGMNPKAAETAGIRVDLRKFEVMIYSGIIGGVAG
FT                   AYLSLGYSRVFAENMTNGRGFMGVAAMLFGGGDPIKSMLGCFIFGLADSIGARLQTFGF
FT                   PSQFILMIPYIATASILSLAMYRKLKRERVAMSAVAEPQKE"
FT   gene            603734..604669
FT                   /locus_tag="Taci_0564"
FT   CDS_pept        603734..604669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0564"
FT                   /product="Ribosylpyrimidine nucleosidase"
FT                   /EC_number="3.2.2.8"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: sfv:SFV_2237 ribonucleoside hydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18800"
FT                   /db_xref="GOA:D1B947"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D1B947"
FT                   /inference="protein motif:PRIAM:3.2.2.8"
FT                   /protein_id="ACZ18800.1"
FT                   /translation="MAKEKVILDMDPGHDDAVAMMMAASHPSLEIKAITVVAGNQTLEK
FT                   TVRNALNVASVLNLKGVPIAAGMSRPMVREQVIADDIHGETGLDGPVFEEHDLQRDPRH
FT                   GVDLIIETLLASDGDVSILPTGPLTNVAMAMRKDPRIVSKIKRIVLMGGSYQLGNVTPA
FT                   AEFNIYADPEAAHVVFSSGVPIVMMGLDLTRQVRCTRQVIDRMGAIGNRVSKLFVDLME
FT                   FFSKTQEEVFGWDAPPLHDPTTVAYVIDPSIFVTKPMRVDVELRGDHTYGRTCCDYFGV
FT                   TKREPNAEVATTLDLDRFWDLLEDCLRRYS"
FT   gene            complement(604719..605285)
FT                   /locus_tag="Taci_0565"
FT   CDS_pept        complement(604719..605285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0565"
FT                   /product="SNO glutamine amidotransferase"
FT                   /note="PFAM: SNO glutamine amidotransferase; KEGG:
FT                   dds:Ddes_1897 SNO glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18801"
FT                   /db_xref="GOA:D1B948"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D1B948"
FT                   /inference="protein motif:PFAM:PF01174"
FT                   /protein_id="ACZ18801.1"
FT                   /translation="MRVGVLAFQGAFREHMEALGKLGAEAVPVRGKADMEGLSGVVIPG
FT                   GESTVIGRFLVQTGLVDPIRDRIMAGELALMGTCAGAILACQRVTNDPPEGLLGVFPAE
FT                   AERNHYGAQVDSFCQPVTLWDGRQIPGVFIRAPRLSPQEGASVLGVSSGQPVLMSWGRC
FT                   LICSFHPELTQNQEVHRLFLDMASR"
FT   gene            complement(605289..606173)
FT                   /locus_tag="Taci_0566"
FT   CDS_pept        complement(605289..606173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0566"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="TIGRFAM: pyridoxine biosynthesis protein; PFAM:
FT                   Vitamin B6 biosynthesis protein; KEGG: snz1; pyridoxine
FT                   biosynthesis protein ; K06215 pyridoxine biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18802"
FT                   /db_xref="GOA:D1B949"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:D1B949"
FT                   /inference="protein motif:TFAM:TIGR00343"
FT                   /protein_id="ACZ18802.1"
FT                   /translation="MFKGDDWKLKDGLARMLVGGVIMDVTTAEQARIAQEAGACAVMAL
FT                   ERVPAEIRQQGGVARMADPSKVREIQEAVSIPVMAKARIGHFAEARILEALKVDFIDES
FT                   EVLTPADHEAHIDKHQFKVPFVCGARDLGEALRRIREGAAMIRTKGEAGTGDVSEAVRH
FT                   VKTVNREIEALKGMSGHELDQLAQRHRVPRELLEICAEMGHLSVVNFAAGGIATPADAA
FT                   LMMNLGCDGVFVGSGIFKSENPFDRARAIVQAVAHHQDWDLVARVSEGLGEAMRGICVS
FT                   SMDQGSLLQTRGW"
FT   gene            complement(606317..607222)
FT                   /locus_tag="Taci_0567"
FT   CDS_pept        complement(606317..607222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Taci_0567"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: cysteine synthase ; K01738 cysteine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Taci_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ18803"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D1B950"
FT                   /inference="protein moti