(data stored in ACNUC7421 zone)

EMBL: CP001821

ID   CP001821; SV 1; circular; genomic DNA; STD; PRO; 3742776 BP.
XX
AC   CP001821; ABVC01000000-ABVC01000031;
XX
PR   Project:PRJNA19715;
XX
DT   23-NOV-2009 (Rel. 102, Created)
DT   16-DEC-2013 (Rel. 119, Last updated, Version 3)
XX
DE   Xylanimonas cellulosilytica DSM 15894, complete genome.
XX
KW   .
XX
OS   Xylanimonas cellulosilytica DSM 15894
OC   Bacteria; Actinobacteria; Micrococcales; Promicromonosporaceae;
OC   Xylanimonas.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-3742776
RX   DOI; 10.4056/sigs.571102.
RX   PUBMED; 21304672.
RA   Foster B., Pukall R., Abt B., Nolan M., Glavina Del Rio T., Chen F.,
RA   Lucas S., Tice H., Pitluck S., Cheng J.F., Chertkov O., Brettin T., Han C.,
RA   Detter J.C., Bruce D., Goodwin L., Ivanova N., Mavromatis K., Pati A.,
RA   Mikhailova N., Chen A., Palaniappan K., Land M., Hauser L., Chang Y.J.,
RA   Jeffries C.D., Chain P., Rohde M., Goker M., Bristow J., Eisen J.A.,
RA   Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.P., Lapidus A.;
RT   "Complete genome sequence of Xylanimonas cellulosilytica type strain
RT   (XIL07)";
RL   Stand Genomic Sci 2(1):1-8(2010).
XX
RN   [2]
RP   1-3742776
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Foster B., Clum A., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Gehrich-Schroeter G., Schneider S., Pukall S.R.,
RA   Klenk H.-P., Eisen J.A.;
RT   "The complete chromosome of Xylanimonas cellulosilytica DSM 15894";
RL   Unpublished.
XX
RN   [3]
RP   1-3742776
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Foster B., Clum A., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Gehrich-Schroeter G., Schneider S., Pukall S.R.,
RA   Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (12-NOV-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 2ab48252713259e879a04861101d7b46.
DR   BioSample; SAMN00002456.
DR   CABRI; DSM 15894.
DR   EnsemblGenomes-Gn; EBG00001049654.
DR   EnsemblGenomes-Gn; EBG00001049658.
DR   EnsemblGenomes-Gn; EBG00001049660.
DR   EnsemblGenomes-Gn; EBG00001049661.
DR   EnsemblGenomes-Gn; EBG00001049662.
DR   EnsemblGenomes-Gn; EBG00001049664.
DR   EnsemblGenomes-Gn; EBG00001049666.
DR   EnsemblGenomes-Gn; EBG00001049668.
DR   EnsemblGenomes-Gn; EBG00001049670.
DR   EnsemblGenomes-Gn; EBG00001049673.
DR   EnsemblGenomes-Gn; EBG00001049676.
DR   EnsemblGenomes-Gn; EBG00001049679.
DR   EnsemblGenomes-Gn; EBG00001049681.
DR   EnsemblGenomes-Gn; EBG00001049683.
DR   EnsemblGenomes-Gn; EBG00001049685.
DR   EnsemblGenomes-Gn; EBG00001049687.
DR   EnsemblGenomes-Gn; EBG00001049689.
DR   EnsemblGenomes-Gn; EBG00001049691.
DR   EnsemblGenomes-Gn; EBG00001049693.
DR   EnsemblGenomes-Gn; EBG00001049696.
DR   EnsemblGenomes-Gn; EBG00001049698.
DR   EnsemblGenomes-Gn; EBG00001049700.
DR   EnsemblGenomes-Gn; EBG00001049702.
DR   EnsemblGenomes-Gn; EBG00001049704.
DR   EnsemblGenomes-Gn; EBG00001049707.
DR   EnsemblGenomes-Gn; EBG00001049710.
DR   EnsemblGenomes-Gn; EBG00001049713.
DR   EnsemblGenomes-Gn; EBG00001049715.
DR   EnsemblGenomes-Gn; EBG00001049717.
DR   EnsemblGenomes-Gn; EBG00001049719.
DR   EnsemblGenomes-Gn; EBG00001049722.
DR   EnsemblGenomes-Gn; EBG00001049725.
DR   EnsemblGenomes-Gn; EBG00001049728.
DR   EnsemblGenomes-Gn; EBG00001049731.
DR   EnsemblGenomes-Gn; EBG00001049733.
DR   EnsemblGenomes-Gn; EBG00001049736.
DR   EnsemblGenomes-Gn; EBG00001049739.
DR   EnsemblGenomes-Gn; EBG00001049741.
DR   EnsemblGenomes-Gn; EBG00001049743.
DR   EnsemblGenomes-Gn; EBG00001049745.
DR   EnsemblGenomes-Gn; EBG00001049747.
DR   EnsemblGenomes-Gn; EBG00001049749.
DR   EnsemblGenomes-Gn; EBG00001049751.
DR   EnsemblGenomes-Gn; EBG00001049752.
DR   EnsemblGenomes-Gn; EBG00001049754.
DR   EnsemblGenomes-Gn; EBG00001049756.
DR   EnsemblGenomes-Gn; EBG00001049758.
DR   EnsemblGenomes-Gn; EBG00001049760.
DR   EnsemblGenomes-Gn; EBG00001049762.
DR   EnsemblGenomes-Gn; EBG00001049765.
DR   EnsemblGenomes-Gn; EBG00001049767.
DR   EnsemblGenomes-Gn; EBG00001049769.
DR   EnsemblGenomes-Gn; EBG00001049771.
DR   EnsemblGenomes-Gn; EBG00001049774.
DR   EnsemblGenomes-Gn; EBG00001049777.
DR   EnsemblGenomes-Gn; EBG00001049780.
DR   EnsemblGenomes-Gn; EBG00001049783.
DR   EnsemblGenomes-Gn; EBG00001049785.
DR   EnsemblGenomes-Gn; EBG00001049788.
DR   EnsemblGenomes-Gn; EBG00001049790.
DR   EnsemblGenomes-Gn; EBG00001049792.
DR   EnsemblGenomes-Gn; EBG00001049794.
DR   EnsemblGenomes-Gn; EBG00001049796.
DR   EnsemblGenomes-Gn; EBG00001049798.
DR   EnsemblGenomes-Gn; EBG00001049800.
DR   EnsemblGenomes-Gn; EBG00001049803.
DR   EnsemblGenomes-Gn; EBG00001049805.
DR   EnsemblGenomes-Gn; Xcel_R0001.
DR   EnsemblGenomes-Gn; Xcel_R0002.
DR   EnsemblGenomes-Gn; Xcel_R0003.
DR   EnsemblGenomes-Gn; Xcel_R0004.
DR   EnsemblGenomes-Gn; Xcel_R0005.
DR   EnsemblGenomes-Gn; Xcel_R0006.
DR   EnsemblGenomes-Gn; Xcel_R0007.
DR   EnsemblGenomes-Gn; Xcel_R0008.
DR   EnsemblGenomes-Gn; Xcel_R0009.
DR   EnsemblGenomes-Gn; Xcel_R0010.
DR   EnsemblGenomes-Gn; Xcel_R0011.
DR   EnsemblGenomes-Gn; Xcel_R0012.
DR   EnsemblGenomes-Gn; Xcel_R0013.
DR   EnsemblGenomes-Gn; Xcel_R0014.
DR   EnsemblGenomes-Gn; Xcel_R0015.
DR   EnsemblGenomes-Gn; Xcel_R0016.
DR   EnsemblGenomes-Gn; Xcel_R0017.
DR   EnsemblGenomes-Gn; Xcel_R0018.
DR   EnsemblGenomes-Gn; Xcel_R0019.
DR   EnsemblGenomes-Gn; Xcel_R0020.
DR   EnsemblGenomes-Gn; Xcel_R0021.
DR   EnsemblGenomes-Gn; Xcel_R0022.
DR   EnsemblGenomes-Gn; Xcel_R0023.
DR   EnsemblGenomes-Gn; Xcel_R0024.
DR   EnsemblGenomes-Gn; Xcel_R0025.
DR   EnsemblGenomes-Gn; Xcel_R0026.
DR   EnsemblGenomes-Gn; Xcel_R0027.
DR   EnsemblGenomes-Gn; Xcel_R0028.
DR   EnsemblGenomes-Gn; Xcel_R0029.
DR   EnsemblGenomes-Gn; Xcel_R0030.
DR   EnsemblGenomes-Gn; Xcel_R0031.
DR   EnsemblGenomes-Gn; Xcel_R0032.
DR   EnsemblGenomes-Gn; Xcel_R0033.
DR   EnsemblGenomes-Gn; Xcel_R0034.
DR   EnsemblGenomes-Gn; Xcel_R0035.
DR   EnsemblGenomes-Gn; Xcel_R0036.
DR   EnsemblGenomes-Gn; Xcel_R0037.
DR   EnsemblGenomes-Gn; Xcel_R0038.
DR   EnsemblGenomes-Gn; Xcel_R0039.
DR   EnsemblGenomes-Gn; Xcel_R0040.
DR   EnsemblGenomes-Gn; Xcel_R0041.
DR   EnsemblGenomes-Gn; Xcel_R0042.
DR   EnsemblGenomes-Gn; Xcel_R0043.
DR   EnsemblGenomes-Gn; Xcel_R0044.
DR   EnsemblGenomes-Gn; Xcel_R0045.
DR   EnsemblGenomes-Gn; Xcel_R0046.
DR   EnsemblGenomes-Gn; Xcel_R0047.
DR   EnsemblGenomes-Gn; Xcel_R0048.
DR   EnsemblGenomes-Gn; Xcel_R0049.
DR   EnsemblGenomes-Gn; Xcel_R0050.
DR   EnsemblGenomes-Gn; Xcel_R0051.
DR   EnsemblGenomes-Gn; Xcel_R0052.
DR   EnsemblGenomes-Gn; Xcel_R0053.
DR   EnsemblGenomes-Gn; Xcel_R0054.
DR   EnsemblGenomes-Gn; Xcel_R0055.
DR   EnsemblGenomes-Gn; Xcel_R0056.
DR   EnsemblGenomes-Gn; Xcel_R0057.
DR   EnsemblGenomes-Gn; Xcel_R0058.
DR   EnsemblGenomes-Gn; Xcel_R0059.
DR   EnsemblGenomes-Gn; Xcel_R0060.
DR   EnsemblGenomes-Gn; Xcel_R0061.
DR   EnsemblGenomes-Gn; Xcel_R0062.
DR   EnsemblGenomes-Gn; Xcel_R0063.
DR   EnsemblGenomes-Gn; Xcel_R0064.
DR   EnsemblGenomes-Tr; EBT00001652238.
DR   EnsemblGenomes-Tr; EBT00001652239.
DR   EnsemblGenomes-Tr; EBT00001652240.
DR   EnsemblGenomes-Tr; EBT00001652241.
DR   EnsemblGenomes-Tr; EBT00001652242.
DR   EnsemblGenomes-Tr; EBT00001652243.
DR   EnsemblGenomes-Tr; EBT00001652244.
DR   EnsemblGenomes-Tr; EBT00001652245.
DR   EnsemblGenomes-Tr; EBT00001652246.
DR   EnsemblGenomes-Tr; EBT00001652247.
DR   EnsemblGenomes-Tr; EBT00001652248.
DR   EnsemblGenomes-Tr; EBT00001652249.
DR   EnsemblGenomes-Tr; EBT00001652250.
DR   EnsemblGenomes-Tr; EBT00001652251.
DR   EnsemblGenomes-Tr; EBT00001652252.
DR   EnsemblGenomes-Tr; EBT00001652253.
DR   EnsemblGenomes-Tr; EBT00001652254.
DR   EnsemblGenomes-Tr; EBT00001652255.
DR   EnsemblGenomes-Tr; EBT00001652256.
DR   EnsemblGenomes-Tr; EBT00001652257.
DR   EnsemblGenomes-Tr; EBT00001652258.
DR   EnsemblGenomes-Tr; EBT00001652259.
DR   EnsemblGenomes-Tr; EBT00001652260.
DR   EnsemblGenomes-Tr; EBT00001652261.
DR   EnsemblGenomes-Tr; EBT00001652262.
DR   EnsemblGenomes-Tr; EBT00001652263.
DR   EnsemblGenomes-Tr; EBT00001652264.
DR   EnsemblGenomes-Tr; EBT00001652265.
DR   EnsemblGenomes-Tr; EBT00001652266.
DR   EnsemblGenomes-Tr; EBT00001652267.
DR   EnsemblGenomes-Tr; EBT00001652268.
DR   EnsemblGenomes-Tr; EBT00001652269.
DR   EnsemblGenomes-Tr; EBT00001652270.
DR   EnsemblGenomes-Tr; EBT00001652271.
DR   EnsemblGenomes-Tr; EBT00001652272.
DR   EnsemblGenomes-Tr; EBT00001652273.
DR   EnsemblGenomes-Tr; EBT00001652274.
DR   EnsemblGenomes-Tr; EBT00001652275.
DR   EnsemblGenomes-Tr; EBT00001652276.
DR   EnsemblGenomes-Tr; EBT00001652277.
DR   EnsemblGenomes-Tr; EBT00001652278.
DR   EnsemblGenomes-Tr; EBT00001652279.
DR   EnsemblGenomes-Tr; EBT00001652280.
DR   EnsemblGenomes-Tr; EBT00001652281.
DR   EnsemblGenomes-Tr; EBT00001652282.
DR   EnsemblGenomes-Tr; EBT00001652283.
DR   EnsemblGenomes-Tr; EBT00001652284.
DR   EnsemblGenomes-Tr; EBT00001652285.
DR   EnsemblGenomes-Tr; EBT00001652286.
DR   EnsemblGenomes-Tr; EBT00001652287.
DR   EnsemblGenomes-Tr; EBT00001652288.
DR   EnsemblGenomes-Tr; EBT00001652289.
DR   EnsemblGenomes-Tr; EBT00001652290.
DR   EnsemblGenomes-Tr; EBT00001652291.
DR   EnsemblGenomes-Tr; EBT00001652292.
DR   EnsemblGenomes-Tr; EBT00001652293.
DR   EnsemblGenomes-Tr; EBT00001652294.
DR   EnsemblGenomes-Tr; EBT00001652295.
DR   EnsemblGenomes-Tr; EBT00001652296.
DR   EnsemblGenomes-Tr; EBT00001652297.
DR   EnsemblGenomes-Tr; EBT00001652298.
DR   EnsemblGenomes-Tr; EBT00001652299.
DR   EnsemblGenomes-Tr; EBT00001652300.
DR   EnsemblGenomes-Tr; EBT00001652301.
DR   EnsemblGenomes-Tr; EBT00001652302.
DR   EnsemblGenomes-Tr; EBT00001652303.
DR   EnsemblGenomes-Tr; EBT00001652304.
DR   EnsemblGenomes-Tr; Xcel_R0001-1.
DR   EnsemblGenomes-Tr; Xcel_R0002-1.
DR   EnsemblGenomes-Tr; Xcel_R0003-1.
DR   EnsemblGenomes-Tr; Xcel_R0004-1.
DR   EnsemblGenomes-Tr; Xcel_R0005-1.
DR   EnsemblGenomes-Tr; Xcel_R0006-1.
DR   EnsemblGenomes-Tr; Xcel_R0007-1.
DR   EnsemblGenomes-Tr; Xcel_R0008-1.
DR   EnsemblGenomes-Tr; Xcel_R0009-1.
DR   EnsemblGenomes-Tr; Xcel_R0010-1.
DR   EnsemblGenomes-Tr; Xcel_R0011-1.
DR   EnsemblGenomes-Tr; Xcel_R0012-1.
DR   EnsemblGenomes-Tr; Xcel_R0013-1.
DR   EnsemblGenomes-Tr; Xcel_R0014-1.
DR   EnsemblGenomes-Tr; Xcel_R0015-1.
DR   EnsemblGenomes-Tr; Xcel_R0016-1.
DR   EnsemblGenomes-Tr; Xcel_R0017-1.
DR   EnsemblGenomes-Tr; Xcel_R0018-1.
DR   EnsemblGenomes-Tr; Xcel_R0019-1.
DR   EnsemblGenomes-Tr; Xcel_R0020-1.
DR   EnsemblGenomes-Tr; Xcel_R0021-1.
DR   EnsemblGenomes-Tr; Xcel_R0022-1.
DR   EnsemblGenomes-Tr; Xcel_R0023-1.
DR   EnsemblGenomes-Tr; Xcel_R0024-1.
DR   EnsemblGenomes-Tr; Xcel_R0025-1.
DR   EnsemblGenomes-Tr; Xcel_R0026-1.
DR   EnsemblGenomes-Tr; Xcel_R0027-1.
DR   EnsemblGenomes-Tr; Xcel_R0028-1.
DR   EnsemblGenomes-Tr; Xcel_R0029-1.
DR   EnsemblGenomes-Tr; Xcel_R0030-1.
DR   EnsemblGenomes-Tr; Xcel_R0031-1.
DR   EnsemblGenomes-Tr; Xcel_R0032-1.
DR   EnsemblGenomes-Tr; Xcel_R0033-1.
DR   EnsemblGenomes-Tr; Xcel_R0034-1.
DR   EnsemblGenomes-Tr; Xcel_R0035-1.
DR   EnsemblGenomes-Tr; Xcel_R0036-1.
DR   EnsemblGenomes-Tr; Xcel_R0037-1.
DR   EnsemblGenomes-Tr; Xcel_R0038-1.
DR   EnsemblGenomes-Tr; Xcel_R0039-1.
DR   EnsemblGenomes-Tr; Xcel_R0040-1.
DR   EnsemblGenomes-Tr; Xcel_R0041-1.
DR   EnsemblGenomes-Tr; Xcel_R0042-1.
DR   EnsemblGenomes-Tr; Xcel_R0043-1.
DR   EnsemblGenomes-Tr; Xcel_R0044-1.
DR   EnsemblGenomes-Tr; Xcel_R0045-1.
DR   EnsemblGenomes-Tr; Xcel_R0046-1.
DR   EnsemblGenomes-Tr; Xcel_R0047-1.
DR   EnsemblGenomes-Tr; Xcel_R0048-1.
DR   EnsemblGenomes-Tr; Xcel_R0049-1.
DR   EnsemblGenomes-Tr; Xcel_R0050-1.
DR   EnsemblGenomes-Tr; Xcel_R0051-1.
DR   EnsemblGenomes-Tr; Xcel_R0052-1.
DR   EnsemblGenomes-Tr; Xcel_R0053-1.
DR   EnsemblGenomes-Tr; Xcel_R0054-1.
DR   EnsemblGenomes-Tr; Xcel_R0055-1.
DR   EnsemblGenomes-Tr; Xcel_R0056-1.
DR   EnsemblGenomes-Tr; Xcel_R0057-1.
DR   EnsemblGenomes-Tr; Xcel_R0058-1.
DR   EnsemblGenomes-Tr; Xcel_R0059-1.
DR   EnsemblGenomes-Tr; Xcel_R0060-1.
DR   EnsemblGenomes-Tr; Xcel_R0061-1.
DR   EnsemblGenomes-Tr; Xcel_R0062-1.
DR   EnsemblGenomes-Tr; Xcel_R0063-1.
DR   EnsemblGenomes-Tr; Xcel_R0064-1.
DR   EuropePMC; PMC6134474; 30203150.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001821.
DR   SILVA-SSU; CP001821.
DR   StrainInfo; 379668; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082373
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-PGF
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Xylanimonas cellulosilytica XIL07, DSM
CC                            15894
CC   Culture Collection ID :: DSM 15894, CECT 5975, LMG 20990
CC   GOLD Stamp ID         :: Gi02069
CC   Greengenes ID         :: 62747
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: Prodigal
CC   Isolation Site        :: Decaying tree in Salamanca Spain
CC   Isolation Country     :: Spain
CC   Latitude              :: 40.964972
CC   Longitude             :: -5.663047
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Coccus-shaped
CC   Motility              :: Nonmotile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 28C
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Soil
CC   Phenotypes            :: Cellulose degrader, Lacks Mycolic acids,
CC                            Xylan degrader
CC   Energy Source         :: Chemoorganotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3742776
FT                   /organism="Xylanimonas cellulosilytica DSM 15894"
FT                   /strain="DSM 15894"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:446471"
FT   gene            150..1556
FT                   /locus_tag="Xcel_0001"
FT   CDS_pept        150..1556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: bha:BH0001 chromosomal replication initiation
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29042"
FT                   /db_xref="GOA:D1BTA0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTA0"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACZ29042.1"
FT                   /translation="MADEDISKVWAQTLEVLETRPEITARQLAFVRLAKPMAVLNGTVF
FT                   IAVPHEQTRTYLETSVRDQLISALSSVLGFDVRFGITVDPEISAESLTGPTQDYVEPEE
FT                   EDDVDAPAPPLPQPVRPAAEPTRLNPRYVFETFVIGASNRFAHAAAVAVAEAPAKAYNP
FT                   LFIYGDSGLGKTHLLHAIGHYAHNLYPHVRVRYVNSEEFTNDFINSIGDKKQGAFQRRY
FT                   RDVDVLLIDDIQFLQGKEQTMEEFFHTFNALHNANKQVVITSDVPPKQLNGFEDRLRSR
FT                   FEWGLITDVQPPDLETRIAILRKKAASDKLDVPQDVLSYIGSRISTNIRELEGALIRVT
FT                   AFANLNRQQVDLPLAEIVLRDLIIDDDPAEVTPAVVIAQTAAYFGLSIEDLCGSSRSRV
FT                   LVTARQIAMYLCRELTDLSLPKIGQQFGGRDHTTVMHANKKIAGQMAERRSTYNQVTEL
FT                   TSRIRQQHRG"
FT   gene            2111..3244
FT                   /locus_tag="Xcel_0002"
FT   CDS_pept        2111..3244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bsu:BSU00020 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29043"
FT                   /db_xref="GOA:D1BTA1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTA1"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACZ29043.1"
FT                   /translation="MKFRVDRDVLADAVTWTARTLPTRPPAPVLAGVRIEADATGVISL
FT                   SSFDYEVSARSEIPAEVSEPGTVLVSGRLLADIARALPHKPVDVSLEGTKVVVTCGASR
FT                   FTLLTMPVEDYPTLPQMPELSGTVSGDALTLAVTQVSVAASRDETLPLLTGVRMEIEGE
FT                   RITLLSTDRYRLALRELTWTPATPGFSAVALVKAKTLIDVAKSLGAGGGLVNVGLSTGS
FT                   GLDLIGFEAGGRHTTSQLVDGDYPAVRRLFPDATPIHAVVPTQALIDAARRVSLVAERN
FT                   TPIRLAFTEGQVVLDAGQGDDAQASEALEAVLVGEDITVAFNPQFLLDGLTALGTDFVR
FT                   LSFTHPNKPVEFTGQESLDGEDSSDYRYLLVPIRFAG"
FT   gene            3297..4190
FT                   /locus_tag="Xcel_0003"
FT   CDS_pept        3297..4190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0003"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; 6-phosphogluconate dehydrogenase domain
FT                   protein; KEGG: dde:Dde_3470 6-phosphogluconate
FT                   dehydrogenase- like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29044"
FT                   /db_xref="GOA:D1BTA2"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTA2"
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /protein_id="ACZ29044.1"
FT                   /translation="MVSHIGLVGLGKMGNNMRARLRQGGIEVTGYDPRPEVTDVPTLAA
FT                   LVEALPPGRRVVWVMVPAGEPTRGVLAELRTVLTSGDIVVEGGNSHYVEDQERAAELAE
FT                   SGVGYVDVGVSGGVWGLENGYGLMAGGSDDDIAALMPVFDALRPAGPREEGFVHAGPVG
FT                   AGHFAKMVHNGIEYGLMQSYAEGYELLAAKGLITDVHGTFKAWQRGTVVRSWLLDLMVR
FT                   ALEDDPQLAKLDDWVEDSGEGRWTVDEAIEAAVPLPVISAALFARFASRQEASPAMKAV
FT                   AALRQQFGGHAVKSAP"
FT   gene            4356..5813
FT                   /locus_tag="Xcel_0004"
FT   CDS_pept        4356..5813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: bsu:BSU00040 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29045"
FT                   /db_xref="GOA:D1BTA3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTA3"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACZ29045.1"
FT                   /translation="MYVSHLSLLDFRSYASVDVELEPGPNAFVGRNGQGKTNLVEAIGY
FT                   VATLGSHRVSNDAPLVRAGAERAVVRTRIVRGDRASTVELEITPGRANRARINRGQLGR
FT                   ARDVLGILRTVLFAPEDLALVKGDPDGRRKLLDQLVVQLLPRAAGLLGDYERVNRQRSA
FT                   LLKSLRGQRAAGRSPDLGTLEVWDAKAAQLGGQILGMRLQLVQAMRPHVAAAYAQVSDA
FT                   DGHAELGYRSSLDAVLPDDAGASAGGAAILPADLADAPPSAVELETLLLAGMAAARSQE
FT                   VDRGVSLVGPHRDDLVLTLGGLPAKGYASHGESWSFALALRLASYRLLGGTPADDGTRA
FT                   DDGTRADDGTRADDGDRADDGDRSMSADPTSADPALGNPALGNPAPGDSVTAVPVTAHV
FT                   PRPERPPAASPSGARFWTEELGHDAEPVLILDDVFAELDLRRRDRLAELVAPARQVLVT
FT                   AAVPDDVPSGLMATRFDVVTGAVTRAS"
FT   gene            5845..6360
FT                   /locus_tag="Xcel_0005"
FT   CDS_pept        5845..6360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   protein of unknown function DUF721"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29046"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTA4"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ACZ29046.1"
FT                   /translation="MPPAEAVIPPAEVARAALNRAKAAARAKGLRPGSPARRSPLVEPR
FT                   TSGSGPSARDPQLVSDVVGRLLRDKGWREEVSVGGVVGRWREVVGDDVADHCTPETFED
FT                   KVLVVRASSTAWATQVRLLTPTLLRRLAEEVGEGVVEDVKVLGPAGPGFGRGPRSVRGG
FT                   RGPRDTWG"
FT   gene            6655..8700
FT                   /locus_tag="Xcel_0006"
FT   CDS_pept        6655..8700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="KEGG: bsu:BSU00060 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29047"
FT                   /db_xref="GOA:D1BTA5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTA5"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACZ29047.1"
FT                   /translation="MANRNDGGYDAGNITVLEGLEAVRKRPGMYIGSTGERGLHHLVTE
FT                   VVDNSVDEALAGYADTIDVTLLADGGVRVVDNGRGIPVAIHPTEGKPTVEVVMTILHAG
FT                   GKFGGGGYAVSGGLHGVGISVVNALSRRVVSEIARDGYHWRMEFADGGHPVGELQRLEP
FT                   TEETGTTQTFWADPEIFETTEFDFETLRARFQQMAFLNKGLTITLTDERAGHADLEDEV
FT                   VGEVPVPDADGVVVVDHDDDPSTPPARTVTYRYDGGLTDYVKHLNSSKRVDLIHPEVID
FT                   FESEDTERKISLEIAMQWTSAYSESVHTYANTISTTEGGTHEEGFRAAMTNLVNSYARE
FT                   KGILKEKEDNLTGDDIREGLTAVISIKLGEPQFEGQTKTKLGNTEAKTFVQRVVREQLT
FT                   DWFDSHPNEAKDVIRKAISASQARIAARKAREATRRKGLLSSGGMPGKLKDCQSNRPEE
FT                   CEIYIVEGDSAGGSAVRGRNPHNQAILPIRGKILNVERARLDKALSNLEVQSLITAFGT
FT                   GIGEDFDASKLRYHKVILMADADVDGQHIATLLLTLLFRYMRPLIEQGHVYLAMPPLYR
FT                   LKWSNAPHDYVYSDKERDAFIREGLANGKRMPKDKGIQRYKGLGEMDYQELWETTMDPD
FT                   HRTLRQVTMDDAAAADEIFSMLMGEDVESRRSFIQRNAKDVRFLDI"
FT   gene            8773..11343
FT                   /locus_tag="Xcel_0007"
FT   CDS_pept        8773..11343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: bha:BH0007 DNA gyrase subunit A; TIGRFAM: DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29048"
FT                   /db_xref="GOA:D1BTA6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTA6"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ACZ29048.1"
FT                   /translation="MTDEIPGGIPELPEVHHGHVEQVDLNLEMQRSYLDYAMSVIVGRA
FT                   LPDVRDGLKPVHRRVIYAMYDGGYRPDRGFSKCARVVGDVMGKYHPHGDSAIYDAMVRL
FT                   VQDWSLRYPLVAGQGNFGSPGNDPAAAPRYTECRMAPIAMEMVRDIDKDTVDFQDNYDG
FT                   EEQEPVVLPARFPNLLVNGSAGIAVGMATNIPPHNLREVAEGVRWHLAHPEASREELLA
FT                   ALMQRVKGPDFPTGAQILGTKGIEEAYRTGRGSITMRAVVNVEEIQNRICLVVTELPYQ
FT                   VNPDNLAAKIADLVNDGRLQGIADIRDETSGRTGQRLVIVLKRDAVAKVVLNNLYKHTQ
FT                   LQDNFGANMLALVDGVPRTLSLDAFIRHWTTHQMEVIRRRTAYLLADAEKRIHILRGYL
FT                   KALDVLDDVIALIRRSPDADQARAGLMELLEIDEIQANAILNLQLRRLAALERQRIIDE
FT                   HAAIEAEITDLQDILAKPERQRSIVGEELDGIVEKYGDERRTHILPYDGDMSMEDLIPE
FT                   EEVVVTITRGGYAKRTRSDAYRQQKRGGKGVRGTQLREDDIVDHFFVTTTHHWLLFFTN
FT                   FGRVYRAKGYELPEGSRDSKGQHVANMLAFQPGEHIAQVLDLRDYDAAEYLVLATRRGL
FT                   VKKTRLQEYNSPRSAGLIAINLREDEDGQPDELIGAMLVDSSQDLILVSRKGQSIRFPA
FT                   ADESLRPLGRATSGVTGMKFREGDEVLTAAVVREDAFLFTVTESGLAKRTELSVDNYRQ
FT                   QGRGGLGIRVANLPEERGDLVGALVVDDDDEVLVIMERGKIVRSAVAEVRATGRTTQGV
FT                   TFAKPDKGDRIIAVARNVERREEEESASVDESVPVDEADDDAEK"
FT   gene            11355..12350
FT                   /locus_tag="Xcel_0008"
FT   CDS_pept        11355..12350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0008"
FT                   /product="putative FHA domain containing protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29049"
FT                   /db_xref="GOA:D1BTA7"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTA7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29049.1"
FT                   /translation="MTTENDTKQGAAGSVPPVPPPPVPAPAARPAQPAATDRPKSAPAG
FT                   GSKPAAKPAAASAPEPAPASTPASAPASAPAGAPAGADDGGKADGVRTDAVKAARAALA
FT                   AARDAAKRVQAGATAKVSAEPATPSSVPSSVPPSSVKPSPAKGQAGKGKPATGATPRAD
FT                   MHYRTGPVQFAADGRTQAPAAGVPGAPGGPGQPGQPAPVRPGQPANVGAPRRVRLTVSR
FT                   VDPWSVMKLAFLLAVAIAIMTVVAAAVFWLVVDGLGTFDEIQQFINQVIGQNATIDLAE
FT                   FIAFDRVVSLATLVAIVNIVLMTAIATIMAIVYNITAALVGGVHLTLTDD"
FT   gene            12491..12567
FT                   /locus_tag="Xcel_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            12491..12567
FT                   /locus_tag="Xcel_R0001"
FT                   /product="tRNA-Ile"
FT   gene            12661..12780
FT                   /locus_tag="Xcel_0009"
FT   CDS_pept        12661..12780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29050"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTA8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29050.1"
FT                   /translation="MKKLIVLLIAAAAGYAVWRKYTEGNAERDLWSEVTDTLD"
FT   sig_peptide     12661..12711
FT                   /locus_tag="Xcel_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.868 at
FT                   residue 17"
FT   gene            12810..12885
FT                   /locus_tag="Xcel_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            12810..12885
FT                   /locus_tag="Xcel_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(13018..14043)
FT                   /locus_tag="Xcel_0010"
FT   CDS_pept        complement(13018..14043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0010"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Hypothetical protein CBG04830"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29051"
FT                   /db_xref="GOA:D1BTA9"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29051.1"
FT                   /translation="MVRKSVTETVQSIDAEAFKDSAARAAASLSDVGSKAAKEASVLAA
FT                   QAKDAAEHAKDWAEPHAKDFLAWLKPRAERAWQESVQAAAPRVEKLADQASPLIDTAHE
FT                   RLVPLIDTAHEKFVPMVDTAHVRVGEAVDVAHDKLVDDYLPRLVTAFNDAAARTADSGH
FT                   AAAAAVAAAVEPAKRKRKGGLFWLLVAGAAAAVGYVFWRRAQPQNDPWAEPWEQDTTPD
FT                   YEGVAREAKHRAADAAEAVGEAAGAAVAISRGAGEKIAERAAEVREDLAEKAAEVRDEL
FT                   AEKAAEASEKLAEVREDVVERASEVTKKATTRTRTTAKKATDAVDEAVDDAKEATPDKN
FT                   D"
FT   gene            14119..14658
FT                   /locus_tag="Xcel_0011"
FT   CDS_pept        14119..14658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0011"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: ank:AnaeK_2206 peptidylprolyl
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29052"
FT                   /db_xref="GOA:D1BTB0"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTB0"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ACZ29052.1"
FT                   /translation="MFATLHTTLGDIRIELLPNHAPKTVRNFVGLATGEQPWADPKTGE
FT                   EKTTPLYDGVIFHRVIENFMIQGGDPLGTGTGGPGYTFDDEIHPELGFDEKYLLAMANA
FT                   GKRRNPVTGETGGTNGSQFFITTTETPWLNGKHTIFGRVADDASKAVVDAIGTVRTRPG
FT                   DRPVEDIVISSVTIED"
FT   gene            14746..15594
FT                   /locus_tag="Xcel_0012"
FT   CDS_pept        14746..15594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0012"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG:
FT                   aba:Acid345_1881 rhomboid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29053"
FT                   /db_xref="GOA:D1BTB1"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTB1"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACZ29053.1"
FT                   /translation="MSTDQPYPAAPEAVPVCPRHPDRVSYVRCQRCGRPACPECQRPAA
FT                   VGIQCVDCVRQAARTAPRTTTAVGGRVRRGRPVVTFTLIGICAVSFVLQLAVPGWTQQF
FT                   MYAPVLGVGEPFRFLTAAFLHSTGFFGHILFNMWALYVTGQFLEPVLGRARFIALCVLS
FT                   AIGGSVAVLLLASPVQAVVGASGMVFGLFGAMVPVLRRLGGNAAQIIGLIAINGVIGFL
FT                   VPGISWQGHLGGLVVGLALGYAFAHAPRGRQKLFGWLLPAVVAVVLLVVVLAKYAAVGV
FT                   L"
FT   gene            complement(15637..15921)
FT                   /locus_tag="Xcel_0013"
FT   CDS_pept        complement(15637..15921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0013"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29054"
FT                   /db_xref="GOA:D1BTB2"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTB2"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ACZ29054.1"
FT                   /translation="MPESKSRKKKVRPSDPEFVERMAKAAEKEKAGNPPWLVPVMLGLM
FT                   ILGLIWIVTYYLTASRVGGGFPIPPLGAWNLAVGFALIITGFGLTTRWK"
FT   gene            16046..16819
FT                   /locus_tag="Xcel_0014"
FT   CDS_pept        16046..16819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0014"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   bha:BH2562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29055"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTB3"
FT                   /inference="protein motif:PFAM:PF05949"
FT                   /protein_id="ACZ29055.1"
FT                   /translation="MTRPALPRLLRLPSSAGRVRPGLTVAAVAGIAGLMFAASAQLASG
FT                   SSGLRHPTDLAELVGAEAQRVDQLTETVEALRLEVDDLAAAAPTGTTEDPALVRLEGMR
FT                   VGSVPVTGPGLRVQLDDAPASNISIPNVTVDDLVVHQQDLQHVINALWAGGAEAMTLQG
FT                   ERVIMTSAFRCSGNILLLHGRVFSPPYVVEAVGDPTALRAALAASPGVQRYLGWVQVVG
FT                   LGWSVRDVDALELPAYTGSTELRFAELPPGTDPLR"
FT   sig_peptide     16046..16168
FT                   /locus_tag="Xcel_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.722 at
FT                   residue 41"
FT   gene            16816..17628
FT                   /locus_tag="Xcel_0015"
FT   CDS_pept        16816..17628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0015"
FT                   /product="peptidase C60 sortase A and B"
FT                   /note="PFAM: peptidase C60 sortase A and B; KEGG:
FT                   sus:Acid_5377 sortase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29056"
FT                   /db_xref="GOA:D1BTB4"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTB4"
FT                   /inference="protein motif:PFAM:PF04203"
FT                   /protein_id="ACZ29056.1"
FT                   /translation="MSAAAVPAHARVRVPRHSAGSVAAGVFGELLITVGVLLGLFVVWQ
FT                   LWWTDVVAVREQHQVLQALDWEAPPPAPEAPAGVEPAAPVERRDPPPVDEEPAFAEVFA
FT                   QLYIPRFGSDYVAPVAEGIDRQQVLDVLGVGHYPGTAMPGELGNFATAGHRTTFGRPYH
FT                   LVADLVEGDPVVVRTAATWYVYRVVSHEIVMPWQTEVISPVPGLRAGDPIPELTQRLMT
FT                   MTACHPMFSARERYIVHAELDFWMPVSAGVPAVLTDAGVDVVGVEGGD"
FT   gene            17628..17783
FT                   /locus_tag="Xcel_0016"
FT   CDS_pept        17628..17783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29057"
FT                   /db_xref="GOA:D1BTB5"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTB5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29057.1"
FT                   /translation="MYGALWRVLPGPWWVKVLLLLVMASAVVWVCFQWLFPWISAYVQL
FT                   NENTVG"
FT   gene            17811..18479
FT                   /locus_tag="Xcel_0017"
FT   CDS_pept        17811..18479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0017"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   swi:Swit_3227 anthranilate synthase, component II"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29058"
FT                   /db_xref="GOA:D1BTB6"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTB6"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACZ29058.1"
FT                   /translation="MNPRILVVDNYDSFVYTIVGYLDQLGAATVVVRNDAVPASVLAAG
FT                   DGERITDADGVPFDGVLVSPGPGTPHDAGASEDVIRACARTRTPMLGVCLGHQALAEVF
FT                   GATVSHAPELMHGKTSLVEHDDAGVVAGLAQPFTATRYHSLAVEPETVPAELQVTCATA
FT                   SGIVMGLQHRELPLHGVQFHPESVLTQGGHRLLANWLELCGDAGAVARSAGMAPLVHTA
FT                   "
FT   gene            complement(18721..20802)
FT                   /locus_tag="Xcel_0018"
FT   CDS_pept        complement(18721..20802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0018"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; PASTA domain containing protein;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; PASTA domain containing protein; KEGG: bha:BH2504
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29059"
FT                   /db_xref="GOA:D1BTB7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTB7"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACZ29059.1"
FT                   /translation="MVDNTPRVLAGRYEVGELIGRGGMAEVHIGHDARLGRTVAIKVLR
FT                   SDLARDPSFLARFRREAQAAAALNHPAIVAVYDTGEDVHTDPATGNQVHIPFIVMEYVE
FT                   GHTVRDILQDGAAVPIEEAVEITVGVLSALEYSHHAGIVHRDIKPANVMITPTGAVKVM
FT                   DFGIARAVADSAATMTATHAVIGTAQYLSPEQARGEQVDARSDLYSTGCTLFELLTGRP
FT                   PFVGDSPVAVAYQHVGQAPQRPSEIASDVPEVLDRITLKALAKERGTRYSSAAEFRSDL
FT                   EAAMRGGAVGAPAVGAGLAAAGAALGGAPTVAFGAPGFGEAGTQLLTPETAATQQWGAT
FT                   GLPQAMPAAGVGGPAGPTGPSRQEQADARRKKTLMWTLITIGVLAVAAIVTIILLNGRQ
FT                   QEVALVEVPEIQAGMTREEARQLVEDEGLVFADAIDPDSNEPEGTFTKQDPEAGEMVRP
FT                   NSTVRAFFSGGPNTIGVPDVAGMTQDEARAALESVDLVVGEITPEPSSDVDEGRVTRTA
FT                   PAANQAVTARSTVDLFVSDGTVELPDLRGMTVDEATAELDRLSLSFSQHDVQTDQVEVG
FT                   RIAEQTPEPGFVPQNQRVTIGVAVAPEIQQIPVPDLVGQPWNTAIGLCAPLNCSPSYEN
FT                   HPTVPLGSVISTEPSAGTMLDEGSTVIVVISQGPATPPDEPGDDGTATTPPPEGDEDD"
FT   gene            complement(20804..22474)
FT                   /locus_tag="Xcel_0019"
FT   CDS_pept        complement(20804..22474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0019"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; protein of unknown function RIO1;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; KEGG: bcy:Bcer98_2514 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29060"
FT                   /db_xref="GOA:D1BTB8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTB8"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACZ29060.1"
FT                   /translation="MRPVAGLALGDRYHLTRQVAVGGMGEVWVADDAFLGRDVAVKVLR
FT                   EEYTGQEDFLKRLRTEARNSAALSHVNIAQMYDYGEQGGTGYLVMELVLGEPLADLLER
FT                   EPVLPPKRLLPILAQTARGLHHAHECGVVHRDVKPGNILLEHPGRAAGAQSIVKITDFG
FT                   VSLAANQAPMTATGMVMGTAQYLSPEQAVGQPATPLSDVYALGVVAYEATAGKRPFTGS
FT                   TPVDIAVAHVNNPVPPLPTTVHPELAALVYRLLEKDPVKRPTSAGALADELEALGADIA
FT                   ADPLGARSRTARRLRSAAASSRAASSASSSSAARSSASSASAASSAASSAAASSSERPS
FT                   SGPTTPGAEPLRASWPQTAAGVGGTAASDLTDDSRSFGELVGESRPGERTSPQHAGARP
FT                   TPLPLRRDVHGARPTGRSPEASRTVDALRRDLARRSPHRGEETRGAGRRPADPSAHRQQ
FT                   ADPRTPAEGQRRTSTTTGLRLGRWGNVSWPLVGLAVLLVVLLIATLIRNLSGGDDGAAA
FT                   APQSNDRVTAAASSLPDSGMMLRNVLRGEAVVTMTSKDM"
FT   gene            complement(22471..23940)
FT                   /locus_tag="Xcel_0020"
FT   CDS_pept        complement(22471..23940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0020"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: mfa:Mfla_2494 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29061"
FT                   /db_xref="GOA:D1BTB9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTB9"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ACZ29061.1"
FT                   /translation="MNTTLRRLSSVVMVMFLGLMVATTYTQFFRADTLNNDSRNVRSIF
FT                   REFNNARGPIVVAGQPIVESVPVDTPFGFQRVYSGGDPEQAQMYAPVTGFFSLVNGSTA
FT                   IESATNSFLNGQADALWIDRLQNLLTGRPQQGSSVELTIDPVIQQAAWDALGGQRGAIV
FT                   AVEPSTGRILAMVSKPSFDPNVLAVHSTSQAGQAYQELLNAENGPLTNRTIRALYPPGS
FT                   TFKLVTAAAAFEHAGMTPETVIPAPDSFVLPGTQTTVRNFGNARCSPTGEQSIDDAMRI
FT                   SCNSAFLGLAVDLGNDTLRDTAAQFGFLDPFRVPMTTAVSDVPADQNAPQTALAGIGQG
FT                   SVTATPLQMAMVSAAIANHGTLMQPYLVDRIRDPELEIVQQNEPSVIREAVSRTTADGL
FT                   RDMMVNTVASGSGTAAQISGVQVAGKTGTAETGREGEQPHAWFTAFAPADDPQIALAVI
FT                   VENGGNLSQGATGGRLAAPMARSVLQAALNR"
FT   sig_peptide     complement(23860..23940)
FT                   /locus_tag="Xcel_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.394 at
FT                   residue 27"
FT   gene            complement(23937..25427)
FT                   /locus_tag="Xcel_0021"
FT   CDS_pept        complement(23937..25427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0021"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: sus:Acid_7521
FT                   penicillin-binding protein, transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29062"
FT                   /db_xref="GOA:D1BTC0"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTC0"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ACZ29062.1"
FT                   /translation="MSAVEQGAVVEAEQVEPRVRRPLRLAELWLLVLAVAASVGAFALV
FT                   GLGVNDTLPENFWRESFALVALALVAHVVVRIKAPFADQTILPAVVLLNGVGLAMILRI
FT                   QESGARGAAGADVVRNTQWSALGVVLACLVMWFLKDHRNLRKLTYTAMIASLVLLGLPL
FT                   VPGIGRSINGAQIWISMFGFSLQPAEFAKITLTIFFAGYLVTNRDTLALAGPKVLGLQL
FT                   PRIRDLGPLLLVWAASLAVLIFQRDLGMSLLLFGLFVAMLYLATDRVSWALIGLVLFAG
FT                   GAFVAWQTFPHVAQRMTGWLNAFDPAVFNARGGSGQLVAGLFGMANGGLIGTGWGQGFP
FT                   YLVPFSFSDFIFTSLAEELGLTGILAILMVYLVFVERGLRTAITVRDGFGKLLAGGLAF
FT                   TIALQTFVVVGGVTRLIPLTGLTLPFMAQGGSSLLSNWILAGLLLKISDSARRPSSLPM
FT                   RGQVGQGRIVPDDAGSPAIPSTLPTQVITPDLPKEGER"
FT   gene            complement(25424..26959)
FT                   /locus_tag="Xcel_0022"
FT   CDS_pept        complement(25424..26959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0022"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Protein phosphatase 2C-like; SMART: protein
FT                   phosphatase 2C domain protein; KEGG: ank:AnaeK_0770 protein
FT                   serine/threonine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29063"
FT                   /db_xref="GOA:D1BTC1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTC1"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /protein_id="ACZ29063.1"
FT                   /translation="MTVSLRYAARSDVGLVRASNQDSAYAGPHLLVVADGMGGHAGGDI
FT                   ASRIAIENLRHLDTATHTPDAALADLEAAVEEARQGLVRASTTEPELAGMGTTVTALLR
FT                   TGSTLVMAHMGDSRAYLLRDGALTQVTVDHTFVQHLVDTGRISPDEAEHHPQRNVVMRV
FT                   LSDFDVDLHPDMSVREAKVGDRWLLCSDGLSGFVHVDVLGEILSEAHDPGEAADLLLLA
FT                   AMHGGSTDNITVIVADVVDDDGDDDIAAEAEGDPGLPAAASGGVGGVQVVGAATGTGPI
FT                   PGSVPPEDTTPSTSSDDGVDGSPHDDDAHPPSDDDGPDDEDPDDADARPAPRRHPVIAT
FT                   LVTLVVLAALGAGGWGAYQWTQQQYFVGVSDDQVAIFRGIPASAGPVTLSHPVELTGTR
FT                   VSDLPAFFAARLDGTIRASSLADAQQRAARLIEQAEEAEQAAQTPTPSPSPSPTPTPTP
FT                   SGTPSGTPSPDPSQEPADEQSADKEPADGQSVEPAAAVEPPDESQGETTESAG"
FT   gene            complement(26967..27479)
FT                   /locus_tag="Xcel_0023"
FT   CDS_pept        complement(26967..27479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0023"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: scl:sce0876 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29064"
FT                   /db_xref="GOA:D1BTC2"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTC2"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACZ29064.1"
FT                   /translation="MSELTFTLLRLGYLVLLWVFVLTAIGVLRRDLSTRATGGRAAGGR
FT                   AERRRQRAGAAPPPAGAPAPAPPAPRGAVAPTRLVVVAGPLQGTSLPLTGSSILIGRSP
FT                   GSTLVLDDDYSSSRHARIFPQGGQWFVEDLGSTNGTFVGDEQLTGVMPLAPGVGVQIGR
FT                   SVVELQG"
FT   gene            complement(27490..28197)
FT                   /locus_tag="Xcel_0024"
FT   CDS_pept        complement(27490..28197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0024"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: mxa:MXAN_2520 FHA
FT                   domain/tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29065"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTC3"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACZ29065.1"
FT                   /translation="MGVLDRFEKGVERAMNGAFSKIGRSEVKPVELAGRLRRELDDRAA
FT                   VMGRDRTVAPNDFTIELSPEDFAQIEAWGAETLADELATNLTEYAASQHYAFVGPVSVS
FT                   FEEHEELTGGRFQVRSASVRGAVAPATTSAPSTRHPLIDIDGQRYLLTGPVTVIGRDAD
FT                   ADIVVDDPGVSRRHLEIRVTPDGVVATDLGSTNGLYVEGHQVPAATLLDGNTLTIGRTR
FT                   IMFWSGTAATEDW"
FT   gene            28405..28488
FT                   /locus_tag="Xcel_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            28405..28488
FT                   /locus_tag="Xcel_R0003"
FT                   /product="tRNA-Leu"
FT   gene            complement(29131..29520)
FT                   /locus_tag="Xcel_0025"
FT   CDS_pept        complement(29131..29520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29066"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29066.1"
FT                   /translation="MRRHLSRSAVAVGIALAGLLASTAPAHAAYSDVPVGSAGLWIAEN
FT                   YLGAPNATYANSVVLTSSNNLINSIVNNGRTSIAHFYDAANHTGVNISLNNPARGGQIR
FT                   DPKLSNGTDATSANWANRISSADFG"
FT   sig_peptide     complement(29434..29520)
FT                   /locus_tag="Xcel_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 29"
FT   gene            29777..30679
FT                   /locus_tag="Xcel_0026"
FT   CDS_pept        29777..30679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29067"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTC5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29067.1"
FT                   /translation="MRHTNLVVRTRLILGASVVCAAVASLTACSAESETTGLSADAVAE
FT                   RYGYRATESALSPVYALVPQFRDPADGYARDLLARQCLQDIVEYTPVVPGASGGFKDER
FT                   TGQWVLDEPTAQASGYPYLRPKDGPVGGVPDDVVLTDATLAEMERCGVAADERLGTPPA
FT                   RLLNDIEATGWFAATDSPDMADVIGQWRECMVPLGLADLPEDPTLMPPRSVINAVVDAE
FT                   SEAANGGYGAMPLTDREREVAVSDAKCLAQVDYYGIQNRVRAEAELSMIGENLKEFEAV
FT                   RREYETYQRGVDAVIAELG"
FT   sig_peptide     29777..29869
FT                   /locus_tag="Xcel_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.750 at
FT                   residue 31"
FT   gene            30731..31834
FT                   /locus_tag="Xcel_0027"
FT   CDS_pept        30731..31834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0027"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   gur:Gura_3473 peptidoglycan binding domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29068"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTC6"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ACZ29068.1"
FT                   /translation="MLAGALLVGGGWVLAQQMVSPEQVAAQAEPPPPTPVVAALREGYL
FT                   HGTMTMTATAVSSGVHEVVAPKALDGVVTFSDFAVAGEVQAGSAVVRVNGRPVIVMAGP
FT                   FPLYRDLTSGDTGDDVLMLQRALVDAGHLRGTPDGVFGARTAAAVRALYRTVGFPAPTT
FT                   AVAPEPAVAASSATADGEPLVAPVRPATMVRAAELVFTGALPAQVGSVVPVGATVEPGT
FT                   VLASLTVGATELRADVPPEAIGPLAVGAAATFVGDGGAAGLAQVESITPGQDGQMQVHW
FT                   SLEGAVAVGTDYVLTVENPAAQDAPTLLAPIAALVSRGGVDTVTVREDDVFREVAVEVL
FT                   GMQGAVAAIRAQDDAGVLRAGSEVRLV"
FT   gene            31827..33713
FT                   /locus_tag="Xcel_0028"
FT   CDS_pept        31827..33713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0028"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; protein of unknown
FT                   function DUF214; SMART: AAA ATPase; KEGG: gur:Gura_3474 ABC
FT                   transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29069"
FT                   /db_xref="GOA:D1BTC7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTC7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ29069.1"
FT                   /translation="MSDQTTGTAPLLRLRDVTRTFGDGTIALDGVSVDVRAGEVVAIVG
FT                   PSGSGKSTLLNILGLLDTPTEGTVILADTDVGALGDGARSDLRSRDLAFVFQRAHLLSS
FT                   LSVEENVRLGIEYSPDHGDAHARAIDALRRCGLDDKAAAQARTLSGGEMQRVAIARALV
FT                   RRARLWLADEPTGNLDTVQSVAIIDELRNHARQAGAALIVVTHEPEIAARLDRTITLRD
FT                   GRIVCDTGTCLAPVVAASPTRRPRGHGGLARAIRTSTTMLRARTPGSRAGVVATALAVA
FT                   LAVTALGLSQSASAQVTSMFDAQRVAQVTASLSRNADPIDATQIRLDEVRGFPGVTGAE
FT                   LWLQHQQVPLNVGNLAATTADVVETTKTPDKTTGSTIVWAAGAGPELGPGDAILGTGLA
FT                   RRIGLGPIDAGAEVTVAGQRLRVVGLMESTRSGTAAGNAFVAAGSVAALPGSRNATLYV
FT                   TTAPGAARQVAERLAPLADPFRQTVMEIDPVLGAEAFAGALTESVGASLQVLAVVAAFA
FT                   GLGTVVFVNLLGITSRTAELGVRRAFGAKRLETAAMVASECAARSFTGAIIGLVVGLTA
FT                   ILAVTITARWEPVLDLRLLAVPLLGALVFGLVGAIAPAIHAARVEPADAVRS"
FT   gene            33805..34350
FT                   /locus_tag="Xcel_0029"
FT   CDS_pept        33805..34350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0029"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: ppg:PputGB1_3064 RNA polymerase
FT                   sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29070"
FT                   /db_xref="GOA:D1BTC8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTC8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACZ29070.1"
FT                   /translation="MQDETRDEASFTTAFRASYDDVRAFLARRVDPQAAEDLTAEVFTR
FT                   AWNTWHRSPIPPQPWLFGIARHLVVDRYRDTERRQRLQSRMENDRPLDLDEARAIDTSL
FT                   DFRHAWAQLSDRDREVLALIAWDGLSVTDAATVIGTTRAAYSVRLTRARRRLAHLLDQA
FT                   GPTTASATRCTTVERSRV"
FT   gene            34347..35333
FT                   /locus_tag="Xcel_0030"
FT   CDS_pept        34347..35333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29071"
FT                   /db_xref="GOA:D1BTC9"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTC9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29071.1"
FT                   /translation="MNHRTADDVMAIVAAANPVTTRSTRTETLDDPYAEGLLARITATP
FT                   PTRRAVARRPRRLWTRATALLSALAAALAAVFAAAPATASDVLRDAATAAAEQVLDTGQ
FT                   YWYVNTEVEYPGQPAFPLESWHSADIYLQRNGRAAATDAAQNGRDELDPDLIRVREVRD
FT                   QDGHTVGFGGELRLTRSQVAMLSTDRDTLRRQVLQHTDHTPHGDDFAAWQATVGLLWSA
FT                   PLTPEQRHAAWELLADSPSIRHLGTMTDSAGRSGEGIEADWSLRRLGRQTIIVDVEHGT
FT                   LLEVRDHENDGVTQVHRTTILDAGTRDHAPDIQPSACGSDNAITTSC"
FT   gene            35466..36656
FT                   /locus_tag="Xcel_0031"
FT   CDS_pept        35466..36656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0031"
FT                   /product="ATPase"
FT                   /note="PFAM: ATPase; KEGG: ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29072"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTD0"
FT                   /inference="protein motif:PFAM:PF01637"
FT                   /protein_id="ACZ29072.1"
FT                   /translation="MDRARNPYTPNAGAPPRYFAGRAAEVEDFRILLKRLAAGYTEQSV
FT                   VVTGLRGVGKTVLLGEYRRIADEESWVAVDAEVSKNTDFGPQMANLARRALLQVSPRAR
FT                   WGDRAKAAAAAVKSFSLTVQPDGSLAGGLDVERAWGKADTGILNEDLADVFEAVGEAAR
FT                   EKDSGVVFLFDEIQFLHKTALEALIGAVHRTVQRRLPVTFAGAGLPQLPGLAGEAKSYA
FT                   ERLFKFPLIGELPEPAARDALVRPARAEGVDYEPAAVDEIIRYTEGYPYFLQEYGRAAW
FT                   NIAEGPTITASDVALAGEVVDAELDESFFRARAQRSSPEELRYMRAMAELGADAQKAGD
FT                   VATVLGKASEQVAPIRARLINKGLLFTPRHGYAKFTVPQFDRFMKRYMELDSVPPA"
FT   gene            36783..37136
FT                   /locus_tag="Xcel_0032"
FT   CDS_pept        36783..37136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0032"
FT                   /product="protein of unknown function DUF488"
FT                   /note="PFAM: protein of unknown function DUF488; KEGG:
FT                   abc:ACICU_03070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29073"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTD1"
FT                   /inference="protein motif:PFAM:PF04343"
FT                   /protein_id="ACZ29073.1"
FT                   /translation="MPADLVLKRIYDEVSPDDGCRVLVDRLWPRGVSKERAALDLWLKE
FT                   AAPSPELRTAWHHDPARFDEFAEAYRAELATNPAVEQLRELRASHERVTLLFAAHDPEV
FT                   NHVVVLRDVIVGE"
FT   gene            complement(37521..38426)
FT                   /locus_tag="Xcel_0033"
FT   CDS_pept        complement(37521..38426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0033"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; KEGG: nar:Saro_2808
FT                   NmrA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29074"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTD2"
FT                   /inference="protein motif:PFAM:PF05368"
FT                   /protein_id="ACZ29074.1"
FT                   /translation="MPRQGDDVVAVTGASGRLGTRLALRLAAEGAHQRLIVRDLARVPR
FT                   LPDGTVLPDADVAVVGSYGDGAAMRRALDGVRVLFLVSARETPDRVAQHLTAVDAAVAA
FT                   GVERVVYTSFLGAAADAVFTFARDHFATEQHLRRSGLRWTFLRDNLYHHALTTFVGDDG
FT                   VIRGPAGRGRVASVSHDDVADVATAVLLDERTHAHDARTYELTGPTAITLAEAAATLAE
FT                   LTGRSIRYETETVEQAYASRAHYGAGRAEVEGWVTSYTAIAAGELEHVSDDVARLVGRP
FT                   ARSFADWLDDYPDQWAHLRR"
FT   gene            38500..39048
FT                   /locus_tag="Xcel_0034"
FT   CDS_pept        38500..39048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0034"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: Protein-tyrosine phosphatase, low molecular
FT                   weight; SMART: Protein-tyrosine phosphatase, low molecular
FT                   weight; KEGG: ppf:Pput_3811 protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29075"
FT                   /db_xref="GOA:D1BTD3"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTD3"
FT                   /inference="protein motif:PFAM:PF01451"
FT                   /protein_id="ACZ29075.1"
FT                   /translation="MTVPYRVMIVCTGNICRSPMAEIVLREAFAAGGLDGAVVVDSTGV
FT                   SGEEQGNPVDDRARRVLTAFGYPGGDAHTARRVASSELAERDLVLAMTAHHARALRRLA
FT                   GSEPAGELSAPAADGPEIRMFRSFDPEAPVLSDGDGEHLLDVEDPWYGGADDFEVCLRE
FT                   IEAATPGIVAYVRDRLAAR"
FT   gene            39089..39619
FT                   /locus_tag="Xcel_0035"
FT   CDS_pept        39089..39619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0035"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ppf:Pput_3213 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29076"
FT                   /db_xref="GOA:D1BTD4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTD4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACZ29076.1"
FT                   /translation="MGYTVRRVRAQEWEAVRALRLEALQDPVAPLAFLTSHEFEAAHVD
FT                   DFWKQRTSAAASGGSVAQFVVADDDGRWVGSATGLLEEPGTDDYAHHGVEQRQVHVVGV
FT                   WLHPEHRGRGLIQQAIDAVVGWGREHGALRARLYVHADNPRAQAAYLKAGFERTGLTFE
FT                   SKVGPEVELAKPL"
FT   gene            complement(39627..40664)
FT                   /locus_tag="Xcel_0036"
FT   CDS_pept        complement(39627..40664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0036"
FT                   /product="alpha/beta hydrolase fold family protein"
FT                   /note="KEGG: abb:ABBFA_001367 alpha/beta hydrolase fold
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29077"
FT                   /db_xref="GOA:D1BTD5"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTD5"
FT                   /inference="similar to AA sequence:KEGG:ABBFA_001367"
FT                   /protein_id="ACZ29077.1"
FT                   /translation="MSATPPEQTWLPDVLPGFEQLTLPLADDDEGEVVATLVRRERPGP
FT                   TDAGVDLLYVHGWIDYFHQVHVADLFEGLGIRFHALDLRKYGRSLRDHQTPGYVSDLRT
FT                   YDEELEAALAVLGHGEGGATDRKLLLMGHSTGGLTLPLWADRHPGRADALILNAPWLEF
FT                   QTRYLGRRVLEGPVRAQAAVAPRSHLVNVDQGFYARTISRRFEGEWDYDERWRPDLGWR
FT                   ATPAWLAAVFSGHERVAQGLHIDVPILVLLSARSTPPVRWSEDLKRTDSVLDVPGIMRR
FT                   VPNLGTLVTLARFEGALHDVTLSERAVRDQVWREITRWVGAYVTPPAPAPEPRRPWWHR
FT                   FWPAP"
FT   gene            complement(40690..41505)
FT                   /locus_tag="Xcel_0037"
FT   CDS_pept        complement(40690..41505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aba:Acid345_2075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29078"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTD6"
FT                   /inference="similar to AA sequence:KEGG:Acid345_2075"
FT                   /protein_id="ACZ29078.1"
FT                   /translation="MTTAADVVAALQSALPAAPRPVTVDQFLDGDPATPVTGVAVTTTA
FT                   TFDVLLAAVEAGANLVITHEPLYYDHHDAARDDLEAEEDPVYSRKRALVQDHSLVVWHL
FT                   HDQQHDTRPDGVDAATTAELGWTLDPADAAQGISTATIDPTTLGALALHVARTLGAQAL
FT                   RYIGDPSAVVTRVGLDLGFRGFGRNRALLRRADVDVAICGELHEWESGGYAVDAVATGV
FT                   ATGLIAVGHVPSEQAGMRAVAAWLPGVLAAAGHAVPVVHVPTPDTFRAL"
FT   gene            complement(41725..42936)
FT                   /locus_tag="Xcel_0038"
FT   CDS_pept        complement(41725..42936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0038"
FT                   /product="proteinase inhibitor I4 serpin"
FT                   /note="PFAM: proteinase inhibitor I4 serpin; SMART:
FT                   proteinase inhibitor I4 serpin; KEGG: scl:sce1266 serine
FT                   (or cysteine) proteinase inhibitor, clade B (ovalbumin),
FT                   member"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29079"
FT                   /db_xref="GOA:D1BTD7"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023795"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="InterPro:IPR036186"
FT                   /db_xref="InterPro:IPR042178"
FT                   /db_xref="InterPro:IPR042185"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTD7"
FT                   /inference="protein motif:PFAM:PF00079"
FT                   /protein_id="ACZ29079.1"
FT                   /translation="MLVADGVEARQVAVSDAGAAADVVGATRRIGAALLVASPADANAV
FT                   VSPSSVAVALSMLADGARGGTLAELDQVLGATGEDRRDAVAALRGTLLRHDGDPAVVRD
FT                   EELPDDPVVHLAAQVVVDDQLTPDDAYLTTLADVYGAGVQRVDLGSDDGKSALDAWVQH
FT                   HSGGLVEESAITPKDSLRLVLQDAVVLAARWYTPFPGHATGDRPFTTADGTEVSVPTMS
FT                   GEAPRAYAEVDGWRAARLPYTGHELHADVILPPDGVNPAAAHPELLAALAAALDDAEDQ
FT                   PVRVTLPVLDLRPDPLDLRDAIATLGAPTVLDPGAADLTGIGTDDAGERLYLGQAMQQA
FT                   VLQLDEEGTRAAAVTELGAEAGSAPVDRPVELTLDRPFLIEIAHTSTSWPLFQAAIRDP
FT                   RPGG"
FT   gene            43156..44325
FT                   /locus_tag="Xcel_0039"
FT   CDS_pept        43156..44325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0039"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   scl:sce5648 aspartate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29080"
FT                   /db_xref="GOA:D1BTD8"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTD8"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACZ29080.1"
FT                   /translation="MKVSRRSHVPPFAVMEILAAANQRRAAGRDVLNLCAGEPSTGASE
FT                   VVRARAIELLQTGDLGYTEALGVPALREAIAGHYRRWYDVEVDPGRIAVTTGSSGGFVL
FT                   AFLAAFDVGDRVALARPGYPAYKNILAALGCEVVELDCGPGTRYQPTVSQLMEAYYGGG
FT                   LDGVVVASPANPTGTMIEPAELAAIARWCAEHDVRLISDEIYHGIAYGTDVHQATAATY
FT                   TGEGAVVVNSFSKYWAMTGWRLGWLVLPDELVRPVDALAGNVALSPPALSQHAGVAAFS
FT                   EAGYAAAAANVERYATSRAALLARATELGWDPVAPADGAFYLYGNIAATGLDSRTYCAR
FT                   LLEEADVAITPGTDFDAVGGHEWVRLSFAASVDTVTRAVERIAAWQRTL"
FT   gene            44386..45375
FT                   /locus_tag="Xcel_0040"
FT   CDS_pept        44386..45375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0040"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   mpo:Mpop_4845 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29081"
FT                   /db_xref="GOA:D1BTD9"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTD9"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ACZ29081.1"
FT                   /translation="MGAMSLRLATFNVQHGRMPDGRVDPPFLAAAVSTLRADVVALQEV
FT                   DRGQVRSAGADLAALVAQAMGAADHRYVPAVVGRVEPRRAAPGQAPGDDDPALALAPLA
FT                   QATGPALLPAAGRVLRSRAGRAAARAYLGTWVSRRRARGDEPDDVPAYGIALISRYPVR
FT                   QWRQVRLPLGSPWLFGRLQLGTDQPRVAVCAVVETPDGPLTVVTTHLSSGSTWNQTQLR
FT                   WLAERLRGAPRPLVLMGDLNLRGSVPTELTGWRDLVEIDTYPRHRPWIGIDHVLVDDVA
FT                   PAVGEPIDPGAPHPGGRVHSLAPARAVDLGISDHCAVVVDVRLGPPRP"
FT   gene            45402..45881
FT                   /locus_tag="Xcel_0041"
FT   CDS_pept        45402..45881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mno:Mnod_3709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29082"
FT                   /db_xref="GOA:D1BTE0"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTE0"
FT                   /inference="similar to AA sequence:KEGG:Mnod_3709"
FT                   /protein_id="ACZ29082.1"
FT                   /translation="MDDDDRGRKETADERSDRNWVELLQELRVMQTGVQILTGFLLTVP
FT                   FQPRFETLTAFQRGFYLVLVVLAALTTGIAVAPVALHRALFRRHLKPRLVTVADRITRA
FT                   ALILLALLVTGVVGLVFDVVVGRGAAITAVALALAFLGVLWAVVPEVVKERSARD"
FT   gene            45924..46253
FT                   /locus_tag="Xcel_0042"
FT   CDS_pept        45924..46253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29083"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTE1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29083.1"
FT                   /translation="MTIHATLAAADGHTPLIAATRNMAVAALRLVSWNAKEPGPQLPRL
FT                   TMAYARIPARAPTHPKAVITAISVMACSEQGRGASERRGLVGRGGSRGAEMPSAASVAC
FT                   GCARQ"
FT   gene            46315..47223
FT                   /locus_tag="Xcel_0043"
FT   CDS_pept        46315..47223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0043"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: rle:RL2799 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29084"
FT                   /db_xref="GOA:D1BTE2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTE2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACZ29084.1"
FT                   /translation="MATDPRRLSFLLAVHRAGGVLAAADLLGVTASAVSQQIARLEAEE
FT                   GFAVLDRGPRGVTLTPAGRVLAEAAERIESELVEARQAIAALGDGVSGRVAIGAFQTAI
FT                   RAVVAPALAPLAERFPGVELDVREHEPADSVRMLRAGDLDVVVLERDAENANPAPRGSQ
FT                   DVPLVDEPWRLVVPASTAAPERLEDLARLTFVGSEVGTASSRALQRLSRTLGTDIGTRH
FT                   ATYDFDTTLALVAAGQGVALLPALALQDVALMDSLQVVRLAGLGERRLVARHRVTRHEP
FT                   SPAVRAVVDVMREVAARLDLA"
FT   misc_binding    47290..47392
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score46
FT                   .91"
FT   misc_binding    47393..47513
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score25
FT                   .88"
FT   gene            47553..50684
FT                   /locus_tag="Xcel_0044"
FT   CDS_pept        47553..50684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0044"
FT                   /product="glycine dehydrogenase"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: bpt:Bpet4074 glycine dehydrogenase; TIGRFAM:
FT                   glycine dehydrogenase; PFAM: glycine cleavage system
FT                   P-protein; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29085"
FT                   /db_xref="GOA:D1BTE3"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTE3"
FT                   /inference="protein motif:TFAM:TIGR00461"
FT                   /protein_id="ACZ29085.1"
FT                   /translation="MTSHSPALDPDLFATRHVGPGGAESAQVRAMLDVLGYPSLDAVVD
FT                   AAVPAAIRTQRPLDLPAARTEPEVLADLRAIAAKNQVKRQMIGLGYYPTHTPPVIRRNV
FT                   LESPAWYTAYTPYQPEISQGRLEALLNFQQVVEDLTGLEVAGASLLDEATAVAEAVALM
FT                   WRASRATTGYVVLDADLFPQTLAVTRGRAEAIGLPVVVANLDQGLAAGLEAAASHAASD
FT                   PASDVAAASAGLSSGLPEGDVVGVVVAQTGASGRVLDARQVIAEAKERGALVTMATDPL
FT                   ALTILVSPGELGADIAVGSAQRLGVPLFYGGPHAAYIAVRKGLERQLPGRLVGVSVDAD
FT                   GATAYRLALSTREQHIRREKATSNICTAQALLAITAAMYAVYHGPDGLRAIAERIHTHA
FT                   TTLTTALRAAHITVEHDTFFDTIRTHVPAQAATIAAQARAAGLNLYTPDHDHVQIACDE
FT                   TTTDADIAAVLQAFTQALGSHTSAPEAAPMHEAGRSDDARAAVNPRVEGPRGPVNAAAR
FT                   ASSDVPAAPAETLPEPLKRTTPFLQHPVFHQHRSETAMLRYLRSLSDKDLALDRTMIPL
FT                   GSCTMKLNATAEMEPISWPEFADLHPYVPADQAEGYEELISALEAGLAEITGYAAVSLQ
FT                   PNAGSQGEFAGLLAIRAYHRSRGEEGRDIVLIPASAHGTNAASAALAGLRVVVVKTAAD
FT                   GEIALDDLREKLAQHGPQVAAIMITYPSTHGVYEEHVREVCDAVHDAGGQVYIDGANLN
FT                   ALVGLARPAELGGDVSHLNLHKTFCIPHGGGGPGVGPVAVAAHLAPFLPGDPVGGGVVS
FT                   TGSTTGDGSTTVGGSTTGGGVPVSAARHGSAGILPISYAYVALMGPDGLTHATKTAVLA
FT                   ANYVARRLADHYPTLYTGPGGLVAHECILDLRPLTAATGVSAEDVAKRLMDYGFHAPTL
FT                   SFPVAGTLMVEPTESEDLAELDRFVDAMIAIKGEIDAVGAGEWPADDNPLRNAPHTAQS
FT                   VSADEWTHPYPRSLAAYPVPALRGAKYWPPVRRIDAARGDRTLICSCPPPESYA"
FT   gene            50695..51834
FT                   /locus_tag="Xcel_0045"
FT   CDS_pept        50695..51834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0045"
FT                   /product="glycine cleavage system T protein"
FT                   /note="TIGRFAM: glycine cleavage system T protein; PFAM:
FT                   glycine cleavage T protein (aminomethyl transferase);
FT                   Glycine cleavage T-protein barrel; KEGG: scl:sce2014
FT                   aminomethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29086"
FT                   /db_xref="GOA:D1BTE4"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTE4"
FT                   /inference="protein motif:TFAM:TIGR00528"
FT                   /protein_id="ACZ29086.1"
FT                   /translation="MSDLKSTPLEAEHQAAGATLTGFGGWLMPLRYTSDLAEHRAVREA
FT                   AGLFDLSHMGEIHLEGRQAAAALDHALVGNATSIAVGRARYSMLCAEDGSVLDDLIVYR
FT                   LGEVHFLVVANAGNAELVSRELVARAADFDVAVTDRSATTALIAVQGPRAEQIVAELTA
FT                   PDDVETLRGLPYYAAAPVTLSTGARALAARTGYTGEDGFELFVDRDDAGVLWRAALTVG
FT                   EPHGLVPAGLAARDSLRLEAGMPLYGHELDTTTTPYEAGLGRVVRLDKVHDDGASVEFV
FT                   GRAALAARKASPPARVLVGLRGEGRRSARAGYDVVTPAGTRAGTVTSAAPSPTLGYPIA
FT                   MAYVTPEVSAEGTALAVDVRGRHEPFTVVSLPFYRRPTA"
FT   gene            51863..52231
FT                   /locus_tag="Xcel_0046"
FT   CDS_pept        51863..52231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0046"
FT                   /product="glycine cleavage system H protein"
FT                   /note="TIGRFAM: glycine cleavage system H protein; PFAM:
FT                   glycine cleavage H-protein; KEGG: lch:Lcho_1560 glycine
FT                   cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29087"
FT                   /db_xref="GOA:D1BTE5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTE5"
FT                   /inference="protein motif:TFAM:TIGR00527"
FT                   /protein_id="ACZ29087.1"
FT                   /translation="MASYPEHLQYSREHEWVDASSPAVIGITSLAADALGDVVYLELPE
FT                   VGAAIESGAVVGEIESTKSVSELFSPVTGTVVEVNQAAIDDPAVVNADPFGAGWLFKVE
FT                   VTALGELLDAEAYAALAE"
FT   gene            52429..52671
FT                   /locus_tag="Xcel_0047"
FT   CDS_pept        52429..52671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0047"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: ppw:PputW619_2158 LuxR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29088"
FT                   /db_xref="GOA:D1BTE6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTE6"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACZ29088.1"
FT                   /translation="MSIIELERTAPAASINPLTRREQVVLSNLTEDVTLEQIATKLFVT
FT                   RNTVKSQVRSVYRKIGVSTRADAVAWARQAGMYTA"
FT   gene            52761..53261
FT                   /locus_tag="Xcel_0048"
FT   CDS_pept        52761..53261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0048"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bba:Bd2220 MutT/NUDIX
FT                   family hydrolase/pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29089"
FT                   /db_xref="GOA:D1BTE7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTE7"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACZ29089.1"
FT                   /translation="MTYQPSADPTDAITGEWSASDGSGLASRRLVVAAVIVDDVVTPTR
FT                   LLGARRVRPEELAGRWEFPGGKVDAGETPVGALHRELREELGVAVELGAELMGPDDGGW
FT                   IITDRHVMRLWFARVTDGDPEPLVEHDELRWLDADGLFDVHWLDGDVRIVEALASHLDR
FT                   DGG"
FT   gene            complement(53166..54608)
FT                   /locus_tag="Xcel_0049"
FT   CDS_pept        complement(53166..54608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0049"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   esa:ESA_02493 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29090"
FT                   /db_xref="GOA:D1BTE8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTE8"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACZ29090.1"
FT                   /translation="MPTHTPALHATTTATAPITPTRAQLQRVRWSLVTMFGLFGIVQTS
FT                   WMGRLPSVRESLDITAGQLGGVLVIGAVGSLVGVTLTGAIIVRFGSRATLRLGMVGTVV
FT                   GFALVGAGTALGSVPLFSAGLLLNGLVVAATNVPINLEAARVEKLLRTSILPHVHASFS
FT                   VGALLGSAVAAATSTFQIHVAWHIVGVALLVTVGRAVLIAPGTELADAPLRVSRRTRAI
FT                   ETADDAERRRVARRNGSGGVLRAWTERRTLLIGLVILAASMSEGAAANWLNLGVVDGFA
FT                   TREAVGAAAYGTFVVAMLTVRLLGAGLIDRFGRVTVLRASGVSALVGLLAFGLSPNLPL
FT                   AWAGIALWGVGAAMAWPLGTAAAADDPTRAAARVSVVGSFGSIASLSMPPVLGLLADSW
FT                   GVRQALLVITVAMVISLAAAKAARPETARSDVPASEAARSEAPAPRDTAESAAVPVQVR
FT                   GQRLDDADVAVQPVHVEEPVGV"
FT   gene            54803..55021
FT                   /locus_tag="Xcel_0050"
FT   CDS_pept        54803..55021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29091"
FT                   /db_xref="GOA:D1BTE9"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTE9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29091.1"
FT                   /translation="MSEFQVTRRVKPEPTAAVVGRVLLSFVLFLGGLVLLGAGASDASS
FT                   TPWLWFGLGLLAVALSFGLPMRGASQR"
FT   sig_peptide     54803..54934
FT                   /locus_tag="Xcel_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.601) with cleavage site probability 0.550 at
FT                   residue 44"
FT   gene            complement(55042..56013)
FT                   /locus_tag="Xcel_0051"
FT   CDS_pept        complement(55042..56013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0051"
FT                   /product="Methylenetetrahydrofolate reductase (NAD(P)H)"
FT                   /EC_number="1.5.1.20"
FT                   /note="PFAM: methylenetetrahydrofolate reductase; KEGG:
FT                   acp:A2cp1_2862 5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29092"
FT                   /db_xref="GOA:D1BTF0"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTF0"
FT                   /inference="protein motif:PRIAM:1.5.1.20"
FT                   /protein_id="ACZ29092.1"
FT                   /translation="MVDPTHPRHTANHRPTVSFELMPPRRPDAAPNFWETARRLVAVQP
FT                   DFVSVTYGAGGGDRATARQVVATLLAGTPVLPIAHLTCVGASREDVSEVIDDFLEAGVR
FT                   AFLALRGDPPKDQPDWRPPVDGVHSADELVRLLREVESARAAADPSSALRGAAHPLSIA
FT                   VATFPDGNPAAGTTRAQEVQRLLAKQSAGASFAITQLFYEADSYIQFVAEARAAGVTIP
FT                   ILAGLLPTTEPRRLRRVEELTGVVAPPDLLDALDALPDAEAQHEYGIARSVELARAVLD
FT                   AGAPGLHVYTFNKHRPALDLLAGIGLLERTEQPASVLTPGAV"
FT   gene            56227..57639
FT                   /locus_tag="Xcel_0052"
FT   CDS_pept        56227..57639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0052"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   bmj:BMULJ_01131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29093"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTF1"
FT                   /inference="protein motif:PFAM:PF01936"
FT                   /protein_id="ACZ29093.1"
FT                   /translation="MDNEERLAVFLDYENLALGAREHLGGMQFDFGPIADALAVRGRVV
FT                   VRRAYADWSYFDEDRRALTRHQVELIEMPQRMGASRKNAADIKMVVDAIEMAFEREYIS
FT                   TFVMCTGDSDFSPLVHKLRELNKRVIGVGVEKSTSRLLPASCDEFLFYDRLEGVDVPDA
FT                   DETAARRGRPGRGGRAAPAPQKRSTRAAEAVAEVLAGTSTGGAEPAENPAEPAPKGRTR
FT                   RKPAASKAGAEPTGAAAEQVTAEPAAEPAPTSASPAEPAPTTNGGRRRAGKAATTKEAA
FT                   PSVEAPSSDVASNDVPTTSDASAEEHETTEEREAPSMEVQVVQTLANLASSTSGSVTAS
FT                   MLKRTLLRKDPTFAETDYGFRTFTEFLEFLAEREFVELGRGPAAGDPEVSLPKQGTSDE
FT                   TFALVRDVVAEAGAPVPLSGLKNRLRKRRPDFSEKALGYRGFLQFCRAAEAAGAVALTW
FT                   DDDADDYLVTAA"
FT   gene            57756..58400
FT                   /locus_tag="Xcel_0053"
FT   CDS_pept        57756..58400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0053"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; KEGG:
FT                   phospholipid/glycerol acyltransferase ; K00655
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29094"
FT                   /db_xref="GOA:D1BTF2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTF2"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ACZ29094.1"
FT                   /translation="MTYRLLRLILSLVAYLALRPQVSGLHNVPRRGPVILASNHLSFID
FT                   SILIPLVVPRHVTFIAKAEYFTGHGIKGRISRWFFTTMGNIPVDRQDPRAGQRSLEDAL
FT                   DVLGRGGAFGIYPEGTRSRDGKLHEGHTGVAWLALAGGAPVVPVALIGTDRVQPVGQRF
FT                   PRPYRGVQIQFGAPIDPNRQLTTGLRPAQARRELTDQIMTQIHVMSAQPRA"
FT   gene            complement(58417..59508)
FT                   /locus_tag="Xcel_0054"
FT   CDS_pept        complement(58417..59508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29095"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTF3"
FT                   /inference="similar to AA sequence:KEGG:MXAN_0055"
FT                   /protein_id="ACZ29095.1"
FT                   /translation="MIEQEAPTEGRRTGAHIAAVIEDRIIAVVGRLLHRTAGWVPRIDA
FT                   YTCFGTPRRVRVLGRVLLGPRRIGSGPPRPVQRGFRSFLTLPEPGHRVVVTVGDTVVET
FT                   VSDRAGYIDVEVDVPPEAPLHPGWQGATLRTATGAEARAGLLVIGDDVRLGVVSDIDDT
FT                   AMITAVPQLLVAAWNMLWVRAAARRAVRGMPALYGRIAAAHPDAPFVYLSSGAWNTART
FT                   LRRFLARHGFPPGPLLLTDFGPTDTGWFRSGRVHKTTSLRRLMATFPRIRWVLIGDDGQ
FT                   ADPEIYAAAAKTHPEQVVAIGIRTLTRTERVIATAGAAKDDAPTNRPTRPTSPPRPDVP
FT                   TVVGRDGDDLAAGLESVPHLLAP"
FT   gene            complement(59513..60097)
FT                   /locus_tag="Xcel_0055"
FT   CDS_pept        complement(59513..60097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0055"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="KEGG: bph:Bphy_7198 DNA-3-methyladenine glycosylase
FT                   I; TIGRFAM: DNA-3-methyladenine glycosylase I; PFAM:
FT                   methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29096"
FT                   /db_xref="GOA:D1BTF4"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTF4"
FT                   /inference="protein motif:TFAM:TIGR00624"
FT                   /protein_id="ACZ29096.1"
FT                   /translation="MEPTARCFGDGDPLYEAYHDTEWGVPVHGEAALLERIALEGFQSG
FT                   LSWITVLRKRDAFREVFHGFDPAAVAAMTPDDVVRLLGDARIIRNRQKIEATITNGQAV
FT                   LALHDAGRTLDELFWSFAPPPRPAPLASYDEMGSTSPESIAMAKALKKLGFRFFGPTTA
FT                   YAAMQACGLVDDHLATCPVVLAREAAGTRAR"
FT   gene            complement(60188..61057)
FT                   /locus_tag="Xcel_0056"
FT   CDS_pept        complement(60188..61057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0056"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Tetracyclin repressor
FT                   domain protein; KEGG: scl:sce6697 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29097"
FT                   /db_xref="GOA:D1BTF5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTF5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACZ29097.1"
FT                   /translation="MSTPDDATARLVQRMWAPPTPPRRGPKPGLSVDRIIEAAYELAEA
FT                   EGIEAVSMARLGSSLGVSAMALYRHVSNKDELLTLLADRLARDLPPIGDVATWREGLDL
FT                   WTRAQIMMVLEHPWFLDLPLSTVMPGPHRLRWIDSLFGLLAETPLSVDEKFAFAGLLAQ
FT                   HVLGEARILVESQRAAAAAEPGAATSADPFGDLGTLLHAFADPADFPHLMAAIETAEGE
FT                   TRVPVMPPDAAAAVEEEITFGLNVVLDGLEAYVAGRQAASPPSSAASPDSAASSGSATP
FT                   SSDGAATA"
FT   gene            61156..62244
FT                   /locus_tag="Xcel_0057"
FT   CDS_pept        61156..62244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0057"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: aeh:Mlg_2715 daunorubicin resistance ABC
FT                   transporter ATPase subunit; TIGRFAM: daunorubicin
FT                   resistance ABC transporter ATPase subunit; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29098"
FT                   /db_xref="GOA:D1BTF6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTF6"
FT                   /inference="protein motif:TFAM:TIGR01188"
FT                   /protein_id="ACZ29098.1"
FT                   /translation="MTDVVVSAEGLRKSYGTTPVLEGVDLTLHRGEVLALLGPNGAGKT
FT                   TTVKILSTLLPFDGGTATVAGFDVARDAAQVRRAISLTGQQVALDLKQTGLENLTMIAR
FT                   LSRIPRRQVRARVAELLAGVGLADVADRRVATYSGGMRRRLDLAAGLVARPQVLFLDEP
FT                   TTGLDPRSRRDLWELVREVVAGGTSLFLTTQYLEEADELADRIALIDGGRVAAEGTADE
FT                   LKRRVGEARVELELATPADALRVRSALRVRSALLAGDPSTLSGAQRAVALPGPDNVVGG
FT                   DGVSGAQRAAVLPGPDSAEEEKLVGLPTDGSLAHVRELLARVEATGVVPTSWKLREPTL
FT                   DDVFLTLTGHAATTHEDQEKAA"
FT   gene            62241..63056
FT                   /locus_tag="Xcel_0058"
FT   CDS_pept        62241..63056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0058"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG:
FT                   bcr:BCAH187_A3467 ABC transporter, efflux permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29099"
FT                   /db_xref="GOA:D1BTF7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTF7"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACZ29099.1"
FT                   /translation="MTALTTTTTPIASLRDTLSDAGTMIGRAVRLATRDVDSMITAVVL
FT                   PVIILMMFTFVFGGAIDVGVDFVQYATPGIILLCAGFGAANTAMAVEQDMAGGMVDRLR
FT                   SLPMRPWTFVLGHVVASLAKTLLTTAVVFGVAVAIGFRPTAGLLGWLGAVGLILLFVHA
FT                   IAWAAAFTGIMVRSPDAAGGFSFVVMFLPYVSSAFVPVETMPSWMRGFAQHQPVTPVIE
FT                   SVRGLLVPGSPGAVVGSELGSTALLAIVWCVGIGAVFAVAAALGFRARR"
FT   gene            63207..64688
FT                   /locus_tag="Xcel_0059"
FT   CDS_pept        63207..64688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0059"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   pde:Pden_4334 amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29100"
FT                   /db_xref="GOA:D1BTF8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTF8"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ACZ29100.1"
FT                   /translation="MSQGTQGTGGAVATEKLAGQADLKRVMGPKLLLLFIVGDILGTGV
FT                   YALTGSVAGEVGGAAWAPFLIAFVVATITAFSYLELVTKYPAAAGAALYTHKAFGIHFI
FT                   TFVVAFMVMCSGITSASTASNAVAGFVSDAFRLDLAAGSGGRLGIALGFMVLVGLINLR
FT                   GVGESVKANVVLTLVELSGLLLVIFVGLWAMTQGRADLSRVVVFESSDDKSVFLAITAA
FT                   TTLAFFAMVGFEDSVNMAEECQDPVRDFPRMMLTGLSITGAIYVLVAICAVALVPVGDL
FT                   TEASKGSALTQVVAAGAPGLPFDRIFPFIGIFAVANSALINMLMASRLLYGMANQRVLP
FT                   PVFGRVHPFRRTPWVSIIVTTLIAVGLITYVVRATASEEGASSVALLGGTTSLLLLVVF
FT                   AVVNVALVVLRRQPVEHRHFRTSLPVAILGAITCAFLAGPWARSEAQQQQYTIAGALVA
FT                   VGIVLSFFTYLWNRAVRNEPTEFDDVDHLKDDVTG"
FT   gene            complement(64783..65109)
FT                   /locus_tag="Xcel_0060"
FT   CDS_pept        complement(64783..65109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0060"
FT                   /product="phage shock protein C, PspC"
FT                   /note="PFAM: PspC domain protein; KEGG: hne:HNE_3296 phage
FT                   shock protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29101"
FT                   /db_xref="GOA:D1BTF9"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTF9"
FT                   /inference="protein motif:PFAM:PF04024"
FT                   /protein_id="ACZ29101.1"
FT                   /translation="MSTQNPNPNPYPSYAMPAPAPSKPFYRPSDGRMIGGVCAAVADRF
FT                   GWDRNIVRLATVASIFLPGPQVLAYVAAWIIIPDEQKFWERQATAQQAPAYQPYPAPPA
FT                   PPQA"
FT   gene            65294..66319
FT                   /locus_tag="Xcel_0061"
FT   CDS_pept        65294..66319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0061"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: bsu:BSU10840 LacI family transcription
FT                   regulator; PFAM: regulatory protein LacI; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29102"
FT                   /db_xref="GOA:D1BTG0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTG0"
FT                   /inference="protein motif:PRIAM:5.1.1.1"
FT                   /protein_id="ACZ29102.1"
FT                   /translation="MSRRLAEVAAKVGVSEATVSRVLNGKPGVSEATRAAVLTALDVMG
FT                   YERPVKLRGERGRLVGLVLPELVNPIFPAFAEVVGGALAQQGYTPVLCTRSAGGVSEAE
FT                   YVDLLLAQQVSGVIFAGGFYAERGKDHAHYRLLHQRGLPVVLINGAIEQLDFARVSCDD
FT                   LVAVNLALNHVASLGHTRIGLLLGPADHVPSERKLAAARAWFGQRGLTLDESLVVHSQY
FT                   SLEAGQATANRLIEGGATAVVAASDPLALGAVRAARRAGLSVPRDLSVVGFDDSALMNL
FT                   TDPALTTVRQPIEPMGRAAVDILAALVAGEDVPHDELLFEPELVVRGSTTVVPRASAVA
FT                   S"
FT   gene            66387..68048
FT                   /locus_tag="Xcel_0062"
FT   CDS_pept        66387..68048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0062"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: alpha-glucosidase ;
FT                   K01187 alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29103"
FT                   /db_xref="GOA:D1BTG1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTG1"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACZ29103.1"
FT                   /translation="MTTSSPSAPDPHAWWRHAVIYQIYPRSFADGNGDGTGDLAGVRGR
FT                   LPYLKELGVDAVWFTPWYVSPLADGGYDVADYRAIDPQFGTLAEAEALITEAAALGIRT
FT                   IIDVVPNHVSSAHAWFQAALASEPGSPERARFWFHDGLGPDGSGMPTHWQSSFQGTTWT
FT                   RTTRPDGTPGQWYLHLFTPEQPDLNWENPDVRQEHLDVLRFWFDRGAAGVRIDSAALPV
FT                   KDRALPEVPEIHGPGEHPHLDRDELHDIYRTWRAVADGYDDPRILVGEVWLPDAERFAQ
FT                   YLRPDEMHTAFNFDFMVRPWAAAAMRESIDTTLAAHAPVDAPATWVLSNHDITRPVTRY
FT                   GREDSSFDFARKRFGIPTDVAVGTRRARAAALLTGALPGALYVYQGDELGLPEVEDLPL
FT                   DVLQDPMHFRSNGVDPGRDGCRVPLPWNRSGASYGFGPERPGSDRAEKPWLPQPVWWGE
FT                   YAVEAQEHDPASMLTLYRTMLRLRRSLPDLAAGAFTWIEDAGADVLAFRRGAGFACVVN
FT                   LGATPAARPDGEMLLASGPLAPDGAVPHDTAVWLRL"
FT   gene            68103..69530
FT                   /locus_tag="Xcel_0063"
FT   CDS_pept        68103..69530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0063"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: mlo:mlr2244 sugar binding protein of sugar ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29104"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTG2"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACZ29104.1"
FT                   /translation="MKSTHRAAAFGLAGALALSLTACSSGSSANDGGDAGSTDGTGDGS
FT                   GEVAQTTLRVVSLLPGSEQAAIDAFNAQVAEFEAANPGIDVVPEEYEWKATTFAAQLAG
FT                   GTLPDVFEIPFTDAQTLIANGQLSDLDAQFRTLPYADRFNPAIVAVGTGADGHVYAVPA
FT                   KNVYGVGLHYNRALFESAGLDPDDPPTTWDEVAEYAKKIADANPGVAGYMQMSQNNTGG
FT                   WQLTVQTYSRGGRVQALSDDGATATSTINNPATVEALEWLQAMRWEDNSLGSNFLLDWG
FT                   TINEAFAAGQVAMFTSGSDVYTSMIQSNGLDPAVYGLAALPLGDSPDVGVLSGGTLAAV
FT                   PAGVDDAVKDAAIAWIDFFYTAKLVDEARAVADAETLVKDNQPVGTPVLPMFGRDQWEQ
FT                   NQEWIKDYVNVPLDQMQSYIDSMFDLPLVNEPARRTQDVYALLDPIVQAVLTDQNADID
FT                   QLLTDADTQAQALLDQE"
FT   sig_peptide     68103..68192
FT                   /locus_tag="Xcel_0063"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.866 at
FT                   residue 30"
FT   gene            69538..70491
FT                   /locus_tag="Xcel_0064"
FT   CDS_pept        69538..70491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0064"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mca:MCA1942 sugar ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29105"
FT                   /db_xref="GOA:D1BTU1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTU1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ29105.1"
FT                   /translation="MTQLTDTPVPVAARPRRTPAAALVAWVRRGGPHHLVFFLPVLVIF
FT                   GVFSWIPIARSVVMSFQKTNLVAPPQWVGWDNFQFVLSDPLLGTAVRNTLWFAVLALVI
FT                   GYPLPLLAAVLMSEVRRAKGLYSALAYLPVVVPPVVSVLLWRVFYNASPSGVFNTILGW
FT                   VGLGPFPWIQDQTWAMPSLVLAATWAGAGGTVIIYLAALLSVPPELYDAAEVDGAGVWR
FT                   KVWHVTMPQLRGVLFITLILQIIATAQVFLEPYLFTGGGPANATLTVLLLIYRYAFQSS
FT                   LGGNYGAATALSLMLAVVLALFSLLYFRLTKRWSQG"
FT   gene            70488..71468
FT                   /locus_tag="Xcel_0065"
FT   CDS_pept        70488..71468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0065"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mca:MCA1924 sugar ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29106"
FT                   /db_xref="GOA:D1BTU2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTU2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ29106.1"
FT                   /translation="MTTTPAPAPDAVAPAAAATVPASVTRNASRGSRPSGDRTAVSVSD
FT                   WRRPSVRWGLGTSQIVLLVLLVVVGLGPLLLLARFAVTPTQDILRTPMDIFPNGIAWSN
FT                   LDTAWNDVQISRYFLNTVWLAAGSWASQLLVATTGGYLLSVLRPAYGKVVEALVLATMF
FT                   IPAVVLLVPLYLTVLDPPLLRSSLINSFWAVWLPAGASAFNVLLVRRFFDSLPREVFEA
FT                   ARVDGAGPYRLFWSVVLPMSKPILGVVSVFAIIASWKDFLWPLLVLRDPAIQPLSVRLP
FT                   SIQGTTDLGVFLAALAIATVIPIVLFLVFQRLFLSSAGLGGAVKG"
FT   gene            complement(71492..72403)
FT                   /locus_tag="Xcel_0066"
FT   CDS_pept        complement(71492..72403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0066"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: dvl:Dvul_0075 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29107"
FT                   /db_xref="GOA:D1BTU3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTU3"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACZ29107.1"
FT                   /translation="MELRHIRYFAGLAETLHFSRAALQLHMTQPALSQAMRQLESEVGA
FT                   KLLDRTTRQVTLTPAGQRLAHDARRILAAVEESEAAVRRIAAGGADVLRVGLTHCAAPA
FT                   LLPRVVKTLRATLPGVALKVRPDLLSGQIATEVGDGRIDVGIVRGAVTAVGLASAPAYA
FT                   EELLLALPEDHPLAHAATVTLKDLRTEEFVLPGPGSPLDPVVRRMCAGAGFIPVESTTT
FT                   DHASVAQALVAAGLGVAFLPAVLATATHPGVTFRSVPGAEMTTLSFVWRAESPTTLVSA
FT                   ALDALAGDGIVGQDLTARAHAG"
FT   gene            complement(72612..73346)
FT                   /locus_tag="Xcel_0067"
FT   CDS_pept        complement(72612..73346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0067"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: ppf:Pput_0861
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29108"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTU4"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ACZ29108.1"
FT                   /translation="MKNRRTKVLIAVAVAAALAVPGTAVAAEKLFKPKPAEYVSFITGD
FT                   TANIGNGVAFGANVAFYKSSGIGPAGNGLPSAQFTAEERLVPLDVFPDFATTHTLPAGV
FT                   TITEAQTINVLKAIGANLAAAGLTYEDVVDMRVFLQNPAGEEKMDYNGFNRGYRQFFAN
FT                   TNLATGATIDVPLGTGPAAPPLVVNPARPSRFALEVENLPVNGWLVEIQVDAIYPEDEP
FT                   APKGKKHKRHFGFNGFGWHWSR"
FT   sig_peptide     complement(73266..73346)
FT                   /locus_tag="Xcel_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            73674..75347
FT                   /locus_tag="Xcel_0068"
FT   CDS_pept        73674..75347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0068"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: xcc:XCC3278 flavin monoamine oxidase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29109"
FT                   /db_xref="GOA:D1BTU5"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTU5"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ACZ29109.1"
FT                   /translation="MTEKFDLLDKEAASGVSRRSFLQAVGIGSSAGVMLGAMGAIGLAP
FT                   TAAAHGNGPGGLAHKQDWRWRPPTKGDFHAKGKDNKKHVVVIGAGPAGLCSAYELQKAG
FT                   YKVTVLEARHRPGGRTLTVRPGDKETDIDGVTQVAKWDDGIYMNCGAGRVAQWMVTMDY
FT                   YRELGVPYEVMTNANAEAYLYNENRGSTPGNPTKYRTAKADFYGTVGELLTYATDQGSL
FT                   DAKLTEEDKVNLKAFLSSVGTLRDGVYWDAPSHANRGYAEYPTAWNFAETELPPTRPTM
FT                   SETLATRFGNYFQFENNWEQAMLMFQPVGGMDTTYQYFVRAIGQQNVFFNSPVTGVENT
FT                   SKGVKVTYKDKNSKSYQISADFAVVASPAHIARGFANNWGTDIDTGLGEFSKGSAAGKI
FT                   GLQYKSRWWETDHNIYGGITETDMDLQHIWYPSYGYGRKKGLIVGYYNTGNAASTYGAL
FT                   TPKDRETRAVAQGVKIHGEKYRTELERSFSIAWHKVPYIEGAWAYPNQSSTYFQKLQEG
FT                   AGNVFFAGDWMSEVSAWQHGAFWAARYAVQALHEKALATA"
FT   gene            75441..75623
FT                   /locus_tag="Xcel_0069"
FT   CDS_pept        75441..75623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0069"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: cha:CHAB381_1252 twin argininte
FT                   translocase protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29110"
FT                   /db_xref="GOA:D1BTU6"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTU6"
FT                   /inference="protein motif:TFAM:TIGR01411"
FT                   /protein_id="ACZ29110.1"
FT                   /translation="MGMLKPTHIILLVVIVLLLFGARRLPELARSVGQSLKIFKSEVKD
FT                   LTADGEQAPAVAPEA"
FT   gene            75647..76051
FT                   /locus_tag="Xcel_0070"
FT   CDS_pept        75647..76051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0070"
FT                   /product="twin-arginine translocation protein, TatB
FT                   subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatB
FT                   subunit; KEGG: vco:VC0395_A2428 sec-independent
FT                   translocase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29111"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTU7"
FT                   /inference="protein motif:TFAM:TIGR01410"
FT                   /protein_id="ACZ29111.1"
FT                   /translation="MLDINAGELLIIAVIAVVLIGPERLPQYVQQLATFARTAKGWFTE
FT                   VKDRVADELGPEVSDVDWSRLDPRKYDPRSIVRDALLDDLLPGGVRRPAGSVEDVVERR
FT                   PQGAVALSDDGPGGAGPAPVGVDERRTEVA"
FT   gene            76053..76883
FT                   /locus_tag="Xcel_0071"
FT   CDS_pept        76053..76883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0071"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: sat:SYN_00305 sec-independent protein
FT                   translocase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29112"
FT                   /db_xref="GOA:D1BTU8"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/Swiss-Prot:D1BTU8"
FT                   /inference="protein motif:TFAM:TIGR00945"
FT                   /protein_id="ACZ29112.1"
FT                   /translation="MVSLTSVPPYADATPDTRASSGPAPGRRKRMPLREHLAELRTRLL
FT                   LVAGGLVVGAVVGWLLYDPLLVLLTRPLHLAAATQHKDIALNFTALGSPLDTRIKVSLF
FT                   LAVMVTCPWWLYQVWAFVTPGLTRREKRHAYGFLGAAVPLFLGGAGLSWWVLPHAVDIF
FT                   ASFVPAGSSQYVNAQEYLSFVMRLVLAFGVAFVAPVLLVALNLAGIVRHETLARGWRWA
FT                   VLLAFVFAAVMTPTPDALTMVLVAAPICALYFGALGVAVWHDRRADRRTAPAAA"
FT   gene            complement(77009..77983)
FT                   /locus_tag="Xcel_0072"
FT   CDS_pept        complement(77009..77983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0072"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   sme:SMc04360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29113"
FT                   /db_xref="GOA:D1BTU9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTU9"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACZ29113.1"
FT                   /translation="MHDDEVAVTADDVRRLLAAQRPELAALPVTPHAEAGTDHRLFLLG
FT                   DASSPGGALLARLPRIGWAAEQAASDARWLPRLAPHLPLAVPAPVAVGHPDGAYPFPWS
FT                   IVPWLPGRAVGDPLGGKPLGFDAEDGARALGAFVRALRSLDPTDGPLKEGTSRGVPLER
FT                   LDPAVREALDAIAGSTASAPPVDVSAADRAWERALAAPPAPEPTWIHGDLLPGNLLAHD
FT                   GALTAVIDWGALGVGDPAVDLCPAWWLFDGGPRVTFLAEATVGVPDDVAAAAVDRARGW
FT                   VLVQAAIAIPYYDERWPAFAAAARRRLAAVLADDDARRRWAGR"
FT   gene            complement(77983..78510)
FT                   /locus_tag="Xcel_0073"
FT   CDS_pept        complement(77983..78510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0073"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; SMART:
FT                   Appr-1-p processing domain protein; KEGG: sun:SUN_1457
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29114"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTV0"
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /protein_id="ACZ29114.1"
FT                   /translation="MRATTELGDITRVDADAIVNAANSTLLGGGGVDGAIHAAAGPRLL
FT                   AACREVRRTTYPDGLPVGDAVATPAFDLPARWVIHTVGPNRHAGQTDPALLASCFTRSL
FT                   DVAADVGARTIAFPAVGAGVYGWSPDDAAVSAVGALRAWAGGSVEHVRFVLFNRSLLAA
FT                   FDAALAALEPRA"
FT   gene            complement(78585..83459)
FT                   /locus_tag="Xcel_0074"
FT   CDS_pept        complement(78585..83459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0074"
FT                   /product="ATP-dependent helicase HrpA"
FT                   /note="KEGG: esa:ESA_01693 ATP-dependent RNA helicase HrpA;
FT                   TIGRFAM: ATP-dependent helicase HrpA; PFAM: protein of
FT                   unknown function DUF1605; helicase- associated domain
FT                   protein; helicase domain protein; SMART: DEAD-like helicase
FT                   ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29115"
FT                   /db_xref="GOA:D1BTV1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTV1"
FT                   /inference="protein motif:TFAM:TIGR01967"
FT                   /protein_id="ACZ29115.1"
FT                   /translation="MSTAPAAPQPPSPDDDGRRRDGGRRRRGRREGQRDPRRGPEGAGQ
FT                   RGPQRTGQRGPRRVSRAHLDKLAATRTAVVVPPITYPEQLPVSARREDIATAIRENQVV
FT                   VVAGETGSGKTTQLPKILLDLGRGRAGQIGHTQPRRIAARSVAERIAEELRTTLGEIVG
FT                   YQVRFTDQSSEQTLVKVMTDGILLAQIQRDPELLAYDTIVIDEAHERSLNIDFLLGYLS
FT                   RLLPRRPDLKVIITSATIDSQRFAEHFSPSHLAALGGAPEAVVDVLPKAAPVVEVSGRT
FT                   YPVEIRYRPLVPEVSENGLQKKGEERDLVTGIIEACDELMRCGPGDILVFLSGEREIRD
FT                   ALDGLEGHLGARARDPRHPQHVEILPLYSRLSAAEQHRVFAAHPGRRIVLSTNVAETSL
FT                   TVPGIHYVVDTGLARISRYSKATKVQRLPIEAISQASANQRSGRSGRVADGVAVRLYSQ
FT                   ADFEARPEYTEPEILRTSLASVLLQMIAVGVVESPDEMARFPFVEKPDTRAVRDGVMLL
FT                   RELGALETVVEPTPAVVEPVETTPSPVVEPPSPVVEPVETTPPPSDVVSTGSTTGGRTS
FT                   TTGAGRTTTRLTTVGRQLAQLPMDPRLARMIIEGARRGAAREVAVIAAALSVQDPRERP
FT                   AEVRERADQLHARFADPTSDFLSYLNLWEYLRDQQRDLSGSAFRRLCKAEHLNYLRVRE
FT                   WQDVVAQLRQMANELGINLSSRASVVEPVETTPRVDGGVVSTGSTTAEGADDGQPRSGE
FT                   WRRVWDGDTIHRALLAGLLSQVGMQDTGEIKASSVAHLKGEARARALRQQAKRVRNEYL
FT                   GARGARFAIFPGSPLSKKPPAWVMAGELVETSRLWARDVARIQPEWAEELAGDLARRTY
FT                   SDPHWSTKQGAAMATEKVLLYGVPIVSDRPVLFARVDPEAAREMFIRHALVQGEWTTHH
FT                   TFFAENRRLLEEAEQVEARSRQRGLVASEDDLFAFYDERVPASVVSARHFDQWWSRARR
FT                   ETPDLLTFRLEDLVDVDAVDPSQFPSSWTQGELTLPLTYQFRPGSDADGVTVHVPLSVL
FT                   PRLSPSGFDWMVPGLLEELCVATIRSLPKAVRVQLVPAPDVGNAVAGWLRQNTPTWEDM
FT                   ARAGDMAEPFHVAFTRAVRALRDVVVPGDAWDTERVERLPAHLRMTFRVVESGVKSGGP
FT                   TTAAGSRGSGRGGRGRGRDGRGSPSAAAAVSPSGTGAAGAAIDESKDLLALQRRLAPKA
FT                   EAAVRAAVKGAVAVALEEARSRTAALSAGGSAEANPSVVEPVETTGRRVVSTGSTTGGG
FT                   GSTTGGGGSTTGRPGGSTTGGGRGVVAERLGLATWPDGLPDGRLPDVVSTDLGGGVVVR
FT                   GYPALVEEPGPKQEPTVALRILADALEQPATHARGVRRLLLAENRLTAGRVTSRWSGTQ
FT                   ALTLAASPYRNTNLLAEDLQLATVMALTSPAADLAPGTPAGPHAVQIRDAESYNAAKAH
FT                   VRTHLEDETYRVAGHVVAALTAWRTLESEVRKTSSLALLNTLQDIREHAATLIHDGFVS
FT                   ATPPRRLPHLVRYLRAASYRLEKAQASPHRDAELAWRIHDVEEAYAKARAAYAAGPADA
FT                   ARAAELAEVRWLIEELRVSLFAQQLGTDGTVSEKRIRKTLAPNGW"
FT   gene            83592..83960
FT                   /locus_tag="Xcel_0075"
FT   CDS_pept        83592..83960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0075"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_7720 plasmid stability protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29116"
FT                   /db_xref="GOA:D1BTV2"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTV2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29116.1"
FT                   /translation="MTDKTSVDKTITVRGIDEELHRQLKVQAKKHGRSMEAEARAILAA
FT                   GVRTGVVELTYPDLRVQVDDLTGVFDEHGKERYPHTAGDDWLSRFRRRLIPLWDGDEWD
FT                   DDWLPEREHAPSPPVVFE"
FT   gene            83957..84379
FT                   /locus_tag="Xcel_0076"
FT   CDS_pept        83957..84379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0076"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   mpo:Mpop_0728 PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29117"
FT                   /db_xref="GOA:D1BTV3"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTV3"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACZ29117.1"
FT                   /translation="MILLDTNVVAELMKARPDVRVEHWAHQAGHERMWASSPVVGELTF
FT                   GALRLPPGRRRSGLLDRLTEFLGVVLDGRLASFGPDEALAYGRIKAARERAGRVAGDVD
FT                   VMVAAIAVTRGGCVATRNVRHFEGFGVDVVNPWEAS"
FT   gene            84506..86272
FT                   /locus_tag="Xcel_0077"
FT   CDS_pept        84506..86272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0077"
FT                   /product="GAF sensor hybrid histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; GAF
FT                   domain protein; response regulator receiver; regulatory
FT                   protein LuxR; histidine kinase dimerisation and
FT                   phosphoacceptor region; SMART: GAF domain protein; response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; regulatory protein LuxR; KEGG: ade:Adeh_1998
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29118"
FT                   /db_xref="GOA:D1BTV4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTV4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACZ29118.1"
FT                   /translation="MTSTADITAPGVGSTASAQRRLDSLAAMANDLAGHFELVPLLGRI
FT                   LRHTMELLGCDSGSVCTVDEVAGTYRKEVDLGVVCEEGRTFPLAEGVTGAVVRARASVV
FT                   LDEYAQVPGGHIPEPERSALHGVIGVPIRWNDTIIGACVVFSRDPGRRFGDDDARLVEL
FT                   FAAHAAVAITNARLHAQAAERTAEAATAAERERVVRDVHDTVGRGLAAVLLHLDAARIP
FT                   AARTAARAALAETRRTVLGLGPELLDGRSLGEAIGLEVAWVESTAGAAARLVAVGEPRA
FT                   LAPEVARQLFRIVQEALTNVVAHAGARSVRVGLVYGDASVTAIVEDDGRGFDPEALRRG
FT                   GAALGLRGLVARARHLGGTALVDSTPGWGTRVRAEIPYAPDGVGRPGRERWRVLVVHPS
FT                   PLARAGLVRMLEVTEPDVQVVGEIADPAQAVEAYGLLHPHVVLTPLHMPHVDGVQLTSY
FT                   LRAVDPHAAVVLVVDTVADDRVREAASGGAVGFVTPDVDAGGLARAVVAAARGDQLVAA
FT                   DLFGAVPSGGGGHVQRLTPRERQVRGLLEEGLAYKQVASRLGISIKTVEKHVGAVLHKT
FT                   GAPSRAALNALP"
FT   gene            86375..87235
FT                   /locus_tag="Xcel_0078"
FT   CDS_pept        86375..87235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0078"
FT                   /product="ketose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: bha:BH3786 fructose-1,6-bisphosphate aldolase;
FT                   TIGRFAM: ketose-bisphosphate aldolase; PFAM:
FT                   ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29119"
FT                   /db_xref="GOA:D1BTV5"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTV5"
FT                   /inference="protein motif:TFAM:TIGR00167"
FT                   /protein_id="ACZ29119.1"
FT                   /translation="MPVVPLKELVDAAFAERYGVPAINIVNDLTLEAVLAGASQARSPL
FT                   IVQTSVKTVKAYGAKVLFGMWQTMTEGIDVPVTLHLDHCPERDVITECLGIGWNSVLFD
FT                   ASTMPVAENQRQTVEVVAEARAHDAHVEGEIESIKGVEDGIGSDTEPRRHSLETSLTFL
FT                   RETGVDVFAPAIGNAHGVYSHRPDLDFERVTELVEATGVPIALHGGSGLDDDQFSDLIA
FT                   RGAAKVNISTQLKITYMQANLAFLRDVAEPADKWDPPSLFTHVRQAVVDMTVGLAQRFG
FT                   SAGKA"
FT   gene            87248..87994
FT                   /locus_tag="Xcel_0079"
FT   CDS_pept        87248..87994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0079"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: CPLD2; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29120"
FT                   /db_xref="GOA:D1BTV6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTV6"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ACZ29120.1"
FT                   /translation="MPALIFDCDGVLADTERAGHLPAFNRTFAELGVPVQWSDDEYREL
FT                   VRIGGGKERMRSLLTPEFVAAHGYPADEDGQAALLREWHAHKTAAYTALVDAGELPARP
FT                   GIPRLVAEADDAGWQLAVASTSAEPSVRAVLTHAVGEDLAQRFTVLAGDIVARKKPAPD
FT                   IYLLALERLGVGADEAVVVEDSGGGLAAALAAGLRTVVTVSAYTADDDFTGAALVVPDL
FT                   DHGPGPDGTGGPVTVATLTRLLTEDA"
FT   gene            87991..88647
FT                   /locus_tag="Xcel_0080"
FT   CDS_pept        87991..88647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0080"
FT                   /product="dihydroxyacetone kinase, L subunit"
FT                   /note="TIGRFAM: dihydroxyacetone kinase, L subunit; PFAM:
FT                   Dak phosphatase; KEGG: bcr:BCAH187_A1134 dihydroxyacetone
FT                   kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29121"
FT                   /db_xref="GOA:D1BTV7"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTV7"
FT                   /inference="protein motif:TFAM:TIGR02365"
FT                   /protein_id="ACZ29121.1"
FT                   /translation="MTTPSFADVEFVVRSIARTCLDNEKEFGDLDAVVGDGDFGYSLAR
FT                   GFEIVDNDWDSFDRADIGTFLQKIAVTITSRIGGTSGPIWGTAFLRAAGQVKGQTELTG
FT                   DDVVRMLRAAVEGIKQRGASDVGDKTLLDALVPLTDTIEASIGAGKAPADVVADAAASA
FT                   RQAADATTSMLARRGRAAYTGERSIGSPDAGAVAVAVITERLAAEWATRAADHLL"
FT   gene            88657..89652
FT                   /locus_tag="Xcel_0081"
FT   CDS_pept        88657..89652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0081"
FT                   /product="dihydroxyacetone kinase, DhaK subunit"
FT                   /EC_number="2.7.1.29"
FT                   /note="KEGG: gdi:GDI0263 putative PTS-dependent
FT                   dihydroxyacetone kinase; TIGRFAM: dihydroxyacetone kinase,
FT                   DhaK subunit; PFAM: Dak kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29122"
FT                   /db_xref="GOA:D1BTV8"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTV8"
FT                   /inference="protein motif:TFAM:TIGR02363"
FT                   /protein_id="ACZ29122.1"
FT                   /translation="MKKFVNDPKQFVPQMLQGLALANPDTLTYVPDYNLIMRKDAPRDD
FT                   KVSIVQGSGSGHEPAHVMTVGKGMLDGACPGDVFSAPPMDYVYETAKLLASPAGVLLLV
FT                   NNYTGDRMAFEMASELAEADGLKVKTLFIDDDVAVQDSTYTVGRRGVAGNFFVMKAVGA
FT                   ASEEGADLDELLRIGQKVNSVTRTMGLALTPCTPPAKGSPLFELPEDEIEIGVGIHGEP
FT                   GRRRGRLGTADEMLAEILEPVVKDLPFSSGDRVALMINGLGGTPISELYLLYGRAHQQL
FT                   TDRGIEIGRSYVGEYCTSLDMAGASLTLVRVDDEIERLLAAPAEIGVRIF"
FT   gene            complement(89655..91274)
FT                   /locus_tag="Xcel_0082"
FT   CDS_pept        complement(89655..91274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0082"
FT                   /product="urea amidolyase related protein"
FT                   /note="KEGG: hypothetical protein; TIGRFAM: urea amidolyase
FT                   related protein; PFAM: Allophanate hydrolase subunit 2;
FT                   Allophanate hydrolase subunit 1; SMART: Allophanate
FT                   hydrolase subunit 2; Allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29123"
FT                   /db_xref="GOA:D1BTV9"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTV9"
FT                   /inference="protein motif:TFAM:TIGR00724"
FT                   /protein_id="ACZ29123.1"
FT                   /translation="MRILPAGDTALLVELDTLAQATALLASLVADPIPGAGEPVPGART
FT                   LLVPFRPHAVSASGLAAALRSRPLVRPDDDVARVVDIPTVYDGEDLTSLAALLGWSPEE
FT                   LVRRHTAATWTVGFMGFAPGFSYLTCTDPAWPQVPRLGSPRTRVPAGAVALAGPYAGVY
FT                   PRVSPGGWQLVGQTDAAIWDATRTPPVLWAPGDVVRFQPVPPDAVNATRRAPGAEPAPI
FT                   VPGADATPDLDAGRAVLVVDAGRGTLIQDLGRTGVAHLGVGQSGAADPRSLRAANRAVG
FT                   NPPGAAAIETEGLLRIRASGDVVVALTGALVTAHVRRDAAGGGVRERPAPSSVPFLLHD
FT                   GEELALGEPTRGRRTYVAMRGGVDVPVTLGSRSTDTLGGVGPAPLTAGTVLPVGADVAA
FT                   AVETGDVGAPDPASLPTPGQTTTLRIVVGPHPDWFDDGAATLTAQEWEVTALADRVGIR
FT                   LAGRPLRRTAARADAELPSEGMVTGAVQVPPNGQPILFLPDHPVTGGYPPVAVVVTADL
FT                   PLLGQLPTSARVRFARTDEPGA"
FT   gene            complement(91277..92191)
FT                   /locus_tag="Xcel_0083"
FT   CDS_pept        complement(91277..92191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0083"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: rfr:Rfer_0870
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29124"
FT                   /db_xref="GOA:D1BTW0"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTW0"
FT                   /inference="protein motif:PFAM:PF03746"
FT                   /protein_id="ACZ29124.1"
FT                   /translation="MGAVDLNADLGEGFGQWTLGDDAAMLDVVSSANVAGGFHAGDPAG
FT                   IRRTVRLAAERGVVVGAHVGYRDLAGFGRREMDVPSAELQADIVYQLGALQGLAAAEGT
FT                   RVAYVKPHGALYNSAQVDERIAHDVAAAVAAVDPTLVLLGLPGSAALAAAGALGLPTAA
FT                   EAFADRAYTPAGTLVSRREPGAVLHDPELVAARMVRLVTDGVVEAVDGSLVPVRVDSIC
FT                   VHGDSPGAVGLARRLREALTAEGIAIGPFATLLGTAAGAAVGAGAAGPADAAGGSTTRA
FT                   RFVGPGPRTEPMPTNRPAGTREG"
FT   gene            92466..94634
FT                   /locus_tag="Xcel_0084"
FT   CDS_pept        92466..94634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0084"
FT                   /product="peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin"
FT                   /note="PFAM: peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin; PT repeat-containing protein; KEGG: similar
FT                   to microtubule-associated protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29125"
FT                   /db_xref="GOA:D1BTW1"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTW1"
FT                   /inference="protein motif:PFAM:PF02557"
FT                   /protein_id="ACZ29125.1"
FT                   /translation="MVSGLSAGVLAAGVLAGTAASSLPGAPGTAAADGAPALAASATVG
FT                   ETAAVSIGLVGGTVTSIPETLDQIFALLERAERAAHDSGREITPAISQAAAELGMLLTT
FT                   YLAQHDDVAATVGDDADLATAAAAAAGATLPEPVAPRATTDPQVADGAAARKSTAGDES
FT                   SADESATNDAAVDESGDSDQTAATADNAAADAAAAGTAAEAEAEAEADAEADAAGDVAD
FT                   ADADAGADAAGADADAAADADDAPTADEQPEVTFDDVVLAAMRLATLLDSEGVYRVAVS
FT                   GAAPLTGEGTPLTTMLRDAVERYGRSTDGYANGRIPADVLCALPFASGHRLRCDAAAQL
FT                   VALNAEYEAKFGRSIPMTDSYRTLESQIVLKVKKPRLAATPGHSLHGWGIAVDLGAPIS
FT                   SGTSREYLWLRLNGPDYGWDNPSWARLDGSKPEPWHFEFFAAGPTPDRALSAEDVALYR
FT                   AASSAPAGSATQQPTSSSTPEATPTPTPSPTPSPTPSTQPTPTPSTKPTPTPSTKPTPT
FT                   PSSEPTPTPSTKPTDPAVDPSTDPTGQPSTDPTTDDPTDSPSDEPSDEPTDPTTSDPTD
FT                   PTTGEPSDEPTGPTTEDPTGPPTDDPAGELTDDPSGEPTDGSTGEPSDGSVGGDPAREP
FT                   GGDPTDTATDPVGDSAGDPATGPAAGQNENPADVGTQDVPPSDVATGPEPATTPTRGSD
FT                   DPGDPDDPDTTDDPDTPGTDPAALDDAA"
FT   sig_peptide     92466..92564
FT                   /locus_tag="Xcel_0084"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.774 at
FT                   residue 33"
FT   gene            94935..95300
FT                   /locus_tag="Xcel_0085"
FT   CDS_pept        94935..95300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0085"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   mag:amb0333 anti-anti-sigma regulatory factor"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29126"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTW2"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ACZ29126.1"
FT                   /translation="MDLDQTEQRTATGSGISCRTTADGTVVTLWGEVDAALREAAGEVM
FT                   ALLAVHATGIPVVIEAKDVTFIDSSGIAFILQVYVLGQETGTPVSLRDPSEAVVEVLDM
FT                   VGIGGRIPVVHESGEAS"
FT   gene            95336..96016
FT                   /locus_tag="Xcel_0086"
FT   CDS_pept        95336..96016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29127"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTW3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29127.1"
FT                   /translation="MALGLLALLAVGADRGAAWATSESVTAAVERGGTDVVDADVQIHG
FT                   FPFLTQLAAGSLERVTASLERGSFGGYGVSDVSIDARGVRPRSPWTTRQASADGVVAFD
FT                   TIAAVMSERLGTDVTMGPAPGDPGAITLGTSVTVLGAAVDVSAVVLPDVVDGELAVQVR
FT                   GVSVGGADVAVDALPGGLGDRLSGLRIPLDLPDGITLVGARGETDGVRLTIDARDVALD
FT                   AVAW"
FT   sig_peptide     95336..95398
FT                   /locus_tag="Xcel_0086"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.877) with cleavage site probability 0.840 at
FT                   residue 21"
FT   gene            96099..96983
FT                   /locus_tag="Xcel_0087"
FT   CDS_pept        96099..96983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0087"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   bxe:Bxe_C1316 polar amino acid ABC transporter periplasmic
FT                   ligand-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29128"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTW4"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACZ29128.1"
FT                   /translation="MRTRPALLVATAVAATLTLGACTSASQDQGGSAPSAAATVVKDEA
FT                   IAALVPAAVAADGKLTVAAELSYAPLEFVDADGKTPVGLDIDIATAIATVMGLEVDVQS
FT                   AQFDSIIPAIGTRYEVGVSAFTITPERLETVTMVSYFSAGSQLAVQAGNPDGVDPDDLC
FT                   GLTVGVQTGTVQQEELEELSAACETPIEILPYDSQATVTANLVGGKLQAMYADSPITAY
FT                   AVEQADGALETLGEIRDAAPYGVVVAKDDPELAEAVRAALQQLMDDGTLAEIAAHWGNE
FT                   AGALTTAEINPAV"
FT   sig_peptide     96099..96179
FT                   /locus_tag="Xcel_0087"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.373 at
FT                   residue 27"
FT   gene            97026..97922
FT                   /locus_tag="Xcel_0088"
FT   CDS_pept        97026..97922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0088"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   bxe:Bxe_C1316 polar amino acid ABC transporter periplasmic
FT                   ligand-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29129"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTW5"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACZ29129.1"
FT                   /translation="MRTRSTLPVALVAVAALALSACSSASQDGDAGATGEAFDLASITK
FT                   DADIAALVPAAVAEDGKLTVGSDLTYAPAEFVDTDGKTAVGFDIDIIRAVANVLGLELD
FT                   VQSATFDSIIPAVGTRYEVGVSSFTITPERLDAVSFVSYFDAGSLFAVAEGNPDGIDPE
FT                   NLCGATVSVQTGTIQLDALNAANETCDEPIKLLTFESQADVTSNLVNGRAQAMYADSPV
FT                   TGYAVLRADGAIELLGEIHDSAPYGIVIPKDDLELGEALRAALQKLMDDGTLAQVAGAW
FT                   GQAEGVLATAEIKTAAG"
FT   sig_peptide     97026..97103
FT                   /locus_tag="Xcel_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.403 at
FT                   residue 26"
FT   gene            98098..98223
FT                   /locus_tag="Xcel_0089"
FT   CDS_pept        98098..98223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29130"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTW6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29130.1"
FT                   /translation="MPSYAAPKLTRIGSFKTVTKSLGKAPHNDIFRRPAVFVIYL"
FT   gene            98337..100238
FT                   /locus_tag="Xcel_0090"
FT   CDS_pept        98337..100238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0090"
FT                   /product="asparagine synthase"
FT                   /note="PFAM: asparagine synthase; KEGG: mag:amb0105
FT                   asparagine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29131"
FT                   /db_xref="GOA:D1BTW7"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTW7"
FT                   /inference="protein motif:PFAM:PF00733"
FT                   /protein_id="ACZ29131.1"
FT                   /translation="MPVVVVPDTPLPPGMAADLVDRVGPVLFRHRSGRAWILGTTDGRR
FT                   VVRARTRFVDVVLLGDGSHETDEAALATAVADARSVDGVPAERFTEADVLLFARSDGRM
FT                   RSQAPPFLTRSLCWTTVDDVPVISDEQLTLQRLADLAPDVDVLASRLTDGEISVPFGLR
FT                   SVWSGLHPLRPGQWLDSRAREAPRPVTWWRPPRPERSLDDLSGELSDALSAALRTRLGA
FT                   HREVSADLSGGLDSTTLSFVLADVLDRPHHTLFLASDNVANGDRPWAARAAEELGTRHV
FT                   VVPYRSVLPQITDAAAGTIDTAPEGPSIASVSAAAVPLIEEVLRGTGSTLHLNGHAGDA
FT                   LFGPVSTVLWSLARSRAKGRWRQLWRQRLVNRYPLGATVRMLAQRGTYRDDLERFARDD
FT                   FRQPEDELATYARWAALPRVHPALTDAAREHVRNLARRELAEGHDGYGADRTVHQIVHF
FT                   LTVHGADVRRMNHARTPGAAVTFDSPLLDRRVVEAALALRIGDRARQYPVKPLLAAARP
FT                   PRMAIDYFTRSDKGDYTAEVFEQHRAIAPTVRELFADGSVLEDLGLVSGERVLRSVTQF
FT                   SVDGSEYRDLDQIVFTERWLRSLPAGQPAGQPAGQPAGQPTASADPRHREGEHAPCA"
FT   gene            100229..100489
FT                   /locus_tag="Xcel_0091"
FT   CDS_pept        100229..100489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29132"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTW8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29132.1"
FT                   /translation="MRLKEGLEIVDVEDGRVLLDSRKGVYWHLNASAIGVLEALAQGRT
FT                   VDDVVRDVVRQTGADEAVVRADHVELVRELRKARLITGEPS"
FT   gene            100486..100911
FT                   /locus_tag="Xcel_0092"
FT   CDS_pept        100486..100911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0092"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmn:BMA10247_0853 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29133"
FT                   /db_xref="InterPro:IPR032708"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTW9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29133.1"
FT                   /translation="MSAPVLAERLTRLGLRQALPARLATTTAFVVAALPPWAIRAVLTV
FT                   AVRGARPAAAPDVLGWRTAVNSVSRRCAGQGCLQRSIAVVLLARLHGVAPAWKTGFRPD
FT                   PFVAHAWVEVDGEPVGEPAAVAHFRAVLSVNPRPARP"
FT   gene            100944..102764
FT                   /locus_tag="Xcel_0093"
FT   CDS_pept        100944..102764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0093"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   bcb:BCB4264_A1961 ABC transporter, permease/ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29134"
FT                   /db_xref="GOA:D1BTX0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTX0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ29134.1"
FT                   /translation="MAQTSVMTEERRGADDAAPAPAPPPRTAGLGDVFRLLGPYRGRMV
FT                   VAFALGLVSTVVGALQPQVVARAVDAFDGSVPGATIGLMVGLLLASALFTNAQQLVMER
FT                   SGELFAFHTRRRLVRHLYTLPIGVLERRDRADLVSRITTDVSQLRMVMSSGIVELATSV
FT                   VAVVVSIVMMALIDGLLLALAVATIVVALVVIVLIGRGTTPAGLRLQDALGRLAGSVTR
FT                   SLGSLRTIRATVSTDREADVTVGEAEEVLKAGYAAATYRAAIQTFASVTIQILLIVIVA
FT                   VGALRVAAGELGVGELSAFIMYLMLMAAPITLSAGIFAALGEAMGALSRVLAVHDIEVE
FT                   QDVQVPPAVPVAGAGDAPTFELVGVGFRYPEHPDAEPGGEAWALRDVSLRFAAGTTTAV
FT                   VGPSGAGKSTIFALLERFYDPTEGEIRFRGQDVRRLSREELRRQIGYVEQDAPALSGTV
FT                   RDNLLLGAHDASDAACTEVLRQVNLLAPGTDPAALLDTQVGETGELLSGGERQRLAIAR
FT                   ALLADAPILLLDEVTSNLDSNNERMIQALIGSADRRRSVVVIAHRLSTVVSADAIVVVD
FT                   GGRVVAQGTHHELLGTSELYRELARNQLLG"
FT   gene            complement(102780..103442)
FT                   /locus_tag="Xcel_0094"
FT   CDS_pept        complement(102780..103442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0094"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: scl:sce5431 two-component
FT                   system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29135"
FT                   /db_xref="GOA:D1BTX1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTX1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACZ29135.1"
FT                   /translation="MEQSPIRVLLADDDARLRSVYRKLLDRTEGFVVVAETGDGAEAVR
FT                   LARERTPDVALLDVQMPGLSGLDAARAILAGGQVRVVMLTTFDLDEYVHDALTAGVSGF
FT                   LLKNATPAEVLAAVRSVHAGHALLAPEVTGRLIRHLAPPRPDHPHPFVGKVLSQREVDV
FT                   VRLVALGRSNQQIADELVLSLETVRTYLRRMFAKLDVNDRTQLAVLAYRAGLLHESR"
FT   gene            103548..104675
FT                   /locus_tag="Xcel_0095"
FT   CDS_pept        103548..104675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0095"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   KEGG: ccs:CCNA_01207 two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29136"
FT                   /db_xref="GOA:D1BTX2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTX2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACZ29136.1"
FT                   /translation="MVRRLVDLLAVVVVVGVFWLPATLEARSAARLTAGLVLAAAVACA
FT                   MLVRRRVPTTAVLVAGTATVVATALGTCQDFMVATAWCLYPLALRSAARTRRLIRVLVV
FT                   ALLATAAIAGIPPGQGSQVVQSTILSVAALCVAWLLGGMVGRQIELARQAESARVRLEV
FT                   ARDVHDVVGHALGLVSAEAGVVRSLPDADERELRESLADIEVHARRALEEMQSLVRGLR
FT                   GLPGLPGPHGGSTGPLRPAGPPAERLTELVDATRATGVAIDARIDLDAPVGEEVAAFVV
FT                   RVLQESLANVVRHAPGAACTVVVEPDGDDVVVRVRDDGTGSGGRPGAGVGLRGMRERAR
FT                   LVGGAVAWGRAPDGGFEVTARAPRAAPWQGLSTFG"
FT   gene            104711..105415
FT                   /locus_tag="Xcel_0096"
FT   CDS_pept        104711..105415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0096"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mxa:MXAN_6827 sodium ABC transporter ATP- binding
FT                   protein NatA"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29137"
FT                   /db_xref="GOA:D1BTX3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTX3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ29137.1"
FT                   /translation="MIQISNLTKRYRGAAAIQDVTFTARPGRVTGFLGPNGAGKTTTLR
FT                   ILLGLAAPTGGTATFDGRRYRDLRAPLRTVGALLDGPGALPDRRAVDHLTWIARSNGIS
FT                   PRRVGAVLELVGLSDVRRRRVRTFSLGMGQRLGIAAALLGDPEVVVLDEPANGLDPDGI
FT                   RWVRTQTRRFAAEGRTVLVSSHVMAEMAETADDIVIIDKGRVLATGSLAEVTGGHASLE
FT                   QAFFATIGGGAR"
FT   gene            105412..106203
FT                   /locus_tag="Xcel_0097"
FT   CDS_pept        105412..106203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0097"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH02708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29138"
FT                   /db_xref="GOA:D1BTX4"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTX4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29138.1"
FT                   /translation="MTMTRLVRAELTKIGTQRSVWVAMGVVLAIQVFAGWQALSLYAGA
FT                   VARMTPDGIVEVFTGQPQAANQAMIENLVSSSLEMSMFLPVVAALLAGQEFQHRQLRTS
FT                   LLAVPARGHLVAAKLASATVFLLVPVLLVVATSTTFTYLAIKDWNPGLLLEPAALRGQV
FT                   GFVGYALALCLVTAAVTMLARSTVVAIVTVVVLTVISMAQVLPAAVDALLPVSAGRNLL
FT                   LDPVSATDLTGGATLAAVVLVGWVVITAASAAVSIARRDAP"
FT   sig_peptide     105412..105516
FT                   /locus_tag="Xcel_0097"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.872) with cleavage site probability 0.842 at
FT                   residue 35"
FT   gene            106200..106943
FT                   /locus_tag="Xcel_0098"
FT   CDS_pept        106200..106943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0098"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29139"
FT                   /db_xref="GOA:D1BTX5"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTX5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29139.1"
FT                   /translation="MRGPSATDRVRAELLKIWTTPATWAALAVTLAAHVLLGWIAGGTE
FT                   LRIAGTSGAVPLGQSGALMLAPVYVFAAVGVFAAGTEFAGGQLRTSLLAVPGRAALFAA
FT                   KLTATALVCTVAAVVVVAPGYVLQHRVALADGRLPWSDVAAGIGSRVAVHVLLAVVGLG
FT                   VAWLARSVVVPMIVLVVVGLLAAPTLRDSVPAVVARLPHDAALSAVGTPAGPEALTRTA
FT                   GLAALALWGAVLAAAAWAALARRDA"
FT   gene            106936..107637
FT                   /locus_tag="Xcel_0099"
FT   CDS_pept        106936..107637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29140"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTX6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29140.1"
FT                   /translation="MPERHVERGRVYDLITVQGPAPVGRPPAQLNLAPGESATVGVCRC
FT                   GSCDLSLRVDDVGAEAFAAQITAAHGYWLVANLSAHHPMTVENVDDRNQYLIVDPGRQG
FT                   MPVPFELSQVGPAAAPSAPKVVVFGAEPRSAPSRARACPAARTRPFLDSGALYFRVLRE
FT                   LCRPRLQGRWGAPLPTSSTIATTLSTGSQPLSTRAVDAHIRYVSQKVGLSPGSGREALV
FT                   ALAIRSGVFLR"
FT   gene            107746..108702
FT                   /locus_tag="Xcel_0100"
FT   CDS_pept        107746..108702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0100"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bxe:Bxe_C1161 polar
FT                   amino acid ABC transporter inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29141"
FT                   /db_xref="GOA:D1BTX7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTX7"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACZ29141.1"
FT                   /translation="MSDPIPDRLHARPVPRPGRVVGAVVVLVLAAMAVHGLVTNTTFRW
FT                   DTVWLYWRDIVVIRGIGWTLVLTFGSMALAVTMAILLAVMRRSDNPVMRGVSWFYIWFF
FT                   RGTPVFVQLTFWGLLSVLYPTLGLGIPFGPEFVTFETKAVVTVFWAALLGLAFNEAAYL
FT                   AEIVRAGLTSVDPGQAEAAKALGMKDTTILRRIVLPQAMRVIVPPTGNETISMLKTTSL
FT                   VIAVPFTLDLFYATSAIGNRLYQPIPLLVVASIWYLVITSILMVGQSYLEKYYGRGFGT
FT                   ESPARRRRPGPGGRPTRQQAIQAAGTTKDDPFLEVTP"
FT   gene            108699..109487
FT                   /locus_tag="Xcel_0101"
FT   CDS_pept        108699..109487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0101"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rle:pRL80063 putative ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29142"
FT                   /db_xref="GOA:D1BTX8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTX8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ29142.1"
FT                   /translation="MTATPDVMVELTGIHKEFGHGHSAVHVLRGVDLTVPRGSVTVILG
FT                   PSGSGKSTLLRCINELEDITAGSVVVDGERMGYRVDAKGVVHRLHPKVVARQRRRIGMV
FT                   FQRFHLFPHLTATANVMEAPMRVRGLSKADARTQALDLLRRVGLADRADHYPAQLSGGQ
FT                   QQRVAIARALAMDPELMLFDEPTSALDPELVGEVLAVMKDLAASGMTMIVVTHEIGFAR
FT                   EVADEVVFMDQGVVVEQGPPSEVLDAPREQRTRDFLAHVL"
FT   gene            complement(109525..110481)
FT                   /locus_tag="Xcel_0102"
FT   CDS_pept        complement(109525..110481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0102"
FT                   /product="Excalibur domain protein"
FT                   /note="PFAM: Excalibur domain protein; KEGG: xau:Xaut_0293
FT                   translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29143"
FT                   /db_xref="GOA:D1BTX9"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTX9"
FT                   /inference="protein motif:PFAM:PF05901"
FT                   /protein_id="ACZ29143.1"
FT                   /translation="MAVRFNPPPGWQVPAGFRPEPGWSPDPAWPTAPADWQYWVDDAVA
FT                   PPAPPTPHAAAPAAPAPTTLIPPVAAPAPPVAPAPAASPTPPASLAPATPTSTSASASA
FT                   SASARTRSVARQGAAIPLPAGPLGHLRAPSPSPSGPDTAAGTSASNGAARKGGTSPWLI
FT                   PGVAIACFAFGVIIGVVASLVQASDAGQATIDAQRAQAQVIEDREDLKAQRSDLEADKT
FT                   ALVEREQDLAARETAVNQKEAEQVARQNELDELAQQAQQNQQSQQNQQRQQGERNSGSG
FT                   FQTCDQLRANGYQTPIAKGDPGYHRFLDLDGNGVACE"
FT   gene            complement(110699..110902)
FT                   /locus_tag="Xcel_0103"
FT   CDS_pept        complement(110699..110902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0103"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: mxa:MXAN_1617 cold-shock protein CspA"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29144"
FT                   /db_xref="GOA:D1BTY0"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTY0"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACZ29144.1"
FT                   /translation="MATGTVKWFNAEKGYGFIAPEDGSQDVFAHYSAIQTNGYRTLEEG
FT                   QRVEFDTAQGPKGLQAENIRAL"
FT   gene            111270..112538
FT                   /locus_tag="Xcel_0104"
FT   CDS_pept        111270..112538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0104"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   csa:Csal_1418 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29145"
FT                   /db_xref="GOA:D1BTY1"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTY1"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACZ29145.1"
FT                   /translation="MIRRHAAVQGIALAAALGLGLAGCAGSSEGADGDGSAEALKIGTI
FT                   LPLTGTLAFLGPPEVAGVGLAVDDINEAGGVLGNDVIVESGDSGDTTDLSVARSTATDL
FT                   IGKGVSAVIGAASSGVSLAVVDQFEEAGVMEVSPANTATDLSGYGEYFARTAPPDTVQG
FT                   AALGSLIIDDGHTSVGFLVQNEAYGNGLRDNTQKSVEAGGVTAVYGATGAGQEFPPGET
FT                   NFGSQVTNLLAQKPDAIAVIAFEETVAIVTELAAQGWDFDGTTYFVDGNLSNYGDKFDP
FT                   GTLKGVQGTLPGAQAEDDFRDRLNTWSEENENTTLEDFSYAAESYDATILVALAAVRGG
FT                   ATDGKTISENIRAVSGSEGGTEVRSFADGVKALEAGDEIVYKGFSGTGPLDENNDPSSA
FT                   FIGIYLYGADNTYTYVKSVEGKS"
FT   sig_peptide     111270..111362
FT                   /locus_tag="Xcel_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.871 at
FT                   residue 31"
FT   gene            complement(112854..113714)
FT                   /locus_tag="Xcel_0105"
FT   CDS_pept        complement(112854..113714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0105"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sit:TM1040_1274 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29146"
FT                   /db_xref="GOA:D1BTY2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTY2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ29146.1"
FT                   /translation="MTSEPTPVVDPAPVVEPVETTPRPEQKVVSTGSTTGVAVSTGSTT
FT                   GVTPLLRAESIVAGYLPGVNILNGCSIEVGKGELVGIIGPNGAGKSTLLKALFGLVPVR
FT                   SGRVTLGGDDITGMRANRLVARGVGFVPQTNNVFPSLSVEENMRMGVFLSPQLFAERWA
FT                   FISELFPTLYDRRAQRAGAMSGGERQMVAMARALMMNPSVLLLDEPSAGLSPVRQDETF
FT                   LRTRMINRSGVSVIMVEQNARRCLQIADRAYVLDQGKDAYTGTGRELQADPKVVSLYLG
FT                   TLAEA"
FT   gene            complement(113711..114619)
FT                   /locus_tag="Xcel_0106"
FT   CDS_pept        complement(113711..114619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0106"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dsh:Dshi_1981 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29147"
FT                   /db_xref="GOA:D1BTY3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTY3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ29147.1"
FT                   /translation="MATDASTTAATALAPVDGTVGVAKPDPILVVDGVQRRFGGMTAVD
FT                   VDHLEVQRGAITALIGPNGAGKTTLFNLITGFDQANHGTWSFDGKSIAGKSGAAVARSG
FT                   MVRTFQLTKALSRLTVLQNMLLATPNHPGERFWLSWLPFTWRAHERAAEVKALEILERF
FT                   KLVEKKDDFAGSLSGGQRKLLEMARALMTDPTMIMLDEPMAGVNPALVQSLLGHVQALR
FT                   DEGMTVLFVEHDMHAVRHISDWVVVMAEGRVVAEGPPTTVMQDQAVVDAYLGAHHDTDL
FT                   GDDSLLDTAMLARLELEEEKR"
FT   gene            complement(114609..115595)
FT                   /locus_tag="Xcel_0107"
FT   CDS_pept        complement(114609..115595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0107"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rru:Rru_A3415 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29148"
FT                   /db_xref="GOA:D1BTY4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTY4"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACZ29148.1"
FT                   /translation="MDDFTRILTQSLAELIAPTTAAFALAAIGLNLHFGYTGLLNMGQA
FT                   GFMLLGAYGFGIATIAGAPFLLALLVAIGAGIVFALILGIPTLKLRGDYLAIVTISAAE
FT                   IVRWLGRSTVFQEWTGGASGLLGKTYKESFQALSFLPEGRTAIGPLEYINNGSDSWWTR
FT                   LFAWGLVLLAVLFVWLVTRSPWGRVLKGIREDEDAVRALGKNVYAMKMQALVLGGALGA
FT                   LGGVLYVLPSAITPDAMGRTMTFFTWTVLLLGGAATLFGPVLGSMLFFFVYMALRTGMR
FT                   TGLGDVLGSTKVEQIGGILVGVTLMLLVIFRPQGILGNKKELAFHGH"
FT   gene            complement(115609..117090)
FT                   /locus_tag="Xcel_0108"
FT   CDS_pept        complement(115609..117090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0108"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29149"
FT                   /db_xref="GOA:D1BTY5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTY5"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACZ29149.1"
FT                   /translation="MTTDRPTSREARARRTPWRRLLAAFAVAAAPVLLPVSPATAAADT
FT                   GCTPDGVACVAVQVLDAENTRIGDVAATISGGDFSVDVVTSPDGPVSAELPGAGTYTVA
FT                   LDPATLPADKQLPAGAPTAVDVTGQIGSTAHAAFRVGAGATAPAETASPSDTPDDADDA
FT                   TGGAAGDQAGSDAATGTTDGGATVADTPEGDASQRELTLGQVWQQVGSGLRFGLLLALA
FT                   SIGLNLVFGTTGLSNFAHGEQVTLGAMFGYLSINVWGLPVWLAIPVTLVIAGATGWVQD
FT                   TALWQPLRRRGTPVMQAMIVTIGLSIALQFTIQMVIGGRSLRVLSGNPTPLRIAGITLS
FT                   QASWVSMAVATVCIVVIALWLTRTRIGQATRAVSDNPALAAATGIDPNRIIRVVWIMST
FT                   TLAALSGILVAVSFGAFNWSLGMQLLLLMFAAVTLGGLGTAFGALVGSILIGLVVELSN
FT                   LVLPSDLRYASALVILILVLLVRPQGILGRRERIG"
FT   sig_peptide     complement(116965..117090)
FT                   /locus_tag="Xcel_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.839 at
FT                   residue 42"
FT   gene            117323..119671
FT                   /locus_tag="Xcel_0109"
FT   CDS_pept        117323..119671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0109"
FT                   /product="Oligopeptidase B"
FT                   /EC_number="3.4.21.83"
FT                   /note="PFAM: peptidase S9A prolyl oligopeptidase domain
FT                   protein beta-propeller; peptidase S9 prolyl oligopeptidase
FT                   active site domain protein; KEGG: pla:Plav_0844
FT                   oligopeptidase B"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29150"
FT                   /db_xref="GOA:D1BTY6"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTY6"
FT                   /inference="protein motif:PRIAM:3.4.21.83"
FT                   /protein_id="ACZ29150.1"
FT                   /translation="MHDAPPVTTTPDDDAPAAPPLTPRRPTPRTHHGDVVIDDYEWLRD
FT                   ADDPAVVAHLQEQDAWTRARLAHLEPLHERLFAEIKDRTLETDLSVPVRLGGHWYYART
FT                   VEGQQYAIHARVPAAADGWEPPALSPGVEPAGERVLLDENALAEGHEFFALGGTEVSGD
FT                   GRLLAYQVDTQGDERYVLRFRDLATGSDLPDVVEETSPGVALTPGYVFYTTVDDAWRPH
FT                   RVWRHRLGSPSADDVLVLEEPDERFWVGVGLTRSQRFAQVELASKVTTEVRLIAAEAPT
FT                   AEPVVVWPRREGVEYTVEDAGAELLVLHNSGAENFELVALPLPDDLQAPGASAAFAPER
FT                   ASVVVPHDPAVRLDGVDAFARHLVLSYRRDATPRVAIAAYPSPVVEPLPVVEPLPVVEP
FT                   VETTPPVVDPPPVVEPVETTPPPTRTPPALLTWREITTGETLEAVQLDASPMLDQPMVR
FT                   VVVESFTTPRTVYDVVLATGELILRKRQPVLGGYTPSDYAQTRAWATAPDGTQIPISLV
FT                   WRRDRFVGSVPVRGSEPTNRHRTHEPTGPAPLLLYGYGAYEYSLDPWFSVPRLSLLDRG
FT                   VVFAVAHVRGGGELGRRWYDDGKLLAKRNTFTDFVAVAQHLVDTGWTTPQRLAAEGGSA
FT                   GGLLMGAVANLAPHLFAGIHAAVPFVDPLTSILDPSLPLTVTEWEEWGNPLDDPDVYAY
FT                   MKGYTPYENVPADASAYPPILATTSLHDTRVLYVEPAKWVARLRAAGAPALLRIEMSAG
FT                   HGGVSGRYSRWRQIAEENAWLLDVLGAAD"
FT   gene            complement(119724..120980)
FT                   /locus_tag="Xcel_0110"
FT   CDS_pept        complement(119724..120980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0110"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: dvl:Dvul_1003 glycoside hydrolase family 3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29151"
FT                   /db_xref="GOA:D1BTY7"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTY7"
FT                   /inference="protein motif:PRIAM:3.2.1.52"
FT                   /protein_id="ACZ29151.1"
FT                   /translation="MPRARSRTATAVAAMGLAVVGMLASCAGGGAATPSPAPPVTASPS
FT                   PSPSPTAPPAPSPSPSSSPTTTPAPSPTPSEADPIAGWTLEQKVGRLLMVGRPLDGDSD
FT                   LTARLVAERHVGGVFLHGRSHEPVEQVRAIVDPLRTLATDPPGLLVATDPPGLLVATDQ
FT                   EGGRVQVLQGPGFDAMPSAVEQLGLPDLRAQAAGWGAQLAAAGVDVNLGPVADLVPADI
FT                   GAANPPIGAFDRNYGSTAAEVVAGAGAFAAGMQDAGVVPTLKHFPGLGRVTANTDTSAD
FT                   VVDAVTTADDASVGVFRDVLAASSAEPRPWVMMSTAVYGLIDPERPAAFSPTVVGLLRD
FT                   RLGFDGVVITDDVSAAAQVQAWSPGDRAVLAIDAGVDVVLASADPTVADEMLDALLARA
FT                   ESDPAFATKVDDAARRLTR"
FT   sig_peptide     complement(120897..120980)
FT                   /locus_tag="Xcel_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.420 at
FT                   residue 28"
FT   gene            complement(120980..121414)
FT                   /locus_tag="Xcel_0111"
FT   CDS_pept        complement(120980..121414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0111"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: mlo:mll2156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29152"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTY8"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ACZ29152.1"
FT                   /translation="MSSDRHTVTVSTFVAEPPARVWAELLHPGARWMLGANIETDFQVG
FT                   SPVTFEGHFFGRQFEDHGTVLAFERARLMHFTHFSPLSGLEDVPENYHDIRITLEAVDG
FT                   GTRVEVVQENIASAERAGNAEHQWSQALSTLAHSDGVRRR"
FT   gene            complement(121538..122701)
FT                   /locus_tag="Xcel_0112"
FT   CDS_pept        complement(121538..122701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0112"
FT                   /product="Threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /note="PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; KEGG: dde:Dde_1657 L-threonine
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29153"
FT                   /db_xref="GOA:D1BTY9"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTY9"
FT                   /inference="protein motif:PRIAM:4.1.2.5"
FT                   /protein_id="ACZ29153.1"
FT                   /translation="MPLPAYADRVLPPFGSDNYAPAHPEVLAAVAAANEGYAVAYGDDP
FT                   WTERLDARIGEIFGAGARAFPVLNGTGANVVSLMATTSRWAGVVASDVAHAHTDENGAP
FT                   ERVGGLKLLTRTSRDGKLSPDDVTAWAGELGDVHRAQPQVLTLTQATELGTVYTVEELR
FT                   ALVAAAHALGLAVHLDGSRLANAAAFLGVGLRALTTDVGVDILSLGAAKNGGLLGEAVV
FT                   VLGPDDAPTPGAAAARQAAAEAVPYLRKSTMQLASKARYLSAQLLAMFGAPVDGDAAPE
FT                   PGAVPLWLRNAHAANAAAQRLRAGVETLGDTVRVTRPTQANAVFATLPRAAADRLREQT
FT                   RFYDWADGETPDRVEVRWMCSWATTDADVDAFVAALAVALRADAFAR"
FT   gene            complement(122704..123756)
FT                   /locus_tag="Xcel_0113"
FT   CDS_pept        complement(122704..123756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0113"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: rpi:Rpic_4918 transcriptional
FT                   regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29154"
FT                   /db_xref="GOA:D1BTZ0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTZ0"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ACZ29154.1"
FT                   /translation="MSSDPRRRRATHADVAAAAGVSKATVSKALNGRDDVSATTRERVL
FT                   TAVTELGYRPTTAPATTSGRRALAVVFDIPASPYILGVLQGALAAASDGHLDLLTRLAP
FT                   ERSARTQRAVAREWIADQRAAGVVGIVGLTLSEPDGLIDAASDASLPFVIVDPVDTRHR
FT                   RMVSVGSSNWAGARTATEHLLGLGHRRIAWIGGPEASDAARDRLYGYQAALDAAGLEVD
FT                   PALIRSDQFDVSVGARHARELLTAAEPPTAIMAADDEIAVGVLATAHALGIRVPDQLSV
FT                   TGFDDTPQAAWTTPPLTTVHQHLEGMGRMAVQTVLAMAEGRRPASRHVELATSLTVRDS
FT                   TSAPASAART"
FT   gene            123934..125568
FT                   /locus_tag="Xcel_0114"
FT   CDS_pept        123934..125568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0114"
FT                   /product="glycoside hydrolase family 39"
FT                   /note="PFAM: glycoside hydrolase family 39; KEGG:
FT                   cja:CJA_3008 beta-xylosidase, putative, xyl39A"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29155"
FT                   /db_xref="GOA:D1BTZ1"
FT                   /db_xref="InterPro:IPR000514"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTZ1"
FT                   /inference="protein motif:PFAM:PF01229"
FT                   /protein_id="ACZ29155.1"
FT                   /translation="MSVDASPSTLLIDGRSPADVALRHIWNECIGAGRANEALRADWQN
FT                   HFREAVDVLGARYVRFHGIFHDDMFVYRASDGGGFGPATVLETPVYTFAYVDKVFDAIL
FT                   DAGARPFVELGFMPRELATQTETLFWWKAHCSPPKDMNAWVELVTTTVDHWIERYGIDE
FT                   VRTWPFEVWNEPNLVPNFWTGTRTQYFELYEATATAIKAIDPQLRVGGPSTSVFVPDAR
FT                   YEGEYHDPSLEVETAVASDPDDLDWQPVWIHEFIEYCAERDLPIDFLSTHLYPTDYAAD
FT                   SLGKVSAITRHKDATYADLQLMRKIIENSPYPDAELHITEWSTSPSSRDAIHDTLFAAP
FT                   YIVRAFLKGAPLAESISYWTFTDVFEEGGGGIGPFHGGFGFVNENGLHKPTFHAMAMLA
FT                   RLGDRLLAELPDGAITRSSATGDVAAIFYNYPADMGKAGLASHHRYADTRPLADVGPAS
FT                   RVQHTIEGLTPGARFAVEILDWDHGNVAEAWHQMGAPRNLSRQDVVDLQHVADGLDRRT
FT                   LAVDADGVLTIDVDLAPWAVMSIAPAA"
FT   gene            125635..126087
FT                   /locus_tag="Xcel_0115"
FT   CDS_pept        125635..126087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0115"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: bvi:Bcep1808_2992
FT                   VanZ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29156"
FT                   /db_xref="GOA:D1BTZ2"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTZ2"
FT                   /inference="protein motif:PFAM:PF04892"
FT                   /protein_id="ACZ29156.1"
FT                   /translation="MRWLRWLFLVYLGAVLSLTLWPSLDQTNVPGWAEATVEFLGGLGI
FT                   RTSVAALEAGSNLVMFLPFGVFGVLLLAPARRRWSLLTVALVVTAAAFAFSGTIETVQL
FT                   AIPGRVSTLQDVALNGAGGFLGAVVAADVVARIERRRRAARPSSSG"
FT   sig_peptide     125635..125718
FT                   /locus_tag="Xcel_0115"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.619) with cleavage site probability 0.505 at
FT                   residue 28"
FT   gene            complement(126328..126993)
FT                   /locus_tag="Xcel_0116"
FT   CDS_pept        complement(126328..126993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0116"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: pmu:PM0634
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29157"
FT                   /db_xref="GOA:D1BTZ3"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTZ3"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACZ29157.1"
FT                   /translation="MTLTLTLVRHGQTHFNSRQILQGSSNSPLTRTGREGVRTTARHLA
FT                   ASDFVAAYTSPAGRAVTTAVEIIRHHPGLPLTVETGLREYDFGKFERRPERELEAFEPW
FT                   AALVPAVLAGRHPGLPDGEPGAAYMARVTATFDRIVAAHDAAAGSGQGVEVLVVGHGLT
FT                   LGAYLWTLQRGGLPALPNASVSTVRVTDGVPEVVEVGLDIAGHGLRAARPAPAPIPAP"
FT   gene            127106..131080
FT                   /locus_tag="Xcel_0117"
FT   CDS_pept        127106..131080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0117"
FT                   /product="Superfamily I DNA and RNA helicase and helicase
FT                   subunits-like protein"
FT                   /note="KEGG: bpa:BPP2679 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29158"
FT                   /db_xref="GOA:D1BTZ4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTZ4"
FT                   /inference="protein motif:COG:COG1112"
FT                   /protein_id="ACZ29158.1"
FT                   /translation="MYLIDGDVVLSASDLTAAATCELAFLRGLDVRLGRIEALDVAEDP
FT                   MLARTASLGEAHELRLLAAYEERFGPARDAADARGVGDLRPDDDGGRGDGGRAGGVVQV
FT                   ERPSLRDPEAVAAALAATRSAFESGADVVYQAMLAEPPSTAADGERRPGFVGFADFVVR
FT                   QADGRCRIQDSKLARHARVTALLQLAAYAGRLRVLGVAVDDDVDLVLGDGTVSTHRLVD
FT                   VEPVYRLRRAHLERLVTAHLAHDDAARWGDPGVSACGRCAVCDAEVTAHRDVLLVAGLR
FT                   LTQRARLAAAGITTIEQLAASSGPVDGIGTSTLAGLREQAALQLESEALPPPPAVDPPP
FT                   VVELPPVVEPVETTPPQTAPLPVVEPVETTPPDRSGVVSTGSTTGDSPAVVVSTSSTTG
FT                   VGSDRSGVVSTVSTTGRVSTGSPTGVGTAVPAVRVVDPDGLAVIPAASDGDIFFDFEGD
FT                   PLYTEGAGTQWGLDYLFGLVEVDGTFRAWWAHSFAEERVALRGFLDYLRDRRRTYPDLH
FT                   VYHYASYERTHLLALAARHGVGEEEIDQLLREHVLVDLYPIVRRSVRVGSRSYSIKKLE
FT                   PLYMGDDLRSGDVQTAGASIEEYAAARAASARGDVVQGEKMLAAIADYNAYDCRSTLRL
FT                   RDWLAGLARERRVEPLPVPDDAPGREVEASPLAERIAALAGDPLDPDRTPDERALGLAA
FT                   AAIDYHRRENKSFWWGHFARLIEPPADWLDTRDVLRVDSVRLVRDWTVEGRQKNPRRVI
FT                   ELRGEWAPGSRPSTFANPGPHLLYEPPGPYPSPTADPGARSVHAVRVLEVVDDATVLVE
FT                   EALPGGHEPHQDVPIALAPAAPPDTRPLAAAVAEWATRLVDPPPPMVEPVETRTPVVEP
FT                   VETTPPDRSGVVSTGSTTGRDTVRWPRDAVVDILRRTPPRSRSGRGLAAVRPGDDGEGD
FT                   HIAAVVASVLDLDDSYLAVQGPPGTGKTYLAARVIRTLVERHHWRVGVVAQSHAVVENV
FT                   LDGVVGAGLDRDLVGKQPGDPEADLVFTAVPRKGYAAFADERATSGFVLGGTAWDFVAA
FT                   DRVPRRSLDLLVVDEAGQYSLGTTIAASVAARNLLLLGDPQQLPQVSQGTHPEPVDTSA
FT                   LGWVSAGHDVLPAELGYFLAASRRMHPAVSRPVSDLSYEGRLHSHPCAAQRSLDDVEPG
FT                   LHVHPVPHEGRSTESPEEAAEVVRIVRSLLGKRWSTAPDDAGRSLTAADVVVVTPYNAQ
FT                   VQRVRQALDAAGLGDARVGTVDKFQGQEAVVAIVSLAASDAVAVPRGMEFLLMKNRLNV
FT                   AISRAQWAAYLVWSPALLDHLPPTPPTLAQLSAFARLVGA"
FT   gene            complement(131088..132389)
FT                   /locus_tag="Xcel_0118"
FT   CDS_pept        complement(131088..132389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0118"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pfl:PFL_3504 sugar efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29159"
FT                   /db_xref="GOA:D1BTZ5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTZ5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACZ29159.1"
FT                   /translation="MSTPASDPSGPSAAGIVDPRRATIILVAMAVSTFLFVLVEGLPGG
FT                   LLTLMAPDLNTTTSRIGLLVTGYALVVLVTTVPLARITQHIPRRWVLSATVLVAAAATL
FT                   WAGLAGSYGSIMTARLVTALAQALFWVAVIPGTTGLFPPRVRGRVVARLALGNSIAPVL
FT                   GLPVGTWLAEQTHWRVTFWVVSALSTVIFVVVVMLFPTVRPSEGGASRAPFPSRPRLLY
FT                   QLVTTALIVTSAFGLITFVTQFLQDVAGYERADMPWLLVISGAAGVVGAFTVGRFLDRH
FT                   SWGSLTVGIAVVAVAQVLLFATGAHPVAAIAGIALFGCAFSTVPPALSHRVMLVAPGST
FT                   DMGVAVSSATFNLGIAAGSALGAALTAAVGVRWVPFVGAVLAVLALGANLLENRFNPPF
FT                   PAHRQAVDEALGLDAPEPDAAALDTTARDAALEG"
FT   gene            complement(132502..134799)
FT                   /locus_tag="Xcel_0119"
FT   CDS_pept        complement(132502..134799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0119"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SNF2 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29160"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29160.1"
FT                   /translation="MAMHEPLPGNPAGIDGVARTVGGQAATLRGVAGRLTRLLATLDRG
FT                   RSAAGSLAADRLTTAADDARAAGRLLDGTAGLLTQYSLRLAELQRADQEATAQYADARD
FT                   RRVRWAREVQAARAAAAAGTAPEWEVSSAQRRLDDAEADVARASSTRTAVWEEHRAEIA
FT                   RAVARATALADARAVRAWALAAPGEVVGDLATSRQAGQEAAAAVTAVAAGGDGETARTL
FT                   ERLLRDGTDDPVFWSSFWDTVDAEQLYRAIDAMPDDVIGLERGFAGVVGPAAAGGVLGT
FT                   LSAGLATWARSHSTSERRDLGNALGSRLPAAVASAPTVAVALLGVQPPRSPAEGGTSAD
FT                   DRARADVAHGILEGLEGPDALAGAQTYVHRDGWTSALASAALTAVSRDRAAALEFFAPA
FT                   DPDVLTARVDHWLGSTIFWDDDGEAVTAAFAAATMGGTEAASSWSEQARVAQLVSRATT
FT                   VLPAGLLQLTDLSPAAEVSVARAYLPYFGQFSELADHTRADGWVEQTPGAETGTRPDVP
FT                   LAYGLPAPPQPVQPWLDALSLREVVVGSSGTREGAAAWLADGEIYQDSIYAELFPADGT
FT                   QEPGQASGLSDEDKLDAGVEAMADVAALAGILEFDGLRDAEIADARVEAAVDLGAAAIG
FT                   SLSGPVGTVAAKKLFADAVTPAAQHAAANAVGSATDAAAAAGAASQGQGFMTATDVARH
FT                   EIAATEDRVIEQATERLGEAAVTWSLARGETPAQAEARWSEIDPDNPEVSRALKLVYRN
FT                   SADTRTGDPGHD"
FT   gene            complement(134799..135131)
FT                   /locus_tag="Xcel_0120"
FT   CDS_pept        complement(134799..135131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29161"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTZ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29161.1"
FT                   /translation="MPRLSLDTAAFDDAAAACRDAAGLLQESAVLDLPPEPFAVPELVA
FT                   ALDDLRRAWTQELGMLAGQVDAMSSALAVAGGLYTVAETTAVRLFDGAPARLTLDATLA
FT                   AIGRAW"
FT   gene            135300..136163
FT                   /locus_tag="Xcel_0121"
FT   CDS_pept        135300..136163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0121"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK0153 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29162"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29162.1"
FT                   /translation="MPTTTATIDVPGAVLTYDVHEPETSSGARPLFIIGSPMGAAGFAT
FT                   LVGHFGDRTVITYDPPGMDRSTITGDGPHPDPMNRGAALHAIADAVGLGPYDLFGSSGG
FT                   AVDGLAWIQQFHEDLATAVLHEPPLAKVLPDSDLVAAAMDDVHATYEARGFGAGMAKFI
FT                   ALVSVQGELDGDYLAQPDPDPAQFGLPADDDGTRGDPLLGINMLTMQHWLPAFASVRAA
FT                   STRIVPAYGSESGETMAARGARALAAELGLESAVFPGDHGAFQGGEYGFVGQPDEFAAR
FT                   LHEVLG"
FT   gene            136337..137131
FT                   /locus_tag="Xcel_0122"
FT   CDS_pept        136337..137131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0122"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: azo:azo2203 putative
FT                   lipoprotein precusor"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29163"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D1BTZ9"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ACZ29163.1"
FT                   /translation="MSSRPSPRHRAERTQLAALTGAIRAVAVDAPKGAGRSAVVVATAG
FT                   GIAMSAIAPAAADSLPVAEREVDTHVHVAKIAYQARAALAAAPAVQVAAEAVVDVERMT
FT                   EEGAVPVEVTPAPLPPPPPPPPVRAQPAAAARTEYRPEYRPAAPGQAWESAAHIALRYE
FT                   GVRYVFGSSNPAVGLDCSGLVVHVYRHLGVELPHQSTRIRDSSRTVRISRSEARPGDII
FT                   WSPGHVSIYLGGGRQIEATRPGGWRVRTANIWQSNPMFLRVV"
FT   gene            137185..137415
FT                   /locus_tag="Xcel_0123"
FT   CDS_pept        137185..137415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29164"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU00"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29164.1"
FT                   /translation="MPTKHPRILVTRTPHVDDVMERGRRRLGVDVDYPASAILVELAER
FT                   GLAGDEEGLLIRRATGRTITSEMVAAALDED"
FT   gene            137405..137830
FT                   /locus_tag="Xcel_0124"
FT   CDS_pept        137405..137830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0124"
FT                   /product="PIN domain protein family protein"
FT                   /note="TIGRFAM: PIN domain protein family protein; KEGG:
FT                   bvi:Bcep1808_6071 PilT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29165"
FT                   /db_xref="GOA:D1BU01"
FT                   /db_xref="InterPro:IPR006226"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU01"
FT                   /inference="protein motif:TFAM:TIGR00028"
FT                   /protein_id="ACZ29165.1"
FT                   /translation="MRTDLPDVNVLIALHFEDHVHHVPAMSWLRKGGQFATTALTEAGF
FT                   VRVSMNPAIVGEPFSGVEALEALRRLRGHTRATFWADDTSLATSPFADRVLSGHKQTTD
FT                   LHLLNLAASRDGVLVTFDSKLGAPLRQAERRHLDVLR"
FT   gene            complement(137847..138368)
FT                   /locus_tag="Xcel_0125"
FT   CDS_pept        complement(137847..138368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0125"
FT                   /product="protein of unknown function DUF1697"
FT                   /note="PFAM: protein of unknown function DUF1697; KEGG:
FT                   mmr:Mmar10_2349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29166"
FT                   /db_xref="InterPro:IPR012545"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU02"
FT                   /inference="protein motif:PFAM:PF08002"
FT                   /protein_id="ACZ29166.1"
FT                   /translation="MSTYVVLLRAVNVGGTGKLPMADLRRLAEDAGFTGARTYIASGNL
FT                   VLESDDDADAVAVGRTLERALAAYAGKPVGVLVRTPAEVRRVLADNPFPGEPGNRVAVI
FT                   FLPGPTPSDALDTVSRADDGEEVRVGDRVLYVHYPHGMGRSKLRMPAAAAGTARNLNTV
FT                   AKLAELSAER"
FT   gene            138559..139086
FT                   /locus_tag="Xcel_0126"
FT   CDS_pept        138559..139086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_6147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29167"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU03"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_6147"
FT                   /protein_id="ACZ29167.1"
FT                   /translation="MTTDDLKRAARVLRAELAEQGVDLSHARALELVAHQAGYKDWNVA
FT                   AARSTPSSTVGLGAPVPVLRMVDVERTRAFYLGFLGFAVEFEHRFEPGLPLYLRVERDG
FT                   ARLDLSEHHGDGTPGSVVWIPVADVRALQRELLATGYTHMRPGIDDDAPGGPTLEVIDP
FT                   AQNVLRFAEVPR"
FT   gene            complement(139115..139891)
FT                   /locus_tag="Xcel_0127"
FT   CDS_pept        complement(139115..139891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0127"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_2323 phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29168"
FT                   /db_xref="GOA:D1BU04"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU04"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29168.1"
FT                   /translation="MSVHAVARPAESTARSRVTFVRLLDVEARRTVSTRAGSLLLTVAL
FT                   AVVVLGTVAALTLGTPGQVSPTAFLLDVAYPLAVVLPLVAIVIVAADPRAHGDRTGARP
FT                   GQVLGAKALVSAAIAVGVPLLVVALTALGVLASAATQGVDAVWDVPAGQHLRLLLFALV
FT                   AMAAGFVAALAARRVPAAVVAYLAVFAGLPLLAGAVAGTQLGAVISWVDLGSAAYALQG
FT                   TTMSGQQWLHLAAASALWLALPAVGGVYRTLRRHSA"
FT   gene            complement(140061..140213)
FT                   /locus_tag="Xcel_0128"
FT   CDS_pept        complement(140061..140213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29169"
FT                   /db_xref="GOA:D1BU05"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU05"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29169.1"
FT                   /translation="MNTHLHRLSPREVASLTTTSRPRTESLTVGVLAATSALAVVAAAL
FT                   ASLLR"
FT   sig_peptide     complement(140085..140213)
FT                   /locus_tag="Xcel_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.802 at
FT                   residue 43"
FT   gene            140362..141012
FT                   /locus_tag="Xcel_0129"
FT   CDS_pept        140362..141012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spe:Spro_0103 DNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29170"
FT                   /db_xref="GOA:D1BU06"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU06"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29170.1"
FT                   /translation="MQLQSPFAVITPTLDGPVLNVLAMARAAFTPGQVARLLDVGSVEG
FT                   VRKVLNRLVDQGIVHVQQIGRARAYELNRDHLAAGAVEAIARQHDVLIQRLADEVARWT
FT                   AGPTFGALFGSAARREMRPDSDLDVFLVRPDTADLEVWDEQTTALAAAATLWTGNDARV
FT                   LDMTESEIAAGAVPVGRAGVREPVLAEIVADGIQFAGPAGWLARQIRDARGTR"
FT   gene            141009..141405
FT                   /pseudo
FT                   /locus_tag="Xcel_0130"
FT   gene            141523..141813
FT                   /locus_tag="Xcel_0131"
FT   CDS_pept        141523..141813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0131"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   rpi:Rpic_1037 antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29171"
FT                   /db_xref="GOA:D1BU07"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU07"
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /protein_id="ACZ29171.1"
FT                   /translation="MIREHALLPVVPGREAAFEAAFAQARPLIEATDGFLGLTLSRSVE
FT                   SPSSYLLLVEWESVEAHTVGFRGSERYPRWRELLHHFYDPFPVVEHFAQVS"
FT   gene            141865..142260
FT                   /locus_tag="Xcel_0132"
FT   CDS_pept        141865..142260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29172"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU08"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29172.1"
FT                   /translation="MADLPFVDEHVWSVAEPPDVVFARVERYVHAVWVRERRRGIEHLL
FT                   GTRDPGGFHVAESVPGALLALEGAHRFSRYRLTFLLAADGAGTRVTARTHAAFPGVRGA
FT                   LYRGAVVGTGLHVVVTRRMLRLATVGG"
FT   gene            142368..142847
FT                   /locus_tag="Xcel_0133"
FT   CDS_pept        142368..142847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0133"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   gdi:GDI1201 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29173"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR010371"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU09"
FT                   /inference="protein motif:PFAM:PF03928"
FT                   /protein_id="ACZ29173.1"
FT                   /translation="MTDTAQDLAAVIARIEEEERELVLPAFTHDDAWRLGCLLVELAEE
FT                   RDLPITIDIRTGSQQVFHAARPGTTPDNDSWVQRKVATVYRFGASSYLVGRQHAARGRD
FT                   FNEAHGLPLQEYAAHGGAFPIRVGGVGIVGVVTVSGLAQADDHALAVEALRAFRS"
FT   gene            142890..143651
FT                   /locus_tag="Xcel_0134"
FT   CDS_pept        142890..143651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0134"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; TipAS antibiotic-
FT                   recognition domain protein; SMART: regulatory protein MerR;
FT                   KEGG: jan:Jann_3675 MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29174"
FT                   /db_xref="GOA:D1BU10"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU10"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACZ29174.1"
FT                   /translation="MEWSIQEVARLAGVSSRTLRHYDAVGLLPPSRTGHSGLRYYDADA
FT                   VRRLQRILLLRQLGLGLDDVGRVLREQADVADALTGHLEQLRGDRRRLDRQIASVERTL
FT                   AALETGEELMADDMLDGFDHTQHREEVEQRWGREAYARSDAWWRSLGADRQKEWMGRVK
FT                   ELNAAWVAAVEAGVAPDSDEAQALAGRHVDWLSSIPGTPGSVEGRATDEYVLGLGDLYV
FT                   SDPRFAANYGGEAGAVLVRDSLRLWLERHAG"
FT   gene            143844..144317
FT                   /locus_tag="Xcel_0135"
FT   CDS_pept        143844..144317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29175"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU11"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29175.1"
FT                   /translation="MSGQPRSRSHDGWETGDVGGDWVAHRTEAARVQAERLRARQDAVH
FT                   AQAEGLLAEFLPVVAAHGPQPEPLRVRGYGGRGEARTPLKGWYLRFDRTAALATDGRFY
FT                   MLIAPLSALDRLRGVRPAPARPPMVLGEGGKDGESVELPIALERVLPGWRDLA"
FT   gene            144385..145533
FT                   /locus_tag="Xcel_0136"
FT   CDS_pept        144385..145533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0136"
FT                   /product="Excalibur domain protein"
FT                   /note="PFAM: Excalibur domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29176"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU12"
FT                   /inference="protein motif:PFAM:PF05901"
FT                   /protein_id="ACZ29176.1"
FT                   /translation="MHSGGVNAAPAARCRTSPWAVMGRLAVALSLLATGVSCAPAITPD
FT                   GAASSSASSHLAVTDDRSPTTQPTPQPTSSRAGAAEAEPPAPEASEPAVEAPASEVAAD
FT                   ADAARPAEDEPAGTEAASGTALAAVAELTIKGRAPKTGYTRDQFGPAWADVDHNGCDTR
FT                   NDILNRDLTGVVTRDGTHGCVVLTGTFADPYSGQTIAFQRGQTTSSLVQIDHVVALSDA
FT                   WQKGAQQWDAETRRQFANDPLNLLAADGSLNAQKGDGDTATWLPPHKAFRCAYVARQVA
FT                   VKRAYGLWVTQAEHDAMAGVLGACPGEPLPTGGPVTVPPAAAEDVVQELAPAQQPAAPE
FT                   LPTDVYFANCTEARAAGAAPLRLGDPGYRPVMDRDGDGVACE"
FT   gene            complement(145603..146859)
FT                   /locus_tag="Xcel_0137"
FT   CDS_pept        complement(145603..146859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0137"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: mpo:Mpop_3746 multi-sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29177"
FT                   /db_xref="GOA:D1BU13"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU13"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACZ29177.1"
FT                   /translation="MSAPLAGRRRRPSAPRSAAQDVPLHDPTRTGVLLASVNVTLYSLM
FT                   SLAAWAAWGGWHTAAETGTNRVLTEALAITAVNFVYGMLVVGGTFLLHPQHWRARVRYP
FT                   LIAAMALAVALPRTLAMGAIYSIPADITFFLAEWAAGAAAGFVAVAAGLLAAELAHRAR
FT                   TEEAHHLRAARRAAKAVDELQSEEMRVRRMVADRLHGTLQYRLVTVTAGLDGVAAALDS
FT                   GATLAQAAAELREWAERLEEIREEEVRSLSHAVFPAGIELGTVRALEMMLRRLPPQIQA
FT                   HLEIGPALQRLVDEARQPIPPAERLIAVYTVEEGITNALKHGRASRLWLAADVLPTDDP
FT                   LSWVLDVTIDDDGDGITQPAPELSGLSRHAARLEARGGSLDLRAGPRGGARLWFRLPFT
FT                   QSTQALDDDGGAGAGQAAD"
FT   gene            complement(146859..147521)
FT                   /locus_tag="Xcel_0138"
FT   CDS_pept        complement(146859..147521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0138"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; Sigma-70 region 4
FT                   type 2; response regulator receiver; SMART: regulatory
FT                   protein LuxR; KEGG: azo:azo2970 two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29178"
FT                   /db_xref="GOA:D1BU14"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU14"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACZ29178.1"
FT                   /translation="MDQVIRVGIVEDEALMRGMLEQTLSAEENIRVVHSVPGATEARLV
FT                   FTPGSVDIAMLDVHLADGNGVALGVQLQRQDPDLAVMLLSSEDVMGLYTSVQEDAPRAW
FT                   SYLSKRSSFARDVLVRAVAATAQGQVVLDPYLVQRSEPRAGSAVADLTPAQFGVLRLVA
FT                   EGLSNQAVAERLGINTRSVESHLKSIYQRLGIDGDGSNRRVAAVLAFIEQTGRAWRT"
FT   gene            complement(147625..148335)
FT                   /locus_tag="Xcel_0139"
FT   CDS_pept        complement(147625..148335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to formin, inverted"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29179"
FT                   /db_xref="GOA:D1BU15"
FT                   /db_xref="InterPro:IPR025241"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU15"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29179.1"
FT                   /translation="MSDPYAPPPASPDEVLRAPAPLPSQVLPYTTDGSVPAPSPYSTDG
FT                   SVPPPSAYGTPLGDFGAAPPPNPYQGTPYESSSYAAYGAPPRPAGRDGVSIAALVTGLL
FT                   GLGPVPLVLGIVGVRRTGRTRQAGRGLAVAGIVLGALQILVGVAAIIALVVAGARGAFG
FT                   PIGAILDTGEPGMYYGDNARLDALWDACDAGEMQACDDLFALSEEGSDYEWFGGTCGER
FT                   ADGAAWCTKLSVVD"
FT   gene            complement(148416..149150)
FT                   /locus_tag="Xcel_0140"
FT   CDS_pept        complement(148416..149150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0140"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: swd:Swoo_1852 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29180"
FT                   /db_xref="GOA:D1BU16"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU16"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACZ29180.1"
FT                   /translation="MSEERRGVGTIDAVVLDVPDVDVAGEFWTTLLGGRVIQELSDGQW
FT                   LTIGTREGWMVAAQPAPNLVPAQWPSQEHPQQLHLDLRVPDLAAATSAAVDLGATLLRE
FT                   NATWNTLADPAGHPFDLCLSDEVDRTTVWGVTFDVPDAAAAARFWASVLGEEIAYEGEG
FT                   MAMLGGERTVMFQQVEGYHAPDWPDPARPQQLHLDLDIAGRAPDEAEAAVLALGARRLP
FT                   GGGATFRVYADPAGHPFCLCWG"
FT   gene            complement(149281..150537)
FT                   /locus_tag="Xcel_0141"
FT   CDS_pept        complement(149281..150537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0141"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; Amino
FT                   acid transporter transmembrane; KEGG: cbs:COXBURSA331_A0988
FT                   amino acid permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29181"
FT                   /db_xref="GOA:D1BU17"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU17"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ACZ29181.1"
FT                   /translation="MTQLARRLTTTDAVVVGLGSMIGAGVFAAFAPAARAVLPVGTGWA
FT                   LLVALGLAAAVAYANATSSAQLAAQYPVAGGTYVYGRERLGPWWGFVAGWGFVIGKTAS
FT                   CAAMALTFAAYAMPDGAPTVVRRGVAALAVVALTAVNCRGVTRTARVARWLVAFVLLAL
FT                   AVTLTVVWAGRDLVVEVASTGSAIGVLGVLQAAGLLFFAFAGYARVATLGEEVRRPRVA
FT                   IPRAISVALGITVVVYAAVAVTLLVVLGLDGVAASGAPLAAAADGLWVAPLVRVAAAVA
FT                   SLGALLALVAGVGRTALAMAREGDLPRPLAAVHERFRVPHVAEVTLAAVVVALVATVDL
FT                   RGAIGFSSFGVLVYYLVANLSAWTQTGGDRRYPRALQVFGVLGCAALAVTLPWTSVVGG
FT                   AGVLAAGVALRALRGRRRG"
FT   sig_peptide     complement(150427..150537)
FT                   /locus_tag="Xcel_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.725 at
FT                   residue 37"
FT   gene            150594..152117
FT                   /locus_tag="Xcel_0142"
FT   CDS_pept        150594..152117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0142"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: sulphate transporter; Xanthine/uracil/vitamin
FT                   C permease; KEGG: yen:YE0973 putative membrane transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29182"
FT                   /db_xref="GOA:D1BU18"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU18"
FT                   /inference="protein motif:PFAM:PF00916"
FT                   /protein_id="ACZ29182.1"
FT                   /translation="MPTPHTVSVRAVLRSPRLLRIEILAGLVTAFALIPEATAFSIVLG
FT                   VDPRLGLFSSFVGAVAIALLGGRPAMVSAAAGSVALVAVPLVREHGADYLIVAVVLSGL
FT                   LQVVLGVAGVARLMRFIPRSVMVGFVNGLAILIFWSQVRHLVGVPWAVYPLVAAGIAVV
FT                   VLFPRVTKAVPAPLVAIVALTVVAVAGGLDVPTVGDEGALPQSLPSLLIPDVPLTLDTL
FT                   RIVAPYVAGMALVGLLESLLTAKLVDDVTDTRSDKSREAWGLGVTNVLAGLFGGQGVCA
FT                   MIGQTVINVRGAGARSRVSTFMAGVFVLVLVVGLNDVVAQIPMAALVAVMIMVAVMTFD
FT                   WHSVRPATLRRMPRSETTVMVATVVVTVATDNLAVGVLVGVVVAMVMFARRVAHFTSVT
FT                   PMDDVAAVGPGLTSDADDGAPRRRTYVVEGELFFASSNDLVYQFDYADDPDDVVVDLTR
FT                   AHVWDASTVATLDAIQTKYAARGKRVTIVGANPDTAARLTRLSTLTPGG"
FT   gene            152235..152414
FT                   /locus_tag="Xcel_0143"
FT   CDS_pept        152235..152414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29183"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU19"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29183.1"
FT                   /translation="MSRDGKPPYGNGTYYPRLWSVVAQRTGSEICVSAVTLAESTDGTA
FT                   AERYLAGAWAVAPG"
FT   gene            152437..153138
FT                   /locus_tag="Xcel_0144"
FT   CDS_pept        152437..153138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0144"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: pde:Pden_4630
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29184"
FT                   /db_xref="GOA:D1BU20"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041484"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU20"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACZ29184.1"
FT                   /translation="MRSVEELSTRSRIRDAAVSRFARDGFRVPLRVIAADAGVSPALVI
FT                   HHFGSKDGLRAACDEHVLEHSLMLKSGVVENTDPALLRSLLGNLRVFDEPVAYLLRALL
FT                   DGGEAARSILERTVAAVETYLEAGVASGVIRPSRDPAGRARYLTYMSLGLLVTAFLAGP
FT                   RTDGDDDDGAASDEGDPYGHVTELLASLTLPHLEVMTHGLIADPELLHTAEDWAATATP
FT                   TTPNRRTRRDP"
FT   gene            153135..154157
FT                   /locus_tag="Xcel_0145"
FT   CDS_pept        153135..154157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0145"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bha:BH1003 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29185"
FT                   /db_xref="GOA:D1BU21"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU21"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ29185.1"
FT                   /translation="MTIPIEIRDLHKSFGTTKALDGLDLTVEQGQVAGFLGPNGAGKST
FT                   TIRVLLGLLKADSGDVRLLGGDPWRDAVDLHRRLTYVPGDVSLWPNLTGGEAIDLLARL
FT                   RGGLDKARKAELLERFELDPTKKARTYSKGNRQKVALVAALASDAELLILDEPTSGLDP
FT                   LMEAVFTDYLREVKARGRSVLLSSHIMSEVEKVCDTVTIIRSGRSVEHGTLDDLRHLTR
FT                   SAVSVLLPDDDAVRTVSGLPGVHDVVAEPGADGVVRLRASVDNDHMTGVLASLGAIGVR
FT                   GFTATPPSLEEMFMRHYGDELPTPPPPVVEPVETTPPPAAEPHPVVEPVETTPERGEAR
FT                   "
FT   gene            154154..155851
FT                   /locus_tag="Xcel_0146"
FT   CDS_pept        154154..155851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH1004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29186"
FT                   /db_xref="GOA:D1BU22"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU22"
FT                   /inference="similar to AA sequence:KEGG:BH1004"
FT                   /protein_id="ACZ29186.1"
FT                   /translation="MTAVVDQGGGFDKLNHRGAPNHRDALDHRGNELTGTWALVRFNLR
FT                   RDRRRITIWTLSIAALYVYCATAFATLFEDTAEQIARANIMRTPASVLMTGPGFGLDHY
FT                   WFGAMMANELLLWLAGTLGLMSILFVVRYTRAEEESSRSELIRSSVVGRHAPAVAAYLT
FT                   VVLVNALIAVVTFPILLTGAQGDVVGSVVFVLGCALVALCFGAVASVTAQVTEHSRGAT
FT                   GMAVAVLLAAVLVRGIGDIPRVGGTPLSWFSPIAWAQQTRVFVDLRWWPLLLTVAFIVA
FT                   ALILASVLGTSRDFGAGLVAAKPGRADAKASLRSPVALVWRQQRTAFWWWLLGIGLMFL
FT                   AIGTYLVDVDDLFGDLVAQNPALADIFGREDMVGSFVQIMMLFGALCAAGYGISGIGRA
FT                   RTEETDNRTEALLATPVSRPRWTVAAFGVPVLCGAVLIMAAVVAVYLGGMSAGFDGPGI
FT                   GKYLAAGAVYLPAFLAVVGLSAALFAWVPRLMALAWIPVAWGIVDGMFGDVIDAPTWLR
FT                   ALNPFRHVPNPMATAAQDYTPLLWLGVLAVVLFAVAFAGFRRRDVPTV"
FT   gene            156323..164497
FT                   /locus_tag="Xcel_0147"
FT   CDS_pept        156323..164497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0147"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="KEGG: bat:BAS3452 hypothetical protein; TIGRFAM:
FT                   LPXTG-motif cell wall anchor domain protein; conserved
FT                   repeat domain protein; PFAM: von Willebrand factor type A;
FT                   SMART: von Willebrand factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29187"
FT                   /db_xref="GOA:D1BU23"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR022464"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR038174"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU23"
FT                   /inference="protein motif:TFAM:TIGR01167"
FT                   /protein_id="ACZ29187.1"
FT                   /translation="MTRNRTAGRRTTRFAPGIAAVLALGLVGAGVVPVAGLVDLAQPAV
FT                   AAEGDVVTTNPARPAGLEEPDKVADPATHHEYPGSDSLARTDTTNYLEYFDSSRNQGRI
FT                   WTDKSVFNKDVGIPKTMDQDPGELKVGPDELAVALSALGSTRHVMSTEPVPIDVVLVLD
FT                   NSYSMTQCVESDAFCRGPNVWQDSRAAAMADAVNSAIQIIHEDDPDNRVAIVLFGTNSE
FT                   VVTGLVNPQPTGSRYVWLTQSGNSNTNGVLTLHVGNQTRTIGTSGSDTQYTNIQRGLTT
FT                   GLGLLASQAKAAVTGSEQRVPNLILFTDGEPTRSSTSQSWWNPSGSAVQGPSSTGSAFY
FT                   GNGFLAALSASLLKAKVEAHYNDADYNRSHGLVGVDANVYTVGLGINGLATSARDIALA
FT                   TLDPSANLGKADGIYGDFTSTFNAYKTGGRPNVPVNTGVDYRINHPAAADAGFREFDPT
FT                   TDADFKYNKAFFSPMNTEELKKDLDRIAETIIEAAPNYPVEVRSDNASTEGYITFVDEL
FT                   GPYMEVTDFNRIAFCSFTEASPTKCIDKTFLESDIVDEGGGTFSYIFDGEYEANTVSGS
FT                   DGPVDLSAIKITVTKGASLADGDVVTMSLPAALLPIYDKRVMVDSDGEPVEITPYISHP
FT                   FHAYYKVAPKPAVLSYLAGINTTSPEERAALAAYVEANTGDGTVRFYSNAHSGAGSDAG
FT                   LATSSFTPALRNDFYRFSVDSPLYIDDEFKEALTGANWDATQKLAGGDNLEIFYMDVAY
FT                   VRAGDSLERVPFPVATTAGKLKAAGFSPSGTGPLVAPAGMLDLSDRTANLDFPKCAVEW
FT                   VAGLPECYDPGDPEFDPNPSNTAATVRTTTSERGQSGGSDAVTAALGNNGFLAYDAPGT
FT                   LTVRKTVEHDGFDPLGATEFTFRLDVAGDEGDGGDEEKPGFPADVYASDDTFLREDSVV
FT                   VGGTLTLKDGEYAVIYGLPHGTDYTVTELDIPDGYTLDGENPRFGTIDSSEPSEEEFVN
FT                   TYEATPATAAPTVTKVLAQGEWDVKDTFTFLLCEGVTEGCQELTLTHGDVAEPGEGVTA
FT                   TGVFGGISFDRPGTYEYTLTEKDENTVNPSISYSAASYLWTVTVVDDGRGVLTATGVLT
FT                   QVLGDGGQSLVPPLVVADGDATFTNVRDANQVSGTLQATKLAWDKTLVGGAMGNPTRAH
FT                   EFDFKYLGAINGEPTAASEPQDLSFVDDTHLLGDPRGSWERKTNVAGSSAVSSSELTFT
FT                   RAHVGHRLYYSVEEVETSDTSFVSTDPVVYIYEIAVGVDTETEVLGGMNPVTAMSVRCA
FT                   TTRDEVTDHGPLGTCRPGTDSFNPTTSVPALFQNEYEAGPVVAPLAATKELVGRDWYGD
FT                   DAFTFRIEGDNTTTRNAIAAGYITLLTGDDPAVGVTLPAEISVTTEGVENVKFNLQFTR
FT                   QGTYRFKITEVPGSAGGMTYSENSLVYTVTVSNPGDDDQSALVATSAWYSGDATFINRY
FT                   EPAQTSATPWFSKLLKGRNWLPDEEFTFVIDGVVKDGVEPPMPAATTAKVTSANAVRFD
FT                   FGSIVFDKAGTYTYVVSEQVPSDKAPGLDYDGRSATVTIVVKDSLEAELGAEVSYGGGF
FT                   REFVNTYATELPWGFDVTKALTGREMAADEFTFKVVPGPGASERFGAQAALTVHGAAGD
FT                   DGQVVTMDGPRVTFTQDDAGKNYCWEVSEDVPTEPLPGIAYDPVMHSVCVDVSDPGLGV
FT                   LTATTRVTSLGGSGGGAADPIVITSAGGNPPWPAVPFENRFEPTSWTLAKTSDPADGHV
FT                   ERGDEITYTLTVVEDIGGAGSAVPTGIVVTDDLSDVIGPGRAEFIGFIGDHGGATFDAE
FT                   SGMLTWELGTFEESATLSYKVLVDDEAYGVTLRNVVTGTGNVPPETCDQETEIDELEDV
FT                   CTTVHTTGPGWTMSKSANPEGDELLAPGDTVEYTLEVMNLSKEFAVTDIVVTDDLAEVL
FT                   ADGVVALVLDESGELAQPAVGAARLEGTTLVWDLAELAPGQTAEFTYSVTTKADGTAYG
FT                   TTLRNKAWGVAKDGDAVLPPEDCTVGRPCSTEHEVATPEWTVVKSSDTEGAVPGGVITY
FT                   ELTVTNKGEVPLYGATISDGPVGHGGGVTDVWDFLDADGWDGKYTVQVGDDGEATDYTD
FT                   ATPEDGLQHVIDELGVEEQAVVTFTVQLPDKFDGVHLRNTVVGSLIPNPAGPGEPDGPS
FT                   FPPQDCALPNGEKPCSVDHTYPPGGAWTLDKSAETPSGTSAVLPGDVVTYTLTVENTGT
FT                   SVVTGVVITDDLAEVLADGVVTLDALVDPEVGAVRLEGTTLVWDVGDLEPEEKVEYTYS
FT                   VTVKADAKSYGATLHNAAWGTGHGVTEDGPDEALPPENCTEDEPCSTDHEVATPQWTVA
FT                   KSSDTQIAVPGGEITYELTVTNTGEVPLYGATISDGPVGHGESVTDIWDLLANGGSWDG
FT                   EYTVQIGEQVTDYTDATPADGLQLTVDGLGVGEQAVVAFTVQLPDQLAAVHVRNTVTGS
FT                   LIPDPAGPGEPEGRSFPPEDCAVSNGAAPCSADHVYTPPAEWTAAKTAETPSGTSTVEP
FT                   GDTVVYTLTVQNTGLSPVTGVIVTDDLSAVLADGLVTLDSLMDPVQGSVSLDGTTLTWD
FT                   VGTLAVGEPVTYSYSVTVSTDEDVWGLTLHNAAWGTGRGPTDEVLEPVWCTEAAPCTTD
FT                   HEVGIPDPEPDPEPTGHGLPAPTDPEPDLPEPTSPVSGVSAARVSSGGALASTGGKVTA
FT                   LAAAGLLLTAGVLIVRRRREEPAD"
FT   sig_peptide     156323..156412
FT                   /locus_tag="Xcel_0147"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.375 at
FT                   residue 30"
FT   gene            165017..172678
FT                   /locus_tag="Xcel_0148"
FT   CDS_pept        165017..172678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0148"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain protein; KEGG:
FT                   bcr:BCAH187_A3696 conserved repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29188"
FT                   /db_xref="GOA:D1BU24"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR022464"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR038174"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU24"
FT                   /inference="protein motif:TFAM:TIGR01451"
FT                   /protein_id="ACZ29188.1"
FT                   /translation="MTLRRAISGATAAVLVLLSAVTTGGAAAAEPDTGGINAEPAATVG
FT                   VSTNPTRPAALAAPSKEVDPATHHEFPGVEDTDYYISSRNPGRIWTDKTVFSTDVAVPK
FT                   DMQDEENPIPDLQVGEDELAVALSAVGSTRHVSREVPTPVDVSLIIDNSTSMRQCVGNT
FT                   NMCTGASADDNPYTKSRAAAMVEALNVAIGIIAENPANRIAVTQFSENSGEFVDLGTPK
FT                   NAPRPSAQATFIGGPYVYLTHSGSTMTLTMTDDTRTGNARTRTLTVGGGSTNIHRGVAT
FT                   GMGLLAQANSVTGENQRIPNVILFTDGEPTYSASVTNWWAPGASGANHGPNSPTATQYY
FT                   GNGFKAALTASLLKNKIEAVYNDEAFNLAHARTPVEASVYTIGLGVSGLSEQGRQLAYA
FT                   TLDPGKTNPATPTVNPMLEQFNVAFGEYNSSGSPEVLVNRTTGQNPQDVFFRVTHPTVN
FT                   GYVEYEPTTLRYNKEFHSPVTQEDLERAFESIAQQIVDPPNYPVEVSSSTATDGYVTFV
FT                   DELGPYMQVTDFNRLAFCSVVPPVIDPNDCANVTFTNPTRTPSGLTDTYVFKGQYPANG
FT                   LGASPDDEDISSIHVTVTRGATLAQGDIVTVKIPAAMLPIYDKQIKLAANGTPTITPYA
FT                   SHPLHAYYKVAPKAEVLSFLGDVTTTLSMAERDALTAYINDHTDSGKVRFYSNAFDAGS
FT                   AAGKTTATFTPAKKNDFYRFSVDTPLFRTDGSPLLFSDWATLDESIPLYYEDIVYINEG
FT                   NGPEAVKMRVDTTVTALLAAKTDTMVVKQGPLGQAVAPAGMRDYGSRPRNLDHSKCAPD
FT                   ALTWDEGSPVPCAEGDLENTTGTASMVRVTKNEQEQVVVALGNNGYLEYEVPGRLTITK
FT                   RVAAGLNLDPNDDDEFRFSVEFTGAPGVYPFGVYALTNMTAPLYIGEMSSGDTITLLAD
FT                   QRAVIAGLPDGATYKVTEFDLPPGYEPVSATPEGVIAVPQAQPVAVEFLNTYAPTRTDA
FT                   VATPTVAKEIDGRGWVVGDAFKARLCPGSGPVTVPLPNPDEGGCQTVILDTDGHTKDFG
FT                   TLSFTTPGTYTYTLTEVGELAPGFSYSAAEYRWVVDVYDDYSGVLQARTRLEQTRSDNG
FT                   DPVNPGLEVIGSATFTNTYAVGSVSGPLDATKRVVDSTASDGDGTRAPKLSHAFRYWYL
FT                   DVEGGDDAGAPAAPTFPDGTPGGTYDVEVRSTPDSSSVASPRLTFTQAHVGHAYYYAVE
FT                   EIDGRAEGVTYDQGVFIYRLEVTGPAPGDVPSEGLTVHVTPTRCEVPDKRNVDFDALLS
FT                   ACTDYKSDTYPVFTNYYDAEAAEVPLGGTKVLTGRPWVGTDAFTFTLEGFGTETLDAIA
FT                   RGDVILPGVSETVVSVTVDADAAADEGDGSRSFTFDSIAFKRQGAYQFVVKEQIPTQLL
FT                   GLTYDEHWLYYDVIVTDDDVDGQLDFVVIAQDGEPSRTFANQYSAYRAFSGVDVLKVLT
FT                   GRELRLNEFEFRVSPENAASAARLNISPEGKTVASGERPDEPALTTVLGPVTFDQDDLG
FT                   EHFTFNVSEVKGSAPGVTYDDRAYTVILKPVYDAESGELDVLTTVTVGLTTTTYSARAA
FT                   EQPVVTFTNAYAPTTWDLAKSSDRDATVTPGQEITYTLTATNTSKEGAAPLTSVVITDD
FT                   LSDVLGAADNPKAHWVGFVGDGGKYASIDGSTLTWELDELSGTKTLSYTVVVDDAAHDV
FT                   TLRNAVTGMGGVDPEGGGGGEVPPESCVAGTPVADLDDDCVTVHVTGPAWTIAKSSPTA
FT                   TEVKPGDTIVYVVDVTFLGNEGSVIPGVVVIDDLSDVLEHATLDQESIDPLVGEAELVD
FT                   GTLRWTIGDLTENARLTYAVRVNDDAHGVDLVNVVTGSGGTGEDGDDEGEIPPIACATD
FT                   EVDPECTTVHSTDPAWTIAKASPTATEVNPGDTIEYVVDVTLLGDEGRSIPSVVVIDDL
FT                   SDVLEHATLDQESIDPSVGEAELLDDGTLRWDIGNLTEDATLRYSVTVNRDAKAYGATL
FT                   RNLAWGTSTGADVDDGEPEVVPPAQCTEMSPCSTDHEVATPTWTIEKSSDSVAVPGGML
FT                   TYELTVTNTGDIPLWGATITDGPVAHGEGVTDIWDFLDGGGWDGKYTVRVGEGEIEYLE
FT                   DTNRSDGLQHTITELGAGEHVVVTFTVKLPDQLDGIHLRNTVTGSLIPDPAGPGEAPNP
FT                   SFPPADCAIPSGEAPCSVDHTYPPSTEWTLDKTAVTPSGTSSVKPGDTVTYTLTVQNTD
FT                   AKNAVTQIVVTDDLAEVLADGVVTLDALAVPDAGTVRQEGTTLIWDVGTLAAGKTVTYT
FT                   YSVTVVESATAYGTTLHNAAWGTGRGITEDGLDEVLPPVTCAEADPCSTDHEVPVPEWM
FT                   LAKSSDTDTAAPGGDITYRLTVTNTGDVPLYDAQIADGPREQAKGITDIWSALGADGWN
FT                   GAYTVQIDDGDPVGYTDTDVSDGLQAELAMVPVGSTAVVTFTVTLPTTLETVHLRNTVT
FT                   GALPGDPDGPGYAPAGCSEPGPDDVCSADHEYVVARMGPPPSENGPSAVTGGEVLGTVG
FT                   TKLAALVAAAGLMTVAGLLLVRRRREESTE"
FT   sig_peptide     165017..165103
FT                   /locus_tag="Xcel_0148"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.902 at
FT                   residue 29"
FT   gene            172897..179685
FT                   /locus_tag="Xcel_0149"
FT   CDS_pept        172897..179685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0149"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: abb:ABBFA_000776
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29189"
FT                   /db_xref="GOA:D1BU25"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU25"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACZ29189.1"
FT                   /translation="MAPRTKFSIRRTPVLRRIAAATVALAIVSGGAIASQAAAEGEGAD
FT                   GQIVATVDGVPVTQAELEELIGQETGERSDADDDGGERVEGSSALAERPDTEESSDADG
FT                   HAADPTGPGHHATGVPAPPEDDERVIAPKAGTTNINVRVGGDRTNANNNLTVEPVAGVT
FT                   LGLFSSRIGGEPVHVAVSGTDGYARFTGLEAGGYYWLRGVSAPAGWTLNDTFATASLTS
FT                   DPAQVTGRTYAFRVPESGTLTANRTYASGTDFMRTRTTSGTGEARFESSTGYFAVSREN
FT                   PGLPTVCSALNIALILDRSASINTPELQATVRNAAKEFVDLLDGSQVSMEIFAFGTTAG
FT                   SLTGNASHNLAGPDSAQYLRNAITNGLGSSSDFSGQYTNWDDALWKVSQRGGFDLAIVF
FT                   TDGLPTVFGNPASTASNGSALTRFAENERAVFAANALKDQGTRVISVGVGPIVGEAAVS
FT                   VPNLVAISSDDAVITAGWESAAGALRDAILHSCTPHLTVQKYTVPWHWASGDSLAEHRA
FT                   GAGWTFTASELEGTDGTFETMSGEERTTESSGSTTWFFSPSHTGTVGSVTITETQQEGY
FT                   QLVQQDGANAVCTQAVAEGTPSDDLHVTNRGDLGFNIGHIGSQDAITCQVINRRPGPVS
FT                   VSGLAATGVYDVDHTWDITKQVRADAASGWVDETTLSGVAPGGQVDVEYRLVVTAERAE
FT                   AHRTTSVSFDVTRPVGSTVGTQAVRVTVDGTEVYRRALSEFPMNQTTPVALDGLVVPGG
FT                   EPATVALYVGDVLIQSTVVDSELGTTTNATAELTDTFVEPFADVTAFADAFGAVTLDAT
FT                   LRQANYTDHGVAGASVTNPAEDGPLTWRFVYPATLDGPERPGDEVTAVNTAVVSPADDG
FT                   LDAEDEATVVITTDPVGPRVVVDASAAYSTDYVWTIDKQVRVAGADGPWLDAAEARTIP
FT                   GAGVEFEYRLVVRAAGTSTNPVMTGHVVLHNDNASPLTLAGSLVVEAGGVEQSIDVDGT
FT                   MIAPAGSTTVGVEISPAHPAAWPITVTATYGDSAGSVGVVPDVVVTNATAVVTDTFAEF
FT                   EEAFPVPESELDAQQPTNNEQWDDAEGVWVFTYTAVRGEQVAAGASDDFVNTATVTPGD
FT                   AGPSDEDDAIVTVRTGLPLAVVGDGDGTLVRTYGWELVKQVQDVTGAWVDAATLPADDD
FT                   GNAEFTFRVVVRPASATDSDWEFTGSAEIHNPNDWTVTARNVTATISGAGIAPVDVALE
FT                   NREIGAGQTVQLDLTAILAEVDYWQFDAVDVSIAWEQDEAFSVTTSDSVTIAVEWDADH
FT                   APVNRVVNVYDDLAGTVDAPVRLGTVDWSTESADDVADVPEGVVVTMVDGAFHFTYTVT
FT                   VAAEDGALSTSSHNRAWLTSGGEDGEDGALPPIAEDATEQTVIRYDLALRTWVNEIWRD
FT                   GVQVHEVTDAALGGPADPIPFTAYDADEDVRVGDVLVKPIVVINQGDERARVTEIVHWL
FT                   PDAALELASSGQAREAGQDNSGWGESQDGRVATLILAEPLDLAPGEWGRVDVTLTVVAD
FT                   PDAEDSTDGQVHANAIAFAEVAAFEGWVPAGTSYGGTAEDAASEGLFTRIGRFIAGIFA
FT                   DDAETGGAWTSTAVDVDSAPNTADHLTDGEWDADAIAAIWAEIDNVVTGATGAVGVPHA
FT                   ADSDDHDGEIVRVLVGLPLEAAVTVSGTNHVDHDWAITKVVTSDDDVETVAGEDVEFAY
FT                   LLTVTSERQVESLEVSGHVSVANPSSVAVALDALSVTIGDESAVLDGVVTSVPGGGAVD
FT                   VPFTATLDGNLVDDGLPLPVVATVVSLPDGQEATETNETELTLDDVTRTITNQTAEVRD
FT                   SFPEFAVQLGDANGEVWLDAADPAASEAWNAEAGRWQFAYTAERGATVPDGGIESFVNV
FT                   ATVIPDPGTPPGVDWEDDQSPGDLEDDAVVIVRTPVVYDLALRSWVAELHRPGVGRISE
FT                   RLPSDLYPDTSGPEQPVPYVTYDNPYADVQVGDIMVSNIRVFNQGNRTARVDELVKYTY
FT                   PGLALASPSETAVVPAHPNDGWAIGESGDAYRTFADGGIVLAPGEEFTIHVTQVVTSEL
FT                   FEEDGVEVVYDDDGRPFREVLTFTEISAFSGWVHDEPVIAAGDPLIRAFATGEVHDGAD
FT                   GSWVTAEPGGLVEDIDSIPGTADHRVPFDETSVRWVDMEIHHSVGEQDEDDHDGAVIRI
FT                   LDPEFVANELPAPAPDVTPTPDGTPGPNGTPDPDATPDLDATDPDVRAATGGTVLDGGG
FT                   RVLLALAAAGLALLAGLVLRRTRNSRESSAGEGD"
FT   sig_peptide     172897..173016
FT                   /locus_tag="Xcel_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.397 at
FT                   residue 40"
FT   gene            179974..181763
FT                   /pseudo
FT                   /locus_tag="Xcel_0150"
FT   gene            181756..182454
FT                   /locus_tag="Xcel_0151"
FT   CDS_pept        181756..182454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0151"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase activating protein; PFAM: Radical SAM domain
FT                   protein; KEGG: rpc:RPC_3515 ribonucleoside-triphosphate
FT                   reductase, anaerobic-like"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29190"
FT                   /db_xref="GOA:D1BU26"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU26"
FT                   /inference="protein motif:TFAM:TIGR02495"
FT                   /protein_id="ACZ29190.1"
FT                   /translation="MVEPPAVVAGLVRLSTVDWPGKLAAVVFLQGCPWRCVYCHNEEIL
FT                   DPREPGTMPWFEVVEFLRRRRGLLDGVVFSGGEPLLSKALPTAIGEVRNLGFAVGLHTG
FT                   GAWPRRLQALLDDGALDWVGLDVKHLPERYASVTGVPSSGAAAWASLEAVLASGVSHEV
FT                   RTTVDPTVHTRPDVVALAERLAALGVQHHALQEARPDGLAAGHAEAFAGWRLADLLAPD
FT                   DLPHVERRAA"
FT   gene            complement(182456..182860)
FT                   /locus_tag="Xcel_0152"
FT   CDS_pept        complement(182456..182860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0152"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   ppw:PputW619_4624 PilT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29191"
FT                   /db_xref="GOA:D1BU27"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU27"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACZ29191.1"
FT                   /translation="MTTLYLLDTNVLIELLRGRGAVARKQLEAAEGRIGVSTISTMELD
FT                   YGVERSSDPARSRQALDGLLSLMDEIPFDAHAAMHSGRIRAHLAAAGTPIGPYDVLIAG
FT                   HARSLGTVLVTHNTDEFSRVPGLEIEDWLV"
FT   gene            complement(182857..183087)
FT                   /locus_tag="Xcel_0153"
FT   CDS_pept        complement(182857..183087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0153"
FT                   /product="putative plasmid protein"
FT                   /note="KEGG: noc:Noc_0441 putative plasmid protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29192"
FT                   /db_xref="GOA:D1BU28"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU28"
FT                   /inference="similar to AA sequence:KEGG:Noc_0441"
FT                   /protein_id="ACZ29192.1"
FT                   /translation="MTTTRLFRSNTTQAVRLPKPVAFPETVRDVEIRVVGRSRVITPVG
FT                   SAWAEWFDHGLVVPDFPGGRDQGVAQEREAW"
FT   gene            complement(183215..183751)
FT                   /locus_tag="Xcel_0154"
FT   CDS_pept        complement(183215..183751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0154"
FT                   /product="membrane-flanked domain protein"
FT                   /note="PFAM: membrane-flanked domain; KEGG: eba:p1B146
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29193"
FT                   /db_xref="GOA:D1BU29"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU29"
FT                   /inference="protein motif:PFAM:PF03703"
FT                   /protein_id="ACZ29193.1"
FT                   /translation="MALREKDLIDDEQVMLELHSHAKAVLWPFVLFLALVAAAVVTLLV
FT                   STNDTVTWMVLAVLAAVALAGVLWPWLRWRTHSYTVTSQRIAERSGIVTRVGRDIPLYR
FT                   INTIAIEKDLVDRVLGCGTLVVTDATEKAGMMLYDVPRVDDVHRTIQQLLWRQDDGTDG
FT                   GELPPTEPRRGGFRR"
FT   gene            complement(183882..184520)
FT                   /locus_tag="Xcel_0155"
FT   CDS_pept        complement(183882..184520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0155"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG:
FT                   phosphoglycerate mutase protein ; K01834 phosphoglycerate
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29194"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU30"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACZ29194.1"
FT                   /translation="MPIQPTSDPQLVLLRHGETAWSASGQHTGRTDIPLTAAGEDQARQ
FT                   AGQALRELDFAAVYTSPLTRARHTAELAGFADAVVDDNLAEWDYGPVDGRTANDLSAVL
FT                   GREFLIFDDGVRWLPPDPSHGDGRPGELLEDVYARALHVVARAEETLQDGGDVLVVAHG
FT                   HLLRVLATAWLGVDARLGGRLELGTAAISLLGYGHALRTIEGWNLPPSL"
FT   gene            184688..184816
FT                   /locus_tag="Xcel_0156"
FT   CDS_pept        184688..184816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29195"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU31"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29195.1"
FT                   /translation="MPDTENLHRSIANPRRTTLSGRTHAEVVAQQPGSRAEDDAER"
FT   gene            complement(184884..185249)
FT                   /locus_tag="Xcel_0157"
FT   CDS_pept        complement(184884..185249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29196"
FT                   /db_xref="GOA:D1BU32"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU32"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29196.1"
FT                   /translation="MAAARPTPPLASATNGSPHKPKTGRVATPNFSRTSTDPGEVPRSR
FT                   AGALWVGICVAALVLVALIVFMLQNTEPVLVSFLGMEGTVPLAIALLIAGVGVGIVALV
FT                   IGTVRITQLRRRRHHTG"
FT   gene            complement(185362..186474)
FT                   /locus_tag="Xcel_0158"
FT   CDS_pept        complement(185362..186474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0158"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: cak:Caul_2941
FT                   fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29197"
FT                   /db_xref="GOA:D1BU33"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR012171"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU33"
FT                   /inference="protein motif:PFAM:PF00487"
FT                   /protein_id="ACZ29197.1"
FT                   /translation="MSSNTRDRLDRPTTPEAARLARLPRDRPVARDYSVLAKLVRDSGL
FT                   HRRRYAYYWTRLIATVAAFALVWAGVVLLGDTWWQLLLAAALAVVLAQLAFLGHDSSHR
FT                   QIFRSHRWNDWTGRILANVFVGVSHMWWTAKHDAHHAAPNQETRDPDISPGVIAFTPAI
FT                   MASRTGWRGRLARRQGWFFFPLLTLEGLNLHVASVRTVLGRRPVVHRGVEVPVLLTRLV
FT                   LNVAVLAILLPPAIAGTFLAVQLGLFGVLLGGAFAPNHKGMPIVPADADVDFLRRQVLM
FT                   SRNIRGNVVVDFVMGGLNRQIEHHLFPSMPRPSLRLVQPLVREYCSTLGVTYTEVGFFQ
FT                   SYRIVVGYLNDVEHRARDPFGCPLAAQLGR"
FT   gene            complement(186555..187457)
FT                   /locus_tag="Xcel_0159"
FT   CDS_pept        complement(186555..187457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0159"
FT                   /product="3-methyladenine DNA glycosylase/8-oxoguanine DNA
FT                   glycosylase-like protein"
FT                   /note="KEGG: scl:sce7864 putative DNA-3-methyladenine
FT                   glycosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29198"
FT                   /db_xref="GOA:D1BU34"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU34"
FT                   /inference="protein motif:COG:COG0122"
FT                   /protein_id="ACZ29198.1"
FT                   /translation="MRVRHESSRPLDVALTLAQLGHGRYDPAVHRTPDGALWRTSLLPT
FT                   GPVTARIVQDGPRSAVVDLWGDGAREAADGVPSLLGEDDDDAGFTPPPQLRDASRRAGG
FT                   MRMPRTGRVLESLVPAILEQRVQTVTAHRAWRWLLTRYGSPAPGPAPSGMRVVPAPRQW
FT                   AAIPSWDWHRAGVDPGRARIVTTCARLAARLEEAAHLEVPAARARLEAVRGVGVWTSAE
FT                   VAQRAFGDADAVSLGDFNLPGAVGWALTGERTDDAGMLALLAPYAPHRHRVVRLISVSG
FT                   RARAPRRGPQTAIVDHRRH"
FT   gene            complement(187468..188043)
FT                   /locus_tag="Xcel_0160"
FT   CDS_pept        complement(187468..188043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0160"
FT                   /product="ribonuclease H"
FT                   /note="PFAM: ribonuclease H; KEGG: mpo:Mpop_0872
FT                   ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29199"
FT                   /db_xref="GOA:D1BU35"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU35"
FT                   /inference="protein motif:PFAM:PF00075"
FT                   /protein_id="ACZ29199.1"
FT                   /translation="MIIVSTDGSCLRNPGGAIGWAWIDHEGGRFDSGGAASGTNQVAEL
FT                   TAVLRAVEAHPGDEPLLIESDSQYAIRCSSEWLEGWKRKGWRTASGSPVKNLELVQAID
FT                   AAIAGRGGPVRFRWVRGHVGNPFNERADELAGLAAAEWAAGRGDVRSVLLSAVEERSAE
FT                   PAPRPAAVGVRAERPAAESPWELGTLFD"
FT   gene            188193..189392
FT                   /locus_tag="Xcel_0161"
FT   CDS_pept        188193..189392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0161"
FT                   /product="protein of unknown function DUF125 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF125
FT                   transmembrane; KEGG: afw:Anae109_0752 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29200"
FT                   /db_xref="GOA:D1BU36"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="InterPro:IPR039376"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU36"
FT                   /inference="protein motif:PFAM:PF01988"
FT                   /protein_id="ACZ29200.1"
FT                   /translation="MRAGETVARRVSLRIGGMSLPMPSARPARTAADVRRWRRYLADER
FT                   AEAAVYRDLAGRRTGEERDILLALAAAEGRHEQHWLDLLGDDAGRPLRGDLRTRVLGWL
FT                   ARRFGGVFVLALAQRAESRSAYGQDVDATPAMAADEQIHEEVVRGLATRGRNRLSGTFR
FT                   AAVFGANDGLVSNLALVLGIGASGAAQQTVLLTGLAGLLAGALSMGAGEFISIRSQREL
FT                   LEASTPAPSAARALPHLDVDANELALVYRARGMAAGDAQRHADQVLTRLAVAGTTSGAT
FT                   PADLHASHAAEEAAGVAPDDADDLETHGTAWGAAISSFCFFASGAVIPVIPYLFGLHGT
FT                   TAVVVAAALVGIALLATGAVTGLLSGTSPLTRAARQLAIGYAAAAVTYLLGLAFGTTLA
FT                   "
FT   gene            complement(189353..189898)
FT                   /locus_tag="Xcel_0162"
FT   CDS_pept        complement(189353..189898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0162"
FT                   /product="carbohydrate kinase, thermoresistant glucokinase
FT                   family"
FT                   /EC_number="2.7.1.12"
FT                   /note="KEGG: afw:Anae109_0595 carbohydrate kinase; TIGRFAM:
FT                   carbohydrate kinase, thermoresistant glucokinase family;
FT                   PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29201"
FT                   /db_xref="GOA:D1BU37"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU37"
FT                   /inference="protein motif:TFAM:TIGR01313"
FT                   /protein_id="ACZ29201.1"
FT                   /translation="MESVLVVVMGVAGAGKSTVAVEVARRVGGVFAEGDDFHSPENVAA
FT                   MAAGRALTDWDRWPWLGSIRDWLAAQHAAGRPAVVSCSALARVYRDLLRDAGPVLFVHL
FT                   TGSPELLAERIGGRAGHFMKADMLASQLATLEPLGPDEPGITIDVAAGLERIVDAAVGY
FT                   LDGAADQASVVPNARPSK"
FT   gene            complement(189975..191339)
FT                   /locus_tag="Xcel_0163"
FT   CDS_pept        complement(189975..191339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0163"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   smt:Smal_0426 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29202"
FT                   /db_xref="GOA:D1BU38"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU38"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACZ29202.1"
FT                   /translation="MSRNPYADVLRVPGAAAFSAAGGLARLPNAMVGIGTVLMVQEYTG
FT                   SYGLAGRVSAVLVVAQALAAPQVARFVDRAGQRRVLLPLLVVTTAGLIGLVAAAGAGAP
FT                   EPVLLLIAAIAGASQGSYGSYVRARWTHAVHDPGRLHTAFSLEAVVDEVAFIIGPIAAT
FT                   VLATAVIPAGGLLVAALAGAAGGFALLVQRRTEPPVRRSDDGGGVRGDVVGRARDGDVV
FT                   GRTGDGGDRPADGPGRDVVGEAEIDVVTRADDGTIVEVAATTADRRSAILMPGIPGLAL
FT                   VFLAMGTIFGAVDVSTVAFASEQGARGLAGVILAAFALGSMLSGLVYGAVHWQSRLSTR
FT                   FAVGTAALAVGVSLFLTAQSKVALAVAMCVTGVAIAPTLINGNAMVQSLVPANRLTEGL
FT                   AWIATATGGGAALGSWLAGTRIDDAGSQAGFWVAMIAGWTCAVMALVSLPTLRRR"
FT   gene            191391..191708
FT                   /locus_tag="Xcel_0164"
FT   CDS_pept        191391..191708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A2206 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29203"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU39"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29203.1"
FT                   /translation="MTRPTTSADPSPVCVVVKLPAQSRYEAHHPESDRVMGWLNYRVEG
FT                   DVMVINSTVTVPEFRGRGVAGMLAGQALEDAIDAGHRVDALCWYVAEYIERNPRYFSLQ
FT                   V"
FT   gene            191763..192134
FT                   /locus_tag="Xcel_0165"
FT   CDS_pept        191763..192134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0165"
FT                   /product="acetyltransferase-like protein"
FT                   /note="KEGG: psa:PST_4142 predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29204"
FT                   /db_xref="GOA:D1BU40"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU40"
FT                   /inference="protein motif:COG:COG2388"
FT                   /protein_id="ACZ29204.1"
FT                   /translation="MAEVRPHVTVTDDPSGSVVVATLDDGTVAGRAFYDRRGTTVTFTH
FT                   TEVDPAFGGQGIGSQLAAGALGLVRQAGGTVVPLCPFIRAYMAKHPEHDDLLRTATDFG
FT                   TRTAGPGTPNAPAHDAAGE"
FT   gene            192139..194274
FT                   /locus_tag="Xcel_0166"
FT   CDS_pept        192139..194274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0166"
FT                   /product="Succinate dehydrogenase"
FT                   /EC_number="1.3.99.1"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: dno:DNO_1026 fumarate
FT                   reductase flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29205"
FT                   /db_xref="GOA:D1BU41"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU41"
FT                   /inference="protein motif:PRIAM:1.3.99.1"
FT                   /protein_id="ACZ29205.1"
FT                   /translation="MRVDHADVVVVGGGAAGLSAALAAVESFAAAGREDAVVALVSKVY
FT                   PMRSHTVAAEGGAAGVVPGGVDTAEQHVADTLAGGAGLGHDDAVRFVVDRAPAELARME
FT                   RLGMPWSRADDGAPAVRRFGGMTNPRTWFAADKTGFHLLHTLFQTSLREETIRRYDEHI
FT                   VLDLLLTDPVVEPVETTTATTPPVVEPVETTPHGGPAPLPVVEPVETTRPRQVRGVVAY
FT                   DQQRGEPVTLIAPAVVLATGGYARAWGTSTNAGIVTGDGLSMALRAGLPLRDLEMVQVH
FT                   PTCLPGSGILITEAARGEGGVLLDADGARYLADYGLGPETPVGAPVARRMELGPRDKLS
FT                   QAFWHADRAGRTIPTRDGGVVHLDLRHLGKAVIDERLPLVAGLARRFAGVDPVTTPIPV
FT                   RPAAHYTMGGIVTTPQGQVLDAAGAAVTGLFAAGECASTGLHGANRLGSNSLVETLVVG
FT                   RAAGTLAAVSGARTPSPTPGLSDAPEDGDLRASDNPGGVGRASREQARIVEQARALAER
FT                   WLGMRGRGTESPAAIRRELGAVLDAEVGIFRDADGLARAAAVLDDLAERYRDVRVADTA
FT                   AVFNTDWTQALELGAMLDIARGAVAAAIGRTESRGAHQRLDHPQTDDVARHSLVTLDAN
FT                   GAITVTWPPAAEPAPAAEPPSVVEPPPVVEPPPVVEPVETTPRPPAVAAAAPVVEPVET
FT                   TPAARPARPARTSEARP"
FT   sig_peptide     192139..192210
FT                   /locus_tag="Xcel_0166"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.810) with cleavage site probability 0.618 at
FT                   residue 24"
FT   gene            194271..195065
FT                   /locus_tag="Xcel_0167"
FT   CDS_pept        194271..195065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0167"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /note="KEGG: hip:CGSHiEE_07890 fumarate reductase iron-
FT                   sulfur subunit; TIGRFAM: succinate dehydrogenase and
FT                   fumarate reductase iron-sulfur protein; PFAM: ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29206"
FT                   /db_xref="GOA:D1BU42"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU42"
FT                   /inference="protein motif:TFAM:TIGR00384"
FT                   /protein_id="ACZ29206.1"
FT                   /translation="MTDQTLRVTVTRQEPGAAPRDETFDVPFDDRTTVLDALDWIKDHT
FT                   EPSLTFRWSCRMGVCGSCGVMVNGRPLLGCETTVAGYRTSGITVGPMAHATVQRDLAVD
FT                   TDEFLAKLRGVQPWMLPTPATESAEPAEPAEPGGSSGPSGAVEAPAGPRTEDVLAVHSQ
FT                   TPGEVEAYKGLSQCIDCMLCYAACPVLDDVADFTGPAAIATARRWDLDSRDEGNETRFS
FT                   LLAENETGIWPCIQVGACTRACPKGVDPARAIRDYQREAMGG"
FT   gene            complement(195084..196754)
FT                   /locus_tag="Xcel_0168"
FT   CDS_pept        complement(195084..196754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0168"
FT                   /product="phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific"
FT                   /note="TIGRFAM: phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; KEGG: ccs:CCNA_00083
FT                   phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29207"
FT                   /db_xref="GOA:D1BU43"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU43"
FT                   /inference="protein motif:TFAM:TIGR01132"
FT                   /protein_id="ACZ29207.1"
FT                   /translation="MHARAGQVALPEDLIDVDQLVGAYYDLTPDVDDPGQQVVFGTSGH
FT                   RGSSLDHAFNEAHIVAITQAIVEYRAAQGTDGPLFIGRDTHALSLPAWTSALEVLAAND
FT                   VTVMIDARDSFTPTPAVSHAILVHNSRGEGGVRTSGPGLADGIVVTPSHNPPRDGGFKY
FT                   NPPHGGPADTDATSWIADRANEIIRGGIGQVRRVSAETALAAPTTTRYDFLATYVDDLP
FT                   NVLDLDAIRSAGVRIGADPLGGAAVEYWGAIAERHGLDLTVVNPQVDPRWAFMTLDWDG
FT                   KIRMDCSSPYAMASLRERMAGGNAPFDVATGNDADSDRHGIVTPDGGLMNPNHYLAVAI
FT                   EYLFSGARPQWPADAAIGKTLVSSSLIDRVGAGLGRRVLEVPVGFKWFVPGLLSGSVGF
FT                   GGEESAGASFLRRDGRVWSTDKDGIILALLASEIIATTGKSPSEHHASLVSRYGESWYA
FT                   RVDAAASREEKARLAALSPSQVTATTLAGQDITDRLTAAPGNGAKIGGLKVTTADAWFA
FT                   ARPSGTEDVYKIYAESFVSPDHLAQVQASAKDVVTAALA"
FT   gene            complement(197000..197629)
FT                   /locus_tag="Xcel_0169"
FT   CDS_pept        complement(197000..197629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0169"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Hdgfl1; hepatoma derived growth factor-like 1"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29208"
FT                   /db_xref="GOA:D1BU44"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU44"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29208.1"
FT                   /translation="MSEPAQNVDDEQQPGAQQPEPDGHHHEQHRVVTPDGEEIAEAAAD
FT                   DEAAQDDEDVSRIEEPAKVMRIGGMIKRLLDEVRDAPLDDAARSRLAEIHERSLHELED
FT                   GLSPDLVEELHRITLPFADDGAPPSDAELRIAQAQLVGWLEGLFHGIQTALVAQQMAAQ
FT                   AQLSQMRRGLPPGGFPGGPGPGGLGGAGMHHGEHGEDGRPSPGQYL"
FT   gene            complement(197626..198663)
FT                   /locus_tag="Xcel_0170"
FT   CDS_pept        complement(197626..198663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0170"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="TIGRFAM: NAD(P)H quinone oxidoreductase, PIG3
FT                   family; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   gbe:GbCGDNIH1_1348 quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29209"
FT                   /db_xref="GOA:D1BU45"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU45"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ACZ29209.1"
FT                   /translation="MRAVTIAPQAGRGKLALIQAIRPAPAAGEVLVQVASAGVNRADLL
FT                   QRAGHYPPPPGAPPWPGLEISGTVIVAGHGVSSPRVGDEVVALLEGGGYAEYAVARAAQ
FT                   TLPVPDGVGLVDAAALPEAVCTAWTNLVDTARLRPGEWVLVQGGSGGVGSIAVQLAKAL
FT                   GAHVVATAGGPERVAHVRALGADVVVDHHASDVVAAVREATGGRGVDVVLDVLGGGGLA
FT                   DNVRALAPDGRLVVIGLQQGRRGELDLAAVLATRATVTGTLLRSRTPAEKAAIVAAVRE
FT                   HVWPMVADGRVRPVVHARLPLADADDALTSLERGEVFGKVLLVTGAPAASSGATDAPSA
FT                   QGWDA"
FT   gene            198768..202226
FT                   /locus_tag="Xcel_0171"
FT   CDS_pept        198768..202226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0171"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; KEGG: GH10507 gene product from
FT                   transcript GH10507- RA"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29210"
FT                   /db_xref="GOA:D1BU46"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU46"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACZ29210.1"
FT                   /translation="MLRRLGVRGKILATLAMPILVLALAAGWVSWDSLRTARTADQTAE
FT                   LVASLAAQDAAGSAVAAERSLNIAAAMGIPGAKESLEAAFEETGKALTARDEALAAVNT
FT                   DALDVRVRRAISATRADLQQIGRLQEQILDGTIPETEATRQYNEYIENALAVAHELAGT
FT                   TEDSTLSLHLDAYVAMDETMLAVVYERPIVGGVLAGAMTGQVDQGSVLRTVTTIDATNR
FT                   QFEATKGKLDRLPGGHRLPPLDGALGTVRTALGQMDVAGLDPAAAGQWNQLTQDWVAES
FT                   QPVRDGVRDGTAAYSQWLADEARISALTTAGGAFGILALSILIALSVARRIVRPLRRLT
FT                   AATGEIRDRLPKMVEQMAVPGQASTVDLFEIPVESRDEIGRLAQSFNDVNATTVAVAKE
FT                   QAALRGSIAEMFVNVARRDQVLLNRQLAFLDDLERSEEDPSTLSNLFRLDHLATRMRRN
FT                   AESLLVLAGIDTGRRVRQPMPVSDVIRTASSEIELYDRVRLDLQVDPLMLGHNALNAAH
FT                   LLAELLENATMFSEPHTPVEVSTAHDYRGVVVTVRDHGLGMTPEEIADANAKVASRSAQ
FT                   DAVGAQRLGLYVVGRLSDRLGAAIAFSTGPDGTGTMVTVVFPPALFVPDDAVPLPQPTD
FT                   PLDAATQREAATLGQSIALGEIAPPAPAYADAAPAYADAAPVFADAAPLSAFGQVAQEA
FT                   LAAASAPLAEPEAPVAVPVDLDALTDGTTATGMPRRRTARPEPAAEADGPADVVLPPLE
FT                   TPDLPFDLTSSEAWTPPADVEASERALPSRQRAERAAEPQGISEPEPAPALAVEQRSAL
FT                   FSSFRSLNELDDTVTGSLHLEASVEDPAAVPEPLAPVPLAPAPSGAAPSPFSAVRTAAE
FT                   PAQVAAAPQVPAFDALMADLPHRRTERDQHAATERKRGLFGRRPQDGSVTAAIPVQAAD
FT                   GAGALSFLAPAPVAPIPAAAPFPPAAAPAPLPFGAGQAPAPAPSALRPFAAPDAPAAPA
FT                   PSPAPAPAYADPAPAFTDAPSTSRSANGGSALPLRSGASDELTDPLDPYAIPDTVEARS
FT                   EWMASAVLYEEMSSLLRRGVFEEQPVTQKDDVAYRPLSTPSADSAGLVRRQSRPTVNPA
FT                   TDRFTARIERDPEQLRSRLSAFQSATTRGRSATEGDGPSTWAPTP"
FT   sig_peptide     198768..198845
FT                   /locus_tag="Xcel_0171"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.741 at
FT                   residue 26"
FT   gene            202265..202714
FT                   /locus_tag="Xcel_0172"
FT   CDS_pept        202265..202714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0172"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   afr:AFE_2578 roadblock/LC7 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29211"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU47"
FT                   /inference="protein motif:PFAM:PF03259"
FT                   /protein_id="ACZ29211.1"
FT                   /translation="MTLSTEATNFGWLLDNFVRTVPGSRHTLVVSADGLLMAMSDQLDR
FT                   VSGDQLAAIVSGMSSLTRGASRQLHGGNVRQAVIEMDNGFLFLMNVSNGSVLAVVAEAS
FT                   CDIGLIGYEMALLVTRTEQTLTPQLISEMRGNLPVEGAQRTASVG"
FT   gene            202726..203148
FT                   /locus_tag="Xcel_0173"
FT   CDS_pept        202726..203148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0173"
FT                   /product="protein of unknown function DUF742"
FT                   /note="PFAM: protein of unknown function DUF742"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29212"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU48"
FT                   /inference="protein motif:PFAM:PF05331"
FT                   /protein_id="ACZ29212.1"
FT                   /translation="MPHGPHGAGHSGFHAADSYEAATVRPYAVTGGRVRSALSDLPLEA
FT                   LVEVLPGAVSSHGLTPEKRAILQHAAHTYVSIAELSALLRLPLGVVRILVADLQEAGHL
FT                   TVHTSTPVNVHTGHGSSQSGLSLSVLESVLNGISAL"
FT   gene            203129..204061
FT                   /locus_tag="Xcel_0174"
FT   CDS_pept        203129..204061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0174"
FT                   /product="protein of unknown function ATP binding protein"
FT                   /note="PFAM: protein of unknown function ATP binding; KEGG:
FT                   lch:Lcho_0656 small GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29213"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU49"
FT                   /inference="protein motif:PFAM:PF03029"
FT                   /protein_id="ACZ29213.1"
FT                   /translation="MAFPPSDRAHGQASGSIAPAWAPISGGAASVTTSPAAPTAPASAA
FT                   PARTSVLGGGGATNAPASFAPSYPPAAQPAPTQPAGQAQAPAAVQTVSTGTAPLPQAAA
FT                   PRPAAPEQPAPGGAPAAPRTAPTVVKIVVAGGFAVGKTTFIGSISDVEPLNTEAAMTEH
FT                   SVGVDDAGGVTDRKTTTTVAMDFGRVALPGNLWLYLFGTPGQDRFLFMWDDLVRGAIGA
FT                   VVLVDTDRLEQCFPAIDYFESRNIPFVVGVNCFDGVAKHRLEDVREALQIPAHVPMLYT
FT                   DARSRAATKQTLISLVQLAMRQLRSGATA"
FT   gene            204171..204258
FT                   /locus_tag="Xcel_R0004"
FT                   /note="tRNA-Ser1"
FT   tRNA            204171..204258
FT                   /locus_tag="Xcel_R0004"
FT                   /product="tRNA-Ser"
FT   gene            204353..205654
FT                   /locus_tag="Xcel_0175"
FT   CDS_pept        204353..205654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0175"
FT                   /product="protein of unknown function DUF1212"
FT                   /note="PFAM: protein of unknown function DUF1212; KEGG:
FT                   smd:Smed_3002 protein of unknown function DUF1212"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29214"
FT                   /db_xref="GOA:D1BU50"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU50"
FT                   /inference="protein motif:PFAM:PF06738"
FT                   /protein_id="ACZ29214.1"
FT                   /translation="MTTQNPRPGAPGDAELEPVELIRHSGTVQRAGRLALASGHGSYRV
FT                   KSHMERVGRALGLDDVKAQVALTEITTTSVRDQIFRTEVSEVRTVGINADRLAELENFI
FT                   GDLPERENAATIERELDRIATKPPLYAPWANALSAGAACGAFAFLNNGGPLECAGVLVA
FT                   ATAGQYVRRSLIHRGINPFGVTMLAGALACLVYLGLIWAMGAVVANPGRHVAGYVSAVL
FT                   FLVPGFPLVTGALDLARLDFSAGISRLTYALMILFSAALALWAVSAAVGLEPTPPVPLA
FT                   IYPVLRWSLLTLASFVGVLGFALMFNSPWHMALGAALIGMVANVGRLFLVQEVGLAPQA
FT                   AAAAAALLVGLLARWIATPLRVPRLTVSVPAVVIMVPGVAAMRGVFELNGGNTTAALGF
FT                   MVDAGLVVCALAIGLAVSRMLTDREWTFEARRAL"
FT   gene            206176..207687
FT                   /locus_tag="Xcel_R0005"
FT   rRNA            206176..207687
FT                   /locus_tag="Xcel_R0005"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            208146..211266
FT                   /locus_tag="Xcel_R0006"
FT   rRNA            208146..211266
FT                   /locus_tag="Xcel_R0006"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            211402..211517
FT                   /locus_tag="Xcel_R0007"
FT   rRNA            211402..211517
FT                   /locus_tag="Xcel_R0007"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            211708..212184
FT                   /locus_tag="Xcel_0176"
FT   CDS_pept        211708..212184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29215"
FT                   /db_xref="GOA:D1BU51"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU51"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29215.1"
FT                   /translation="MGTTTAKRPWVPPRWFKRAAWRIHRWIYRVSDGRRGLKRPSAGKS
FT                   GLLRLRAIGRRSGEERAVILAYFEDGDRYVTLAMNGWDDPAPQWWLNLCAQPDVVVDTV
FT                   DGPRLVHGRAAEGDERQRLWAALGAHEGWGAGIDRFAALRSRETPVVVLEPRAE"
FT   gene            complement(212249..212524)
FT                   /locus_tag="Xcel_0177"
FT   CDS_pept        complement(212249..212524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29216"
FT                   /db_xref="GOA:D1BU52"
FT                   /db_xref="InterPro:IPR025329"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU52"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29216.1"
FT                   /translation="MAQRDESLAVKIAAMVLTLAAGWLAQKAVGMIWEKSTGHHAPTDL
FT                   DDDEITVVQAVTFAAVSGGVAVLARRLTRRGVVRAAARITPKPPPA"
FT   misc_binding    212723..212827
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam(RF
FT                   00059), score 58.08"
FT   gene            212897..214057
FT                   /locus_tag="Xcel_0178"
FT   CDS_pept        212897..214057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0178"
FT                   /product="ABC transporter, periplasmic binding protein,
FT                   thiB subfamily"
FT                   /note="TIGRFAM: ABC transporter, periplasmic binding
FT                   protein, thiB subfamily; PFAM: extracellular solute-binding
FT                   protein family 1; KEGG: cvi:CV_3164 thiamin-binding
FT                   periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29217"
FT                   /db_xref="GOA:D1BU53"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU53"
FT                   /inference="protein motif:TFAM:TIGR01254"
FT                   /protein_id="ACZ29217.1"
FT                   /translation="MTHETPRTRQTPRTRQTPRTRQTPRAGHTLRTRAAAVVVVGLLPA
FT                   LAACGSGETPGADASEPAPSSTVTLVTHDSWAVSEEVVAQFEAESGFTVKQVPMGDAGT
FT                   LANQVVLTKDSPLGDVVFGIDNTFASRVVDAGALEPHTPAGLPASAVPLVLGDGALTPV
FT                   TVGDVCVNTDAAWFEAEGIAEPETLEDLTEPEFQDLMVALNPASSSPGMAFLLATIGAF
FT                   GDDGFGGEGWTGYWAALRANGLRITDSWSDAYYAEFSGGGEGGTRPIVVSYSTSPAFTT
FT                   TEDGSASTTRALLGTCFRQVEYAGILAGAANPEGARALVDFLVSEPFQADVPGQMYMYP
FT                   ADSSIELPEEWLRFAPLSDSPFDVPPADIAAHREAWLDAWTAAVGA"
FT   sig_peptide     212897..213049
FT                   /locus_tag="Xcel_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.567 at
FT                   residue 51"
FT   gene            214095..215804
FT                   /locus_tag="Xcel_0179"
FT   CDS_pept        214095..215804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0179"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rfr:Rfer_3245
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29218"
FT                   /db_xref="GOA:D1BU54"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU54"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ29218.1"
FT                   /translation="MTRARAAVSAPTAWGWGVAVAVPLLFLGVFFAWPVVALVGRGFTG
FT                   DAGGVDLGEVRDVLGNPRTWRLVGTTLAQAGAGAVGSVALGLPVAYLLYRTRFPGRGVL
FT                   RGLVTVPFVLPTVVVGVAFRSLFRADGLLGWARLEETFAAVVVALVFFNVSVVVRTVGG
FT                   LWERLDPRVEQAARALGASPARAFRTVTLPALAPAIASAAAVVFLFCATAFGVVLVLGG
FT                   LGYGTVETEIYRRTTQFLDLRTAAVLSILQLLVVTLALWVAGRARARRERALHLVPDDV
FT                   AAHRWSHRNLPDVAAAAATVLVVGGLIVLPLAGLVGRSFRGPDGSWGLANYRALGTTGG
FT                   HNALVVTVWEALATSLRTALLATVIAVVVGGLVALVVSRRPRARATRRAVGLLDAVVML
FT                   PLGVSAVTVGFGFLITLDRPLGLNVDLRTSGLLVPIAQAVVAVPLVVRTVLPVLRAIDP
FT                   RLRQAAGVLGASPGRVLRDVDLPIALRSLGLAVGFAFAVSLGEFGATAFLARPDSATLP
FT                   VVIFRLIGRPGAENYGMALAASVVLAVLTAVVMMLAESLRGNRASGAAGGEF"
FT   sig_peptide     214095..214160
FT                   /locus_tag="Xcel_0179"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.902) with cleavage site probability 0.857 at
FT                   residue 22"
FT   gene            215804..216862
FT                   /locus_tag="Xcel_0180"
FT   CDS_pept        215804..216862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0180"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pzu:PHZ_c1203 spermidine/putrescine ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29219"
FT                   /db_xref="GOA:D1BU55"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU55"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ29219.1"
FT                   /translation="MRTDRAGAGPVTPVAAPPAGLMVRGAVVRYDDGEGARGGVTTAVD
FT                   RVDLDVADGEILALLGPSGCGKSSLLRAVAGLEPLAAGSVTYDGADLAGVPVHRRGFGL
FT                   LFQDGQLFAHRDVGRNVAYGLEVAGASRAERSARVRELLAAVGLAGYERRAVTTLSGGE
FT                   KQRVALARALAPRPRLLLLDEPFSALDRALRERLADDVRDVLHATGTTAVFVTHDHDEA
FT                   FTVADRVGIMQAGRLLQVAAPEELWRTPASREVAEFLGYQAFVPQDGGWLAVGPTGLRV
FT                   VEPGTTGADGGTAARVVGSAFRRGRTEVTVDVDLGAGTQRLVALADGAPALEPGTAVVV
FT                   ETDPAGTAAVPR"
FT   gene            217018..217632
FT                   /locus_tag="Xcel_0181"
FT   CDS_pept        217018..217632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0181"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: oan:Oant_1327 bifunctional deaminase-
FT                   reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29220"
FT                   /db_xref="GOA:D1BU56"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D1BU56"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ACZ29220.1"
FT                   /translation="MGRIVSTLFSSLDGVVEIDPEWHFPYFDDQMGAAVTDDYAGVGAI
FT                   LLGRVTYDSFVGAWPDREAAGEEDAGFAKLIGDTRKIVATRGTGDLGWRNVEATPDVVA
FT                   TAQALRADQGVEKVIVPGSITIVRELLAAGLLDELRLLVHPIAARTGERLFDEGAERYP
FT                   MRLVSAEPFDSGVVRLIYAPTTPPEAKTYDDVKQHDMPQPD"
FT   gene            complement(217740..219521)
FT                   /locus_tag="Xcel_0182"
FT   CDS_pept        complement(217740..219521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0182"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="PFAM: glycoside hydrolase family 5; KEGG: bha:BH0603
FT                   endo-beta-1,4-glucanase (celulase B)"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29221"
FT                   /db_xref="GOA:D1BUI0"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR016282"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR040946"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUI0"
FT                   /inference="protein motif:PRIAM:3.2.1.4"
FT                   /protein_id="ACZ29221.1"
FT                   /translation="MARRRWTGAGALVAAVALGLGGLGVGLTGPAAAAPETQHARDGHH
FT                   QGRDRDPRDNDRHDRDQRRDGVPRSASAVVGAMQPGWNLGNTLDAVGADETAWGNPRVT
FT                   PELFDALADAGFRSVRIPVTWGQYQGAAPDHTVDPAAMDRVEEVVDEALDAGLYVLLDV
FT                   HHDSWMWADAFPQDHDAVLAQLTSLWQQIAERFRDHPRSLLLESLNEPQFANVGDDEGD
FT                   LLLDELNQAFTRTVRATGGGNADRVLVLPTLHTDAGQARLDSLLTTFDALDDENLAATF
FT                   HYYGYWPFSVNVAGGYRYDATAQADTEDTFARVEAAFVDRGIPVILGEYGLLGFDRHTG
FT                   TIERGEKLKFFEHLGALARSTGVTTMLWDNGQHLDRTTFRWQDPELYAAIATSWRTRSG
FT                   TGSTDQVFVRPDDVAAQTVTLDPHGQRVTGVWFDGRRLRPADARLTGDDLTLSAALLGR
FT                   VVAGVPEGSAGWLEVRFNRGLPWRIEIIAATTPVLSASSGSTDAFAIPTAFHGDRLATM
FT                   EAHYADGTFAGPHGWTSYKEYDVAFAPDDASIVLTPAFFAEVTDGTPVRLTFHFWSGET
FT                   VEYTVTRTGTTVTGTPA"
FT   sig_peptide     complement(219420..219521)
FT                   /locus_tag="Xcel_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 34"
FT   gene            complement(219854..221569)
FT                   /locus_tag="Xcel_0183"
FT   CDS_pept        complement(219854..221569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0183"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   acp:A2cp1_3272 glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29222"
FT                   /db_xref="GOA:D1BUI1"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUI1"
FT                   /inference="protein motif:PRIAM:5.3.1.9"
FT                   /protein_id="ACZ29222.1"
FT                   /translation="MTTPAPVDPTSTSAWADLTTHHESLRADLRGWFEADPARAERLTL
FT                   EAGELFVDLSKNLVTDETLALLVRLAQEVNLTERIEAMFTGERINVTEDRAVLHTALRR
FT                   APGTQPPLVVDGQDVDADVAAELDKLSAFADKVRSGEWTGVTGRRVETVVNIGIGGSDL
FT                   GPVMIYEALEPYRQDGLTVRFVSNIDPTDVAQKTKGLDPETTLFIVASKTFGTLETLTN
FT                   ARLARTWLLDGLVARGVVEDTAEARRAAVGQHFVAVSTALDKVAAFGIDPANAFGFWDW
FT                   VGGRYSVDSAIGTSVAIAVGPDRFRELLAGFRAIDEHFRTTPLERNVPALMGLLNVWYV
FT                   NFLGAASHAVLPYAQQLHRFAAYLQQLTMESNGKSVRWDGTPVTTATGEVFWGEPGTNG
FT                   QHAFYQLIHQGTQLIPADFIAVAEPAYPLADGEGDGGAVAAGADVHELFLANFFAQTKA
FT                   LAFGKTAAEVREEGTPEALVSARTFPGNRPTTSILAPALTPSVVGQLVALYEHITFTQG
FT                   IVWGIDSFDQWGVELGKKLAMEIAPAVSGDEAALAAQDPSTQSLVRRYRALRHG"
FT   gene            complement(221640..222716)
FT                   /locus_tag="Xcel_0184"
FT   CDS_pept        complement(221640..222716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0184"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   csa:Csal_1153 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29223"
FT                   /db_xref="GOA:D1BUI2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUI2"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACZ29223.1"
FT                   /translation="MSVLPWRLVEVAAEPAGSPPGWAHRGAEALDRAACLERDGHEDLA
FT                   TLAVEFASQLAHQEDELRTLLVAVDDDDSVVGRASIDIPTTSNLHAAWVSVVVHPAHRR
FT                   RGLGAALLERAEKVAADAGRGTLQAELDFAEQPGSPPLVPPTGSGAAPADAPGVRFALA
FT                   HGYALAQVDRRSLLPVPVAAAHLDRLEAQALPHADGYRLHRWDTTIPDAWLDAFALLET
FT                   RMSTDAPVGALDYREDPWDAARVQRMMVQHAEQGREYVITAAEREATGELAAMTMLMWQ
FT                   PDQTFAFQWDTIVLAPHRGHRLGMLVKVANLRALAELRPDVERVHTWNAEENDHMLAIN
FT                   VALGFRPAGGAAGWQKVV"
FT   gene            222841..224151
FT                   /locus_tag="Xcel_0185"
FT   CDS_pept        222841..224151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0185"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: atc:AGR_L_3153 hypothetical ABC transporter
FT                   extracellular binding protein YurO precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29224"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUI3"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACZ29224.1"
FT                   /translation="MTTTKRAASALALGAAIALLASGCAGRAAPGGLDNVQTITWWHNS
FT                   TQTAAKDYYDKVANDFERDHPGVNVEVTALEHSDMLARLDATLESDDPEQVPDVFMSRG
FT                   GGELEGEVAAGVTRDLTKVAAEELAKISRFTNDYTVDGKVYALPYSMGIVGFYYNTDLF
FT                   EQAGITEVNPSPTIDEFNGWIDQLQAAGIPPISVGAGDKWPAAHYWFYNVVRECTYDTV
FT                   EAAIASKSYADPCFLRAGESLSALVAKQPFNEGYATTAAQEGPTSASGLLANGQVAMEL
FT                   AGHWEPGLVGGLRADGTVPDTLSWFAYPTFPGQAGDPLDQMGGGDAWEVSTSAPDVAVD
FT                   LAKYLLSDEVQKGFAELNMGLPTNPAAADSIAFPALQDLVAVRDKASRAPQLYLDTRLG
FT                   SKIGDPLVAEIYKVFTGESGAQQVVDAINAAANGSTE"
FT   sig_peptide     222841..222927
FT                   /locus_tag="Xcel_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.876 at
FT                   residue 29"
FT   gene            complement(224225..225217)
FT                   /locus_tag="Xcel_0186"
FT   CDS_pept        complement(224225..225217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0186"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: hch:HCH_06913 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29225"
FT                   /db_xref="GOA:D1BUI4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUI4"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ACZ29225.1"
FT                   /translation="MTISDVAREAGVSVATVSKVVNGRYGVAAATAERVLQIVADLGYE
FT                   TSLVASSLRRSRTNVLGILLAGFDPFAAELLKGISAEAVGKGYELLAYSGAISDDNAVG
FT                   WERRSLSRLGGTLIDGAIILTPTVSLQGASVPVISVDPHTGTSGSHIVDSDNVAGARTA
FT                   TRHLIDLGHRRIAHIRGRTDLESAHRREHGYRLSLEEAGIPFDPELVRDGGYRSAWSTD
FT                   AARDLLTLPDRPTAIFAANDLSAFAVLQVAHELGLRVPHDLSVVGFDDIPEAASASPRL
FT                   TTIAQPLQEMGARAVTMLLALLDGHDAETHVRLPARLVVRKSTGPAPQR"
FT   gene            225556..227967
FT                   /locus_tag="Xcel_0187"
FT   CDS_pept        225556..227967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0187"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: esa:ESA_02100 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29226"
FT                   /db_xref="GOA:D1BUI5"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUI5"
FT                   /inference="protein motif:PFAM:PF01915"
FT                   /protein_id="ACZ29226.1"
FT                   /translation="MTDAAQAPAPAHMPEVSERVRTLIAQMTVEEKLAQIVSFWPDQGG
FT                   NVVAPMQGEMAAESGGKSLADITKHGLGQYTRVYGTRPVDPIQRAEWLWGEQRRLKKET
FT                   RLGIPALVHEECLTGLAAWQAATFPAPLAWGASFDDELVYEMGQVIGESMKKLGVHLGL
FT                   APVLDVIRDPRWGRTEEAISEDPYVVGTIATKYVQGLQASGVHATLKHFVGYSGSKAGR
FT                   NHAPVSAGPRELADTFLPPFEMAVLDGKVKSVMNSYTDVDGVPCAANEGLLTGVLREKW
FT                   GFEGTVVADYFAVAFLEVMHGVASDRADAAAQALRAGLDVELPGMDAFPLLAEKVRSGE
FT                   FPEAFVDRALARHLTQKEELGLLEPDAFEDEPPTEIDLDSPRHQAIARKLAQESIVLLS
FT                   NDGTLPLAGADAPKRIAVVGPNADAVEALQGCYSFANHVLAHYPDHEIGFHIPTVTEAM
FT                   REAFADAELVTAHGCDVEGTDSSGIAEAVAAAEGADVVVAVVGDRAGLFGRGTVGEGND
FT                   AESLDLPGVQRELVEALVATGKPVVMVMTLGRPYVIDWALDGEGPKPAAVIHAAFPGEG
FT                   GGLAIADVLAGTVNPSGRLPLSLPRSSGAQPYSYLHPMLGGPSDVTNTDSTPTRPFGFG
FT                   LSYTTFAYADLEVSSSVEAGGTITAAVTVTNTGDVAGAEPVQVYGRDVLGSIARPVVQL
FT                   LGYQRVALEAGESKRLTFEIPTTRFAFSDRRMVKIVEPGDVEVWVASHSAAAETSSDVA
FT                   ETTAGAIVNEKKAAKVEIPGTATPRATVTITGPLHEVTTSDARWVTTTIA"
FT   gene            228206..228568
FT                   /locus_tag="Xcel_0188"
FT   CDS_pept        228206..228568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0188"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein; KEGG: cvi:CV_2787
FT                   ribosome-associated heat shock protein HSP15"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29227"
FT                   /db_xref="GOA:D1BUI6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUI6"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACZ29227.1"
FT                   /translation="MRVDVWLWAVRLFKSRSSAAALLRAGRVRIGGAVVKASAHVKVGD
FT                   RVTWREALRERDVEVVELLPKRVGAPLAVKAYVDHSPPLPTREERFAVGVRDRGTGRPT
FT                   KRERREIDHLRGTRRD"
FT   gene            228724..229257
FT                   /locus_tag="Xcel_0189"
FT   CDS_pept        228724..229257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0189"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: mes:Meso_2920 DoxX"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29228"
FT                   /db_xref="GOA:D1BUI7"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUI7"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACZ29228.1"
FT                   /translation="MSAVTERREGALPTTTVPTVGRYAFAALRVVLAFEFLWAFLDKTF
FT                   GFGMATPSERAWVNGGSPTSGFLGGVEGPFQGFFNGMSGSVLADVLFMVGLLGIGVALL
FT                   LGIGMRIAAVSGFVLMILMWAASLPLTNNPIFDEHWIEALVILGLGFTTVGTAWSLSKR
FT                   WGELDLVRRNPWLR"
FT   gene            229282..229941
FT                   /locus_tag="Xcel_0190"
FT   CDS_pept        229282..229941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0190"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: bsu:BSU33080 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29229"
FT                   /db_xref="GOA:D1BUI8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUI8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACZ29229.1"
FT                   /translation="MADMDPVRVFLVDDHEVVRRGVADLLEAESDLEVVGEAGTAAEAL
FT                   VRVPALAPDVVVLDVRLPDGDGVAVCRELRATTDVACLMLTSFDDDEALFDAIIAGAAG
FT                   YVLKQVRGTDLVHAIRTVAAGGSMLDPHAAERVMARMRAQARHDDDPLASLTPQEQRIL
FT                   SLIGQGMTNRQIGAELFLAEKTVKNYVSNLLAKLGMERRVQVAVLATKLGRGDPAP"
FT   gene            complement(230042..231676)
FT                   /locus_tag="Xcel_0191"
FT   CDS_pept        complement(230042..231676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0191"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /note="PFAM: GAF domain protein; histidine kinase
FT                   dimerisation and phosphoacceptor region; ATP-binding region
FT                   ATPase domain protein; SMART: GAF domain protein;
FT                   ATP-binding region ATPase domain protein; KEGG: scl:sce2236
FT                   putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29230"
FT                   /db_xref="GOA:D1BUI9"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUI9"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ACZ29230.1"
FT                   /translation="MQPESRSGVDVLLEAVLAVGRGLELGTTLHRLVQAAADLTDARYA
FT                   ALGVLDADGRIGQFLTVGMAADEIRALDHHPTGQGILGELIRDPRPLRISDVRTDPRAA
FT                   GFPARHPEMDTFLGVPLRVHDAPFGNLYLTSKRGGGDFTDADQRRVEALAAAASIAIEN
FT                   ARLYDDARLRERWAVASDEISRRLLAGDSPDDVLDLIAQHAAQVAGADVAALSVPGEDG
FT                   LVVRAAFGDRAARGTLIPPDGSFAAEVFDSGLPVVTVDAAADPRTTPAIGAAAATIGPF
FT                   AALPLGDPGHTRGVLSVGRERGKLAFTDVVIEALQGFAAQAAVALELAERRRDAARLAV
FT                   VRDRHRIARDLHDLAIQRLFATGLGLQGVARRLERADDADDAARVWAAVDEVDETIGLI
FT                   RTTIRGLQPSGDDPRRVGVRSRAIAEVEAAARALGFPPALRFEGPVDALVPPDTADHLV
FT                   AVVRESLSNVARHAHATRTDVLLTAGDELTVTVSDDGVGIAAGTTLSGLANLRTRAREL
FT                   GGTLTIAAGADGRGTRLRWQVPLPTSG"
FT   gene            231805..232671
FT                   /locus_tag="Xcel_0192"
FT   CDS_pept        231805..232671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0192"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: tbd:Tbd_2614
FT                   universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29231"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUJ0"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACZ29231.1"
FT                   /translation="MVTWRQGVVVGVDGSEEGYRALDWAAAAADRHAAPLTVVGAYAVA
FT                   LVAVPVGGVLDAATLHDGARHVVARATSRLGSRRPGGHEVVADVVPGAAAHVLVQHSRT
FT                   ADLVVVGRRGLGAVDRVLAGSVSSAVAAMAHGRVAVVPASAVGTTPRRVVVGVDVEDPG
FT                   PELEAAFDEAAQLGAGVEVVHAVDPDLLGETLAAYEGWGDAWRAQADGAVRAGVARWSE
FT                   RYPRVRVTTRVEDGRPADVLLRALRPDDLVVVGGRSHRRVVGRLLRSVPDRLLRSAPCA
FT                   VLIVHPA"
FT   gene            complement(232682..233014)
FT                   /locus_tag="Xcel_0193"
FT   CDS_pept        complement(232682..233014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29232"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUJ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29232.1"
FT                   /translation="MRVHMRTDAAWGNSGPQGRGVTMDDIDAGSLTIALLTACSEPDGP
FT                   GIHSRIVQELLDEATADPQLARNVLTTMLTASVVSLRAFTDATHRDREAVLHTLGVGWE
FT                   KRRLAL"
FT   gene            complement(233050..233658)
FT                   /locus_tag="Xcel_0194"
FT   CDS_pept        complement(233050..233658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0194"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pae:PA1928 ribosomal protein alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29233"
FT                   /db_xref="GOA:D1BUJ2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUJ2"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACZ29233.1"
FT                   /translation="MTPTPSGSDATSRDTDDLARPPVLPARLADDVVLRLARPGDGRAM
FT                   AAAYERNREHLAPWDPERPPEFFTAAWQEQNLAVQLADHAAGRFWPLLLVADDGDVVGR
FT                   LNIANVVRGAFHSADLGYWVDGARTGQGLMTAAVGVAVTVARDELGLHRLAASTLLHNT
FT                   ASQAVLRHHGFVRYGLAERYLRIAGRWQDHLLFQRILHD"
FT   gene            complement(233655..234173)
FT                   /locus_tag="Xcel_0195"
FT   CDS_pept        complement(233655..234173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0195"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; KEGG: dar:Daro_0677
FT                   phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29234"
FT                   /db_xref="GOA:D1BUJ3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUJ3"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ACZ29234.1"
FT                   /translation="MDETFPHEPGIILGAPHTSNWDFVHMLALAWRNDAPIRWLGKHTL
FT                   FTGWKGPLMRRLGGIAVDRKNPYGVIEHVLAEVAAGRVFHLIITPDGTRSASGPWKSGF
FT                   YRIARDAHLPVTLGFVDRTTMTLGVGPTLELTGDVGADMDAIRAFYADKAGNRPGKRRE
FT                   PRLASEGGE"
FT   gene            234402..235373
FT                   /locus_tag="Xcel_0196"
FT   CDS_pept        234402..235373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0196"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG: psa:PST_0574
FT                   sodium:bile acid symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29235"
FT                   /db_xref="GOA:D1BUJ4"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUJ4"
FT                   /inference="protein motif:PFAM:PF01758"
FT                   /protein_id="ACZ29235.1"
FT                   /translation="MRTPRTRNVVEWWDRRQVPLYLVAIGVGAVLGLGAPQAAPVLTPS
FT                   ITPVLALLLFATFLGVPLVEVGRAVRDLRFLGTVLVANFVVVPVIVFGLSRLVADDRGL
FT                   LIGVLLVLLTPCVDYVIVFTGLAGGARARLLAAAPLLMLVQVLLLPGYLLLFAGRAALS
FT                   VVEIRPFVEAFVVLIVLPLVASAAVQALGRRRRAGRVVEHVMAAAMVPLMMATLAVVVG
FT                   SQLAAVGGQVAALARVVPVYVAFAVVAVVVGRIAGRVARLDVPATRAVVFSTTTRNSLV
FT                   VLPLALALPAPLAIAPLAVVTQTLVELVAMVVLVRLVPRLVR"
FT   gene            235439..235549
FT                   /locus_tag="Xcel_0197"
FT   CDS_pept        235439..235549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29236"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUJ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29236.1"
FT                   /translation="MVDATSTTAPNAWWRHLHLMLDAYRAERAHPIPDRR"
FT   gene            complement(235620..236006)
FT                   /locus_tag="Xcel_0198"
FT   CDS_pept        complement(235620..236006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0198"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   bcm:Bcenmc03_0064 PilT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29237"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041705"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUJ6"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACZ29237.1"
FT                   /translation="MRLLIDTHILLWLADDDPRLPARGRELLADPAAQIVFSAASIWEV
FT                   AIKAGLDRSDFTKDPFALRSTAIAAGLEELPVTGDHAARVAALPAIHSDPFDRILVAQA
FT                   TAESITLVTHDETVSRYPGPIVLV"
FT   gene            complement(236003..236260)
FT                   /locus_tag="Xcel_0199"
FT   CDS_pept        complement(236003..236260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0199"
FT                   /product="prevent-host-death family protein"
FT                   /note="KEGG: hha:Hhal_0788 prevent-host-death family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29238"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUJ7"
FT                   /inference="similar to AA sequence:KEGG:Hhal_0788"
FT                   /protein_id="ACZ29238.1"
FT                   /translation="METINVHDAKTHLSRLLARVEAGETLSIGRGGKHVAYLTRDISYA
FT                   TPAEVDLRFGFMRGHGTPAPEDFDTMHAEEIRDLFEGTST"
FT   gene            236415..237350
FT                   /locus_tag="Xcel_0200"
FT   CDS_pept        236415..237350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0200"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; Ribonuclease B
FT                   OB region domain; SMART: Cold shock protein; KEGG:
FT                   rce:RC1_3671 cold shock-like protein CspA"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29239"
FT                   /db_xref="GOA:D1BUJ8"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUJ8"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACZ29239.1"
FT                   /translation="MPQGTVRWFDAERGFGFIDVGNEAEDLFVHASEIVGDDGPRLLRE
FT                   GQAVEFEVGEGDRGPQARRVRVTGDRAPDAPLGVLGTVSWYEPAKGYGFVTPDGGRDEV
FT                   FVHSSAIVGGGVISEGQRVAFLVVEGERGLQADHLLPLGSQAARSAGPSDGADGTVSWY
FT                   DDTKGFGFVAPDSGGEDVFVHVSALGPGLTELFEGARVTYDVVEGERGPNAHDVRLVRV
FT                   SGGARAATDRGRPSRPAASGGPVRGGEGTVARYDAERGFGFITPDAGGADLFVHVSVLR
FT                   GVGDLAEGDRVRFKVRQSDRGPQADGVELV"
FT   gene            237483..239348
FT                   /locus_tag="Xcel_0201"
FT   CDS_pept        237483..239348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0201"
FT                   /product="chaperone protein DnaK"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: bha:BH1346 class I heat-shock protein
FT                   (chaperonin); TIGRFAM: chaperone protein DnaK; PFAM: Heat
FT                   shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29240"
FT                   /db_xref="GOA:D1BUJ9"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUJ9"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ACZ29240.1"
FT                   /translation="MARAVGIDLGTTNSVVTVLEGGEPTVIANAEGSRTTPSVVAFSKT
FT                   GEVLVGEVAKRQAVTNVDRTISSVKRHMGTDWAVEIDDKKYTAQEISARVLGKLKRDAE
FT                   EYLGEPVTDAVITVPAYFNDAERQATKDAGQIAGLNVLRIVNEPTAAALAYGLDKGKED
FT                   ELILVFDLGGGTFDVSLLEVGKDETDGFATIQVRATSGDNRLGGDDWDQRVVEHLIKQV
FT                   KNSAGVDLSKDKIALQRLREAAEQAKKELSSATSTNISMQYLSMSENGPIHLDEKLTRA
FT                   QFQQMTQDLLDRTKAPFHNVIRDAGISVADIDHVVLVGGSTRMPAVAEVVRELTGGQEP
FT                   NKGVNPDEVVAVGAALQAGVIKGDRKDVLLIDVTPLSLGIETKGGVMTRLIERNTAIPT
FT                   KRSEVFSTAEDNQPSVAIQVFQGEREFTRDNKPLGTFELTGIAPAPRGMPQIEVTFDID
FT                   ANGIVHVSAKDRGTGREQSMKITGGSAIPKEDIDRMIKDAEAHAEEDKKRREEAETRNQ
FT                   AESFAYSMEKQIADNRDKLPADVVTEVEADIAAVKSALEGEDADAVKSSFEKLGQSSQK
FT                   IGQALYAAEQSAPADEAPAAEDAAPSSSDDDVVDAEIVDDEDEKK"
FT   gene            239345..239998
FT                   /locus_tag="Xcel_0202"
FT   CDS_pept        239345..239998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0202"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: scl:sce0004 chloroplast
FT                   GrpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29241"
FT                   /db_xref="GOA:D1BUK0"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUK0"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ACZ29241.1"
FT                   /translation="MTDEPQRTPGNEEDKPFSFTDKRKVDPTSGAPRVPEETADAGAGT
FT                   GAAHEGAPASGAADADPLAGLDFEPSAETAELEKAKADAADHLDALQRERASFTNYRNR
FT                   ALRDQEAARTRGLEDVLTALLPVLDDIERAKSHAELVGPMAAIAEKLDASLAKFGIERF
FT                   GAVGEVFDPTQHEALMHRETDTVTEPTIELVVEPGYRIGERIVRAARVGVVGPE"
FT   gene            240338..241339
FT                   /locus_tag="Xcel_0203"
FT   CDS_pept        240338..241339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0203"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="PFAM: chaperone DnaJ domain protein; heat shock
FT                   protein DnaJ domain protein; SMART: heat shock protein DnaJ
FT                   domain protein; KEGG: vfm:VFMJ11_1186 chaperone protein
FT                   DnaJ (heat shock protein J) (HSP40)"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29242"
FT                   /db_xref="GOA:D1BUK1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUK1"
FT                   /inference="protein motif:PFAM:PF01556"
FT                   /protein_id="ACZ29242.1"
FT                   /translation="MTGQDWIEKDFYAALGVPKDADDAAIKKAYRKLARQHHPDQNQGD
FT                   AKAESRFKEIGEAYAVLSDAEQRKQYDALRAMAGGGARFQAGGPGGGAGGFEDIFGAMF
FT                   SGGAPAGAGQQRFQTGGGGFEDILGQMFGGGGAGGFGARRAGFQTAERGADLAAATTLD
FT                   FRTAVQGATVELGIDGKKVTTRIPAGVNDGQKLRIRGKGRPGTGGGEAGDLVLTVHVKP
FT                   HPVFTLSGRDLRATVPVTFVEATLGAQVDVPTLSGETVTLKVPAGTPSGRVLRVKGRGV
FT                   GTAKGTGDLLVTVQVAVPQKLSKKAKEALEAFAAASDHEDVRADLAARAAQV"
FT   gene            241347..241805
FT                   /locus_tag="Xcel_0204"
FT   CDS_pept        241347..241805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0204"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: sun:SUN_1561 MerR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29243"
FT                   /db_xref="GOA:D1BUK2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUK2"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACZ29243.1"
FT                   /translation="MNDDAPVLTVTQAAQLAGMHPQTLRQYDRLGIVVPRRTLGRGRRY
FT                   SRRDVAKLLEVQRLAQGEGINLAGIKRILDLQSHVSVLEAQLAKLLAYQAELYEAERRV
FT                   FAAGTVEGDVVVVQRGRRAHREHLRLEAAPNDRSGALVLWRPRPARED"
FT   gene            complement(241840..242631)
FT                   /locus_tag="Xcel_0205"
FT   CDS_pept        complement(241840..242631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29244"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUK3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29244.1"
FT                   /translation="MVARGGKPIVKRFLAETPGSPDLRERWRAGSLAGVWLRPNDWYHP
FT                   AVDALVEAVEAHRTPVAAAQRLGAARGSAGVGMGESLDDLSCLYRALERPVDVDAMRAL
FT                   AIGWAEGHESVPDHAVVRDPGTGLPTAEYLGERLREAYGQAERDGTSATETFCLVVLDV
FT                   ALDDLDAWRRMARSATVGRTLGQVFGDGYPMAVLADGIYVVLCPRGQGTPQLAGTLRRV
FT                   VEKNAEILGLAGAMRRPTRVWVEQLPAAHTDAVELLGQLGR"
FT   gene            242785..247110
FT                   /locus_tag="Xcel_0206"
FT   CDS_pept        242785..247110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0206"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: Muc19; mucin 19"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29245"
FT                   /db_xref="GOA:D1BUK4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUK4"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACZ29245.1"
FT                   /translation="MTDVYIESGDQPSSPSDAELILEVRGGDLDAYGALYARHAGAARR
FT                   LAQSYVRNAADADDVVADAFARVLRVLQSGRGPDQMFRAYLFTVVKNVAIEVAKGHRRM
FT                   QPTDDEATFETALFSEVSSEDPTLAGFEKTVVSRAYRNLPERWQAVLWYTEVEGYTPAQ
FT                   IAPVLGLTANGVSALAYRAREGLRVGYLQEHLSGFTADGCRTVNPLLGGYVRGSLASRE
FT                   IAKVDAHLKTCGDCRTLVLELSDVAHGMRGVIAPLVLGGLGLGLVSALPLGALVGAGVT
FT                   SAAGAAGGAGVVGGAATGATVTGSFGAAGSAGTAGAAAGTAGAAGTAGATAGVGAGAAG
FT                   ATGAATGAVAGTAGATTAGAAAASSGAGSIAAGLGAATASVATSAGSAAAATGTTAVTA
FT                   ATTAASSTAVASTLAASTAGAVVGTSSVAAAASAVAVAAVGVVTVLHALAPSSGDIPTP
FT                   QATSIVTTLPGLQAPAEIGPVEPTPQVSPSQLPAFAQAPVVALVDPAKLAVAPVSTGTL
FT                   QPRVPQRVKLTVANTGEQTAVGTTVRFDLADGLSPVFASSTGARGAPIAGLPLDAAALP
FT                   CRPADDDADVVCRLGDVPGGSTTTFAFDVVARNGGTYDITGQVWASGLKPSAIALVPAV
FT                   VDHYGAELTAELGTLDDLANPGVGTLPVSVVNSGDEPAAEGWSVDVTLPDGLTLAGVEG
FT                   GLDCTTDPQAAGHLTCVAANPATLRPGVGAFASLRVLAPATPTNGTLTARAIPVAADGG
FT                   HVVAGTGAINVQAPWAGAAPIGVTTWCAATGNLATADVVVGGTFVNTTSQTVTARLEAA
FT                   GSAAVGRALAPGESVRLALHDGARVPAGTATWILSTTVAGREYTTSVGGGDVAATDCYV
FT                   PEWDVTTAVVPRNEAGQIRLTGTITNRTTEAMRVDLRAAGRTSAPVTVAAGESATLVLD
FT                   TQTRKLPAGVARFGLSRWVTDVDGDQPRAAVEPEKPATVRYAAAVLAPAIGGEGQASYP
FT                   GACVYDPASETSSRTVAITLDNRGSTLPVAFTVGTAAVTVPAGETRTVEQRVVAGTAGL
FT                   DVVADGRSLGTVPVQVASCATFAWPADVTAAAQARCVPAGGPDSRPSVAVTVSDATGRS
FT                   YEARTRLVRGTWTGPVAVPGGGSASLAVDPGSGLRVRGGDVVVELARTIEGKRYTAEKT
FT                   VGYDAVSCVVRDPGARLELGDVVVNQSGWWPTSSRTVGVVLDNTASNVPVRFVVTGGPD
FT                   GGTTQRTVRPGQAQTVDLGTVVGRTGASISVRTDGWSTTLVVDPFTGTPGWCAPAWNGG
FT                   TEARGGYTAGDVVSYGPTSYRYLGAAQPASGGNAGTGSASPTGPATTPGTTGTAAGADA
FT                   ASSQTSQGTIDGADRSEERSDDGSAVTGRNGSVTGRDGDRDTANTRWGGRWSGGGVSRS
FT                   VGQAVPLFGSWVTPPPRSDVWQAAGACEWRWPGGAQTTP"
FT   gene            complement(247095..247730)
FT                   /locus_tag="Xcel_0207"
FT   CDS_pept        complement(247095..247730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0207"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /note="TIGRFAM: uracil phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: bha:BH3764 uracil
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29246"
FT                   /db_xref="GOA:D1BUK5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUK5"
FT                   /inference="protein motif:TFAM:TIGR01091"
FT                   /protein_id="ACZ29246.1"
FT                   /translation="MRLHVADHPLVDHKLTVLRDKNTPSATFRQLVDELVTLLAYEATR
FT                   HVRIEPHVIETPVTTTTGAKISAPAPIVIPILRAGLGMLEGMTRLLPTAEVGFLGLQRD
FT                   ETTYEAVTYANRLPDDLTDRQVFLLDPMLATGGTLVAAIDYVLERGAREVTCVCLLAAP
FT                   EGLEVVDRALGGRVDVEVVVAAVDERLNEKKYIVPGLGDAGDRLYGVV"
FT   gene            247938..248510
FT                   /locus_tag="Xcel_0208"
FT   CDS_pept        247938..248510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0208"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   gsu:GSU0065 cytidine/deoxycytidylate deaminase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29247"
FT                   /db_xref="GOA:D1BUK6"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUK6"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ACZ29247.1"
FT                   /translation="MRDDDDDGVGGGHSGGRAGVALPWSDGSFPPATLSQRRVVWDALM
FT                   GMALHEATHALASGDVPVGAVVVGPDGRLLGTGRNRREETGDPTAHAEVLALRQAALSR
FT                   REWRLEGCTLVVTLEPCVMCAGALVAARVHRLVIGAWDPKAGATGSVWDLVRDQRANHA
FT                   VEVVGGVREHECGAMLRAFFESHRERP"
FT   gene            248507..249706
FT                   /locus_tag="Xcel_0209"
FT   CDS_pept        248507..249706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0209"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   mxa:MXAN_2875 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29248"
FT                   /db_xref="GOA:D1BUK7"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUK7"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ACZ29248.1"
FT                   /translation="MTDDTAALPRPRTAVLFEPRNVWRTGLVVLGLIALAAVVLQVLRA
FT                   GSSLLFIVFTAWFVSLAMEPAVSRLARRMPRGAATGVVMLGVLGFVALFSALFGNLVVQ
FT                   QVTSLVETIPSLVDQALDYVDQQFGVRYSLDDLLAQVQQNAGSAASVAGTVAGGILSFV
FT                   GALAGAVGTFFIFALLLFYLSADGPRLRRWIASLFPPRAQEATLVVWDTMAEKTGRYVG
FT                   ARLVLATVNGTLSAIVFAIIGLPSWLALALWTGIVAQFIPAIGTYISIALPVLVGALSP
FT                   NPWLGLIVLGWGVLYQQVENLTFEPRISARAVNVNPAVSFSSVILGTSMFGVAGALLAI
FT                   PVVAMLLALLDLYRTRYELVPALAEPGSAAAGDDDEPADDAGEATPQDEGPPRAQQPDA
FT                   "
FT   gene            249709..252066
FT                   /locus_tag="Xcel_0210"
FT   CDS_pept        249709..252066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0210"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   oan:Oant_3334 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29249"
FT                   /db_xref="GOA:D1BUK8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUK8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ29249.1"
FT                   /translation="MGGMAAPAPGTVPGPTTTPVPDAARIAGSPDQPVLRRIATLLAPY
FT                   RAQLLLVGLAVIVSASLTSVAPFLTRAVFDDALFPAGPDGVVGPPDLDLLYWLIGGLVA
FT                   IPLVSALIGVGQTYLTTRIGNGAMADLRVALFAHLEKMELAFFTSTRTGDIQSRLANDV
FT                   GGVKNVLTSTATTILQNVVTVIAAFVAMVLLSWQLTIITLVLMPVFMVIQVRVGKRRKV
FT                   LQRRTQESLSEMTAITEESLGVSGVLLAKVFNRTDVEVERYRRENRRQTRLQVKNAMTG
FT                   QTFFSIVSTFFGLTPAIVYLVAGLLINGGTLVGGAVLSAGTIIAFTTLQARLQQPLVQL
FT                   MRVTLDIQTSFALFARLFEYLDLEPAIRDRPGARVLGKDEVRGDVELREVWFRYPSTRA
FT                   ASAPAGSAPRPDGGGGRGRGGGGGRGARGRSGRGYRALEVPVVAAITDAAGANVLPPSS
FT                   APGLAAAVPVDDPLPVPAPHPVVELVESTQTSDGRVVSTGSTTGDRGVVSTGSTTEGGS
FT                   TTGGGLPDDEKWALADLSLTVRAGQLAALVGPSGSGKTTLTYLVPRLHEVTRGAVLVDG
FT                   VDVRDMTLGSLADVVGMVTQEPYMFHGTITENLRYARADATDAEIVEACRAANIHDRIM
FT                   SFADGYETITGERGFRLSGGEKQRLSIARVLIKDPKILILDEATSALDTATERLVQEAL
FT                   ERAMADRTTFAIAHRLSTIMNADVIFGIADGRLVEQGTHAELLERGGLYARLYAEQFGG
FT                   GQVEARLADAVRFTDGSLLAEAWGHPKPDVPV"
FT   gene            252142..253533
FT                   /locus_tag="Xcel_0211"
FT   CDS_pept        252142..253533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0211"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: ppd:Ppro_3162 PAS/PAC sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29250"
FT                   /db_xref="GOA:D1BUK9"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR025828"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUK9"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ACZ29250.1"
FT                   /translation="MTSTDASTLEERIAPALTSAAGFTRAPFSAATGRALAQLVVGWVW
FT                   AMTAGLTLWICVVTFASFVPALGVGLPLLAFSLGAARLYGASERSRLAAQLPVRIADPA
FT                   PLGVRTSTLREAWHAMWAAIRDGRGWAATAYAFLSLALTSVIVGLVTAAAGAAVAAIAL
FT                   VFAGRDTVVVEWLSTPWPLTVGIALALAVVLLWSAALLAQYGALLQVQLAQALLGPSRA
FT                   EAAQARARLAEQHAQTAAAEASTARERAVVLTETRAGAVAAADSERRRIERDLHDGAQQ
FT                   RLVALGVELGVAKRQAERDPAAAAAALDHAHTEIKETLAELRDLVRGIHPAVLADRGLD
FT                   AALSALAARSTVPVRVQVDGDLAAAGPAAQAAAYFVVAEALTNVAKHSAASSALVTAAL
FT                   APDGAGGCRLRVAVADDGRGGATAAPGSGLAGLRGRVAALDGTFDLDSPAGAGTRLTVE
FT                   VPCAS"
FT   gene            253521..254177
FT                   /locus_tag="Xcel_0212"
FT   CDS_pept        253521..254177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0212"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; response
FT                   regulator receiver; KEGG: dde:Dde_0977 two component LuxR
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29251"
FT                   /db_xref="GOA:D1BUL0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUL0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACZ29251.1"
FT                   /translation="MRIVIAEDSVLLLDGLTRLLTAEGHDVVGHTTADALVRALADGDL
FT                   PDLIVTDVRMPPSHTDEGLRAAVHLRSLHPTLPVLVLSQYVEQRYASELFAAGARGLGY
FT                   VLKDRVADVDEFLDAVARVSSGGTVLDPEVVTQVLARSRSTGLETLTPREHEVLALMAE
FT                   GRSNSAIAERLVVGAAAVEKHVTNILTKLGLPPDADDHRRVLAVLRYLDQNGNRS"
FT   gene            254174..255226
FT                   /locus_tag="Xcel_0213"
FT   CDS_pept        254174..255226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_1228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29252"
FT                   /db_xref="GOA:D1BUL1"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUL1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29252.1"
FT                   /translation="MSNDQQPPYGGFPQQPAGFPQEPAGGLTPQPGAGYPQQPGTGYPP
FT                   QPGAGYPPPGPGGYPPAPAPAPRSRRKVFLVGGLILGVLLIAQAAVLLVDLTLSKTETT
FT                   HRTYDAVSVVELVADGAVNVAAAEGDIEVDAVAHSGIRAPRYSVQEQGDRLVVTHRCGP
FT                   WSWGTWRCSGGLDVTLPADTEVVVRTSNGDVVASGLAGDANLRTSNGRIEALRIDGRLT
FT                   ARTSNGSIAVRDAGGDVEARTSNGSVEVARVGGSLEAETSNGRVDVRDVAGDARATASN
FT                   GRIDVEQVGGNVFARTSNGPVTVRGSGDPVRLTIDTSNGSQTIEGATDPAATRTVEIRS
FT                   SNGDVAYLAP"
FT   gene            complement(255432..257138)
FT                   /locus_tag="Xcel_0214"
FT   CDS_pept        complement(255432..257138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0214"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="KEGG: ade:Adeh_0229 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29253"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUL2"
FT                   /inference="similar to AA sequence:KEGG:Adeh_0229"
FT                   /protein_id="ACZ29253.1"
FT                   /translation="MVTSRWEAHVEDAVVVGSGPGGLAAAVTLARAGLRVTVLEANESV
FT                   GGGARTLDLGLAPGLVHDVCSAVHPMAWASPFFRAFDLRAHGVELLTPEVSYAQPLDGR
FT                   SAAVAYRSLDLTVDALGADGGAWASLVGAASAQWEAVTSLAMGDKRSIPPGLGSAGALL
FT                   GAARFGLGVLEQGTPVWGRRWRTPEAAALLTGVAAHSITPLPSLAGAGTALLLAALAHA
FT                   GPPLAAPPHPVVEPVETTPTPDGRVVSTSSTTGFGVVSTGSTTGGGGVVSTGSTHRVST
FT                   GSATEGSTTDEGGGWAIPRGGSQAISDALVADLRAHGGDVVTGVRVRSRDDLPAARAYL
FT                   FDTTPRTLLDVVGDDVPPEVRRPLAAFRHGNAAAKVDFVLNGPVPWADPDGVGAIARAG
FT                   TVHVGGTREQMAFAEAEVAAGRHAERPMMLVSDPTVVDESRAVGGLRPLWTYAHVPAGS
FT                   DVDVTDAVTAQLERFAPGFRDVVVTSRCVPAAQMEHHNQNYVGGDISAGAVTMWQMIAR
FT                   PTLRANPYRAAGGVYLCSAATPPGPGVHGMPGYHAARRALREVFGIRIPAL"
FT   gene            257229..257636
FT                   /locus_tag="Xcel_0215"
FT   CDS_pept        257229..257636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29254"
FT                   /db_xref="GOA:D1BUL3"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUL3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29254.1"
FT                   /translation="MSSADARHGRRARQVTYGMVAVLVAAAIAHVELWPLTSFRLFSSV
FT                   RTGTGTAYELLAVGADGTRTPVPARIQLLAGLAEEAPDDVAAQVGAWLDDAGLDPAAVD
FT                   VVVLERATWQLDPDTLARHETARDVVLEVRP"
FT   gene            257633..258523
FT                   /locus_tag="Xcel_0216"
FT   CDS_pept        257633..258523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0216"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce1926 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29255"
FT                   /db_xref="GOA:D1BUL4"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUL4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29255.1"
FT                   /translation="MTAPAARLGRGRWRDRIDAALVAPGEARTARWVHAGVAAVVGLRL
FT                   AARDWTVLADRAPALRTHTNLLGWVPDLPAAVLVVVQVVGVLAAVAAIARWRPRLAFGV
FT                   AWACYLVLCGLWTSSGKVMHNDVLTVWVGMVWLFAGPPGRDVPPGERSVRWGWPPRASL
FT                   AVLGCVYFLTGFQKLVHSGPRWAYSDNMAWVLLEGAHTSPFGPEFPQAIAHLPVVPQLL
FT                   ATGALLLELSAPLLLWHRWSRPLFALAVAGMHTSIWACLGLDYSAWVLTAAAVTLPHLR
FT                   SPRVVSGRSGWRRGW"
FT   gene            complement(258489..259406)
FT                   /locus_tag="Xcel_0217"
FT   CDS_pept        complement(258489..259406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0217"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: scl:sce3874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29256"
FT                   /db_xref="GOA:D1BUL5"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026587"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUL5"
FT                   /inference="protein motif:PFAM:PF02146"
FT                   /protein_id="ACZ29256.1"
FT                   /translation="MPSAPRPLAPTYQQRTWTLPPDAVVHHGTVDDAADLLRGRTFTAL
FT                   TGAGISTDSGIPDYRSPDSPPRNPMTYEQFVGDEAFRRHYWARNHVGWQHVRRTRPNDG
FT                   HRALAALEAAGIVRGVITQNVDLLHEDAGSRRVIDLHGRYDRVACLTCGRVISRARLAE
FT                   RLDALNPHFLDTVLAEGLTVSDIEVAPDADAVVEQTSHFVPAPCEFCGGVLKPEIVYFG
FT                   ETVPRERVERAYAMVDDADALVVAGTSLTVMSGLRFVRHAAKRGTPVVIINRGPTRGDP
FT                   LATLKLDAGTTETLTTLAATLTSR"
FT   gene            259532..261292
FT                   /locus_tag="Xcel_0218"
FT   CDS_pept        259532..261292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0218"
FT                   /product="glycoside hydrolase family 18"
FT                   /note="PFAM: glycoside hydrolase family 18; Carbohydrate-
FT                   binding family V/XII; SMART: chitinase II;
FT                   Carbohydrate-binding family V/XII; KEGG: smt:Smal_0542
FT                   glycoside hydrolase family 18"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29257"
FT                   /db_xref="GOA:D1BUL6"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUL6"
FT                   /inference="protein motif:PFAM:PF00704"
FT                   /protein_id="ACZ29257.1"
FT                   /translation="MHRSVTSTRHQPLPRPVTVLLAATTTIAVALGITTLGAQTAHSAP
FT                   PAAGTTPAVGAAPDPDGINGFRTIGYFPGWVPPSGGYQVADLERTGAVDDLTHLNYAFG
FT                   NVTSDLICDISDAVGPEGPEGDPNADYLRLVPKNQSVDGVADRADQPLAGNLNQLRKLK
FT                   ERHPDLKILISLGGWTWSDHFSDAVATPENRTRLVESCVDLWIRGNLPVYGAQGGDGVA
FT                   AGIFDGIDIDWEWPGADGEHPSPRPTEDAANFLSFMEELRGALDVEEAETGHDYLISGF
FT                   APAGWAPRTNGGWVDPRLAAVVDYVNVQGYDYHGTWVPDRTGHQGNLHKYYWPDSTGEY
FT                   ANWDLAADDLLAAYRSAGYRGDQVNLGLAAYGQGWSGVTSPVPGSPATAGLGTRTYAEL
FT                   RSLGTEYYDADAGAAYRWDGDQWFSLDTPRSVTDKAEWVAVNGYGGGFIWDITGDYRNE
FT                   LAGALAGTLRAATPGPLATPSGAAPWYSTGVYTAGDVVVHDGVEFAAAWWTRGQEPGAT
FT                   PYGPWVPTGTTTPVVTPPACAPAWSADAVYTTGDVVSRAGVNHVALWWTRGQAPGTDTW
FT                   GPWDASRPCT"
FT   sig_peptide     259532..259663
FT                   /locus_tag="Xcel_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.939 at
FT                   residue 44"
FT   gene            261358..261444
FT                   /locus_tag="Xcel_R0008"
FT                   /note="tRNA-Ser2"
FT   tRNA            261358..261444
FT                   /locus_tag="Xcel_R0008"
FT                   /product="tRNA-Ser"
FT   gene            262301..263353
FT                   /locus_tag="Xcel_0219"
FT   CDS_pept        262301..263353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0219"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   afw:Anae109_0322 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29258"
FT                   /db_xref="GOA:D1BUL7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUL7"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACZ29258.1"
FT                   /translation="MKALVYHGPGHKEWESVPDPAILAPTDAIVRIDTTTICGTDLHIL
FT                   QGDCPEVKEGTVLGHEGVGTVVEVGAAVGNVRAGDRVIVSCISSCAVCSYCRKGMPSHC
FT                   LGMGGIGWVLGHLIDGTQAEYVRTPFADTSLYKVPDALTDEQAVMVSDIFPTGFEIGVR
FT                   YGDISPGDVVAVVGVGPVGLAAVATAKLYGPSKVIAVGRSRPRIDHALRMGADVGVSTN
FT                   DPDWADVVMAQTDGLGVDVVIEAVGVPRTLQDCVRIVRPGGHIANAGVHGRPVELPMES
FT                   MWINNLTLTTGLVDGTSSPMLIDLMVAGRLQPEQMVTHRFALEEMVKAYEVFADAPTWD
FT                   ALKVAIHREA"
FT   gene            complement(263382..264503)
FT                   /locus_tag="Xcel_0220"
FT   CDS_pept        complement(263382..264503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0220"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: bha:BH2688
FT                   alpha-D-mannose-alpha(1- 6)phosphatidyl myo-inositol
FT                   monomannoside transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29259"
FT                   /db_xref="GOA:D1BUL8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUL8"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACZ29259.1"
FT                   /translation="MRVAVVAESFLPHVNGVTGSVLRVLEHLQRRGHEAMVLAPSLGAP
FT                   PFVSGAPVIEMGAVGLPGYPQVRVAVGQRARIQRALEAFGPDVVHLASPFVLGWHGLRA
FT                   AENLGLPTVAVYQTEVPGYAARYGMRHLEPLLWRRVHHLHERATLTLAPSSAVLASLTE
FT                   RGLPRLRLWGRGVDATRFRPAARSEPWRALVGAGRPLLVGYVGRLAPEKQVEDLRALAG
FT                   LPHVRLVVVGDGPERETLERLLPDAHFTGLLRGPELARAVASLDVLVHPGELETFGQTL
FT                   QEAHASGVPVVAPAAGGPIDIVDHSRTGWLYAPGDLTAMRERVVDLLGDDRKRAAFGAA
FT                   ARARAVGRTWPAVCDELLGHYRDAIATTSRLPV"
FT   gene            complement(264578..265870)
FT                   /locus_tag="Xcel_0221"
FT   CDS_pept        complement(264578..265870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0221"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_0175 integral membrane protein-
FT                   like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29260"
FT                   /db_xref="GOA:D1BUL9"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUL9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29260.1"
FT                   /translation="MRTQTATEPRAHAPVGDLLLSRWGLVTAFVLVHAWVVLSALARSG
FT                   EIFGDVSLYHWWAQRGLSTGWWPVLHEAWVYPAAALVPVTLPALGTSGFVQYATVWSAM
FT                   VIALNAGAVWLLARAERPGRVAALWWLGFLAALGPIWLGRLDGVAAPLILATLLLAHRN
FT                   RAVATAVATLGAWIKIAPGALVVALAATSRSVRDLVRQVAVPGAVVSVVVVGLALAGGA
FT                   GERAWSVFGEQSDRTLQAESVAATWFSVARLWDPSVRIEYNDVIYTYEVVGDAANTVGH
FT                   LLDVALVIAVVVVGLLAWAATRRHPELAQDVLLLSAAATLFALVVFNKVGSPQFVAWLG
FT                   PPVAAALALAGPRLRRVWLVPAVAMLGVGMLTQVLYPLAYGYFLDGTPWMVGVAAVRNV
FT                   AIVVLLGGALWRLVQLAASQGSRPAGSPDVP"
FT   gene            265969..267288
FT                   /locus_tag="Xcel_0222"
FT   CDS_pept        265969..267288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0222"
FT                   /product="Mn2+/Fe2+ transporter, NRAMP family"
FT                   /note="TIGRFAM: Mn2+/Fe2+ transporter, NRAMP family; PFAM:
FT                   natural resistance-associated macrophage protein; KEGG:
FT                   bcb:BCB4264_A1874 transport protein, NRAMP family"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29261"
FT                   /db_xref="GOA:D1BUM0"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUM0"
FT                   /inference="protein motif:TFAM:TIGR01197"
FT                   /protein_id="ACZ29261.1"
FT                   /translation="MTAVTSEPTGPTRPPRRPRLRPSPTSASRARLITLLGPAFVAAIA
FT                   YVDPGNVAANLTAGARYGYLLVWVLVAANVMAVLVQYLSAKLGVVTGRSLPEVLGGSLR
FT                   RPARLAYWAQAEVVAAATDLAEVIGGAIALHLLFGVPLVIGGVITGVVSLLVLSVQQRR
FT                   GQRVFEAVVVSFLLILTVGFCAGLFFSPPDAGAVLGGLVPRLAGTDSLLLAASMLGATV
FT                   MPHAIYLHSSLARDRRRHDAAVRARQGVPETAASTERLLAATRWDVVCALVLAGGVNIA
FT                   MLLVAAANLPGREGTDTIEGAHAAISSSLGASIALLFAIGLLASGLASSSVGAYAGAEI
FT                   MAGLLRVRVPLLGRRLVTLIPAVALLATDISPTWLLVVSQVVLSFGIPFAAIPLVTLTR
FT                   RKSLLGEYRNGVVTQVLAWTAAGVIVVLNIVLLTLTLLGR"
FT   gene            267362..268606
FT                   /locus_tag="Xcel_0223"
FT   CDS_pept        267362..268606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0223"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: bur:Bcep18194_B1396
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29262"
FT                   /db_xref="GOA:D1BUM1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUM1"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACZ29262.1"
FT                   /translation="MSAAQPIMPGVTAPEYDVSRPLDLDYVGAFADVTPAERAHQLAVR
FT                   EFVQDRVLPVIDGYWERAEVPFELVKELGARDFLRDGVSVPDRPEISLTAEGLAAMEMS
FT                   RGDGSVATVCGVQGGLALRSIMMHGSDAQIARYAEPMARGDVLGAFALTEPTHGSDSVS
FT                   LETTAVRTVRDGVEGYAINGEKKWIGFGSCGHITVVWARLVGDAGDSQVHGFIVPQDAD
FT                   GYRATTIEGKVALRAITQAHIVLDDVFVPLDAALPGATSFKATSQVLFATRLAVAWSAV
FT                   GHAIACYEAALEYVGQRVQFGRPLAASQLVQERLTRMLSTISQLQLLVARLTRVAEAGG
FT                   LTGAQASLAKYSCTRGAREVAALARDMLGGNGILLANRVARHFADIEALHTYEGTESMN
FT                   ALIVGRDITGFSAFA"
FT   gene            complement(268682..268819)
FT                   /locus_tag="Xcel_0224"
FT   CDS_pept        complement(268682..268819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29263"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUM2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29263.1"
FT                   /translation="MSESSSDPITEDEAYALAVDEAEAADDLDEATEVQRRLETAAEDF
FT                   "
FT   gene            complement(268947..269645)
FT                   /locus_tag="Xcel_0225"
FT   CDS_pept        complement(268947..269645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0225"
FT                   /product="nicotinamide mononucleotide transporter PnuC"
FT                   /note="TIGRFAM: nicotinamide mononucleotide transporter
FT                   PnuC; PFAM: Nicotinamide mononucleotide transporter PnuC;
FT                   KEGG: sal:Sala_3131 nicotinamide mononucleotide
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29264"
FT                   /db_xref="GOA:D1BUM3"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUM3"
FT                   /inference="protein motif:TFAM:TIGR01528"
FT                   /protein_id="ACZ29264.1"
FT                   /translation="MDIFEQFLNAQLTIGDDHMLWREIVGNVFGLVSALGGMRRKVWGW
FT                   PIGIVGNVLLFTVFLGSWFGMAGEHPDMLGQAGRQIMFIGVSIYGWYRWNQTRKSGGAG
FT                   AVAVHPHWATWRQRAGLVLGMAAGTAGFALIFAQLNSWAPVPDAWIFVGSVLATYGMAR
FT                   GWVEFWLIWVAVDAVGVPLLFRAGYYATGFMYLFYGAFTIVGFIVWWRVHRRESGKVGP
FT                   RSDAPADAVA"
FT   gene            complement(269751..271016)
FT                   /locus_tag="Xcel_0226"
FT   CDS_pept        complement(269751..271016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0226"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mxa:MXAN_2233 major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29265"
FT                   /db_xref="GOA:D1BUM4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUM4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACZ29265.1"
FT                   /translation="MPSSPSPSAVPSAARRARVAVSAVFLVNAVLYANVVPRLPEVKAD
FT                   LGLSNAALGAAIAAMPLGALLAGLLAPALIQRFGSAGVASFGLVALAGAVAAIPLAGAW
FT                   VVLAGLFLLAGALDAVIDVAQNAHGFRVQRLYGRSIVNAFHGLWSVGAVLGGLIGSAAA
FT                   GLSIPLSVHVATTSAVFSVVAVVAFRFLLRGPEDAERPDDGGAHGHGSRPLRHVAGRTI
FT                   LLLAALGAIAAGAAFVEDAGSSWGALYLRTELGAGAAAAGLAFVALQVAMTVGRLTGDR
FT                   AVDRFGQRRVARVGGVAIAVGMGFALAVPSLASTLVGFALAGLGVATLVPAVMHTADEL
FT                   PGLPAGVGLTVVSWLLRVGFLVSPAAVGLVADATSLRVGLLGVVGAGVLVAVVGRVLLA
FT                   GPAAGDDEPITASGGPAASPST"
FT   gene            complement(271091..271834)
FT                   /locus_tag="Xcel_0227"
FT   CDS_pept        complement(271091..271834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0227"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: scl:sce6308
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29266"
FT                   /db_xref="GOA:D1BUM5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUM5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACZ29266.1"
FT                   /translation="MTVVRTSHTHAHAVDAAIELFSRQGYEQTTVEEIADAAQVSRATF
FT                   FRRYRSKEDVVFADHELLLEEVTVMLAATRPEARDDGERAWDPATAPYLEVCRAARLVF
FT                   DHHLGQRATSLARYRLLQQVPALRDRELITTHRYERLFTRYLRDTLPADRSSTVQSIAF
FT                   SAGVVAVHNAILRRWLRQPELDLRPELEEAFAELRRGATADLARRDQPVPTTTVSADGA
FT                   RVVVVQVDPGTTAETVADAVRTALA"
FT   gene            complement(271844..272011)
FT                   /locus_tag="Xcel_0228"
FT   CDS_pept        complement(271844..272011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29267"
FT                   /db_xref="GOA:D1BUM6"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUM6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29267.1"
FT                   /translation="MGIRWASVRTVLVAGAVALVLAWVAVRGRWWAWAPFLLALGVVVR
FT                   EVRWLQRRER"
FT   sig_peptide     complement(271943..272011)
FT                   /locus_tag="Xcel_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.751) with cleavage site probability 0.447 at
FT                   residue 23"
FT   gene            272043..272681
FT                   /locus_tag="Xcel_0229"
FT   CDS_pept        272043..272681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29268"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUM7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29268.1"
FT                   /translation="MSTQTAANANLTASPVVDVFVDPLCPYAWITSRWILEVAAQRPVD
FT                   LTFRLMSLYWLNEGRDLDAGYRARLDAGRGIGRVAAAVQTEHGPEAFAAFYTAAGTRIH
FT                   PGGRADYDAVAREALAEAGLPEALADAASSDAYDEALRASHAAGMAPVGEDVGTPTIHV
FT                   DGVGFFGPVLTRIPRGQDAVRLFDGAVALSAFPDFYELKRSRTGNPDFT"
FT   gene            272876..274636
FT                   /locus_tag="Xcel_0230"
FT   CDS_pept        272876..274636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0230"
FT                   /product="Cellulose synthase (UDP-forming)"
FT                   /EC_number="2.4.1.12"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bph:Bphy_2377 cellulose synthase (UDP- forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29269"
FT                   /db_xref="GOA:D1BUM8"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUM8"
FT                   /inference="protein motif:PRIAM:2.4.1.12"
FT                   /protein_id="ACZ29269.1"
FT                   /translation="MALLDTLVLDPGAAERLGTGRPGIPRPDRPRADRDRPGADPQAGR
FT                   RQRAAATSPSLMLLVLLATLGIVAYAGFLLNPHHRGDLLPWLLVVFAESVLVAQALAAM
FT                   WTVLSSGYDPRDFRFHHAADRLFDVPRILADGDEDDPTRWTLHLNGEPIVVDILITTCG
FT                   EDLAKIEATVAAAVAVRGAHRTWVLDDGRDDAVRELAARLGARYVRRLSGGGQKAGNVN
FT                   HGLTVAKGDFYVILDADFVPEPELLTETIPFFVDRQVAFVQTPQTYGNMRSIISRGAGY
FT                   MQELFYRFVQPGRNRFNAAFCVGTNVVFRRAAIDDVGGMYTDSKSEDVWTSINLHERGW
FT                   KSVYIPTTLAVGDTPETIEAYSKQQLRWATGGFEILLQHNPLARGRRLTVDQRLQYLVT
FT                   ATHYLAGIVPAILLLIPPLFIYLDLTPMSTSMGAGQWAMHYLGFYALQMAIATFTLGSF
FT                   RWEVLLLSAVSFPIYLKAFRNALTRRQQAWHVTGSRSGHRSPFEFIVPQMVTFVFLALT
FT                   SVVGVLRQWDDPVLTAALAWNLVNTLILGGFLVTAAREDVTGRRAARQVNATAPPPRTR
FT                   AAARRAGGAS"
FT   gene            274633..275364
FT                   /locus_tag="Xcel_0231"
FT   CDS_pept        274633..275364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0231"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: bpt:Bpet1203 HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29270"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUM9"
FT                   /inference="protein motif:PFAM:PF00364"
FT                   /protein_id="ACZ29270.1"
FT                   /translation="MSRAAWFRLVGGVLAVTLVAGGLTWVLGRRDGQVTSFLATVQTQT
FT                   VDVGVDYPGTVTDTLVKPGEQVDAGQPVLVVNSLRLAHDIAEGLLAASTVAYEVAADGT
FT                   MTVLSPVAGTVTHVGVTEGQYVPGGQVLATIDESRTAHVEAKFMLDATDLTRLAIGAPV
FT                   TIALPDRTRLEGTIDGFAVDNADAKAVVTATVVAPVLAREGGALTQAGTPVVASVRLAP
FT                   QGPLSAVYETLDGFRQKVAGL"
FT   gene            275361..277550
FT                   /locus_tag="Xcel_0232"
FT   CDS_pept        275361..277550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0232"
FT                   /product="Endo-1,3(4)-beta-glucanase"
FT                   /EC_number="3.2.1.6"
FT                   /note="PFAM: glycoside hydrolase family 81; KEGG:
FT                   scl:sce7103 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29271"
FT                   /db_xref="GOA:D1BUN0"
FT                   /db_xref="InterPro:IPR005200"
FT                   /db_xref="InterPro:IPR040720"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUN0"
FT                   /inference="protein motif:PRIAM:3.2.1.6"
FT                   /protein_id="ACZ29271.1"
FT                   /translation="MRAARRTTAAPTTAARTPGVSTTAVRRLAVVAVALAAALAGCVGG
FT                   GRAEPDGSAAAGTPAGPLAATDADPPDVDPGILPARQIAPTSTMRLADGLSPPTNRWFS
FT                   ALALGDTAQPVFPRPLAVGLTEAGFGVGVPELTTTQTAVMGSYTPQVTIDVGATDPVVT
FT                   AYDAASVTVDLGTGTLTLVEGSPVLHWTATTAGTVTWDVPFEPGGPAGSAVAAVGERTW
FT                   LLLASTPDGTPATPALADDGRSAEIPAGGRLAWLALPDDADPTSTAAQTLAEAAVHPPA
FT                   PTTLRWAADDAAATTAIDLGAPTAVVRLPHQSTPAPQDDLDCDGLGTYATVLGAATACV
FT                   GRTTAWSVPTVPTDATLDVVALTDDERAELADVVTADTERLTGDDAPAYPADTYFGTKA
FT                   LARDARLLTLATALGLDEPAARLRERIGAELRLRADPDGCTQRAERCFVLDPVLATVVG
FT                   LPPGFGSDEANDHHFHYGYLLEAAALAAADDAEHGDGTLAAALAPVVDLLAADIAAAGP
FT                   VPAGDGPDLPALRVFDAFAGHSWASGYAPFADGNNQESSSEAVAAWRGLALWAQVRGDD
FT                   ALGTQARWLLAAEAASARAYWLAPAEGPTSFASLVWGGKRERATWFSPEPSAALGIVVL
FT                   PITPSSGYLVEPDDGGERVRANLAEALGVAPDALWDDPAVWDVQFGDQLLAYAALAGPD
FT                   DAAHAVGLLRDLPAEGIDDGATRAWLLAWAMTRGG"
FT   sig_peptide     275361..275507
FT                   /locus_tag="Xcel_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.757) with cleavage site probability 0.607 at
FT                   residue 49"
FT   gene            277717..279108
FT                   /locus_tag="Xcel_0233"
FT   CDS_pept        277717..279108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0233"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; Benzoate membrane
FT                   transport protein; KEGG: uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29272"
FT                   /db_xref="GOA:D1BUN1"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUN1"
FT                   /inference="protein motif:TFAM:TIGR00801"
FT                   /protein_id="ACZ29272.1"
FT                   /translation="MAASPRAPWGWTLHGNGKTLAPGDVVAPGQRLTWPRTAGIGLQHI
FT                   VAMFGATFLVPLITGFPPSTTLFFSAIGTIGFLLITGNRLPSYLGSSFAFIAPIMAAKA
FT                   SAGGDLGTAIGGILATGVLLAVVGLIVHFTGGGWIDAVMPPIVTGTIVALIGFNLAGAA
FT                   WCTPATGELDGQAVNFVDVCTGGFKTAPLTGVITLGAIILASVLFKGILGRLSILVGVV
FT                   VGYVAAILQGQVSFDAVREAAWIGLPTFHAPSFDPAVLGYFLPVVLVLIAENVGHVKSV
FT                   AAMTDTNLDRVTGRALFADGVATSLAGLGGGSGTTTYAENIGVMAATRVYSTAAYWVAA
FT                   IGALLLSLFPKFGALIATVPAGVLGGAGTMLYGMIGILGARIWVQGKVDFSNPINLTTA
FT                   SIPLIIGIANFTWVVGDLTFAGIALGSGAALVIYHGMRWISRLTGAHQEPATPASVPAG
FT                   AEVTH"
FT   gene            complement(279244..279936)
FT                   /locus_tag="Xcel_0234"
FT   CDS_pept        complement(279244..279936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29273"
FT                   /db_xref="GOA:D1BUN2"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUN2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29273.1"
FT                   /translation="MTTPAQDPARIARRRREHERQAVIYGVLIALIAVVGLGALAIYTG
FT                   AIDAPFAREFTPSTPEEEVTPPCLPVVEDQPDGALPLPYGEVVLNIFNASGSDGTAGIA
FT                   GANESVLSARGFQIGTVGNHPKTLIHNELRFGEQGIVAAYTVASHFPQVRMVMDTREDA
FT                   TVDLLVGTNFDRPLDVDDVSTGPLKNAEGCKPADEITMVPGPAPTGEGEDAEGGEEPAD
FT                   DGDPAPEG"
FT   gene            complement(279946..280251)
FT                   /locus_tag="Xcel_0235"
FT   CDS_pept        complement(279946..280251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29274"
FT                   /db_xref="InterPro:IPR014447"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUN3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29274.1"
FT                   /translation="MKAMIFKSVGEGRPYPDHGLVSAKDWADVPPRQVRLDELVTTKRT
FT                   LDLDVLLAEDSTFYGDLFAHVVEYQGVLYLEDGLHRAVRAALQQRPVLHARVLTLR"
FT   gene            280475..281980
FT                   /locus_tag="Xcel_0236"
FT   CDS_pept        280475..281980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0236"
FT                   /product="glycoside hydrolase family 6"
FT                   /note="PFAM: glycoside hydrolase family 6; KEGG:
FT                   cellobiohydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29275"
FT                   /db_xref="GOA:D1BUN4"
FT                   /db_xref="InterPro:IPR001524"
FT                   /db_xref="InterPro:IPR016288"
FT                   /db_xref="InterPro:IPR036434"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUN4"
FT                   /inference="protein motif:PFAM:PF01341"
FT                   /protein_id="ACZ29275.1"
FT                   /translation="MQSRTRTTRTTRTLAALATAALAGATLLATSAPASASRSETLWVN
FT                   PNSSTTEHITELKLKGQARDDARLLAGYATATWFTGETPKKVRNAVRDVVRSADRARAV
FT                   PTLVAYNLPFRDCSQYSAGGATSQAEYEAWIDGFAAGIGDERAIVILEPDGLGIIPWYT
FT                   TFEGTQEWCQPEEADPATAADERFAMLNHAVDVLAALPNTDVYLDAGHSGWLNVGDNTD
FT                   RLIKAGVQKADGFYLNASNYQYTENSVAYGRWISSCIALVTEVGGALADCGNQYWNGGP
FT                   LSDWEGVEMTKYAPWTADPTAPLERRTDVLDDRYAQALGGVQPTARFVVDTSRNGQGPW
FT                   DPATSDVGYDPLDSAEDWCNPPGRGLGLRPTLQTGDPLVAAYLWIKVPGESDGLCHRGL
FT                   GGPLDPERGIEDPAAGQWFVQQARELIELAVPAVKGDERCRDGKGGKGDRDGKGDRDGK
FT                   GDRDGRGGKAGRADRGDKGDRDRDRHDSGKRDVRTSDRDARSR"
FT   sig_peptide     280475..280585
FT                   /locus_tag="Xcel_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.793 at
FT                   residue 37"
FT   gene            complement(281946..282746)
FT                   /locus_tag="Xcel_0237"
FT   CDS_pept        complement(281946..282746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0237"
FT                   /product="FAD-binding 9 siderophore-interacting domain
FT                   protein"
FT                   /note="PFAM: FAD-binding 9 siderophore-interacting domain
FT                   protein; Siderophore-interacting protein; KEGG:
FT                   sml:Smlt3577 putative siderophore interacting FAD binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29276"
FT                   /db_xref="GOA:D1BUN5"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUN5"
FT                   /inference="protein motif:PFAM:PF08021"
FT                   /protein_id="ACZ29276.1"
FT                   /translation="MAYKDARKATGLYAAEVQRTKQVTPHMVRVTLVGEDLGALPQRGF
FT                   DHWFRLFLPSAGEQTDFARLPDRFGIGGYLKYLRTPAGTRPVCRSYTVREHRPELRELD
FT                   IDFVAHGDTGVAGPWAQKAQPGERVVLLDQGVGFEPAPGTDFHLFAGDESALPAIGGIL
FT                   RDLPRDARGLAVIEVPDAADAQDVEAPDGVEVRWLPRTDPQARAGSLALAEVRAFTPAD
FT                   PATLSAYLVGEQALPTEGRRHLVAHGVPKDRITFIGFWRHGRTS"
FT   gene            283210..283665
FT                   /locus_tag="Xcel_0238"
FT   CDS_pept        283210..283665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29277"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUN6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29277.1"
FT                   /translation="MDIAGAELDEFARGSMIENVRLSRPDVVDGTHPEATRLISVDVEP
FT                   AVFDIARGTDVRVLTHRALVHDLCSFIDTRDLSARLDVERVLAGAALWDVVDDAVLAER
FT                   RVLLSHDGLRRKVVNAALTLAWRESGQIGATDLIEDSEFPRPRADLR"
FT   gene            complement(283877..284569)
FT                   /locus_tag="Xcel_0239"
FT   CDS_pept        complement(283877..284569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0239"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: scl:sce5431 two-component
FT                   system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29278"
FT                   /db_xref="GOA:D1BUN7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUN7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACZ29278.1"
FT                   /translation="MITVVLADDHELVRSGLRLILEAQDDIQVLSEAADGEAALREVRR
FT                   LRPDVALLDIQMPRMSGLEVARAVVADTTAHTRVVMLTTFDRDDYLYDALVAGASGFML
FT                   KSSPRAHLLHAVRTAASGEALLDPSLTRRLVESHVRRPRAVEPGQTPAQLAGLSPRERD
FT                   VLQALARGESNAEIAGTLFLAETTVKTHVAAVLRKLGLRDRTQAVILGYEIGLVVPGDN
FT                   APGGPRRV"
FT   gene            complement(284566..285678)
FT                   /locus_tag="Xcel_0240"
FT   CDS_pept        complement(284566..285678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0240"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   KEGG: scl:sce5432 putative two-component system sensor
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29279"
FT                   /db_xref="GOA:D1BUN8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUN8"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ACZ29279.1"
FT                   /translation="MPVSGSAPMRIYFWLGLAVAGLGVVQLLADRSADDAPVVLVAALA
FT                   CGASVALLPRALLWATLGVAVSVVSMVVVIEVPVFASFLAAMVASFTLALYAERRQALI
FT                   GVAIVLATVVVVAVPEMRASSEGAFGLVYPVFYFGGSATIGWLSRQRAKYTQSLQDFAA
FT                   SLERERHQQAALAAAAERERLARDLHDVVSHGVSLMVVQAEAAREVIGARPEAAANALE
FT                   TIADTGRAAMEDLHRMLGVLRDESTDLGPLAVRMRAAGIDVRLQVDPAWHSWDEPVRAA
FT                   LFRVAQEAITNTLRHAEGASEVSIQASTAEGAAVLEVRDDGTGTTEESTGLGSGLSGLR
FT                   DRIAALGGRLDAAKSDGGFAVRATVPLGRS"
FT   gene            285873..286469
FT                   /locus_tag="Xcel_0241"
FT   CDS_pept        285873..286469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0241"
FT                   /product="tellurite resistance protein and related
FT                   permease-like protein"
FT                   /note="KEGG: rsq:Rsph17025_1151 tellurite resistance
FT                   protein and related permease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29280"
FT                   /db_xref="GOA:D1BUN9"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUN9"
FT                   /inference="similar to AA sequence:KEGG:Rsph17025_1151"
FT                   /protein_id="ACZ29280.1"
FT                   /translation="MSSITGSHRRTTQTEGSGTSVALRASGPLAAIALVAFVASIVATE
FT                   GDPLELATSPFSIAASMAGLAALVALSLGMTDLAARRPELRHGPGQVGWAIASVGTVLA
FT                   AGGQWTQLFALPGLAGPAPDLAVNGIGSVVAGYIASYIVLGVGWLLVGISLLRAGSAPR
FT                   AIVWTLIVGAVLSIAPLPVRFAVLAVAVSLLARRR"
FT   sig_peptide     285873..286004
FT                   /locus_tag="Xcel_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.601) with cleavage site probability 0.331 at
FT                   residue 44"
FT   gene            286646..287758
FT                   /locus_tag="Xcel_0242"
FT   CDS_pept        286646..287758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0242"
FT                   /product="protein of unknown function DUF450"
FT                   /note="PFAM: protein of unknown function DUF450; KEGG:
FT                   pmy:Pmen_3692 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29281"
FT                   /db_xref="InterPro:IPR017035"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUP0"
FT                   /inference="protein motif:PFAM:PF04313"
FT                   /protein_id="ACZ29281.1"
FT                   /translation="MEISERLASLATKLQQQRGSIGTEEATKNAIIMPFIATVLGYDVF
FT                   DPNEVVPEYTTDVGTKKGEKVDYAIVKDGDVQILIEAKAVGAPLSVNHASQLFRYFAVS
FT                   NARIGILTNGQVWHFFTDLEKPNRMDEKPFLQLDLLDIDAALIPEVAKLTKASFDIDSV
FT                   VSAAEELKYIGAIKRELAAQFREPDVDWVRVLTSRVYDGSITARVREQFTVLVSKAMRQ
FT                   FLADQVNDRLKTALGGQGYGDAGAPPAAVTSAPEAPDAADAGATDADQTRERGVETTME
FT                   ELEGFQIIRAIACSELSLSRIVPRDTKSYFGVLVDDNNRKPIARLHFNAGTKYLGLLDE
FT                   TKAETRHRIETLDEIYRYADEIRIAAKRWA"
FT   gene            complement(287858..288691)
FT                   /locus_tag="Xcel_0243"
FT   CDS_pept        complement(287858..288691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29282"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUP1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29282.1"
FT                   /translation="MSKYSNRPKDYDLDGFLYDARVLAAQCCYLNLQHQAPLVLGEFGP
FT                   DADHQIETDLAGYAEILDSRADGIHRPVRVRDVNRLVCTCALVVRTEDRFREPAGHLDA
FT                   CCRPARTVIVDLGGDTEIIAACQGCGASTTVTDLRLARSWAAEHACPPRPVPPGDAHGS
FT                   TFDAFVIEEGMAPDDIVHRARTQMRNDAAPSGHLIPWDFHPRHRLAYTLAMLRHAERVH
FT                   HGATLRDGDAQRLAEWTAKLRDLNAVVTYDPASPQGFLLVPREEGDEDLIRRPKA"
FT   gene            complement(288855..289505)
FT                   /locus_tag="Xcel_0244"
FT   CDS_pept        complement(288855..289505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0244"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; Sigma-70 region 4
FT                   type 2; response regulator receiver; SMART: regulatory
FT                   protein LuxR; response regulator receiver; KEGG:
FT                   bph:Bphy_6469 two component LuxR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29283"
FT                   /db_xref="GOA:D1BUP2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUP2"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACZ29283.1"
FT                   /translation="MRVIVVDDALLTRAGLVRLLAEVGVDVVAQAADARDIQALVADHD
FT                   PDVVVLDIRMPPTFTDEGLLAASALHRERPELGLLVLSQYLETEYAMRLIEEHPEGVGY
FT                   LLKDRLFDIAVLVDALRRIAEGETVIDPTIVARLLGRRRRQDPVDRLTPREREVLALIA
FT                   EGLSNQAIAQRLVVTERTVETHVTSIFMKLELADDATTHRRVQAVLRYLRHAV"
FT   gene            complement(289496..291232)
FT                   /locus_tag="Xcel_0245"
FT   CDS_pept        complement(289496..291232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0245"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4945 periplasmic sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29284"
FT                   /db_xref="GOA:D1BUP3"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUP3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29284.1"
FT                   /translation="MNRREVAARALVSVGAMLVALSLPLLRPGHSMAPATTTATSALVA
FT                   ATGATALIGCALLASMRPPASSMGPLAAAAAVVWVSPSWVGWAEGPPLVRSVGELLVPF
FT                   AAPVLLHVVVAAPRGRIDGRGARSLVATVYTSIGLAVATLALVRDPFLDRLCSANCTAN
FT                   VFLVVPLPRVAALLRDAVIVTTTAVAVLGVVLAGTRLIGSARAARADTARVVAPAALAL
FT                   LAGASGRLLAPGAMLGRDHVGVHRLASVTEAAALTLLGAGIAWSVLIVRARRRRVARLA
FT                   HELGASPMTGSLRRALAAILDDPTLDVLYPLAGSTRHVDATGEPRELTLRPDRAVTEIR
FT                   RGENTVAVVVHDIALRGDPRLADYLGTAARLAIDNERLQADVLARLRELRESRARIVEA
FT                   ADAARRAVERNLHDGAQQSLVALLYELTLARLHAERAGEPAQAADIAATQRRAAEIAER
FT                   LRSIAHGPIPAILDHHGLEAALRTLAEESTVPTDVRVGFSHRLPLPVERAAYVVVARSV
FT                   EAGDVARGSVHASVTLDRSLLTVSVNGNAPDDIEALRDRVGALGGSITATDGGLQAVIP
FT                   CA"
FT   sig_peptide     complement(291164..291232)
FT                   /locus_tag="Xcel_0245"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.779) with cleavage site probability 0.297 at
FT                   residue 23"
FT   gene            291594..292943
FT                   /locus_tag="Xcel_0246"
FT   CDS_pept        291594..292943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0246"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: rfr:Rfer_1484 TRAP dicarboxylate transporter, DctP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29285"
FT                   /db_xref="GOA:D1BUP4"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUP4"
FT                   /inference="protein motif:PFAM:PF03480"
FT                   /protein_id="ACZ29285.1"
FT                   /translation="MAVLDLAHRIERRSGGGIDVEIEWQAHRRTTDVWTADAAPIVADL
FT                   VTAGDVELAVTPEWVWIEHGAPSLAALRTPFLIDRLEVLQEIAVGGTGERMLADLTEHG
FT                   VRGLALLPQGLRSPLSFGPAILEPDDLVGSSFRSLDRQGLSLFRSLGAEVPVVDGDEYT
FT                   GRVARGEIDGVDASLATASAHPELGTITADLAYYPLSSVVVANSAWFASLAPDVRELVQ
FT                   AAATETVGFVIDSTPSPAAAAEAYCAAGGTVSLAGETLVARWRAAAAPARAALEQDPVT
FT                   AENVAAIMALAARVPPERDPARACEGTAARPPGAGGHAPSADFPEGVYRAEIPVSAFLE
FT                   AGVDGQTAEGHAGIWTLTFRGGTWESTDPHAPVHDCPGSAYRVEGDRIVVVLGDRGASC
FT                   GGSAGRELFSARWEVDDGVVRFLDVRAGPGGGSDAFVQALFGSTDWSRAD"
FT   gene            293069..294589
FT                   /locus_tag="Xcel_0247"
FT   CDS_pept        293069..294589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0247"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: pol:Bpro_2963 TRAP dicarboxylate transporter, DctP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29286"
FT                   /db_xref="GOA:D1BUP5"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUP5"
FT                   /inference="protein motif:PFAM:PF03480"
FT                   /protein_id="ACZ29286.1"
FT                   /translation="MSALHPAVSRRGSESRPMVLPTAALIVSALAVLGACTSPAAPTTS
FT                   SGTTSSSGTTTLRLLHTDSDLILDPAVGWFVDEVAERSGGALAIDVVAACCGRGAEIEQ
FT                   ELISRVADGEGDLGVVGTRAFDVLGVDGLRSLTAPLLLDSYALQEAVITSDVAREHLAG
FT                   VAQLGVTGIALLPGPVRVPLSSGRPLLDPDDWTGLRVHTVRSELSVAAFAALGAEAVSP
FT                   DVEGRDVGLYDGSLQAIDNGFAFQRADRERILPYASVNVRLWPRVSALIAHPGALEQLS
FT                   AAHQSLLRDAAAAVATHTGDLAAMDAATVAEACERGARLAEASPSQLASMEAAFAPVYA
FT                   ELEKDAATADLIGGIRALEQTVEAEAAVAVPEGCAGTAPSPAIGTDDTTTAVDGRWTRA
FT                   AMTIDELVAEGLSEVQARDLTTRFTLEFADGRFTLTVDDEWVCDGTPSTSGDHLFVEYA
FT                   PGGRCGPGGLLFEATFTVEGDVLTLTDVDSQNAADRLFFGLRPWTRVG"
FT   sig_peptide     293069..293206
FT                   /locus_tag="Xcel_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.673) with cleavage site probability 0.152 at
FT                   residue 46"
FT   gene            complement(294612..296024)
FT                   /locus_tag="Xcel_0248"
FT   CDS_pept        complement(294612..296024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0248"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: afw:Anae109_1809 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29287"
FT                   /db_xref="GOA:D1BUP6"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUP6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACZ29287.1"
FT                   /translation="MPAVATVAARSALVLAGVVAALVASVVAHGWEGSLLVPDLVAAIA
FT                   FVVLAARAWPDGRPTFWLALAFTVAWIAGTLVAYGLYWHRGFLVHLLLSFPRAWPGRRL
FT                   HRLAIAGGYAASVTPFVWSSDAAAVVLAAALASVAAFSWQGDRPGRVVRWCSLAFAVVV
FT                   VVGSGARSVVPQGRAVEPVFWAYALVVTATAVVLGLGLRRADPARVADLVVELGGLTGR
FT                   DDATASVARSLSDVLGAPVAEDDPLVARTVDIARRMTATHRALEDETRRRLGEVEASRR
FT                   RLLAAGDDERRHLQERLQQQVIEPLGELERRIRDSPTGAGASLDGAGALVRRAIGEVGE
FT                   TAAGLGPRALEAGLEAALRPLTVSGPVSVHLSIVAERFAPEIEAAAYYVCAECLVNAFK
FT                   HAGAATVVIVARRDGSRFEVSVSDDGAGGADLDAGSGLRGLRDRVDSLGGGVEIVSPPG
FT                   AGTTVRAWMPVS"
FT   sig_peptide     complement(295932..296024)
FT                   /locus_tag="Xcel_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.784 at
FT                   residue 31"
FT   gene            complement(296172..296259)
FT                   /locus_tag="Xcel_R0009"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(296172..296259)
FT                   /locus_tag="Xcel_R0009"
FT                   /product="tRNA-Ser"
FT   gene            296386..296478
FT                   /gene="ffs"
FT                   /locus_tag="Xcel_R0010"
FT   ncRNA           296386..296478
FT                   /gene="ffs"
FT                   /locus_tag="Xcel_R0010"
FT                   /product="SRP RNA; RNA component of signal recognitionparti
FT                   cle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            296869..297783
FT                   /locus_tag="Xcel_0249"
FT   CDS_pept        296869..297783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0249"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: bcb:BCB4264_A0360
FT                   putative ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29288"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUP7"
FT                   /inference="protein motif:PFAM:PF03180"
FT                   /protein_id="ACZ29288.1"
FT                   /translation="MTRKRFSLLTRSLAAVAVVGSLALTGCASSSDAAISAGTEADPIV
FT                   IGIVSSGEEYWKTFTAKAEEAGIHVELKNFSDYQLPNQGLADGDLDLNQFQHLQFLADF
FT                   NVKTGNDLTPIGATAVYALDLYSTKVTDVADIPDGAEVAVPNDASNQARALLVLQDAGL
FT                   VTLKDGGNSFSTAADVIADESRVAVTALKADQTPAALQDPKIYAAIVNNDYVPNLPAES
FT                   QKPIYSTDASSSANDPYINIWVARAEDKDNETFAKLIEIYHDTEVTDGVIEASGGTGII
FT                   KSETPAELQEILATIEKNQKAQG"
FT   sig_peptide     296869..296970
FT                   /locus_tag="Xcel_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.816 at
FT                   residue 34"
FT   gene            297790..298992
FT                   /locus_tag="Xcel_0250"
FT   CDS_pept        297790..298992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0250"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mno:Mnod_5160 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29289"
FT                   /db_xref="GOA:D1BUP8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUP8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ29289.1"
FT                   /translation="MSTTPIISFRDAAKVFPGSRKRPEVRAVDGVTLDIEAGEIFGVIG
FT                   YSGAGKSTLVRLINALEKTTSGSVVVGGQDLTALGESQLREVRAGIGMIFQQFNLLSSR
FT                   TVAGNVAYPLEVAKWPREKREARVRELLEFVGIADKAGSYPSQLSGGQKQRVGIARALA
FT                   TNPRILLADEATSALDPETTREVLRLLQRVNRELGITVVIITHEMDVVRYACHRVAVME
FT                   HGKVVEVGDAYAIFSGPTAPVTRRFVATSLRDRPSAETLARLRERHPGRLVVVGIDEVT
FT                   GSTHAISQVLRDAGVEPAIIYGGITEVADKPYGSLTFELTGSDDDVAAAIERLREVTGV
FT                   DDLGTADAPVSAPAETTTDPTAGRSGPPRTRVVGAQDYGMLGGQGGRLAGPDRLVIEED
FT                   D"
FT   gene            298992..299654
FT                   /locus_tag="Xcel_0251"
FT   CDS_pept        298992..299654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0251"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcu:BCAH820_0344 ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29290"
FT                   /db_xref="GOA:D1BUP9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUP9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ29290.1"
FT                   /translation="MSFDWVTNGPLLWEAAGQTLYMVLITLVAGGFVGLVIGLGLYLTR
FT                   SGNLLANRFVFTVLNVLINLIRPVPFIIFLVALGPLTRVVTGRTIGIEAFTFAMCVMAS
FT                   VVFARLVEQNLVSIDPGVVEAARAMGASPLRIVRTVLVPEALAPLILGYTFLFIGVLDM
FT                   SAIGGYLGAGGLGDFAIVHGYQQYNWGVTFVVVLIIVAVVQLVQVLGNTLAKRALRR"
FT   gene            299699..299965
FT                   /locus_tag="Xcel_0252"
FT   CDS_pept        299699..299965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0252"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29291"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUQ0"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ACZ29291.1"
FT                   /translation="MLIESENLVPLTEANQNFSRVARMVDERGSVVILRNNKPRYVLID
FT                   YDLLQGQMTVAPPEAQTPSEDEVLASGRKFLTKYAEAFAELAK"
FT   gene            299962..300342
FT                   /locus_tag="Xcel_0253"
FT   CDS_pept        299962..300342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0253"
FT                   /product="death-on-curing family protein"
FT                   /note="TIGRFAM: death-on-curing family protein; PFAM:
FT                   filamentation induced by cAMP protein Fic; KEGG:
FT                   rpe:RPE_4100 death-on-curing family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29292"
FT                   /db_xref="GOA:D1BUQ1"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUQ1"
FT                   /inference="protein motif:TFAM:TIGR01550"
FT                   /protein_id="ACZ29292.1"
FT                   /translation="MKRLTQGLVLALHQQMLAAHGGSEGVRDESLLDAALEAPYAAFAG
FT                   REFFPTIEEKAARLGFGIVANHPFVDGNKRTGIMALLVLLDLNGVTVSTNNAELISLGL
FT                   GLASGEITYEQTVRWVRERAGV"
FT   gene            300441..303221
FT                   /locus_tag="Xcel_0254"
FT   CDS_pept        300441..303221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0254"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: ade:Adeh_3637 DNA polymerase III, subunits
FT                   gamma and tau; TIGRFAM: DNA polymerase III, subunits gamma
FT                   and tau; PFAM: AAA ATPase central domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29293"
FT                   /db_xref="GOA:D1BUQ2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUQ2"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ACZ29293.1"
FT                   /translation="MTTALYRRYRPETFAEVIGQEHVTGPLMQALRSGRVNHAYLFSGP
FT                   RGCGKTTSARILARTLNCHANTPQTPLDTPCGVCPSCVELARGGSGSLDVVEIDAASHG
FT                   GVDDARDLRERATFAPARDRYKIFIIDEAHMVSPAGFNALLKIVEEPPPHIKFVFATTE
FT                   PDKVIGTIRSRTHHYPFRLVPPDVLAPYLESLCASEGVTLGGGVVPLVVRAGGGSVRDS
FT                   LSVLDQLIAGASTGVVDYDLAVGLLGYTHSSLLDDVVDALAARDGASLFRVVDQLIASG
FT                   HAPQRFVDDLLERLRDLIVIAVSGDAAGAVLRGLPADQLDRMAAQASRLGVAELSRAAD
FT                   LVNAALTEMTGATSPRLHLELLCARLLLPGADEGAAGLAARIERLERGGLVAAASVAAP
FT                   VRSGRQADGGAPTAGADVGGLRGAAAVRAAMQASRRPTAEVQGDATEGAGARTVASAPA
FT                   QDPAPAPGRSSVVAAPPQGDSGVGHAVEPVASGPAAETVGGDPAAGPAVDAEPDVEPVP
FT                   AAPVSDRPVDDELLHDEPVPDEPLDDQPLDGPPVAAAPAEPHVGAAPGARAEEPPAPDP
FT                   ASAGGITTEIVRRRWPEVLGSIQNPRAQAFLGEHAQVLSLEDGVLTLGFTPAVVTQARM
FT                   GRPETISDAVYETLGVQVRVEIVAGSGGPRPRDAAPTRRTQDDAAESDDPAPAAPPAPT
FT                   APAASATPSEPAVRRVPTAPTAPTAPTAPSAPTAGRGPTSPPAPTPFPAAPATPAPPAA
FT                   FDEADAAWLAGTAMYEPPSEDEPEPPADDVEPAGTSGWAASSSPAQSSPSPASSSPASP
FT                   SQAIAAARASIAGSTRASNTSATAPGTGQVPAANGAAASRRESPMEAVQRHALQARAHG
FT                   VRAQEAVPSSSAASPDPYDDAATDDPEIASTGLVGVPLVVKLLNGTIIDEQIDQA"
FT   gene            303344..304855
FT                   /locus_tag="Xcel_0255"
FT   CDS_pept        303344..304855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0255"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: bbt:BBta_6049 putative
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29294"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUQ3"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ACZ29294.1"
FT                   /translation="MTHTMWRRLPRTSPEAAGVDRAAIAKLTEQLDLLGTHSLLVLRHG
FT                   AVVAERFWAPHTAERPHQMFSVSKTFTAMAVGLAVSEGLLTVEDRVVDLLPEAAPAEVS
FT                   DKLAAMRVEHLLTMTSGHAGDLFETFDGLGDDWPRALLAAEVVREPGSRFLYDTAATYL
FT                   LSAIITRLTGQRLLDYLTPRVLAPLGITDATWEQDPRGIDMGGFGLSVTTEDMAAFGQL
FT                   LLQRGRWGDAQLIPASWVETAAANHVDSSVQGWGVDASIGYGYQMWRCQPGCARADGAF
FT                   GQFIVVWPEHDAVVAITSGSQRTQDQLDAVWGCLGSAFGTGQALPAPDDADARADDAEP
FT                   DADRIDRADDGADSQPLQLELPQGVAWTAAADLVDGRTFALDTEVPVPEAPPGTPPFRT
FT                   VTVRRDDDGIVVDVGPLRGHARYGAWGTTTDGGVVPTTSSAYAWTDDRTLEVRVAGLGM
FT                   PFVWTIRLVVAADGASIDVAVDQNVSFGARELVRATARRVRATAR"
FT   gene            304925..306106
FT                   /locus_tag="Xcel_0256"
FT   CDS_pept        304925..306106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0256"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: mxa:MXAN_6549
FT                   transcriptional regulator, ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29295"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUQ4"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACZ29295.1"
FT                   /translation="MTGTSRSGTGSQTALRGRNTAAIVRALTVTGPQLQADLSRVTGLS
FT                   RATVSNIVALEVEAGRLRAERVLRDGRWGLLVSRAPEDWVVAGIDIGRSHLRVVARDAA
FT                   ARTVGDREIALDPGHLPDVTLARASELLDEVVAQAGLSRSRVRKVGIALPASVGPDGAV
FT                   VQQSVLREWSGMNVAERAAGVLGIETVVDNDANLGAFAHAAGRGGRGTLVYLKVASGIG
FT                   AGIVVGDRLYRSTTGLVGEIGHVQVVDGGQTCYCGSRGCLETLASVRTVVADFERVHGR
FT                   AATLDDVLAAIAADDPVALRIVTEAGDALGRVLAVMCNILSPDVVVVGGPLTPVGAPLL
FT                   DAIVASVRKRALPAAISRTEFAVSDSEPRAEVSGACLLALQALDAEDLSVPTS"
FT   gene            306232..307782
FT                   /locus_tag="Xcel_0257"
FT   CDS_pept        306232..307782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0257"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bha:BH3441 L-arabinose ABC transporter ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29296"
FT                   /db_xref="GOA:D1BUQ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUQ5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ29296.1"
FT                   /translation="MQDEAPILEMRSITKTFPGVKALDDVSMTVRRGEIHAICGENGAG
FT                   KSTLMKVLSGVYPHGTYEGDIYYKGEEVQFKDIRSSENAGIVIIHQELALIPELSVAEN
FT                   IFLGNEQRGPFGIDWETTREKAKELLARVDLNVDPMTQIKNLGVGQQQLVEIARALSKD
FT                   VELLILDEPTAALNEHDSMLLLELLRGLRSKGLTCIIISHKLNEIMAISDTITVIRDGL
FT                   SIATMDVTQGDVDEDRIIRAMVGRSLESRFPPHTPNIGDVFFEVKDWTVEHPQLPGRLV
FT                   AKGSSFFVRRGEIIGFAGIMGAGRTELARSLFGRSYGRYLGGTIAMHGKEIKVPTVAAA
FT                   IEHGISYVTEDRKALGLNLLDDIQTTVVSADLKKVKPGWALDDTLIHQAGERARKAFRI
FT                   KANSVSVGVAKLSGGNQQKALLGKWLFPEPELLIVDEPTRGIDVGAKYEIYGLINELAR
FT                   AGKGVVVISSELPELIGLCDRIYTIFEGAITGVIDRADADQEKLMRLMTGVGADADAA"
FT   gene            307815..309077
FT                   /locus_tag="Xcel_0258"
FT   CDS_pept        307815..309077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0258"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG: bha:BH3440
FT                   L-arabinose ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29297"
FT                   /db_xref="GOA:D1BUQ6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUQ6"
FT                   /inference="protein motif:PRIAM:3.6.3.17"
FT                   /protein_id="ACZ29297.1"
FT                   /translation="MIEALKELFRGGARKSGMVIALLFLVLLFNWLTDGLVVTPGNAQS
FT                   IIFGNAHILVMTMGMVMVIIAGHIDLSVGSVAAATGVIVAVATRDWGVPWWAGILLGLA
FT                   VGALIGAWQGFWVAYVGIPGFITTLAGMMLFRGLHLYISREAGTNVRVPQEMWFIGSGH
FT                   LPEWGPDTGLNNSTLLLGVIGIALVVWVEFRKRATAKRLEGKPLSTALSLLRAGGLSVV
FT                   LGYLTWLFGSGRPGTSFPVTGLILLVIAGIYWFLSTKTITGRNVYAVGGNRAAAALSGV
FT                   NIKRTNFLVMLNMSLLASVAAILFISRSRTTGPADGTGWELDVIAAVFIGGAAVSGGIG
FT                   TVTGSLIGGLVMAVLNNGLQLMSVEAPQTNMIKGLVLLAAVAFDVYNKVQGRPSIIGRI
FT                   TDSFRRSPTAPTAPAPTKPTA"
FT   gene            309128..310243
FT                   /locus_tag="Xcel_0259"
FT   CDS_pept        309128..310243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0259"
FT                   /product="putative sugar uptake ABC transporter periplasmic
FT                   solute-binding protein precursor"
FT                   /note="KEGG: pde:Pden_2745 putative sugar uptake ABC
FT                   transporter periplasmic solute-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29298"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUQ7"
FT                   /inference="similar to AA sequence:KEGG:Pden_2745"
FT                   /protein_id="ACZ29298.1"
FT                   /translation="MKKFKTGAALAAVAMAGAFVLSGCGEGRGSGDATDAAAADGAGFA
FT                   ADAVIGVSLPQQTSENWVLAEDLFNDGLSEAGFEPIVQFANAGVGEQQNQVQAMIERGA
FT                   EVIVIGAVDGAQLGTQLEAAHAAGITVIAYDRMLTQTPDVDLYVAFDNFQVGVLQGTAL
FT                   LEGLEARKAGASPWNIELIAGSADDANSTPFFEGAMSILQPKIDDGTLNVVSGQTTFDQ
FT                   VATAGWLADNAQRRMDTLLSGFYNDGTELHGVLSPNDTLARAALTAVDSAGLDVPVVTG
FT                   QDSEVESVRSIMQGIQYSTIYKDTRELVAETIRQVQRAQAGDDFESNDTVNNGVQDVPT
FT                   FFLPPVIVTQENAVEVFAGDPILEPVMSEFE"
FT   sig_peptide     309128..309199
FT                   /locus_tag="Xcel_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.724 at
FT                   residue 24"
FT   gene            complement(310330..312501)
FT                   /locus_tag="Xcel_0260"
FT   CDS_pept        complement(310330..312501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0260"
FT                   /product="glycoside hydrolase clan GH-D"
FT                   /note="PFAM: glycoside hydrolase clan GH-D; KEGG:
FT                   esa:ESA_03854 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29299"
FT                   /db_xref="GOA:D1BUQ8"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR031705"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUQ8"
FT                   /inference="protein motif:PFAM:PF02065"
FT                   /protein_id="ACZ29299.1"
FT                   /translation="MVQHIALRGHGVGIVVSVPDVGLPAVVHWGADLGDLDSEGLAALD
FT                   LATARQTAPGTLDAAWRLPLLPQESDGWSGRPGLLLARDGRPVFPRWQGSVTMPDGGTP
FT                   AVTADGGMLVVTADDAAAGLALVTRLRIADGGLVLVDHELTNTGDGELEVVHVEATLPV
FT                   PRAADTLTSFGGRWNREKTPTTAAMPRGTWLRESRRGRPGHDQPWVTLASAGAPRHRSG
FT                   EVWAVHLGWSADVRHRIDRVTEHVTLLGAGELLRPHEVRLVPGDTYRTPTAYFAWSDAG
FT                   LDGISDRFHTHLRARARHPRTPRPLVLNTWEAVYFDHDPARLEALARQAARVGVERFVL
FT                   DDGWFLGRRDDTTSLGDWVVDPHVYPDGLEPLAALVHDLGMQLGLWFEPEMISLDSQVA
FT                   RAHPDWVLGSPESVPSPEGLSFRSQYVLDLANPDAFEHVRGQMSDAIRRLGVDYVKWDH
FT                   NRDLVEAVHHDPSHTGRPGTRAQTLAAYRLMDALRAEHPGLEIESCSSGGARTDLGVLA
FT                   HTDRVWASDNNDPVDRWDVHRWTELVLPPELIGAHVGPSPAHSTHRATDLSFRAALALT
FT                   GHAGLEWNLLDAAPSDLEGVAALAALYRELRGLLHTGTVVHADVADPVLRARGVVAPDR
FT                   SQAVWTVACLAAPEEALAERLRLPGLDPSRSYAVRVRDDVGAARWGWVTPGWLGKDPVV
FT                   VPGRVLTDVGLQLPTLWPVQALVLHLTAV"
FT   gene            complement(312611..313549)
FT                   /locus_tag="Xcel_0261"
FT   CDS_pept        complement(312611..313549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0261"
FT                   /product="6-kinase"
FT                   /EC_number="2.7.1.72"
FT                   /note="PFAM: aminoglycoside/hydroxyurea antibiotic
FT                   resistance kinase; KEGG: bcj:BCAM2633 streptomycin
FT                   3''-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29300"
FT                   /db_xref="GOA:D1BUQ9"
FT                   /db_xref="InterPro:IPR006748"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUQ9"
FT                   /inference="protein motif:PRIAM:2.7.1.72"
FT                   /protein_id="ACZ29300.1"
FT                   /translation="MDRTHVPEALAASHQEYWGDDARAWVDAAPAVLARLLDAWTLTPD
FT                   GPATHGTVAWIVPVRRADGSPAVLKLQPQDEETVGEPTALAAWGGDGAVLMLEHDAASG
FT                   AMLLERLDATRSLDTIDVDTALETIGGLARRLHAHAPPATTGLRRLADDAARILERTRV
FT                   VAASSGPDLRDVLDRCAAVVTEVLPEPGDRLLHWDLHYRNVLAPLPGSAAAARGDWLAI
FT                   DPKPLLGDPGYELLPAVHNRWELAVATGDPAREGLRRLDLLTEVMGLDRDRARAWTLAR
FT                   LLANLTWLAEGHRAWFADPDLTLARALLRRS"
FT   gene            313763..315526
FT                   /locus_tag="Xcel_0262"
FT   CDS_pept        313763..315526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0262"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: scl:sce4302 ABC-type dipeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29301"
FT                   /db_xref="GOA:D1BUR0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUR0"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACZ29301.1"
FT                   /translation="MFRLRTRRSAAVAAVAASMLILAAGCSSDGGSTTDPTPTEGGEAT
FT                   EEVPDVVGEYPRAETVFTSGTQWGPPSSWNPIPGSGDATGTRGLLYETLFHFDPSTLEL
FT                   SPWLAESGEWVDDQTYTVTLRDNATWTDGEALDAEDVVFTTELGQQPGVPWQNLWNWLD
FT                   SVEAVDAHTVTWHFSESRPQEWENWLYTRTILPQHIMGDWTGEDITTNANPDPVGSGPF
FT                   VYSTHSQDRMVWERNDDWWGTEAMGIEFPMRYVVDIVNPSNEVALSLLMQGTLDVSNNF
FT                   LPGITQLVESGAVATYYDEAPYMLSANTAMLIPNATKAPGNDAAFRRALAHAIDIDTIV
FT                   TTAYGNIVQAANPTGLLPAFETYYDQDVIDELGFTFDVETAKQLLADAGYEDSDGDGYV
FT                   ENLDGSEMNLELIVPAGWTDWMDAAQIIAESAGEAGIHITNATPDSGAVDDARTTGNFD
FT                   LVMNNWAQMSNTPWTYYNYLFSMPIQDSMWSGNFGRWDATEAFAKVNDLARAQSGSPEF
FT                   QAAISDLQRISLEEMPMIPMWYNGLWSQVTDGTWTNWPSSDGPVTAFPSTWHGYWEMGG
FT                   LEMLASLTPAG"
FT   sig_peptide     313763..313849
FT                   /locus_tag="Xcel_0262"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.270 at
FT                   residue 29"
FT   gene            315617..316612
FT                   /locus_tag="Xcel_0263"
FT   CDS_pept        315617..316612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0263"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: scl:sce4301 peptide ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29302"
FT                   /db_xref="GOA:D1BUR1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUR1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ29302.1"
FT                   /translation="MRTYLLRKLAIYVLTFVVAVTLNWVLPRLMPGDPVQTMLARAASS
FT                   HPETVGAMRDYYNAIFGFDLPIWQQYLNYWVELFRGNLGISVWLFPTPVTEVLSSAIPY
FT                   TLALMLPSILLSWLVGNRLGALAARSRWLDNTVLPVGYVLTAMPYMWLAIMLAWSLGIV
FT                   AGVLPVAGGYSFELVPSFSWKFVSSLLQHWLLPFLSLFLVQLGGWAIGMRNLIIYELES
FT                   DYANYLDALGAPRGLVRGYAFRNAMLPQVTGLALQLGTVVGGALVTEIAFAYPGLGRLI
FT                   LNAIQNQDFFLLQGALLFIVLGVLIANFVIDIVYVLIDPRTRTGLQGATA"
FT   gene            316609..317508
FT                   /locus_tag="Xcel_0264"
FT   CDS_pept        316609..317508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0264"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sit:TM1040_2743
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29303"
FT                   /db_xref="GOA:D1BUR2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUR2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ29303.1"
FT                   /translation="MTTPPTTDVVVATPRRRRNETLYFALRNPKVVGAIVIVGGLLLLG
FT                   VLGPMFLSYGPTERIPGAAMKPPGSEHWFGTTMQGHDVFTQFVVGLRATFVVGVLGAAI
FT                   SGLIGMLVGFVAGYRGGVVDDLLNMLTNIVLVIPGFVVLIIINAYMGVRSIPMQAIFIG
FT                   LSSWPWVARAVRSQTLSLRSRDYIDLARTSGLGTAAIIRREIAPNMYSYLFMTFVLLFG
FT                   GSVLTAAALDFIGLGPTGRNAMSLGLMMNQAVQWSALTLNMWWWFLVPGAGITVIVGSL
FT                   YIMNVGLDEVFNPKLREM"
FT   gene            317510..318463
FT                   /locus_tag="Xcel_0265"
FT   CDS_pept        317510..318463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0265"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: oan:Oant_4612 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29304"
FT                   /db_xref="GOA:D1BUR3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUR3"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACZ29304.1"
FT                   /translation="MSLKVEDLKVYYASLRGDVKALDGVSFEVADGEIMGVAGESGCGK
FT                   TTLGKALIRLDSRQRHVGGKVFLDDVEMKPGDESSMRKRRYQDVSLIPQYAMSAMNPTR
FT                   KIGKMIADLVKAHGRRYTEIRPELERRLELVGLDVEVLERYPIELSGGMKQRVVLVIST
FT                   LLNPSLLIGDEVTSALDVTSQKAVARALVEFRDAGFVTSMIVITHDISVLFQVADTIMV
FT                   MYAGHLAEKAPAKTIINEPLHPYTKMLIGALPKVGDRYGEQELQGIEGRPPSLLNPPEG
FT                   CRFRDRCPLAHDRCVERPPFVEVAPGHQVACWAVTA"
FT   gene            318460..319461
FT                   /locus_tag="Xcel_0266"
FT   CDS_pept        318460..319461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0266"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bbt:BBta_4864 oligopeptide ABC transporter
FT                   ATP-binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29305"
FT                   /db_xref="GOA:D1BUR4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUR4"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACZ29305.1"
FT                   /translation="MTATASAPQTRETRTPVLSLDAVDKVYKVGTFGSGELRAVRSASL
FT                   EVHAGEVVSLIGESGSGKSTIGKMVLHLVSTDGGTMRVGGQDVTRLKRGRLRDYYRDVQ
FT                   GVFQDPFSSFNPIYKVDRVFDTVRRSYFPKIRRADWHLKVDDALAAVTLRPEEILGKFP
FT                   HQLSGGQLQRLLVARALLLDPKLLVADEIISMLDASTRVDVLNLLVELKHKGLGILFVT
FT                   HDLSLGNYVSDRVVILYRGRIVESGETREVFENPLHPYTRDLLASVPQLDATWAEVEAQ
FT                   EAVRTRRLAGTCVFHSLAPSEPDAAEGLAQVTDGHQVGCFRLGADDPCPRHE"
FT   gene            319469..320713
FT                   /locus_tag="Xcel_0267"
FT   CDS_pept        319469..320713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0267"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: mxa:MXAN_6549
FT                   transcriptional regulator, ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29306"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUR5"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACZ29306.1"
FT                   /translation="MQGSGAGHANARSTIIDAVRAAGVVSRTGIVQATGLTGATVSKEV
FT                   RALLDEGLLVESGTAPSTGGRSQVLLQLQRASRYAAGLHLDHDGVTAVLLDLGGAVVAE
FT                   QRMRWVGAAEPAVVVDSMIERLGAMLRGVGAERERLLGIGVVAPGPVTPGEGIVASRPA
FT                   LREWVRFPFAERLSRTAGLPVIVDNDATASAVGELWTGGARGSNVFTALYMATGIGSGT
FT                   VVDGVPYRGASLTVGEIGHVCIDLAGPECWCGNVGCLEAVAGPSAVVAEGRAAGLMLPE
FT                   RLTVAEAFAEVVSLARRGDGVAVDIVQRSAQHLAVAAQTLCTLMAVDLVVLTGASFGVA
FT                   GDLYLPTVRERVRSSFLAHASGTVRVEVSQQARRAPAVGAAALVLQDALVPRSFSTRLA
FT                   LPSAEPSALVPGESR"
FT   gene            320710..323241
FT                   /locus_tag="Xcel_0268"
FT   CDS_pept        320710..323241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0268"
FT                   /product="glycoside hydrolase family 2 TIM barrel"
FT                   /note="PFAM: glycoside hydrolase family 2 TIM barrel; KEGG:
FT                   similar to mannosidase, beta A, lysosomal"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29307"
FT                   /db_xref="GOA:D1BUR6"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUR6"
FT                   /inference="protein motif:PFAM:PF02836"
FT                   /protein_id="ACZ29307.1"
FT                   /translation="MTFVPATFRPLHDGWSVTAVEGPVPDDAVGALAAGIPAVVPGEAH
FT                   LDLLAAGLIADPFDGDNEAAQQWIGDTSWRFATTFEWAPDGETRHDLVAYGLDTVARVE
FT                   LNGVVVATTQNMHRSYRWDVRPLLRAGANTLTVTFAAPVPEAAARAERNGALPRVNHHE
FT                   YNQLRKMACSFGWDWGIDVAGAGIWKPIGLDSWSGARIAAVRPLVDVDDDGVGLLTAHV
FT                   EVERATGDEAVPVTVTLTPPSGGAALTATAVVPAGTTSTAVVVRVPDVAVWWPVGHGDQ
FT                   PLYGVDVVAGDASWAGRVGFRTVAVDTSDDAAGAGFVLRVNGEPVEVRGVNWIPDHAFL
FT                   TKVTRERYARGIDDALGANVNLLRVWGGGIYEDDDLYDLADEAGILVWQDFLFACAAYA
FT                   EDAETWAEVEAEARENVTRLSPHPSLVIWNGNNENTWGSVDWGWGGRLAGRAWGDGYYT
FT                   RLLPGILAELDPTRFYSPASPFSFGPYRHPNDERFGTMHVWDVWNRADYTVYRDYRPRF
FT                   VSEFGFQAPPAWSTLTAVVHDQPLDPFGPQMLVHQKANLGNKKLERGWQGHLPDPTSIE
FT                   DWHWTTQLNQAHAIRFGIAHFRSLTPHCTGAVLWQLNDNWPVMSWAAVDHAGHRKPLWF
FT                   ALRDVFSPRLATLQPRASQHAIDTAWEGLAPDPDITALVLVNDTAEPFTGTFTATRQRF
FT                   DGTVLATATLPAAVPARGAVDVVLPADVATFDDAACEVVVVTPDDADSGFATAFLDGAD
FT                   VVGQALDPDALTVDAHAVDGGVELRLTARSYVRDVFVHADKVDPAARTSAGLMSLPAGA
FT                   SATIVVDTASDAAPAAFAGTVRTANDLTGKG"
FT   gene            323243..324496
FT                   /locus_tag="Xcel_0269"
FT   CDS_pept        323243..324496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0269"
FT                   /product="N-acylglucosamine 2-epimerase"
FT                   /note="PFAM: N-acylglucosamine 2-epimerase; KEGG:
FT                   ppf:Pput_1052 N-acylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29308"
FT                   /db_xref="GOA:D1BUR7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUR7"
FT                   /inference="protein motif:PFAM:PF07221"
FT                   /protein_id="ACZ29308.1"
FT                   /translation="MPAHIPWPHLASHRTWLDDEARRLLAFGSAAALPSTAGTGGGAAY
FT                   LDGAGRPDPAHGVQTWITARTVHSYSLGHLLGVPGSGAVADAALAGLTGVLHDDAHGGW
FT                   FHAVSTDGEPDVAAGKSAYDHAFVMLAGASATIAGRPGGADLLAEATAVYLERFWDEET
FT                   GRPVDTWDVSFTSLDPYRGLNATMHSVEAMLTVADAVPDAEAGAWRERAARAAAFVVEL
FT                   AATHDGRLPEHFGPDWAPDLELNADQPGDQFKPYGATPGHGLEWARLLLHLEAVSPDPA
FT                   LLATAVTLFDRAVADAWAPDGADGFVYTTDWAGAPVVRTRMHWVVTEAIATAAALVERT
FT                   GDARFARWYATWWDYAARHLIDREDGSWHHELDTANRPAATVWPGKPDVYHALQATLIP
FT                   RLPLAPTLARALREGLLR"
FT   gene            324493..325479
FT                   /locus_tag="Xcel_0270"
FT   CDS_pept        324493..325479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0270"
FT                   /product="Fructokinase"
FT                   /EC_number="2.7.1.4"
FT                   /note="PFAM: PfkB domain protein; KEGG: sme:SMc02164
FT                   fructokinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29309"
FT                   /db_xref="GOA:D1BUR8"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUR8"
FT                   /inference="protein motif:PRIAM:2.7.1.4"
FT                   /protein_id="ACZ29309.1"
FT                   /translation="MKFVILGEALVDVVPDNVDADAAAPDTTAPDAAAAAAAAAAAGST
FT                   RDLPGGSPANVAVTLGRLGHRPTLVTALADDARGALVRGWLEASGVDVQASVPATGRTS
FT                   TAAVVLGADGGASYEFDLDWSLPAEQAAAVEGADVVHAGSIATVLAPGADVVEAALRAA
FT                   RGHALVSFDPNARPAITPDVAAVRVRVERLVGLADVVKVSEEDLDWYHPGTDPVDTARA
FT                   WATQGPAVVVVTLGGDGAVVVRGDTVVRVAGVKVEVADTIGAGDTFMGALLDALAGLGA
FT                   HGPQARSVLEGLTPEQLAEAASWAARAAAVTVSRPGADPPTRAELAD"
FT   gene            325762..326874
FT                   /locus_tag="Xcel_0271"
FT   CDS_pept        325762..326874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0271"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="TIGRFAM: magnesium and cobalt transport protein
FT                   CorA; PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: bbt:BBta_0881 putative metal ion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29310"
FT                   /db_xref="GOA:D1BUR9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUR9"
FT                   /inference="protein motif:TFAM:TIGR00383"
FT                   /protein_id="ACZ29310.1"
FT                   /translation="MATTLPTRTSRQLLSGVLRSRRRPDGVAPVVDTVPPRRRALVTSA
FT                   IYDDGARTSSHATLGETFRALRSRPGGMAWIGLERPDPRELASLAAEFDLHALAVEDAI
FT                   QAHQRPKLERYGDTLFIVLHAARYDDAAEEVEFSELHVFVGPDFVVTVRHGASPNLPAV
FT                   RRRLEADPVMLARGPEAVLYAILDAVVDGYAPVVAGLENDIDEIESQVFSMGAEASRRI
FT                   YELSREVADFQRAVRPLRQVLHALTKGFAKYEVDEEQQARLRDVADHLTEVAERVETHR
FT                   GALRDILTVNATLVAQRQNEEAKAQNDEIKKISSWAAILFAPTVVGGIYGMNFDVMPEL
FT                   HWAFGYPFALGLMLAVSVVLWGVFRLRRWI"
FT   gene            326946..327554
FT                   /locus_tag="Xcel_0272"
FT   CDS_pept        326946..327554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0272"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: sus:Acid_3167 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29311"
FT                   /db_xref="GOA:D1BUS0"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUS0"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ACZ29311.1"
FT                   /translation="MAGVYEGAVQDLIDELGRLPGVGPKSAQRIAFHLLAADAGDVRRL
FT                   ADALIEVKARVRFCEVCGNVAEAERCRVCVDPRRSDDVICVVEEPKDVVAIERTREFRG
FT                   RYHVLGGAINPIENVGPDDLRIKDLLSRLADGRVQEVILATDPNVEGEATATYLARLIG
FT                   PMGVTVSRLASGLPVGGDLEYADEVTLGRAFEGRRVVGR"
FT   gene            327595..328164
FT                   /locus_tag="Xcel_0273"
FT   CDS_pept        327595..328164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_01581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29312"
FT                   /db_xref="InterPro:IPR032025"
FT                   /db_xref="InterPro:IPR038312"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUS1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29312.1"
FT                   /translation="MGEIETGSDLRDVASKTQAHVRAYLSTVSEVASGAAPGAELGLLL
FT                   LATSDLLACGAHLAAITDVVPAERFEPDADDETDVDPLRVALAKMFDGFDDYLEVVDPV
FT                   LSSEVGPATLSGDIACVVEELAKGLAHYDEGHELEALWWWQFSFLSLWGERAASAVRVL
FT                   QALLAHLRLDVDDDVAAEAEYDALHA"
FT   gene            complement(328178..329509)
FT                   /locus_tag="Xcel_0274"
FT   CDS_pept        complement(328178..329509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0274"
FT                   /product="Excalibur domain protein"
FT                   /note="PFAM: Excalibur domain protein; nuclease (SNase
FT                   domain protein); SMART: nuclease (SNase domain protein);
FT                   KEGG: SNF2 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29313"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUS2"
FT                   /inference="protein motif:PFAM:PF05901"
FT                   /protein_id="ACZ29313.1"
FT                   /translation="MSRRLQVTAITVGAALTLATGVGVVHSVAQRLEAERRDEAVAACE
FT                   AALTDHALARDTLEVAYTDARELLLATSGLALASEKHQVLATTVESASRVRASSPPTCN
FT                   ANASRQDVEADTQAVRSAREAAADGSRQIGRDTVPLTEALTVFEEFVSARDALRAPVDA
FT                   AEAALADSEARVLDDAVRVALATAVYGARTALGYEPTPTLTAHIDARDTAHGLREDISA
FT                   RKYDIQRARDAWDTEQARIEAERVEAERVAAERRRQTVISNAGLTQARVTRTIDGDTIE
FT                   VEVAGQTERVRLAGINAPEVGRPGADSATAFARTAIDRAGGTVWLERSGDSRDRFNRLR
FT                   RNVWLDVPTSTGNAEQRRALLLNRMLLDAGHAVVSTPARSAPRPAPSAPPRAASPAPAT
FT                   RAPFRNCTAVWDTLGRPIRRGEPGFHSRLDRDNDGVGCEWDPRR"
FT   sig_peptide     complement(329426..329509)
FT                   /locus_tag="Xcel_0274"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.859 at
FT                   residue 28"
FT   gene            complement(329624..330781)
FT                   /locus_tag="Xcel_0275"
FT   CDS_pept        complement(329624..330781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce7370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29314"
FT                   /db_xref="GOA:D1BUS3"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUS3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29314.1"
FT                   /translation="MSVDTEITAQPGGPTTSRRREDWRLTWHGIRTVTQLELRQRVRST
FT                   RWKVALIVWFVVVGGITGLTTGALHALQSSGDDEPLGALIFGIVVFFVLFLGLLVSPTL
FT                   SAASINGDRNAGTLATLQATLLSPAEIVIGKLLAAWLAALAFLAASVPFIVWALAAGGV
FT                   AVLSLVTTLLMLAVVLLVVCAIGLGFSALVAKTSGSAVLTYLTVGGLSVVTPVLFGLST
FT                   PLVTTQEEVRVWTLPASAWEETNPSPSLCRWETETMSRVHTERTWWLLAVNPFVIVADS
FT                   QPLGDREEIERAGATSPLGLIQLGVRYARTGPSAEEDWCPYYGGFVDGSDTRPDSPVER
FT                   VEPSDQAVWPWGLGVLLVVAGGAVVVAVNRLRIPTRTLPQGTRVA"
FT   gene            complement(330778..331812)
FT                   /locus_tag="Xcel_0276"
FT   CDS_pept        complement(330778..331812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0276"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mxa:MXAN_6475 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29315"
FT                   /db_xref="GOA:D1BUS4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUS4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ29315.1"
FT                   /translation="MSSDGGIRARDVRRAFGQVKAVDGVDLVARPGRVTALVGPNGSGK
FT                   TTLLLVLAGLLVPDAGEVTVAGFDPVTQGVEARRRTGWMPDVFGTWDSLTCREVLTTVA
FT                   AAYRLPRDVGAARAAELLTLVHLDEYADAPAHVLSRGQKQRLGLARALVHDPDVLLLDE
FT                   PASGLDPRSRVDLRELVRRLAAQGKTVLISSHVLTELDEMADDAVFLSRGRTVATRSVT
FT                   AAAAERRPWRITALDTVALRAWLAANGYLPAAGPTSGPRDTLAPDVTGPIAGPATAKDP
FT                   GEGPDETRGEDPGEGGVLVDLDGAVAAAALLRAAVSDGVPVSSIAPAGGVLEQAYLALE
FT                   EERR"
FT   gene            332040..334184
FT                   /locus_tag="Xcel_0277"
FT   CDS_pept        332040..334184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0277"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   acr:Acry_1166 triple helix repeat-containing collagen"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29316"
FT                   /db_xref="GOA:D1BUS5"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUS5"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ACZ29316.1"
FT                   /translation="MTQPPGDDLQGFDPDAGEPARDAFLTNLRARMASLPAVVTSDDGS
FT                   LEARLTDRRGLLDSMLGRDLLDPLDMTFRAGEVTDTLAQDVAQSVAPDAAQSAQSAQSA
FT                   QSAQSAQSTQSVSVAPMGGGADADDGLAAAAAGDAALPPQVADLLRVVGPVAARDLDVT
FT                   IDALTLVRSRVNALEALEAVLLERARRQALRASVLDESEPLIRSASGDLRRSLARRAVV
FT                   ADVALAVRATERQLSDRMDRAHALTSRAPHTLGAALAGDACWANAAKVADAVGELEPAV
FT                   AARLDRDVAAAARCQDPRRFAATVRRTRDRLHPTPLVVRHQEAAARRAVWVDPARDAMA
FT                   YLTLFAPAPTIHAIKDRLDRTATHLRATGDPRILPQLRADVACALLLDDGTLDLNAATL
FT                   AATGATGATGATGATGMAAATGMTTATGMTAGATAATAATAATDATTATGATGAGRVDG
FT                   RNATPAHLSAHGADVSEVAGAGPVGGAGSDGAYASTAPDLAVIARSIRPHVYLTVPVLS
FT                   LLGRADEPALLDGTVPIDADTARQLAVLAPSFSRVLTHPVTGNVLAMDARTYTPPPGLR
FT                   RHLVVRDTSCRFPGCQRRAVQTDADHTTAYAAGGRTTGANLALLCRHHHLLKHQARYDV
FT                   VQHPDGSGTLTWTTPTGRTHTDRPEPVPATVHSTVPAPLHVPGVGAGGEYEPEPLGDSA
FT                   DGHPDGACVAVADLDGEPPF"
FT   gene            334387..335163
FT                   /locus_tag="Xcel_0278"
FT   CDS_pept        334387..335163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0278"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   reh:H16_A3656 predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29317"
FT                   /db_xref="GOA:D1BUS6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUS6"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACZ29317.1"
FT                   /translation="MPELDVLAWVLLVVAGFAAGWVDAVVGGGGLIQLPALLLVPGIAP
FT                   VQALATNKVGSIMGTSTSSITYARRVQPDFTTAGPMAVAALAGAVGGAVLAARIPAAAF
FT                   RPIILVVLVAVFVYTLLKPSLGDRTRLRWEGNRHRVTAAMTGLVIGVYDGVLGPGTGTF
FT                   LVIALVGVLGYAFLPASALAKIVNFATNLGALIFFVPAGHVIWHLGLAIGAANLMGGYL
FT                   GARMAVARGSRFVRVVFVVVVGALILRLGYDVVTGG"
FT   gene            complement(335228..336034)
FT                   /locus_tag="Xcel_0279"
FT   CDS_pept        complement(335228..336034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0279"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: Tetracyclin repressor domain protein;
FT                   regulatory protein TetR; KEGG: scl:sce6697 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29318"
FT                   /db_xref="GOA:D1BUS7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUS7"
FT                   /inference="protein motif:PFAM:PF02909"
FT                   /protein_id="ACZ29318.1"
FT                   /translation="MCPPSSLDPERLDVIWGRTPVRARGPKPSLTVEQVAQAAIALADD
FT                   AGLDAVSMKRLAEVLKVGTMTLYTYVPDKATLLHLMLDRALAEVTLPDASADWREHLRT
FT                   SAEALLELYQGHPWIMQINVEGPPVTPHQMRYLESVLTALRKTGLNHGESLDIALSISY
FT                   FVLGAAKLTVGILRAEQESTLSDDETHTRRAEALGRVLDPAEFPMVLQAMTAPPPEPPP
FT                   VDIWASLGFRFGLDRLIDGIGTYIETRAPAPAGHEDGHEDDGPPTQ"
FT   gene            336237..336821
FT                   /locus_tag="Xcel_0280"
FT   CDS_pept        336237..336821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0280"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bha:BH0988 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29319"
FT                   /db_xref="GOA:D1BUS8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUS8"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACZ29319.1"
FT                   /translation="MIQIRRMDAYDREVRDEVADLFIEGFYNKLHFFTKDPQRLKVAFR
FT                   DELRADMFYVAELDGQIAGILAVSSSTRRAVVADKGSLRRGLGFLMGTVAYSALKNDFN
FT                   SPLPYDDETGYIEWVATAEQARGQGVSTALFQHVLQQLPYTTFVLEVLDFNENAHRLYL
FT                   KLGFEEYDRRPAKGGEKKVFKERIFMRRRSG"
FT   gene            337022..337357
FT                   /locus_tag="Xcel_0281"
FT   CDS_pept        337022..337357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_1974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29320"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUS9"
FT                   /inference="similar to AA sequence:KEGG:Sden_1974"
FT                   /protein_id="ACZ29320.1"
FT                   /translation="MSIARTPEPPYTAVIFTSLRTPGDQGYARMSERMVELAAQQPGFL
FT                   GIESAREGLGITVSYWSDDDAAAAWKQVHEHVVAQERGRSTWYEDYEVRIATVTRAYGK
FT                   PAADPTD"
FT   gene            337465..338769
FT                   /locus_tag="Xcel_0282"
FT   CDS_pept        337465..338769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0282"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: pca:Pcar_1006 aspartate kinase; TIGRFAM:
FT                   aspartate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29321"
FT                   /db_xref="GOA:D1BUT0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUT0"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ACZ29321.1"
FT                   /translation="MALVVQKYGGSSVADAESVKRVAKRIAEAKRAGNDVVVVVSAMGD
FT                   TTDELLDLAAQVTPLPPQRELDILLTAGERISMSLLAMAINSLGVKAKSFTGQQAGVIT
FT                   DAVYGKAKIVDVVPARIRETLDRGQVAIVAGFQGVNTDTNDVTTLGRGGSDTTAVAIAA
FT                   GLSADVCEIYSDVDGVFTADPRIVPTARKVDRLTYEEMLELAACGAKILALRAVEYGRR
FT                   YGVPIHVRSSFSNATGTLVAGTYGDLIDPNAPAHGQEADVEAPIISGVAHDRSEAKITV
FT                   VGVPDVPGMAARIFEVVAAAGANIDMIVQNVSAAHTGLTDISFTLPEGDGPLTLTALRG
FT                   VQDEIGYASLQFDDQIGKLSLVGAGMKTNPGVSARLFGALRDAGINIEMISTSEIRISV
FT                   VTRADSLDDAVRAVHSAFGLDTTEGEAVVYAGTGR"
FT   gene            338773..339873
FT                   /locus_tag="Xcel_0283"
FT   CDS_pept        338773..339873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0283"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: aspartate-semialdehyde dehydrogenase; PFAM:
FT                   Semialdehyde dehydrogenase dimerisation region;
FT                   Semialdehyde dehydrogenase NAD - binding; KEGG:
FT                   cak:Caul_4072 aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29322"
FT                   /db_xref="GOA:D1BUT1"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUT1"
FT                   /inference="protein motif:TFAM:TIGR01296"
FT                   /protein_id="ACZ29322.1"
FT                   /translation="MAEINTEGVNVAVVGATGQVGAVMRRLLAERDFPVRSIRLFASAR
FT                   SAGSVLEFGGYDVVVEDVAAVPTEELADIDIALFSAGGGTSKEHAPRFAEAGAVVVDNS
FT                   SAWRRDPAVPLVVSEVNPDAIGEAELGIIANPNCTTMAAMPVLKPLADAAGLERLRVTT
FT                   FQAVSGSGLAGVSELATQVRAAVEQDFEALAHDGSAVEFPAQVKYVAPIAFDVVALAGS
FT                   IVEDGSNETDEEQKLRNESRKILSLPDLAVAGTCVRVPVFTGHSLSIHAEFASPITPEQ
FT                   ATALLADAPGVRLVDVPTPLAAAGADESLVGRIRQDQSVPDGRGLVLFVSGDNLRKGAA
FT                   LNAIQIAELVAADIAELATLEAAQEG"
FT   gene            complement(339975..340628)
FT                   /locus_tag="Xcel_0284"
FT   CDS_pept        complement(339975..340628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_2228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29323"
FT                   /db_xref="GOA:D1BUT2"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUT2"
FT                   /inference="similar to AA sequence:KEGG:Rsph17025_2228"
FT                   /protein_id="ACZ29323.1"
FT                   /translation="MSSVPPSCEPLGPALWTQPASAWTSLAFVVAGVAIVVRASRAGAG
FT                   PRAAVLGVLTVLVGVGSVVQHGPAPSWNPLVHDPPLMGALALVAADGVADLAGRRFRHW
FT                   WWVAPTAVVVVLAAVSSGASSAAQSAMAVVAVGVTLLRAWRRPAVRARSLAATALLGAG
FT                   GLIGTLSRPGWPWCDPSSAWFASGWSGHAVWHVLAAAALWMLAPALGSARRAAA"
FT   gene            complement(340643..343951)
FT                   /locus_tag="Xcel_0285"
FT   CDS_pept        complement(340643..343951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0285"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="KEGG: mxa:MXAN_5351 SNF2/helicase domain protein;
FT                   PFAM: SNF2-related protein; zinc finger SWIM domain
FT                   protein; helicase domain protein; SMART: DEAD-like helicase
FT                   ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29324"
FT                   /db_xref="GOA:D1BUT3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUT3"
FT                   /inference="protein motif:PRIAM:2.7.11.1"
FT                   /protein_id="ACZ29324.1"
FT                   /translation="MRTALTPPTPAMVAGLVGPGAFGRGAAYRDEGRVSEIRWSPGTHR
FT                   LEGLVRGSGRHVYTASVWFTRSDHRLLPDESVCTCPVAVDCKHVAALLLEAHARVQAGL
FT                   ALDDGGPSAPVAPSGPGPAWRRTLDRLPSTAPATLPERDRVVRLALQLRVDGAGKANGA
FT                   SVSVRPVRQGVKGGWSGGYDVSWDVLAHPYYGTRWEPVAHGWLTELAALRKPSAPHYGS
FT                   STWDGLGGFIPRLLWPHLARGVELGVPLLGPGGGTVRLADGGEIALDLTADGDGLLLTP
FT                   TMTLDGLPVTAPVRGAIGDGGLFAVDDDVLVIGPTPEPLSLAAIELLGAAPVAVPAADV
FT                   ADFWSAYHPRLARQVTLTSSDGTVDLPAPSLPALVVTATFEGPPLLRVACSWEYPTPAG
FT                   PVEHPWQATTRDAAGRDLPAEQRLRDAVALAIRDLPALADTTLGEHLTFTDIDALDAAE
FT                   VLLPALDEIEGVRVDVEREPAYNELTGAPQVTVAAVDTERTDWFDLAVTVRVADHDVPL
FT                   RAIIEALGTGKKRLMLVDGSWLRLDHPALERLRELLDEASRLSDRPGRPYAPSINRYHA
FT                   GLWEDLDELADVVDVSERWRASVGGLLALTSGGEEARPQPLPPPSGLKAQLRPYQQQGY
FT                   EWLAFLHEHGLGGVLADDMGLGKTVQTLALIAHARESRGGAPFLVVAPASVVSNWAAEA
FT                   AQFTPGLRVVTRTTTSTRAAAPLVEEVAGADVVVTSYAIFRLDSDAFHDLPWAGLILDE
FT                   AQFVKNHASRANACARSLPAPFKLAITGTPMENDVGELWALLSVVAPGLYPSRRRFAED
FT                   YVKPLTAASRPGADPAVRRLAASRAGLLRRRVRPLMLRRTKDQVAPELPERQEQVLTVD
FT                   LAPAHRRAYDARLQRERTRVLGMLDDVDGNRLAIFKSLTTLRRMALDASLVDPSASAGI
FT                   PSSKLDVLVEQVAEVVAEGHRALVFSQFTGYLSLVAARLDALGLRFAYLDGSTRRRADV
FT                   VRGFREGDAPLFLISLKAGGFGLNLTEADHVFLLDPWWNPATEAQAVDRTHRIGQTRPV
FT                   NVVRMVAAGTIEEKVMALKERKAAAVGAVLGDGDDVFSRALDADDIRGLLTSAP"
FT   gene            344170..344451
FT                   /locus_tag="Xcel_0286"
FT   CDS_pept        344170..344451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0286"
FT                   /product="HesB/YadR/YfhF-family protein"
FT                   /note="PFAM: HesB/YadR/YfhF-family protein; KEGG:
FT                   rpb:RPB_0979 HesB/YadR/YfhF"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29325"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUT4"
FT                   /inference="protein motif:PFAM:PF01521"
FT                   /protein_id="ACZ29325.1"
FT                   /translation="MLTVTDNARAAVEDLAQQAGVPSEGGLRIAQSAGQPGNFELALVP
FT                   APQPDDQVVDEGATHVFVEKDAADALEALTLDTDPAAQGPGFVLTPQA"
FT   gene            complement(344520..344909)
FT                   /locus_tag="Xcel_0287"
FT   CDS_pept        complement(344520..344909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0287"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   gur:Gura_3513 HxlR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29326"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUT5"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACZ29326.1"
FT                   /translation="MVTTSSESVVVGSPYRADCPSRRILDRIGDRWTVLTVGALGDGNV
FT                   RFSELRRRVEGVSHKMLTQTLRALERDGLVRRTVYPEVPIRVEYTLTEAGRTLREPLRA
FT                   LEEWSITHLHDVSTSQETYDRTRSS"
FT   gene            344997..345644
FT                   /locus_tag="Xcel_0288"
FT   CDS_pept        344997..345644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0288"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   gbe:GbCGDNIH1_1597 quinate/shikimate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29327"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUT6"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACZ29327.1"
FT                   /translation="MSRITVIGGTGHAGSAIVAEAAGRGHQVTALSRSLPAEPVPGVTY
FT                   LQGDATDEATLSQAIDGADVVASAYSARSPHAPSLRDFYRTAARVADTAGVPLYIVGGY
FT                   SSLRPAPGADRFVTDLSDIPAELHAEIRDGAQLIIEDLPATPATLDWVFVSPALRFGAR
FT                   MPGERLGRYRLGDDVAVEPDGGGAISAADYALGFVDLIEKGDHHREQVNLGH"
FT   gene            complement(345628..346584)
FT                   /locus_tag="Xcel_0289"
FT   CDS_pept        complement(345628..346584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0289"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: bur:Bcep18194_B2467
FT                   XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29328"
FT                   /db_xref="GOA:D1BUT7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUT7"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACZ29328.1"
FT                   /translation="MPADIPTDSLGAFLRASRARITPEDAGIPRYGERRRVVGLRREEL
FT                   ALLAGVSASYYTRLEQGQSRNASPEVLDALASALQLDDAERAHLGRLAGGRGHRQPARR
FT                   PTPETVAPALAGLLDSLAAVPALVMGRRSDVLAWNPLGHALLAGHLRPDAPEAAATRPN
FT                   MATLVFTDVDTRELYADWRAKSRAVVGNLRLTAGQHPDDPELASLVGRLTMTSTEFASL
FT                   WADHQVQACATADYALHHPLVGDLTVTQQTLRSIDRPDQTLVTHTTPAGSPSAEAITLL
FT                   AQLVGDRPSHHTAPPRTAQQHPDSPGVVPSRLLNGRG"
FT   gene            346728..347681
FT                   /locus_tag="Xcel_0290"
FT   CDS_pept        346728..347681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0290"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   nar:Saro_2457 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29329"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUT8"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACZ29329.1"
FT                   /translation="MTTSTTTETITTSDHLTFGEVTVSRVVESVGSIGMTPDQFFPGTD
FT                   PDAWVGHEDELRPYFLENDGETTMASTARVAMQTWILRSGGRTVLLDACVGNDKDRPDV
FT                   PGWSHLRTAFLGHLAAAGVTPESVDVVVNTHLHADHVGWNTRLTDGAWVPSFPNAEYLM
FT                   PAEDLEFWDPARNRTTVMGPGAHRVWADSIAPVVAAGQVTAWSGSHRIDDALTLEAAPG
FT                   HTPGASILRLVSGDDEVLFLGDTLHSPAQVQDVHTSSCFDEDPAQAHLTRARLFTEAAE
FT                   KNLLLLPAHFAGHGGFRVEQSGDAFRIVGWAGLTAV"
FT   gene            complement(347715..348458)
FT                   /locus_tag="Xcel_0291"
FT   CDS_pept        complement(347715..348458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_2497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29330"
FT                   /db_xref="GOA:D1BUT9"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUT9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29330.1"
FT                   /translation="MNAVSFDSLGDVLGRIWDAATTPVPAPPQSVVLAMALAALAVVLV
FT                   TPVWRIARHVVTIAHEGAHALVATLTGRRLDAIRLHSDTSGLTVSAGRPRGFGMVATTF
FT                   AGYVGPGLVGLGAAWVLRAGYAVGLLWLLVVLLALLLLKVRNLFGLWSVLVAGAALVAV
FT                   SWWLDEPTQSAVAYAVTWFLLLGAVRPVLELQAQRFRRRARQSDADQLARLTGLPGLFW
FT                   VAVFLLVTVGALALGAWWIVGPVWT"
FT   gene            348647..350158
FT                   /locus_tag="Xcel_0292"
FT   CDS_pept        348647..350158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0292"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein; KEGG: mno:Mnod_7234 DEAD/DEAH box
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29331"
FT                   /db_xref="GOA:D1BUU0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUU0"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACZ29331.1"
FT                   /translation="MNFTDLGLPMPVVASLAERGITSPFPIQAASLPDSLAGKDVLGRG
FT                   RTGSGKTVAFALPVVTRLAGGRRAPRRPRALILAPTRELALQIDATTAPLAKVMGLRTT
FT                   VVFGGVAQSRQVTALDAGVDILIACPGRLEDLLNQRLLTLDGIEITVLDEADHMADLGF
FT                   LPGVKRLMDRTPTKGQRLLFSATLDNGVDVLVKRYLHQPVTHSVDEAAAPPPLMTHHVL
FT                   AVADAAAKRDVVRQLAAGTGRRVLFMRTKHHAKKLAKQLTLDGVPAVDLHGNLGQGARE
FT                   RNLAAFTSGDVKVLVATDIAARGIHVDDIELVVHVDPPAEHKAYLHRSGRTARAGSGGD
FT                   VVTIMLPEQRKDVADLTRKAKITAQPQPVVPGDRTVTALVGEAAAPVITPEIRQARARA
FT                   DATRTAQERARTGASGTSSSSRTAPSARAGRSGAASSTRAASPSGRASSGTTSSGSASS
FT                   GPSSPGAPASSRTSTSSSSSRRGGRGRRPGNRSGDRAVARFGGAS"
FT   gene            350155..350556
FT                   /locus_tag="Xcel_0293"
FT   CDS_pept        350155..350556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0293"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /note="TIGRFAM: methionine-R-sulfoxide reductase; PFAM:
FT                   Methionine sulfoxide reductase B; KEGG: mes:Meso_0863
FT                   methionine-R-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29332"
FT                   /db_xref="GOA:D1BUU1"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUU1"
FT                   /inference="protein motif:TFAM:TIGR00357"
FT                   /protein_id="ACZ29332.1"
FT                   /translation="MTDYEVTKTDDQWQAELDPQEFAVLRQAATERPWTGELLDEQRVG
FT                   VYRCRACGNELFRSETKFDSHCGWPSFYSPLAGDRVELLEDRSLGMARTEVRCARCGSH
FT                   LGHVFDDAPQTPTGDRFCMNSVSLTFEQA"
FT   gene            complement(350705..351115)
FT                   /locus_tag="Xcel_0294"
FT   CDS_pept        complement(350705..351115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29333"
FT                   /db_xref="GOA:D1BUU2"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUU2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29333.1"
FT                   /translation="MSGPQDDSADSRAPGSLWLPVGLLVVGAVLLIGGVVLHAAGPIAP
FT                   DTATSPSDFMEVGRLAAGRSIVALVCGAGLGWIGAHGVTGASASWIARQVVIFMALVFA
FT                   LALLQGLVLTAALCLVCCATAAIALVRLRGRR"
FT   gene            complement(351128..351613)
FT                   /locus_tag="Xcel_0295"
FT   CDS_pept        complement(351128..351613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0295"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: xau:Xaut_1307 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29334"
FT                   /db_xref="GOA:D1BUU3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUU3"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACZ29334.1"
FT                   /translation="MTHAPPAPDPTADPVGALERELRILVRRAASSAAQTARRVHPELD
FT                   ASAYPLLAHIHLNPGTRGSDLAAHFGVGRATVSRQLSRLAQLGLIHREVDPEDTRGQQI
FT                   TLTDDGEARFAAARDGRIDALGHALAEWDPADVAQLATLLRRYSESWVRWRDAHSTD"
FT   gene            complement(351712..353307)
FT                   /locus_tag="Xcel_0296"
FT   CDS_pept        complement(351712..353307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0296"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   spe:Spro_2480 EmrB/QacA family drug resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29335"
FT                   /db_xref="GOA:D1BUU4"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUU4"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACZ29335.1"
FT                   /translation="MSTTTATAPTSAAGMTHRETLEALSGIILGMFVALLAATITSSSM
FT                   PRIVSDLGGSQSSYTWVVTATLLAQTVSTPLWGKFADLFGRKLLVQIALVITVLSAAAA
FT                   GFSQDIGTLIACRAVQGLGAGGLMALATILIADIVSPRERGRYMGLMGGVMAVSQVGGP
FT                   LLGGVLTDSIGWRWNFFVGVPFAIAAIIVLQKTLHLPARPRRVAKIDYWGAALISLGVS
FT                   LVLVWVTFAGNQFAWASWQTGVMVGAAVVALVAAVLVERVVDEPVIPLHLFKNRTFVLA
FT                   VVGSIAVGVAMFGTAVFLSQYLQISRGKTPTESGLLTIPMVVGTMLAGVVLGRIISITG
FT                   RYKGIMVGGGVVLIASLLGMSTIDSHTSFWLIGTYLFGLGISVGALMQNLVLAVQNTLD
FT                   VKEMGAGTSTVAFFRSLGGAVGVSALGAVLASTVKSDIVHGLSKLGVSTDAMGVGGTVP
FT                   NIATLPAPIAHVVQDAYSDGISELFLIAVPMAVIALVCVIFLKEVPLGQRSGIQQMLEE
FT                   NAAEQDAEPALASH"
FT   gene            complement(353307..353804)
FT                   /locus_tag="Xcel_0297"
FT   CDS_pept        complement(353307..353804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0297"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: dvm:DvMF_1558 transcriptional
FT                   regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29336"
FT                   /db_xref="GOA:D1BUU5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUU5"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACZ29336.1"
FT                   /translation="MITHESPAPVATPPPAETLYSALEELGRAQREAAAWMARRLDWPR
FT                   AGVGVVRMLARCGPVQLTDVAARLRVDVSVASRQVGQLVDAGYVRRTVDADDRRARVLE
FT                   LTDEGHALVGELSARFSALFGEVFDGWTAADLTDAVDQIRRVAAAISTIRDLSHDDEEG
FT                   TH"
FT   gene            353899..354528
FT                   /locus_tag="Xcel_0298"
FT   CDS_pept        353899..354528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0298"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29337"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUU6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29337.1"
FT                   /translation="MNDARFRRPARLDQRAAEELAGESDPALRDEVAHTTARAVVHRAR
FT                   AAEDPAVVERLVRLVETEGLDAVAALWADAAPVSLPGALWRLYVLREWVRRDPQTVTLR
FT                   YRLGVDAAPVHEAVAGVPAPPGPEDLRTLADAVLSGVYAGDLAVALERAASFCRILATG
FT                   AAFDADAREVADPDGADRLTRGGAGLQRTAEELEHAARYWRSGALE"
FT   gene            354751..355371
FT                   /locus_tag="Xcel_0299"
FT   CDS_pept        354751..355371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0299"
FT                   /product="protein of unknown function DUF47"
FT                   /note="PFAM: protein of unknown function DUF47; KEGG:
FT                   aba:Acid345_3130 protein of unknown function DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29338"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUU7"
FT                   /inference="protein motif:PFAM:PF01865"
FT                   /protein_id="ACZ29338.1"
FT                   /translation="MRLRLTPRDTTYFDLFTELAGHVVTGVGLLAELLGADKAERKSIS
FT                   ARFVEAEHAADEATHAITKRLNQTFVTPFDRDDIYGLANALDDVVDSMEEACDLIVLYK
FT                   LEELPKRVSEVIQVLQRCAELTAEAMPKLRTMETLNGYWVEIHRLENQADKLHRKLVAE
FT                   LFDNTTDAVTLIKLKEVVDILEEACDGFERVATMVETIALKES"
FT   gene            355467..356465
FT                   /locus_tag="Xcel_0300"
FT   CDS_pept        355467..356465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0300"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: gme:Gmet_3131
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29339"
FT                   /db_xref="GOA:D1BUU8"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUU8"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ACZ29339.1"
FT                   /translation="MEAALVVLVVALALGFDYTNGFHDAANAIATSVSTRALTPRVALV
FT                   MAAVMNFAGALLGTEVAETIAKSIVALDHASTSTELTVVLCALVGAIVWNLITWWFGLP
FT                   SSSTHSLIGGLVGAGMAGGLPIFWSAIVDKVVLPMVLSPLIGFVLAFAVMIGILWIFRN
FT                   AAPARTHRRFRIAQTASAAAMALGHGLQDAQKTMGVIFLALLSVGWADPANGIPLWVKL
FT                   AAAAAISLGTYSGGWRIMRTLGRRIIELDPARGFVAETVSAVVLYANAFILHAPVSTTH
FT                   TITSAIMGVGATRRLSAVRWGVAKNIAVAWVLTIPASAAVAAAATWLVTVW"
FT   gene            complement(356525..357499)
FT                   /locus_tag="Xcel_0301"
FT   CDS_pept        complement(356525..357499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0301"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; Phosphoglycerate mutase;
FT                   KEGG: rec:RHECIAT_PC0000074 putative NTP
FT                   pyrophosphohydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29340"
FT                   /db_xref="GOA:D1BUU9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUU9"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACZ29340.1"
FT                   /translation="MTARVAAVRTAGGLVWRVRGGRLQVLLVHRPRYDDWSWPKGKLEI
FT                   GESHQAAAVREIAEETGKPVVLGAPLPSLRYRMPDGRWKTVTYWAARRSRTIDDFAALA
FT                   ARHPVPPVSEEEIDQTRWLDVAAATAKLTRRTDRKPLVALAEEFEQGRLPTHVVVIARH
FT                   GKAMARSTWPGDEATRPLTPMGHAHAAAIVPVLAAYGVTRVVSSRWERCAATVAPYVQA
FT                   ARLKPWYSEHLTETEHERSPARVAATVRELLETPSSVVLCTHRPVLPTVLDVLGQHSRR
FT                   SVADKLPSDDPFLDPGELLVAHVARTGKGPRVVAVEKVTPPLS"
FT   gene            complement(357496..359784)
FT                   /locus_tag="Xcel_0302"
FT   CDS_pept        complement(357496..359784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0302"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="PFAM: Polyphosphate kinase; KEGG: mxa:MXAN_0056
FT                   polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29341"
FT                   /db_xref="GOA:D1BUV0"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUV0"
FT                   /inference="protein motif:PRIAM:2.7.4.1"
FT                   /protein_id="ACZ29341.1"
FT                   /translation="MDTSETRTRDEQGRFARAIDPELAAHIAEHIAEDAGATDHLPAPP
FT                   DQAPLPTDRFADRELSWLAFNERVLELAEDPDLPLLERLRYLAIFASNLDEFFMVRVAG
FT                   LKRRIAIGIAVTAASGQSPHEVLGGIGKAAHILMDRHAKVFAGDVQPALAAEGITIVHW
FT                   DDLETREQDRLHKFFRKQIFPVLTPLAVDPAHPFPYISGLSLNLAVLVRNPVTGKEHFA
FT                   RVKVPALLPRFIAVDERGRPSDPAAGSAAQRPTSFVPLEEVIAQHLDHLFPGMEVVESH
FT                   TFRVTRNEDVEVEEDDAENLLKAMEKELLRRRFGPPVRLEIAEGISPRIRDLLVRELGV
FT                   SQDEVYELPAPLDLTGLTIIADVERPALHFPPFVPTTHRQLAEVESATATNVFVAIKRR
FT                   DVLLHHPYDSFSTSVQTFLEQAAADPKVLAIKQTLYRTSGDSPIVDALIDAAEAGKQVL
FT                   ALVEIKARFDEQANISWARKLEEAGVHVVYGIVGLKTHAKLSLVVRQEADGLRRYCHVG
FT                   TGNYHPKTARVYTDHGLLTCDPDVGQDLTRLFNQLSGYAPQSRFHRLLVAPRSVRAGLI
FT                   ERIEREADAARAGHEAWVKLKVNSAVDEATIDALYRASQAGVQVDLVVRGICALRPGVP
FT                   GLSENIRVRSLLGRFLEHSRIYAFANSVGPAIGEGPETGPEVFIGSADLMHRNLDRRVE
FT                   ALVRITDEAHVAELLDLLEVSTADSTASWHLGPDDTWTRHHVDDEGKPLADLQAVLVRR
FT                   HRRRRESAR"
FT   gene            complement(359844..360287)
FT                   /locus_tag="Xcel_0303"
FT   CDS_pept        complement(359844..360287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0303"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; Cupin
FT                   domain protein; KEGG: pde:Pden_5003 cupin 2, conserved
FT                   barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29342"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUV1"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACZ29342.1"
FT                   /translation="MSQTPTQAALKNLSVQRGDDLAQAPGQTRHARRISGVSKENTEVT
FT                   DLWFGKVYTGPGEVSDPHHHGEAETGGYVFKGHGFIRFGERYEEIVYLAEGDFVYVPPF
FT                   VPHIEGNLSRTEELVWMTTRTPDNIVVNLTDQDVADIEIAYVD"
FT   gene            complement(360366..360797)
FT                   /locus_tag="Xcel_0304"
FT   CDS_pept        complement(360366..360797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0304"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: scl:sce2000
FT                   translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29343"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUV2"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ACZ29343.1"
FT                   /translation="MSTDLTPRPVNPASLPAPSGYSHGTLSGNTLHLGGQTALDANMRI
FT                   VPGGIVEQFRQAFGNVLTTLRAAGGVPEDLVSITIYLTDIPDYQAHGREIGAAWRELAG
FT                   PVYPAMAGIGTTRLWQPEALIEIAGVAVIPDERLVTPTP"
FT   gene            360855..361655
FT                   /locus_tag="Xcel_0305"
FT   CDS_pept        360855..361655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0305"
FT                   /product="5-oxopent-3-ene-1,2,
FT                   5-tricarboxylatedecarboxylase"
FT                   /EC_number="4.1.1.68"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   dac:Daci_5633 5-oxopent-3-ene-1,2,5- tricarboxylate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29344"
FT                   /db_xref="GOA:D1BUV3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D1BUV3"
FT                   /inference="protein motif:PRIAM:4.1.1.68"
FT                   /protein_id="ACZ29344.1"
FT                   /translation="MRIATVTTPHGTAAAVQADAGWRALPAPDLSALLADGDAWEPGDL
FT                   LADAVPTLPLPRPGKVICCGLNYGDHIAEMGRDLPTHPTLFAKHADTLLADGQDIRLPA
FT                   GLQIDWEAELAVVVGRELRHADEDQARAAIAGYTVANDISVRDWQRRTPQWFQGKAWDA
FT                   TTPLGPVVVTPDEVDPEAGLEVICRVNGVEHQRGSTKTLVFSSAALLAYVSTFTVLRPG
FT                   DIVLTGTPGGVGMGMEPPVYLADGDVVETEIPGIGALTNTVRLA"
FT   gene            361676..362635
FT                   /locus_tag="Xcel_0306"
FT   CDS_pept        361676..362635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0306"
FT                   /product="acyl-CoA thioesterase"
FT                   /note="PFAM: acyl-CoA thioesterase; KEGG: tesB; acyl-CoA
FT                   thioesterase II ; K10805 acyl- CoA thioesterase II"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29345"
FT                   /db_xref="GOA:D1BV74"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV74"
FT                   /inference="protein motif:PFAM:PF02551"
FT                   /protein_id="ACZ29345.1"
FT                   /translation="MPTTAIPTTALPAPTMPTSATLTDVLTLKPVDPEVFDVAFTATTG
FT                   PCPWPKAYGGDMVAQALVAATRTVTDGKAIHSTHAYFLRPVDVGAEVRYEVEVLRDGRG
FT                   YSTRQVRGFQHGKPVYVCLANFAAGEPGGSFQASMPDDVPAPDELPTSAACLDGRSGGT
FT                   TTDAARAYWAGGRSVDMRHVPGPLYLAVDGGRVPTQAVWVAPYDVLRPVDGLTTAQRDA
FT                   AALAYVCDYTILEPLLRVLGHAWADDGLVTASLDHAMWFHRPVAMDGWLLYAQEAWSVA
FT                   DGRGSATGHFFTADGALVATVVQEGMIRATAPAKGDLS"
FT   sig_peptide     361676..361738
FT                   /locus_tag="Xcel_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.683) with cleavage site probability 0.389 at
FT                   residue 21"
FT   gene            362632..365004
FT                   /locus_tag="Xcel_0307"
FT   CDS_pept        362632..365004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0307"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   monooxygenase FAD-binding; KEGG: scl:sce8661
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29346"
FT                   /db_xref="GOA:D1BV75"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV75"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ACZ29346.1"
FT                   /translation="MKIAIVGGGPGGLYFATLMKTLDPTHDITLWERNAADDTFGFGVV
FT                   FSDETLGSIDGADPVIHERMEASFARWSDIDVTFDGQPLTVGGQGFAAMSRKELLQILQ
FT                   QRALELGVTVHFRTQAPDLDTLQSTHDLVLAADGLHSAIRTKYSDHFRPSLDRRGNKYI
FT                   WLGTDLVFEAFQFFVKNTPWGTMQVHGYPYSAEGSTFIVEMHEDVWRRAGFDATEGESF
FT                   PPGVSDEHAVARIAEIFADELQGHAIATNNSKWINFHTVRNERWHHENVVLLGDAAHTA
FT                   HFSIGSGTKLAMEDALALAACLHEHPRLDEALAAYQTERKPVVESTQRAAQASLEWFEN
FT                   IGMYAHQDPSEFAFNLLTRSRRITFENLHDRDAAFATRIGSAFARRQGGDEGAPAMFQP
FT                   VRVGELELKNRVMLSPMDMYSATDGMIDEFHLVHLGSKALGGAGLVMTEMTCVSPEGRI
FT                   TPGCPGLWTDAQRDAWRTVTEFVHARSTAKIGVQLGHSGRKGSTRLMWEGIDKPLEDGN
FT                   WEVVGPSALPYGSGCHVPREATRADLDKVVADFVAAARRAVDAGFDLVEVHAAHGYLLS
FT                   SFLSPVANRRDDEYGGSLENRLRFPLEVFAAVRAAVPARVPVTVRISATDWVPDGNTAQ
FT                   DGVEIARAFVAAGAAAIDVSSGQVTQDERPAFGRSYQTPFADKIRHEVAAPAGVAVIAV
FT                   GAISSYDDVNSILLAGRADICALGRTHLYDPSWTLHAAAEQGYAGDAAAWPVQWAAGRR
FT                   KPPASRTDKIPPRLQLLREGETTVPHLRWRAGATVPA"
FT   gene            365001..365504
FT                   /locus_tag="Xcel_0308"
FT   CDS_pept        365001..365504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0308"
FT                   /product="thioesterase-like protein"
FT                   /note="KEGG: sal:Sala_0686 4-hydroxybenzoyl-CoA
FT                   thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29347"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV76"
FT                   /inference="protein motif:COG:COG0824"
FT                   /protein_id="ACZ29347.1"
FT                   /translation="MTHEPLAIGVARARVEWVDTDAAGIYHNSTVIRFVESAESRLMVE
FT                   RGLPDYFPSSPRVRFEADFQAPLFFTQDVTTRVLLTRIGTSSMHWEFEVWGEAFDGRPR
FT                   RRAARGRYVTVHIGVGNRAGYDVGSVPWPESWVAALTGEPAAPASPASPADPALRPTPV
FT                   ESIP"
FT   gene            365501..366409
FT                   /locus_tag="Xcel_0309"
FT   CDS_pept        365501..366409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0309"
FT                   /product="transcriptional regulator, PaaX family"
FT                   /note="PFAM: PaaX domain protein domain; PaaX domain
FT                   protein; KEGG: bha:BH0194 repressor in the phenylacetic
FT                   acid catabolic pathway"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29348"
FT                   /db_xref="GOA:D1BV77"
FT                   /db_xref="InterPro:IPR011965"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV77"
FT                   /inference="protein motif:PFAM:PF08223"
FT                   /protein_id="ACZ29348.1"
FT                   /translation="MTAAATEPSGTGVGNAQDTGSADTGTQDTGAQATRRSRTTVVTFL
FT                   GAVVRPLGGWTPIAGAVELLSQCGLDDPGVRTAIHRLKRKGWLASQTRDGVRGYALTET
FT                   ATATLAAGDEVIWHARTPPALADGWCIVNFSVPESKRALRHQLRAHLAALGFGNIGTAV
FT                   WIAPARMRPAAARAVAELGLEPFTTIFTGDYHGPQDLTTLAYDSWDLAAIDQGYRGFVD
FT                   AYGDLASRIEEAAPSGREAFTLHLQMIDAWRRLPFRDPGLPREVLAADWPGPSAARLFE
FT                   RMVAVLEAPALAHAAGYWPKA"
FT   gene            complement(366499..367602)
FT                   /locus_tag="Xcel_0310"
FT   CDS_pept        complement(366499..367602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0310"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   azo:azo1944 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29349"
FT                   /db_xref="GOA:D1BV78"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV78"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACZ29349.1"
FT                   /translation="MSIPVLESNHFRLGLFSSNCSGGLAVTTIPERWSASWEDNLRLAK
FT                   LADETGIDFMLPIARWIGYGGETNFHEGVLEPVPWATAILAHTERLTAFATVHTAFNHP
FT                   AVTAKQLATIDQMAPGRVGVNVVAGWNQPEYVAMGVDLPQDHDSRYELAQEWIDVLTTL
FT                   WSRDGRYDLTGRFWNLERIESVPKPAARRLPILNAGSSVQGKAYAARNADFVFTIVGGP
FT                   EDGAGVVKELEANSAALGRKAGVLTPTHVVCRPTRKEAEEYLHYYAEENADWDAVDNLM
FT                   KLQGLHAQSFSKDLLQNFRSRFAAGHGTCPLIGSPDDVADEIERFAKAGFGGITMAFVD
FT                   YVGELEYFAQEVMPRLVKKGLRPEDLG"
FT   gene            complement(367663..368139)
FT                   /locus_tag="Xcel_0311"
FT   CDS_pept        complement(367663..368139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0311"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: sil:SPO1806 flavin reductase domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29350"
FT                   /db_xref="GOA:D1BV79"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV79"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ACZ29350.1"
FT                   /translation="MTCVTPNTLEVTPSSLRGQLARWPTGVAIITANGTARPLGKTVNS
FT                   FHAASLEPALVGWCIDRKSSRFDEWITTSGYAVHVMAGHQTDLISRFATSGTDRFDGLE
FT                   TAPGLDGIPLLTHEVPLRLECRVANRFDVGDHVYLIGEVVTMTAADHVPMTLQR"
FT   gene            368269..369237
FT                   /locus_tag="Xcel_0312"
FT   CDS_pept        368269..369237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0312"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: azo:azo1936 AraC family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29351"
FT                   /db_xref="GOA:D1BV80"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV80"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACZ29351.1"
FT                   /translation="MTRVTTPLASHGVLRTTDVDDARSSVAASLAPHRLTPLRDAGAFE
FT                   ALHNVAVLDRLSLHYIDYGTEVEVTTERLGFHLVQIPLGGLSTIQAGTSTLAATPRSAA
FT                   VTASGEVLRMRYSAGNPRLMLCIAPDLLRERLEVAAEVGVVVTIRGGATVDITAGAGRS
FT                   WRGLVDVVLADLEHEGGLGRSPLAATTLQLAVVDGLIASLAEPWTDPGDHSTPERVIRR
FT                   AARLIEEHCAEPLGTPDIAEAVGISVRALQAGFKAHLSTTPMAYMRHARLRRVRGSLTD
FT                   GSAHSVAEAASRWGVTHLGRFSADYRAAFGEFPSETFRRAR"
FT   gene            369381..370151
FT                   /locus_tag="Xcel_0313"
FT   CDS_pept        369381..370151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0313"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: plu:plu1439
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29352"
FT                   /db_xref="GOA:D1BV81"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV81"
FT                   /inference="protein motif:PFAM:PF04199"
FT                   /protein_id="ACZ29352.1"
FT                   /translation="MPAIDALLTALTTGEVELVDLTAPLTPETPILQLPAPFANTIPMS
FT                   LEVVSDFDDAGPAWGWNNIHTGEHTGTHLDAPVHWATGRQGYTVDAIPPSRLIGPAVVL
FT                   DLTAEVAENPDFVLEPEHFEKHVAEHGPLPEGAWLVFRTGWSAFNKDAAAFANADEHGP
FT                   HTPGVSPEGAQWLAASAITGFAVETVGIDAGQAGGMEPPFPAHHFLLGANKFGLTQLQN
FT                   VDRLPVTGAVIVASPLPIVGGTGSPARVLAFVPA"
FT   gene            370219..372393
FT                   /locus_tag="Xcel_0314"
FT   CDS_pept        370219..372393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0314"
FT                   /product="Indolepyruvate ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.8"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: pol:Bpro_4734 thiamine pyrophosphate
FT                   enzyme- like TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29353"
FT                   /db_xref="GOA:D1BV82"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV82"
FT                   /inference="protein motif:PRIAM:1.2.7.8"
FT                   /protein_id="ACZ29353.1"
FT                   /translation="MAERSFAHEVRKLRTGAGDTLSGEGILAVTKALLQSGVAYVGGYQ
FT                   GAPISHLMDVLGDAHEILEELGVYFENSASEATAAAMLAASVNYPLRGAVTFKSTVGTN
FT                   VASDALANLSSGGVRGGALVIVGEDYGEGSSIMQERSHAFAMKSQMWLLDPRPNIEAIV
FT                   NAVEAGFELSEASSTPVMLQLRLRSCHLYGSFTAKDNVRPPMTVKDAVENPSRQLDRIV
FT                   LPPASFLHEKEKIEDRWPAAVEYITSHGLNEVLGAGTSDVGIIVQGGVYNTLNRAMELL
FT                   GVSDAYGNTQVPTYVMNVTYPVVDAEILDFVADKRAVLLLEEGQPDYIEQNLNAILRRA
FT                   GSDVALHGKDLLPVAGEYTATVVTQALHAFLSKYLPGTVAERPALLLPHSDPGSPFAPR
FT                   VEASVVRTRPPGLCTGCPERPIFSALKLAEKETGKKHHVSADIGCHLFAINEPFNLGAT
FT                   TMGYGLGSAGAAALNSKDADRRTVAVMGDGGFWHNGLTSGVGNAVFNQSDQLLLVVDNA
FT                   YSAATGGQDVLSSRADSALRSTKHPIEKAVRGIGVTWARTVTNTYKIGELKDLFVKALT
FT                   TKEPGPKVIVAQSECQLNKQRREKPQRAKAIKEGKRVVKERFGVDADTCTGDHACIRVS
FT                   GCPSLSIKANPDPMRTDPVATVLDSCVGCGVCGANAHAASLCPSFYRSDLVFNPTWRDR
FT                   TLAWLRARWIGALSLGVERRADRFEPAEVN"
FT   gene            372393..374054
FT                   /locus_tag="Xcel_0315"
FT   CDS_pept        372393..374054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0315"
FT                   /product="putative indolepyruvate oxidoreductase subunit B"
FT                   /note="KEGG: pol:Bpro_4735 putative indolepyruvate
FT                   oxidoreductase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29354"
FT                   /db_xref="GOA:D1BV83"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV83"
FT                   /inference="similar to AA sequence:KEGG:Bpro_4735"
FT                   /protein_id="ACZ29354.1"
FT                   /translation="MSSWSSGRRPITIAILAMGGEGGGVLADWIVAVGENAGYHSQNTS
FT                   VAGVAQRTGATVYYVELYPGGRSQGDDVRREPVLSLFPTPGEVDIVIASELMEAGRAIQ
FT                   RGFSTPDRTTLIASTNRVYSMDEKLALGDGRVDSNTLLEAAHAGAKHFIGADFMELALA
FT                   ARSVISASLFGALAGSGALPFDRTGFEDAIRASGKGVDASLAAFAAGYDAAQRPAPLPL
FT                   PAAPTPASGGPVAVTIGLSRPVDPAEEAATAAEKRREEQAVRDPGALVGAALQHAAARV
FT                   TADFPAPARSMLLHGVVRTAVYQDTRYTDAYLDRVARFAAVERPDGPARLTTEAARHIA
FT                   LWMCYQDTIQVAQQKIRRRRLDGVRTEAKAAPGQLLNVREYLHPQVEEIADTLPTALGR
FT                   WVAGSAWFGKAVGRLTRNGMIVNTTGIIGFTMLWAMAMFRPLRPRSLRFGREQAAIDAW
FT                   LDQALAAAAIDYDLACEIVECQRVLKGYGATHQHGTESFAILLAEAAALAGRPDAAATL
FT                   VRLRDAALADEDGSALQQARAELASGAPVPELSPVA"
FT   sig_peptide     372393..372476
FT                   /locus_tag="Xcel_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.704) with cleavage site probability 0.702 at
FT                   residue 28"
FT   gene            complement(374087..375190)
FT                   /locus_tag="Xcel_0316"
FT   CDS_pept        complement(374087..375190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0316"
FT                   /product="mycothiol biosynthesis acetyltransferase"
FT                   /note="TIGRFAM: mycothiol biosynthesis acetyltransferase;
FT                   PFAM: GCN5-related N-acetyltransferase; KEGG: mxa:MXAN_1686
FT                   acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29355"
FT                   /db_xref="GOA:D1BV84"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017813"
FT                   /db_xref="UniProtKB/Swiss-Prot:D1BV84"
FT                   /inference="protein motif:TFAM:TIGR03448"
FT                   /protein_id="ACZ29355.1"
FT                   /translation="MPVPLQIGPLGPSDVEGVRGLARAAETADGVAPLSEQPLLRLSSD
FT                   EGWLTHVVARSKAGQVIGYAQVDRGGEDASAELVVHPEHRRAGVGGLLLRTAERDATLP
FT                   QFGGTAGHHGKRLRVWAHGNLEPARAFAAAAGYVVVRELLFLTKPFPPVVAPVEPTPPV
FT                   TEPVEPAPPVVEPVEPAPPVVEPVETTSASTSGVVSTGSTTGGGSTTGGGYRVRAFVPG
FT                   VDDDAWVALNARAFAAHPEQGRLTVADLHDRMAEPWFDPAGFFLAEAPDGTLAGSLWTK
FT                   VEGDDGEIYAVGVDPAHQGRGLGATLTAVGLDHLATRARRATLYVDGDNAAALATYARA
FT                   GFVPTAVDVQYGKATGGTPVPRALPSR"
FT   gene            complement(375204..376241)
FT                   /locus_tag="Xcel_0317"
FT   CDS_pept        complement(375204..376241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0317"
FT                   /product="protein of unknown function DUF1016"
FT                   /note="PFAM: protein of unknown function DUF1016; KEGG:
FT                   apl:APL_1460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29356"
FT                   /db_xref="GOA:D1BV85"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR041527"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV85"
FT                   /inference="protein motif:PFAM:PF06250"
FT                   /protein_id="ACZ29356.1"
FT                   /translation="MTQSNTRSQAPVPGALLSEARQIILDARTRAVRSVDAERVRMYWR
FT                   LGERIVEEEQGGEARAEYGKRIVDRLAAGLQPEFGSGFAARQLWRAKQFYTAYPILTAV
FT                   RSELNWSQYRLLSTMDDADKREYYEREAVTNGWTGRELERQVNSGLFERLLASTNRDAV
FT                   MAAARGERIPQDPTEIIKDPMVLEFLGLERRPEYYERDLEGALLTHLQSFLLELGNGFS
FT                   FVARQRRIVLEDDEFFVDLVLYNRLLRCFVLVELKTRKVTHADLGQLQMYVNYFDREEK
FT                   LGDENPTVGILLCADKNDTVVRYSLPTDNTTILASRYQLYLPSEAELVSELRREVGDVL
FT                   GERDS"
FT   gene            complement(376376..378373)
FT                   /locus_tag="Xcel_0318"
FT   CDS_pept        complement(376376..378373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0318"
FT                   /product="acetate/CoA ligase"
FT                   /note="TIGRFAM: acetate/CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: tbd:Tbd_0504 acetyl-CoA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29357"
FT                   /db_xref="GOA:D1BV86"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV86"
FT                   /inference="protein motif:TFAM:TIGR02188"
FT                   /protein_id="ACZ29357.1"
FT                   /translation="MTTHPEAASLENLLHETRSFPPASAFAAQANAQPSLYAEAAADRP
FT                   EFWARQARELVSWRTPFTQTLDWSDAPVARWFADGTLNAAYNAVDRHVEAGHGDRVAIH
FT                   FEGEPGDTRTVTYADLQREVARAANALAALGVSKGDRVVIYLPMLVESVVAMLACARIG
FT                   APHSVVFGGFSADALRSRIADAEATLVITADGGYRRGAASALKPAVDEALTGAGTDTVR
FT                   HVLVVRRTGQETAWTPGRDIWWHEALESADTFHEPVWVDAEHPLFILYTSGTTGKPKGI
FT                   LHTTGGYLTQCAYTHRNVFDLKDDDVYWCTADIGWVTGHSYVVYGPLTNGATQLLYEGT
FT                   PDTPHRGRWWELIEKYGVSILYTAPTAIRTCMKWGEDIPSAFDLSSLRLLGSVGEPINP
FT                   EAWIWYRRVIGGDTTPIVDTWWQTETGAIMISPLPGVTAAKPGSAQVPLPGIAADVVDD
FT                   EAKPVPDGGGGYLVLTEPWPSMLRGIWGDRQRYEDTYWSRFRGLYFAGDGAKKDDDGDI
FT                   WLLGRVDDVMNVSGHRLSTTEIESALVSHDIVAEAAVVGASDDMTGQAVVAFVILRGEH
FT                   AGRAATPDGAEQVQAELRAHVAKEIGPIAKPKRILVVAELPKTRSGKIMRRLLRDVAEN
FT                   RAVGDATTLADSSVMDLITAGLAAGKSADD"
FT   gene            378574..379629
FT                   /locus_tag="Xcel_0319"
FT   CDS_pept        378574..379629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0319"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   pap:PSPA7_1398 putative FMN oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29358"
FT                   /db_xref="GOA:D1BV87"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV87"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ACZ29358.1"
FT                   /translation="MSLLFEPYRLRELTVPNRAWLAPMCQYSAVDGVVGDWHLAHLGAR
FT                   AVGGFGLLVAEATAVVPQGRISPQDAGLWSEDHVPPWRRVTDLVHAQGAAVGVQLAHAG
FT                   RKASTYRPWSPVHGTVPASDGGWATLGPTSEPFPGYDAPDAMTSRQVADVPEQFAAAAR
FT                   RAHAAGFDVVEVHAAHGYLLHQFLSPLTNRRTDAYGGTPENRARLLAETVTAVRDAWPD
FT                   GKPLLVRVSATDWTEGGLEPDDVAAALKGLDVDLVDVSTGGLLPAPVPAAPGYQVPHAR
FT                   RVRDVSGLPAGAVGLITSAEQAETILRDGAADAVLVGRAALRDPHWPLRAAHELGADVA
FT                   WAKQYERGAWR"
FT   gene            complement(379893..380669)
FT                   /locus_tag="Xcel_0320"
FT   CDS_pept        complement(379893..380669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0320"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB (PSPase-
FT                   like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: ppu:PP_1721 HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29359"
FT                   /db_xref="GOA:D1BV88"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV88"
FT                   /inference="protein motif:TFAM:TIGR01490"
FT                   /protein_id="ACZ29359.1"
FT                   /translation="MTRVAAFFDLDKTIIATSASAALSRPFYEGGLVTRGDVLRSAYAH
FT                   FLFVLGSADADQTERMRKHLSELATGWDVDKVRQIVAETVHEVIDPYVYAEAVDLIAEH
FT                   HELGHDVVIVSASGSELVEPIAAVLGADHTIATQMRVADGRYTGDMEFYAYGENKAVAI
FT                   RELAAKQGYDLTRSYAYTDSITDAPMLDAVGHGFAVNPDRALRRLAAERGWGTLTFTRP
FT                   VALRTALRPPTPVLAALAAVALAVAGVWVWRTLRRR"
FT   gene            380748..381335
FT                   /locus_tag="Xcel_0321"
FT   CDS_pept        380748..381335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0321"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: rlt:Rleg2_2358 transcriptional
FT                   regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29360"
FT                   /db_xref="GOA:D1BV89"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV89"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACZ29360.1"
FT                   /translation="MEIRHVELTAESVKVLAHPLRSRLLSALRRGGPATATALAAQLRT
FT                   NSGATSYHLRRLEAVGLVADTGDGRGKERLWAASTESHGWRNSAFADDEDARTAIGWLV
FT                   RDYQHTYDQRFTAWLDVADTWPAAWQDVLGLEDAWVEVTPEQLQALKAEIDAVVLRYAE
FT                   AGKGDPRARRIALYRTSMPLDLELDPPAAEEP"
FT   gene            381332..382600
FT                   /locus_tag="Xcel_0322"
FT   CDS_pept        381332..382600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0322"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sit:TM1040_0869 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29361"
FT                   /db_xref="GOA:D1BV90"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV90"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACZ29361.1"
FT                   /translation="MNVAAARRVLLLLTVSRWFPVGLVVAVLVLLMIERGLSVGQALTV
FT                   SSLGGVVVFLLELPTAGLADALGRKPLLLLAAGLQVVAAVMVASAQSFAAFAVAAVVTG
FT                   AFRALDSGPLQAWFVDTVHRTSPGADVDRALSQQSAVLGLSIALGALVSGGLVWWHPVT
FT                   VWSALTLPYVVYAALAVVHLVATAMLLREARPDDAERGWARARREARRAPHVVADGLRL
FT                   ARGNRVLLALLLVEVFWAAAMVVFESLMPVRLGEVLGSTQQAGALMGVVASVGWAVFAA
FT                   GAGLAGWAAGRFGVARTALAARVLNGLGAVWMGLVAGPAALVSAYLVTYGLHGSGGPVY
FT                   EALLHREATAGNRATVLSMASMLGFASFAVASPALGWTAEGVSTPVAMMIGGAFSVLGA
FT                   FCFLPAWRREKQLRLSGTVAARV"
FT   gene            382701..383501
FT                   /locus_tag="Xcel_0323"
FT   CDS_pept        382701..383501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0323"
FT                   /product="flp pilus assembly protein FlpE"
FT                   /note="KEGG: asa:ASA_2910 flp pilus assembly protein FlpE"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV91"
FT                   /inference="similar to AA sequence:KEGG:ASA_2910"
FT                   /protein_id="ACZ29362.1"
FT                   /translation="MAASSTPLVAVVGASGGIGTSCVAAALAHGLRRATGRGVLVDLDA
FT                   GGSGIDVLLGIEDEPGARWPALADARGDVDGRGLLASLPRWGSVPVLSGLRNVPSAPDD
FT                   DVVLDVCAALLRAGEAVVADLPRPGAWTPAVRALVTGAEDILVVAAATLPGAAGAVAVA
FT                   RTLAGVAEGRVRLVVHRTQPGGPPADDLETLTGLEVVAQVGRDRGLAAAIERGEGPRVG
FT                   RGTRLARLAEELVAATGADRATGPRGVGAVQSGVVGDGVLRSAR"
FT   sig_peptide     382701..382787
FT                   /locus_tag="Xcel_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.398 at
FT                   residue 29"
FT   gene            383498..384649
FT                   /locus_tag="Xcel_0324"
FT   CDS_pept        383498..384649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0324"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   bbr:BB2098 secretory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29363"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV92"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACZ29363.1"
FT                   /translation="MSRLDAGLLADVRGRLADQEVDDDAVGAALAASGRVLGSAALRDL
FT                   TRAARAELAGAGPLQPLLELPGATDVVVNGPHDVWLDRGRGLERADLDLGTPGAVRALA
FT                   VRLAALAGQRLDDAAPVCDGRLPDGTRLHAVVEPVVPAGAAISLRVLRQSGLGVTALAA
FT                   GGSLAPGWEALLRGLVAGRANVLISGGTGTGKTTLLAALLGLVPVDERIVTVEEARELA
FT                   PAHPHVVPLVTRRANVEGAGAVGLTELVRAALRMRPDRIVVGECRGAEVREVLLALNTG
FT                   HDGGFATLHANAVEHVPARLEALAALAGMSRDAVAAQAVAAVDVVLHVRRKPGRRFVEA
FT                   VGVVARDAGGFAVREVARWDGSAAETTVVDPRAWDALQARWCA"
FT   gene            384646..385320
FT                   /locus_tag="Xcel_0325"
FT   CDS_pept        384646..385320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_3451 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29364"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV93"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_3451"
FT                   /protein_id="ACZ29364.1"
FT                   /translation="MSGGGVGVAVGLAVLVALGQGGRSAVAVLGEGRRPGATVAWLRGA
FT                   ARGAALRRRGAEREGVRVRVVVAQVTALLRAGAPPGAAWTRAAGVPVDALGVPEVDALG
FT                   GVVGDGPARAVCAATRLALTVGAPLGRVLDAVADALVAEAEAAAERDAALAGPRTTARV
FT                   LLWLPAAGALLGWTLGADPLAVATDGGAGTAAVGGGLVLLGVGRWWTGRLVDAARRAGA
FT                   EP"
FT   gene            385317..385868
FT                   /locus_tag="Xcel_0326"
FT   CDS_pept        385317..385868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0326"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   mno:Mnod_2571 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29365"
FT                   /db_xref="GOA:D1BV94"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV94"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACZ29365.1"
FT                   /translation="MIAALGLLAVMPWLLVDRVARRRCAALAGVAPTGCSQDARPPVDV
FT                   TVVLELLGAALRAGAGVPRAIETVAQAVGGADGAALARVASALRLGAAWTVAWEGVPPR
FT                   LDVVARALRPAWDEGAAPGEALTAAGEELRRARRDATRTAAGRLAVQLVLPLGTCFLPA
FT                   FVLVGLAPVLLALGSGLLAG"
FT   gene            385926..386111
FT                   /locus_tag="Xcel_0327"
FT   CDS_pept        385926..386111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29366"
FT                   /db_xref="GOA:D1BV95"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV95"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29366.1"
FT                   /translation="MNEEQHGTGVEADGEAGMATAEYAIATLAAVGLAGLLVVILKGDM
FT                   VKGLLEGIISAALSVV"
FT   gene            386119..386490
FT                   /locus_tag="Xcel_0328"
FT   CDS_pept        386119..386490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0328"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sal:Sala_1101 TadE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29367"
FT                   /db_xref="GOA:D1BV96"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV96"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29367.1"
FT                   /translation="MTIATHPSDAGRRPERGAVTAELAIGLPVVVLLLVAVLTIAAASG
FT                   AQLRALDAARAGARAVAIGQDAATVRAVVDHVGGAGSDLRLEHDGEWVVVEVSRPVAGG
FT                   WFTRLPLRATGKATAWVEP"
FT   gene            386487..386855
FT                   /locus_tag="Xcel_0329"
FT   CDS_pept        386487..386855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0329"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /note="KEGG: acp:A2cp1_1867 GAF sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29368"
FT                   /db_xref="GOA:D1BV97"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV97"
FT                   /inference="similar to AA sequence:KEGG:A2cp1_1867"
FT                   /protein_id="ACZ29368.1"
FT                   /translation="MTAGADGERGAGTVLMLGVVAVVLLFGLALAAVGAAQQARGTAQA
FT                   AADLGALAAATARRAGFDACATAREAVERNRGHLVACELEAGGVVGLTVARSTAGLPGW
FT                   LARDATARARAGPRPPGG"
FT   sig_peptide     386487..386582
FT                   /locus_tag="Xcel_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.765) with cleavage site probability 0.530 at
FT                   residue 32"
FT   gene            complement(386912..389518)
FT                   /locus_tag="Xcel_0330"
FT   CDS_pept        complement(386912..389518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0330"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein; KEGG: sfu:Sfum_1698 DEAD/DEAH box
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29369"
FT                   /db_xref="GOA:D1BV98"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV98"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACZ29369.1"
FT                   /translation="MAAPFAFHRYWKDGTVPPADAHPLLDVLLAGGARADRLTHVRTLP
FT                   ARDGATADWPSWADPALVAGYQSLGVARPWVHQASAASAAWSGRHVALATSTGSGKSLA
FT                   FWLPALTIIGRTQPPQQRGSVLYLSPTKALAADQLAALERVLAAMPADAGRQLRVTTCD
FT                   GDTPTDERRWVQDYADVVLTNPDFLHFSLLPNHRRWSRFLRALRYVVVDEGHTYRGVFG
FT                   AHVSLVMRRLTRLVEHHRGGALTFVVASATSAEPAASAARLLGVSPSDVEAVTEDASPS
FT                   GRRTVALWQPPEIASFAFTRADPHEDDPWALPDPLDPAHEEAEQTAVVTADGAADHPRR
FT                   SATAEVADLLADLAAHGARTLAFTRSRRGAESVAQAARDHLRPVSTDLSRRIAAYRGGY
FT                   LPEERRELEESIRSGALLGLATTNALELGVDISGLDAVLIAGWPGTRMSLWQQAGRAGR
FT                   AGADGLVAFVAREDPLDTYLVTHPEAVFDAPLEATVFDPSNRYVLAPQLCVAAQEVPLR
FT                   SEELSRFGDPDLVRGVLDELVEGGALRRRPSGWYWTHAQPAAPMADLRGSGGRPVRVVE
FT                   ATTGRLLGTVDAGSADGQVHDGAVYVHQGTTFVVDHLDLTDRVALVVRRDVDHGTWSRE
FT                   VMTIAIEEPEPHTSPVVDPVETTTPAAEPPTAPVVEPVETTTGSTLRRAWGPVSWGLGP
FT                   VDVTSQVISFERRRVPDLQVLGTEPLDLPERSLATTAVWWSVPDFVLRAAGLSPDVVPG
FT                   ALHAAEHASIGLLPLLATCDRWDLGGISTDLHPDTGEATVFVYDAYPGGAGFAERGYEL
FT                   GATWLHATRDAIASCPCDHGCPACVQSPKCGNYNSPLDKAAAVVLLDAVLGHAPPE"
FT   gene            389598..389987
FT                   /locus_tag="Xcel_0331"
FT   CDS_pept        389598..389987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0331"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ccs:CCNA_03057 glyoxalase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29370"
FT                   /db_xref="GOA:D1BV99"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D1BV99"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACZ29370.1"
FT                   /translation="MRLHHVQVACPRGGEDAARRFYADGLGLTEVPKPAALAGRGGAWF
FT                   RAHDDGGVVVAEVHVGVEDPFAPALKAHPALVVDDVVTLDALGERLEALGFAVDRRERE
FT                   TFDGYPRFHTADGAGNRVEVLAHRH"
FT   gene            390025..390843
FT                   /locus_tag="Xcel_0332"
FT   CDS_pept        390025..390843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0332"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   rec:RHECIAT_CH0000435 rRNA methylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29371"
FT                   /db_xref="GOA:D1BVA0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVA0"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ACZ29371.1"
FT                   /translation="MAQKISKRNARFQELEALLTNRSKRSRSGHFLVQGVRPVTLAVEH
FT                   GWQVDAFCYEDGRRLSDWARGLLHRTGPEHYALSADLLAELAEKPEGEAELVAVVSVPD
FT                   DDLDRVPVPADFLGVVLDRPTQPGNVGSIIRSADAFGAHGVIVTGHGADPYDPRAVRAT
FT                   TGSLFAVPVVRAPSHREVLDQVAAWRAAGTPVTVVATDEDGDVDIAGVDLTGPVLLLVG
FT                   NETAGLTRAWRESADAVASIPMVGAASSLNAANAASVVLYEARRQRAVPR"
FT   gene            complement(390845..392233)
FT                   /locus_tag="Xcel_0333"
FT   CDS_pept        complement(390845..392233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0333"
FT                   /product="Aspartyl aminopeptidase"
FT                   /EC_number="3.4.11.21"
FT                   /note="PFAM: peptidase M18 aminopeptidase I; KEGG:
FT                   dar:Daro_1590 putative aminopeptidase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29372"
FT                   /db_xref="GOA:D1BVA1"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVA1"
FT                   /inference="protein motif:PRIAM:3.4.11.21"
FT                   /protein_id="ACZ29372.1"
FT                   /translation="MTRGVVDDGARQHCADLGAFVVASPSSFHAAAEIARRAVGAGFTL
FT                   LREPEAWSLTPGGRYVVVRDGSAVVFRLPDDAGPTTPFTIIGTHTDSPGFKLKPRPTTG
FT                   GHGFWQAGVEVYGGPLLNSWLDRELELAGRLVLLDGSEHLVRTGPLLRLPQLAIHLDRA
FT                   VNDGLALDKQRHTQPVWGLGEVADADLLAALAPTGVDPAAIGGYDVVVADTQEPRAFGA
FT                   GEALFASGRLDNLLSTHAALTALLTVTSPVVEPPPVVEPVETTPPPVVEPSPLVEQPSV
FT                   VEPVETTIAVVAAFDHEEIGSESRSGAAGPLLKDVLTRIGAALGATAEDRARAFASSFH
FT                   VSSDVGHGVHPNYPERHDPANQPRVGDGPILKINANQRYATDAYGAARWAAACAAAGVP
FT                   FQEFVSNNAIPCGSTIGPITATRLGIRTVDVGVPILSMHSARELTAVVDPWYLSRAMAA
FT                   VLAG"
FT   gene            complement(392273..393094)
FT                   /locus_tag="Xcel_0334"
FT   CDS_pept        complement(392273..393094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29373"
FT                   /db_xref="GOA:D1BVA2"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVA2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29373.1"
FT                   /translation="MSIHDDHDDLRLALDAIAGAGAGTARPEQLLRTVRGRVRRRRAAK
FT                   QVGIGATTLAVGGALAFGAVQLVPRALDPGPVGPATTPTVSATEPSPGPDPTEPTQPAP
FT                   TTPSTPPVEPVADCSAAGGSTDVDLTGLPEPAQQTLRTLVQAAAACDADTLIALAQRDG
FT                   THLNFGANDPVETWTLPDAEADEPVYEILRALLTQTSWAPYTIESADDAVVWPRVFTPE
FT                   NAEDDAAWQEAIDAGAVPADLAADMRAAGEYLGWRVAITAEGTWQFFTGGD"
FT   gene            complement(393091..393645)
FT                   /locus_tag="Xcel_0335"
FT   CDS_pept        complement(393091..393645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0335"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 4
FT                   domain protein; KEGG: rce:RC1_3903 RNA polymerase sigma-70
FT                   factor, ECF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29374"
FT                   /db_xref="GOA:D1BVA3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVA3"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACZ29374.1"
FT                   /translation="MTAWDEELTELVTHRGRALVGYAYLLCGDARQAEDLVQDALVKVY
FT                   ARLRGTPGPATVHPLDADGPPRRGTEAYVRRAILTLFLDDRRRHTRWIERRHLVATETT
FT                   ARGPESGATARADVAAALTGLAPRERAAVVLRYFEDLTVPQVAEAMGLATGTVKRYLSD
FT                   ATAALRGVLAVPADEAREERS"
FT   gene            393812..396178
FT                   /locus_tag="Xcel_0336"
FT   CDS_pept        393812..396178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0336"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: mms:mma_2575 membrane-bound proton-
FT                   translocating pyrophosphatase; TIGRFAM: V-type
FT                   H(+)-translocating pyrophosphatase; PFAM: Inorganic H
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29375"
FT                   /db_xref="GOA:D1BVA4"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVA4"
FT                   /inference="protein motif:TFAM:TIGR01104"
FT                   /protein_id="ACZ29375.1"
FT                   /translation="MLELGTGSIVIVAVIAVIALAALACAVVLRRQVLAADEGTPSMRE
FT                   IARAVQEGAAAYLNRQFRTLALFAVVVFALLFLLPGDGGVRIGRSIAFLFGAAFSAAIG
FT                   YLGMWLAVRANVRVAAAASRPGGRNQGAHIAFRTGGVVGMSVVGLGLLGAALVVLVYRE
FT                   NAPVVLEGFGFGAALLAMFMRVGGGIFTKAADVGADLVGKVEKGIPEDDPRNAATIADN
FT                   VGDNVGDCAGMAADLFESYAVTLVAALILGKAAMGEQGMVFPLMITAIGAFVALLGVLV
FT                   TRVRGNENGLKAINRGFYLSALVGAGLSAVAAYVYLPDSFDALNGTAELGEMHALSADP
FT                   RLDAALAVVIGVALAGVILWITGYFTGTTSKPTLHVAATSRTGAATVVLSGIGVGFESA
FT                   VYTAGIIAAAICGAFLLAGGSVWLALFLIALAGCGLLTTVGVIVAMDTFGPVSDNAQGI
FT                   AEMSGDVDEEGAKALTDLDAVGNTTKAITKGIAIATAVLAATALFGSYADAVERALTQV
FT                   GHRGTGLVNTMLSFEIISPVTLVGVILGAATVFLFSGLAIDAVTRAAGAIVYEVRRQFR
FT                   EHPGIMTYDERPEYGKVVDICTRDSLRELATPGLLAAFAPIAVGFGLGVGPLAGFLAGA
FT                   IGAGVLMAIFLANSGGAWDNAKKIVEDGAHGGKGSEAHAATVIGDTVGDPFKDTAGPAI
FT                   NPLIKVMNLVALLIAPAVVALSVPDDANHWLRIGVACAAAAIAFGAVIASRLRAARADE
FT                   ASVAEAEAELAALAQATPPTPTPTPAEEPAPTRRH"
FT   sig_peptide     393812..393886
FT                   /locus_tag="Xcel_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.480 at
FT                   residue 25"
FT   gene            396297..397190
FT                   /locus_tag="Xcel_0337"
FT   CDS_pept        396297..397190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0337"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: xau:Xaut_1199
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29376"
FT                   /db_xref="GOA:D1BVA5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVA5"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACZ29376.1"
FT                   /translation="MSDLLPAGTGMRAVTLHVDDLDGMTAYYRDALLLDELAVPETAGL
FT                   TPGDRAETVVLGRAGVPAVVLRRTPGLPRPARGAAGLFHTAIVYPDRAALAATVASVGA
FT                   AAPGTYVGSADHLVSEAFYFTDPEGNGVELYYDRPRDTWAWDAGQVRMDTLWLDPNAYL
FT                   TGHLPRDAQDQHAARAAAAVVGHVHLQVGDVAAARAFYVDALGLAPTAALPGALFVAAG
FT                   GYHHHLAVNTWSSRGAGPRASTLGLATIGLEVPTADDAGALRDRLRHAGIAVADDGATL
FT                   RFDDPWRNHLEVAVAA"
FT   gene            397291..397971
FT                   /locus_tag="Xcel_0338"
FT   CDS_pept        397291..397971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0338"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcr:BCAH187_A2829 putative uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29377"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVA6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29377.1"
FT                   /translation="MARVEPEQLGLPRLAVERWETTTVANVAAGVVERARVVEASGGGR
FT                   RHLVVVDGDGGSGKTTFARRLVAALPGSGLVHVDDVSWWLDWTDWTDAMLDGVVRPWLS
FT                   GTDVDYRPPGWIAKGREGSVRATAARFLVLEGVGAGRRELAPYVSYAAFVTADPLVAQE
FT                   RILVRDIGTDGDTRDEVFAFYADSQRILVPFLLDQRPWERADLIVDGDHDAAGNDLRVA
FT                   RGLG"
FT   gene            complement(397972..398544)
FT                   /locus_tag="Xcel_0339"
FT   CDS_pept        complement(397972..398544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0339"
FT                   /product="protein of unknown function DUF664"
FT                   /note="PFAM: protein of unknown function DUF664"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29378"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVA7"
FT                   /inference="protein motif:PFAM:PF04978"
FT                   /protein_id="ACZ29378.1"
FT                   /translation="MGPTKRDPPRVTSTTSGLWVEPENDPRATGAEPVGEKETVWEYLC
FT                   RYRMTLVMKCEGLDAEQLARRSVPPSTLSLLGIVRHLANAEHHWFQRVLAGGAAPGPFE
FT                   LPDVADHDFDGATASDACVAEAWGEWHQAVEAADEVFWSQDMDREIPYLDGTVEVRDIL
FT                   VHMVEEYARHMGHVDLLRECIDGRTGL"
FT   gene            398692..399597
FT                   /locus_tag="Xcel_0340"
FT   CDS_pept        398692..399597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0340"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29379"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVA8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29379.1"
FT                   /translation="MLPPSESLAVPAAPAADEVSRPAPAASSGPISFRDLLGPVRTDAP
FT                   AAAPDDAEPAAASPFTRTPFTRTPAAAPPADEPVASAPDDAEPAAGAPPFAPTRLTRTP
FT                   FRRTPAAAPDDDAEPDGVEPDDAEPDAIPAVETAPASARRRLTVPRLLDHRLALAAAAA
FT                   LALGAGAGTGAATDLLREDVAEVAATTPEQCLTIQAAWTASASSQVGMTADDPVTLRDG
FT                   FLGARDALVGVPTPSGAAADWTLVAAYLDAVADAVEPVDPADGEAIMAAVGTAIGELDT
FT                   SAATAASARVTAYLQGGCVG"
FT   gene            399658..400284
FT                   /locus_tag="Xcel_0341"
FT   CDS_pept        399658..400284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0341"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Hypothetical protein CBG15581"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29380"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29380.1"
FT                   /translation="MLPVRQIPSRRRASVRLAAAFALCAGLLGGCVGPFAPASSEPSIE
FT                   PLPEASAVIVAPDAVIPESDGGSVPAPSDEPDDEAAPDDEATPEDEAAVEETSDCVDLQ
FT                   TAWTTTNQALVSLSPEHPRAFVNSFRVAADAMAGVTVPDDVADDWAAMSAYLARVNAAF
FT                   ADVDANDADAVASAMRDAVSAQDTEAAAATAREITSFLAADCPAE"
FT   sig_peptide     399658..399780
FT                   /locus_tag="Xcel_0341"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.870 at
FT                   residue 41"
FT   gene            400281..401999
FT                   /locus_tag="Xcel_0342"
FT   CDS_pept        400281..401999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0342"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; Methyltransferase
FT                   type 12; KEGG: sus:Acid_0228 methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29381"
FT                   /db_xref="GOA:D1BVB0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVB0"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ACZ29381.1"
FT                   /translation="MSARRGVSTGSTARDVGSTARDVGSTARDVGSTAGGADAVTPAPA
FT                   ATDAALALLHDDLAAARYTVDGVAELFGPVATAALHREQAVPARLAVEAAVRGRAPSSW
FT                   DPRATLSRLFLLGGEVPRSALDAALPATRADGLVRAGLAVAAGQGDDDAVRAAVDLAPY
FT                   AATDGGGGGPAEDIVWWLASDLGELARGGAIATDHVLGAGGASLTLAQVTVRNQTGRVL
FT                   DLGTGCGIQALHAHRHAAAVVGTDISARALAFARFNAGLNLGDADAFDLRRGSMLEPVA
FT                   GEQFDLVVSNPPFVITPHSGAAGRAVHDALGDFEYRDGGRAGDDLVRDLIQGVGAVLAP
FT                   GGTAQLLGNWEHRRGIPWTERVGEWLDASGLDGWVIQREVLDPAEYAETWIRDGGTTPE
FT                   RDPAGWAAAYGAWLDDFASRDVEAIGFGIVTLRKPEGPATLRRLEEHTGSVHQPLGAHL
FT                   AASLAAHAWLAARTDDDLLAAHLETAPDVTEERYLTPGLPDPNVVVIRQGDGLGRGVHA
FT                   STALAALVGACDGELAVGQIAGAIAALFDVDAGALRAELLPAVRGLVRDGFLRPA"
FT   gene            402209..403129
FT                   /locus_tag="Xcel_0343"
FT   CDS_pept        402209..403129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0343"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; KEGG: bpa:BPP3396
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29382"
FT                   /db_xref="GOA:D1BVB1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVB1"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ACZ29382.1"
FT                   /translation="MLDAAPTAPRSPAPLVVGAPRTGPRVVAALLALVAALGVHLTWQV
FT                   FVGSEAGQRLDRLALEGAQHGQHRLWTVAEPLLDVVSVSFVVLGILTAMVVCLVRRRWV
FT                   LAAQVAVLIGGSNATTQLLKDWVYDRPHLLPGWNGGNTLPSGHTTVAASVAVALLIAVP
FT                   RTWRPAVALLGAAWTAATGISTLVGQWHRPSDVVAGVLVVAAWGAAACALGTGSTLDVA
FT                   RRHGDGGLAAPGSYVAAGLLALGGAVAGFFAGVALVDLGTGARSVPFEGDVTAYAGGVA
FT                   GVIAVTAFVFAALLLVRQATARPDR"
FT   gene            403239..406013
FT                   /locus_tag="Xcel_0344"
FT   CDS_pept        403239..406013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0344"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: bba:Bd0964 DNA topoisomerase I; TIGRFAM: DNA
FT                   topoisomerase I; PFAM: DNA topoisomerase type IA central
FT                   domain protein; TOPRIM domain protein; SMART: DNA
FT                   topoisomerase I DNA-binding; DNA topoisomerase I
FT                   ATP-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29383"
FT                   /db_xref="GOA:D1BVB2"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVB2"
FT                   /inference="protein motif:TFAM:TIGR01051"
FT                   /protein_id="ACZ29383.1"
FT                   /translation="MATKLVIVESPTKARKIAGYLGAGFEVEASVGHIRDLPQPSELPA
FT                   EMKKGPFGKFAVDVENGFEPYYEVYADKKAKVRELKKLLKDADELYLATDEDREGEAIA
FT                   WHLIQELKPKVPVRRMVFHEITKEAILRALENTRDLDTDLVDAQETRRILDRLYGYEVS
FT                   PVLWRKVRQGLSAGRVQSVATRLVVERERERMAFVTASYWDVTGSFAPTAGDDAGVVFS
FT                   ARLSGIGGERVATGRDFDDRGRLKVRTGVVHCSQAVAQAVVTGLDGADFAVRSLETKPY
FT                   TRKPAAPFTTSTLQQEASRKLRMNARATMRTAQSLYENGYITYMRTDSPALSAEAIDAA
FT                   RRQAAELYGSEFVPGTPRLYQSKSAGAQEAHEAIRPAGDSFRTPAQVARELSGDQFRLY
FT                   ELIWKRTVASQMADAKGSTASVRLGAVLSAAAGDLAGKDAIFSASGTVITFRGFLAAYE
FT                   EGTDTEDSPEARAATPKDARLPRMAQGDGLDARDLTADGHSTTPPARYTEASLVKALEE
FT                   LGIGRPSTYAATISTIQDRGYVRTSGQAMIPTWLAFAVTKLLEDHFGSLVDYRFTAEME
FT                   QDLDEIAEGRRARGAWLEEFYFGDREAAAGSDAVGTLATSGLKGLVDGLGEIDPVAVNS
FT                   VELGEGLRLRVGRYGPYVEDLSAPVAEGATPQRASVPDDLAPDELTVEKARELLAAGGD
FT                   DGRSLGVDPVSGHEIVAKAGRYGPYVTEVLPEPVLDEGLSAAAKKRALAALPKPRTGSL
FT                   FKDMDLATITLDDALKLLSLPRVVGVDPADGVEITAQNGRYGPYLKKGTDSRTIASESM
FT                   LLTVTLEEALAIYAEPKRRGARGAAQPPLRELGDDPTSGKPIVVKDGRFGAYVTDGETN
FT                   RTLPRDVTPETITPERAIELLAEKRAAGPAKKRTTTRKAPAKKAPAKKAPAKK"
FT   gene            complement(406074..408695)
FT                   /locus_tag="Xcel_0345"
FT   CDS_pept        complement(406074..408695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0345"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   acp:A2cp1_1921 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29384"
FT                   /db_xref="GOA:D1BVB3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVB3"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACZ29384.1"
FT                   /translation="MIRVALRGVREHLVRFGLSVLAVTLGVAFVVGTFAFRGMLSATFD
FT                   EIVATSVSADVYVRGTQAITSDVADQTGPPTSPASFGQQRNPVSAALAEDVAAVDGVDR
FT                   AVPDYSGSIVLVGADGTAVVTQGPPSIAFGIDPEFPTAHLTAGDWPGPDELVLETGAVA
FT                   ASGLAVGDTATVVLGDSPRELTVSGTFAIDAAAAGAVLVGIDADTARETFAPDGQVPQI
FT                   AVHAEPGVDPAGLTERVAAVLPAGSGAEAVDGDVVRDEASAAIQELLGFLQTFLLIFAA
FT                   IALVVGSFIITNAFAMAVRERQRENALLRAVGASPAQVFAAVLAQAVAVGLVGSAIGVG
FT                   LGVLLVHGIRAVLDRMGMPFGGDISLTGWQVAAAVGLGTLLCVVAAAVPARRAALVPPV
FT                   QAMRDDVVPERGVRTRAVAGVLIAAVGGVLLYLASRLGSRLGDRLTGWAWVDDLNPRWV
FT                   LGVGAGLLLLGVLVGSPAVARWVLHGLGAPAAWLLRPLGGLARGNVTRNPRRTAATAGA
FT                   LTIGMALVACTGVIAASTEASVHTVVHTELRAPLLVDSATFRVPADAVAAVQAVPGVGS
FT                   TEVVRIGTTAAAPPDDDADDARAVPLAGVSTAFFTDAVNAQELAGDPTTALVGGKAAVV
FT                   RRTARDLGVQVGDELRLGLGEHARTVQVGAVFESQVVGTGVLVRGDLFDSIVPQAQESV
FT                   RAIYVTPADGTDVETLRADLREAVTPFVVLTVRDRDETASAVADQVNQAVAILYALLAL
FT                   SIVIALLGIVNTLALSVIERTREIGLLRAVGLGRLQLAAVIAIESVLIAVYGTVLGVAT
FT                   GIAVAAALPGVLADEGLSRLAIPWGQVLAVLGIAVVIGLVAAIGPAVRAARLPVLEAVT
FT                   VD"
FT   gene            complement(408787..409695)
FT                   /locus_tag="Xcel_0346"
FT   CDS_pept        complement(408787..409695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0346"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: aba:Acid345_0970 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29385"
FT                   /db_xref="GOA:D1BVB4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVB4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ29385.1"
FT                   /translation="MDPARGRHAQPDASSEQPPAQASARDLVKTYGAGETEVRALDGVS
FT                   VDFARGRLTAIMGPSGSGKSTLMHCMAGLDTPTSGTVVVDDVEISSMSQRALTRLRRTR
FT                   IGFVFQAYNLVPTLTAEENITLPLDIARAPVDPAWFDAVVDAVGLRSRLRHRPNALSGG
FT                   EQQRVACARALVSRPSVVFADEPTGNLDSKSSREVLTFLRQSVDELGQTVVMVTHDPRA
FT                   AAYAHRVLLLGDGRITADLDHPSRAEILAAVGAEDDDDARPATGRYAAVPAPRTGPLAV
FT                   VEAPRRARRARVDGDGGGVES"
FT   gene            complement(409802..411166)
FT                   /locus_tag="Xcel_0347"
FT   CDS_pept        complement(409802..411166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0347"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG: gbm:Gbem_1583
FT                   aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29386"
FT                   /db_xref="GOA:D1BVB5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVB5"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ACZ29386.1"
FT                   /translation="MLYADAAATTPVRREVLEAMWPYLTGEFGNPSSSHELGHRAAAAL
FT                   TVARATVARTFGARPGEVTFTSGGTEADNLAVKGLALAATDPARGRRARGRHLVTSAIE
FT                   HEAVLESVDFLRRWHGFEVTVVDLEPDGTVTPDALRGAVRPDTALVTIHHANNEIGTVQ
FT                   DVRALAAVAHEVGALFHTDAVQAAGWLPVSLAGSGADAISVSGHKLGAPKGVGALLVRA
FT                   GVPVEPLVHGGGQERGRRSGTENVAFAVGLAAAVGALPALQARADDVAASRDALIDGVL
FT                   TRVPTAILTGPDPRLGGFDRLNHRGEPADLNYRPVGGFDRLNHRGTPVDHNRHPVGGFD
FT                   RLNHRGAPADHNRHPVVEPVETTRRRLPGHASFCFPGTSGEAVLLELERAGIVTSSGSA
FT                   CAAGRDEPSHVLLALGIDPEIAQTSVRFTLDAPFDAEPLVAAVVEATTTLGRLGT"
FT   gene            complement(411189..412046)
FT                   /locus_tag="Xcel_0348"
FT   CDS_pept        complement(411189..412046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0348"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: ccs:CCNA_03009 nicotinate-nucleotide
FT                   pyrophosphorylase (carboxylating); TIGRFAM:
FT                   nicotinate-nucleotide pyrophosphorylase; PFAM: Quinolinate
FT                   phosphoribosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29387"
FT                   /db_xref="GOA:D1BVB6"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVB6"
FT                   /inference="protein motif:TFAM:TIGR00078"
FT                   /protein_id="ACZ29387.1"
FT                   /translation="MTPVAAVDEILTHALAEDAPWGDLTSEVFLPAGARAKAALVAREP
FT                   GVLSGLTVFARTFTLLDPAAVVELPTADGAEFAAGDVLAVVEGDARAVLRAERIGLNLV
FT                   QRLSGIATTTARYVAVVAGTGARVVDTRKTTPGLRVLERAAVRDGGGHNHRFSLSDAVM
FT                   AKDNHLAVLAAQGISVGDAIRAARAKLPHTATIEVEVDRLDQIEEVVAAGVTTIMLDNF
FT                   TPAELVAGIEIVAGRAIVEASGGITLDTIRAVAETGVDVISVGALTHGVRSLDLGLDMA
FT                   VTQP"
FT   gene            complement(412198..413928)
FT                   /locus_tag="Xcel_0349"
FT   CDS_pept        complement(412198..413928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0349"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="KEGG: sus:Acid_7341 L-aspartate oxidase; TIGRFAM:
FT                   L-aspartate oxidase; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein; FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29388"
FT                   /db_xref="GOA:D1BVB7"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVB7"
FT                   /inference="protein motif:TFAM:TIGR00551"
FT                   /protein_id="ACZ29388.1"
FT                   /translation="MRVVVVGSGAAGLLAAYRAASRGHDVALVTKADLPESNTRYAQGG
FT                   VAAVMFEDDTVDAHVADTLVAGAGLCDAEAVRLLCTEGPDRVRDLLALGLELDRVAGPG
FT                   SPLARGREAAHSADRILHSHGDSTGLSLEIALIEAVRSVPIEVHEHAFLRDLLVEEGTD
FT                   ASRRVVGVDVVHADGSSSQLRADAVVLATGGAGQLYAHTTNPLVTTGDGVAAALRAGAV
FT                   VADLEFYQFHPTALAVPGTPLISEAVRGEGAVLRDAAGRRFMLDVHPDAELAPRDVVAR
FT                   GIAAAMAAQGGDPVVLDATAQGSSTGGTERMTRRFPGITTTLAAHGYSWDDPIPVTPAA
FT                   HYWMGGIRTDLWGRTSLPGLFAVGEAACTGVHGANRLASNSLLEALVFGWRAAEALESP
FT                   HTPDVSARGWGAGRRAPDNAHDSLAPRNLSVARQGMGLPASDNSWGAGSRGLDRAALQA
FT                   LLWDRAGLVRDGAGLRDAHAVLSGLVVGSGSGRQTEPTTRPRTDDQTAAAASVRALEDR
FT                   NLVLLGRAVVAAALARTESRGGHARSDFPAADPAQAVSTTWRLPEHALVPAAVPTGVSA
FT                   "
FT   sig_peptide     complement(413857..413928)
FT                   /locus_tag="Xcel_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.831) with cleavage site probability 0.643 at
FT                   residue 24"
FT   gene            complement(413928..415193)
FT                   /locus_tag="Xcel_0350"
FT   CDS_pept        complement(413928..415193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0350"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /note="TIGRFAM: quinolinate synthetase complex, A subunit;
FT                   PFAM: Quinolinate synthetase A; KEGG: mca:MCA0376
FT                   quinolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29389"
FT                   /db_xref="GOA:D1BVB8"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023515"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVB8"
FT                   /inference="protein motif:TFAM:TIGR00550"
FT                   /protein_id="ACZ29389.1"
FT                   /translation="MTSVNLQIAGAPGATCDPDLAAGPWDFDTVPGYGPGASIADVAPP
FT                   SAPRQGTLPAQYREASEEELHARIVAARATLGSRVVVLGHFYQRDEIVQHADFLGDSFQ
FT                   LANAAQTVPDAETIVFCGVHFMAETADVLAKDDQAVILPNLAAGCSMADMADIDSVEEA
FT                   WAQLSALYGEEPDADGRVPVIPVTYMNSAADLKAFCGRHGGIVCTSSNAETVLEWAFER
FT                   GQRVLFFPDQHLGRNTAKKMGVPLEQMPLWNPRKPLGGSTEDELLAAKVLLWHGFCSVH
FT                   KRFTVDQITRARADHPGVRVIVHPECPAPVVDAADEAGSTDYIRKAVAAATEPTTFAIG
FT                   TEINMVNRLAAEYPQHTIFCLDPVVCPCSTMYRIHPGYLAWVLEELVAGRVVNQVRVPD
FT                   DVAADARVALERMLAAKPKVSA"
FT   gene            complement(415190..415957)
FT                   /locus_tag="Xcel_0351"
FT   CDS_pept        complement(415190..415957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0351"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: scl:sce2352
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29390"
FT                   /db_xref="GOA:D1BVB9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVB9"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACZ29390.1"
FT                   /translation="MSGIRLAVSTVIFALRPHPESGRPVLSIPLVRRTRDPFQGLWALP
FT                   GGWVDPAESLTASAGRTLVETTGVRPSYLEQLYTFGALDRSPGERVVSVVYWALVRPDQ
FT                   IGERPAPSKGPAFDAENVAWFVADALGSPGTPDDGAPRTGDAPRLAFDHHAIVTYALWR
FT                   LRTKVEYSAIAQGFLGSTFTLSELRQVHEAVLDRELDPANFRRQVEASGTIVATGEHVL
FT                   GGRHRPPRLYRFDTSAPLVDNGPLGELTPGEMS"
FT   gene            416098..417156
FT                   /locus_tag="Xcel_0352"
FT   CDS_pept        416098..417156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0352"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; homoserine
FT                   dehydrogenase NAD-binding; Oxidoreductase domain; KEGG:
FT                   xcv:XCV2116 GFO/IDH/MocA family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29391"
FT                   /db_xref="GOA:D1BVC0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVC0"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACZ29391.1"
FT                   /translation="MFADPSVFAPRLTGADLDGTVPDLLDAPAIRWGILGAGNIAGSFA
FT                   DGVRERTASSVVAVGSRSVEKAAGFASAHAPGARAHGSYEDLVADDDVDVVYVATPHSH
FT                   HLEHTLLAIAAGKNVLVEKPITRSAAEAERVLDAAREAGVFCMEAMWTRFLPHVAALRG
FT                   AIARGEIGQVMTVQAEFDVSFPYDPTHRLFAPELAGGALLDLGIYPIAFAHDLLGMPAA
FT                   ITARGTRAATGVDDHVSVILEWDGGQQAVLHTSSRASGPNTATIVGTQGYIELPSGFFT
FT                   PVPVTVTKGDGSRYTVESPQGEGKAYEAAEVARQVTAGATSSDRHTWKDTLEVMAILDE
FT                   IRRQLGVVYPGE"
FT   gene            complement(417210..417617)
FT                   /locus_tag="Xcel_0353"
FT   CDS_pept        complement(417210..417617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0353"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: mlo:mlr4723 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29392"
FT                   /db_xref="GOA:D1BVC1"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVC1"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ACZ29392.1"
FT                   /translation="MSLNVTELTEAESWEFLGLQEVGRLATAAASEPEIFPVNFATSGG
FT                   RIFVRTAPGSKLAEVAVNAKVAFEADQLGPEIAYSVIVKGVAEILEHDDDLVDAEHTGL
FT                   LTYQENEDSPKNVWLRITVQEISGRRFVRVG"
FT   gene            417768..418613
FT                   /locus_tag="Xcel_0354"
FT   CDS_pept        417768..418613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0354"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="KEGG: nar:Saro_1941 thymidylate kinase; TIGRFAM:
FT                   thymidylate kinase; PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29393"
FT                   /db_xref="GOA:D1BVC2"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVC2"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ACZ29393.1"
FT                   /translation="MTERGYFVSFEGGDGGGKTTQARLLGDWLGTALGREVVVTREPGG
FT                   TALGATLRQLILHGEDMDPRTEALLYAADRAHHVASLVRPALERGAVVITDRYLDSSVA
FT                   YQSGGRELSEQEVEDLSLWAVRGLLPDVTILLDVDLATSGARMSGDLDRLERVDDAFRQ
FT                   RTRDAYHRRAAADPARWVVVDAAGTVEEVHAQVRAAVAERLHLPALDPAETPAAPVVEP
FT                   VETTSSRVVEPAKSSRVVEPVETSPVVEPVETTSSRVVEPVETSPVVEPVETTPGDGLR
FT                   "
FT   gene            418610..419755
FT                   /locus_tag="Xcel_0355"
FT   CDS_pept        418610..419755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0355"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   KEGG: gsu:GSU2230 DNA polymerase III, delta prime subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29394"
FT                   /db_xref="GOA:D1BVC3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVC3"
FT                   /inference="protein motif:TFAM:TIGR00678"
FT                   /protein_id="ACZ29394.1"
FT                   /translation="MTVWDEVVGQEAAVEVLQRAVTDTRSMTHAWLLTGPPGSGRSVAA
FT                   RAFAAALQCQAGGCGECHQCTTTLAGTHPDLTVVATDQVTIRIEEVRGLIGTAARTPSL
FT                   GRFRVIVVEDADRMIERTTNVLLKAIEEPPPHTVWVLCAPSVQDVLPTIRSRCRAVPLR
FT                   VPPPESVAELVVRRDGADPHVALAAARAAQSHVGLARRLARDPEARRRRSAVLDVARRI
FT                   RGVGDAVLAAGELVDVAKAEAASSTTERDAAERAELLRALGATDGQTLPPRLRSQVKQL
FT                   EDDQKRRATRRQRDVLDRSMVDLLSLYRDVLVVQLGADVDLVNGLDDADLAVVRALAAD
FT                   STPEQTVRRMDAIGVARERLQGNVAPLLALEAMTIALRPQG"
FT   gene            419925..421496
FT                   /locus_tag="Xcel_0356"
FT   CDS_pept        419925..421496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0356"
FT                   /product="TAP domain protein"
FT                   /note="PFAM: TAP domain protein; alpha/beta hydrolase fold;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29395"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVC4"
FT                   /inference="protein motif:PFAM:PF08386"
FT                   /protein_id="ACZ29395.1"
FT                   /translation="MKFPAPLARTLGSAAIVVALAFSAGCTATDPGNGPTTSSPSSDAP
FT                   KPTTSTTPAATAGAPEGFEDLYAQAVEWEDCDGGFECATVEAPLSWQYPTAGTIDLAVK
FT                   RHPATGNKQGSLLVNPGGPGGSGVDYVTFAWSTFGEPLRDAFDVVGFDPRGVGASTPVR
FT                   CFDDARKDKSLAMDFDLDDDAGLAAMAAEHAAWGAACAESTGDLLGTVDTQSAARDMDL
FT                   LRAVLGDEALHYLGFSYGTQLGATYAGLFPERVGAMVLDGAIDVTLDADAVSAGQAAGF
FT                   ELALRNYVTDCQGGAGCPLTGDVENGLRTVRQVLDRALTDPYPTSSNRRVTRNLAFYGV
FT                   AVTLYDQGSWPALTQALEEVLTSGTGDTLLYLADFYNDRDPDGTFANNSAEAFRAVGCL
FT                   DSRGTTDVAEMRAQVAEIEKVAPTVGTFFGFSGLVCSDWPVPPVAQEFDLHAVGAPPIV
FT                   VIGTTNDPATPYAWAQALADTFDSGVLVTYDGEGHTAYARSNDCILDAVDDFLVDGVVP
FT                   ADGLRC"
FT   sig_peptide     419925..420011
FT                   /locus_tag="Xcel_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.968 at
FT                   residue 29"
FT   gene            complement(421561..421633)
FT                   /locus_tag="Xcel_R0011"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(421561..421633)
FT                   /locus_tag="Xcel_R0011"
FT                   /product="tRNA-Thr"
FT   gene            complement(421753..422061)
FT                   /locus_tag="Xcel_0357"
FT   CDS_pept        complement(421753..422061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29396"
FT                   /db_xref="GOA:D1BVC5"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVC5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29396.1"
FT                   /translation="MLQRIFYQGPVATTVESYRERIDFARTVATAASVLLVVMTVMFVW
FT                   SATTVFPLGDTHGLLATAIVAIKALAAVVIVGDVVFLVTSLRDWRRLSRELAAFRGR"
FT   gene            422237..422920
FT                   /locus_tag="Xcel_0358"
FT   CDS_pept        422237..422920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0358"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: cja:CJA_3582 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29397"
FT                   /db_xref="GOA:D1BVC6"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVC6"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ACZ29397.1"
FT                   /translation="MARIFRRRPATYVLGERVKDYPAYAPESQRGRVLRITEIGEPVLH
FT                   TPARPVTELGTPELARLIDDMFTTMDVAEGVGLAAPQVGVDLRVFVYDLTDDAGDRHVG
FT                   AVVNPELELDLDADPEVEDEGCLSVPGAYAPLERPGGATIRGVDQLGGPVQLEATGYLA
FT                   RCFIHEAQHLDGTLYWDHLTPEQQADALRQRDEKRAEVLAQRREIAIELEKRPAEYPEA
FT                   PAGGR"
FT   gene            complement(422924..423484)
FT                   /locus_tag="Xcel_0359"
FT   CDS_pept        complement(422924..423484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0359"
FT                   /product="hydrolase of the alpha/beta-hydrolase fold
FT                   family"
FT                   /note="KEGG: abo:ABO_1591 alpha/beta fold family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29398"
FT                   /db_xref="GOA:D1BVC7"
FT                   /db_xref="InterPro:IPR026555"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVC7"
FT                   /inference="protein motif:COG:COG3571"
FT                   /protein_id="ACZ29398.1"
FT                   /translation="MTIPAGLILTPGAGASCDHHTLVAVESAVSPLPVLRLDFPYRAAG
FT                   KRMPDRAPVAVAHVRDAAELWAAQLGAAPSDLVLGGRSYGGRMCSMAVADGLPAAGLVL
FT                   LSYPLHPPGRPEKLRVEHLPALDVPVLFVSGDRDPFGTPDELAAHAAAIPGPVTTVTLP
FT                   GAHDLRGRDDDVAAAVAAWLADR"
FT   gene            423540..424115
FT                   /locus_tag="Xcel_0360"
FT   CDS_pept        423540..424115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0360"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   bca:BCE_1946 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29399"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVC8"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ACZ29399.1"
FT                   /translation="MDVMGEDWWARDLSDQQFDGARFVDADLSEATATGATFTDCTFRG
FT                   VRFNASHWTDTAFTGCTFHRCTFFDARFERCKLVGSSFDDCTFDVLHVDGGNWSFVSLR
FT                   RAPLERVEIVGARFREADLVGVKAAHAVLRGCDFSGAELLDADLTGADLTGSDLSALDP
FT                   RHARLDGAIIDTTQAVALAESLGLVVHP"
FT   gene            complement(424143..425024)
FT                   /locus_tag="Xcel_0361"
FT   CDS_pept        complement(424143..425024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0361"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: aeh:Mlg_0315 UspA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29400"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVC9"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACZ29400.1"
FT                   /translation="MHGVVVGVSGSAESDAALDWALTEAASRHVPLTALLAWTGPRGVQ
FT                   PHEYQDLLERRREDLLALLDASVRRTGLTDVDVTASVAEGDAAESLVTVAQDVEMLVLG
FT                   RRRRGRFGRLVLGSVSSEVVERADVPVTVVRAPHTTDDDGPDDDGAADDEPRIVVGVDT
FT                   SGSSMLALQHAAEVAQRTGAVLEALFAWQITTLAPLPGSWGWAPPIDDYEAFAAERLDA
FT                   AIEAAGVTLPPEQLVRSVVHRSAASALIEASTEAERIVVGARGLGGFDRLLLGSVSRQV
FT                   LEYASCPVTVVR"
FT   gene            complement(425136..425702)
FT                   /locus_tag="Xcel_0362"
FT   CDS_pept        complement(425136..425702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29401"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVD0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29401.1"
FT                   /translation="MSRSWEELVARFARLSGLVAEVDDPLTWGLDLEEETVTGDERPDD
FT                   PTSQRFLRSYRTYDGEVIEVETLPSPCPEAMVDDVVRAAASGALAAPLHADLRSPDFAE
FT                   EFDDYRSAMRAVVEAVDQVPLEQATFVLGGTEVPCTRVVVRGVAAIYAPAGDRAVVVSG
FT                   SADLIRCVDVVMRPVRSLLQQSDDA"
FT   gene            425922..428480
FT                   /locus_tag="Xcel_0363"
FT   CDS_pept        425922..428480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0363"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: ATPase AAA-2 domain protein; AAA ATPase
FT                   central domain protein; UvrB/UvrC protein; ATPase
FT                   associated with various cellular activities AAA_5; Clp
FT                   domain protein; SMART: AAA ATPase; KEGG: bha:BH0103 class
FT                   III stress response-related ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29402"
FT                   /db_xref="GOA:D1BVD1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVD1"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ACZ29402.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVA
FT                   AKALESLGISLDGVRSQVTEIIGEGQQAPQGHIPFTPRAKKVLELSLREALQLGHNYIG
FT                   TEHILLGLIREGEGVAAQVLTKMGADLNKVRQQVIQLLSGYQGKEPVAAGGPAEGQPSG
FT                   SAVLDQFGRNLTQAAREGKLDPVIGRSKEIERVMQVLSRRTKNNPVLIGEPGVGKTAVV
FT                   EGLAQDIVRGDVPETLKDKQLYTLDLGALVAGSRYRGDFEERLKKVLKEIRTRGDIILF
FT                   IDEIHTLVGAGAAEGAIDAASILKPMLARGELQTIGATTLDEYRKYVEKDPALERRFQP
FT                   IQVAEPSLQHAIEILKGLRDRYEAHHRVSITDSALVTAATLADRYINDRFLPDKAIDLI
FT                   DEAGARLRIRRMTAPPELKVLDEEISEARREKESAIDEQDFEKAAGLRDKEKQLTAKRA
FT                   ERERAWKSGDLDTVATVDEELVAEVLAMSTGIPVVKLTEEESGRLLRMEEELHKRVVGQ
FT                   EAAIKALSQAIRRTRAGLKDPKRPGGSFIFAGPTGVGKTELAKALAEFLFGDEDALIQL
FT                   DMSEFSEKHTVSRLFGSPPGYVGYDEGGQLTEKVRRKPFSVVLFDEVEKAHADIFNSLL
FT                   QVLEDGRLTDSQGRVVDFKNTVIIMTTNLGTRDIAKGVQTGFQAGGDLVTSYERMKAKV
FT                   NEELKQHFRPEFLNRVDDVVVFPQLTQKEIVEIVDLEIAKLDKRLRDKDMAIELTDAAK
FT                   NLLAEKGYDPVLGARPLKRAIQREIEDTLSEKILFGDLKPGQIIVVDGEGEGILGEFTF
FT                   AGKPKPSGKEPVAVGAPSGTDVPRSGSSDLPPSGELQAGA"
FT   gene            complement(428535..429224)
FT                   /locus_tag="Xcel_0364"
FT   CDS_pept        complement(428535..429224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0364"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: bbt:BBta_0025 putative haloacid
FT                   dehalogenase- like hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29403"
FT                   /db_xref="GOA:D1BVD2"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVD2"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ACZ29403.1"
FT                   /translation="MTLVLLDLDGTLMDSAPGITRSAAHAFRVLGLPVPDDAALRSFVG
FT                   PPIGDSLRAHGVPADRVADGVAAYREVFRETGMWENAVFEGIPAQLALLREAGCTLAVA
FT                   TSKPEVFAVPIAERFGLAPLIDGVFGAPLDESGSKAGVIAKALAALGWSGEPALMVGDR
FT                   VYDVVGAREHGIDTLGVSWGYPTGDELVQAGAVQVIDDVADLAPTALTLLARPTVSPTA
FT                   HPSAPTP"
FT   gene            complement(429275..430276)
FT                   /locus_tag="Xcel_0365"
FT   CDS_pept        complement(429275..430276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0365"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   sus:Acid_7076 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29404"
FT                   /db_xref="GOA:D1BVD3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVD3"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACZ29404.1"
FT                   /translation="MTSRNPKSVLFIGGSGVISHASVARAVEQGHRVTLLNRGLSSQRP
FT                   LPDTVETLVADATDHDAVDAALAGRDFDVVAQFRAFHPDHVARDVARFTGRTGQYVFIS
FT                   SASAYQKPPARLPVTESTPLVNPFWQYSRDKIACEDLLVRELRDNGFPSTIVRPSHTYD
FT                   RTLIPTLGGWTDVARMRAGKPVVVHGDGTTQWTLTHTNDFAVGFVGLLGNPRAVGDTFQ
FT                   IMGTHAPTWNQIYTWLAAAAGVPEPELVHVASETIARVLPEDGPGLLGDKAHSMVFDCS
FT                   KLQALVPEFATTITYDEAAAEQIAWHDATASAQQVDAARDKAFDDLVDHARG"
FT   sig_peptide     complement(430196..430276)
FT                   /locus_tag="Xcel_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.934 at
FT                   residue 27"
FT   gene            complement(430317..431351)
FT                   /locus_tag="Xcel_0366"
FT   CDS_pept        complement(430317..431351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0366"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: rpi:Rpic_0879
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29405"
FT                   /db_xref="GOA:D1BVD4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVD4"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACZ29405.1"
FT                   /translation="MTSVTREPSPDRGATIAQIAHEIGVSVPTVSKVLNGRSDVAAETR
FT                   ARVEDALERHHYRRRKAAPPPAGAGLIDLVFHRIGSSWSMEIIRGVEDAAAAARMSVIL
FT                   SELGGVHRPPRAWLDATLLRPPRGVVMVASRLSPAQQRQLAHRSIPVVVIDTDGEPPPD
FT                   VPTVGSDNWNGGLIATRHLLALGHRRIAAVSGPADMLCSHARLDGFRTAHAEAGATVDD
FT                   DLILPGNFYVESGYRAGHELLTRRQRPTAIFAGSDMAALGVLRAAHELGLVVPRDVSVV
FT                   GYDDLSLAQWAHPALTTVRQPLAEMGSMATGMLVDLVEGRQPQTRRINLATELVVREST
FT                   AEPA"
FT   gene            431596..432594
FT                   /locus_tag="Xcel_0367"
FT   CDS_pept        431596..432594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0367"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: atc:AGR_L_3564 AlgM1,
FT                   putative multiple sugar transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29406"
FT                   /db_xref="GOA:D1BVD5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVD5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ29406.1"
FT                   /translation="MAHRSEVIDLAAAGAGGSVGAFDHREEQKLRFKNSWGHALRRDWR
FT                   LYTFVIVPVIFLLIFRYAPMVGNVIAFRRFRPGGNPLGDEWVGLYYFNMFLDNPLFWSV
FT                   FWNTVILGGLWMIIGFPLPIILALLLNEVRSRKLKRSVQTLTYLPHFLSIVIVAGIVLQ
FT                   LTSVNGSINQLLGTFGIEPIAIMQQPEYFRAVYIISEAWQTVGWGTILYLAALTTIDDQ
FT                   LYEAARIDGANRWRQTWHITLPGIRPTIVVLLILNIGTFMAVGFEKVLLLQNPLIYSTG
FT                   DVITTYLFRVGVQSSQYSYATAIGLFESVIGLALVLSANFISKKLVGSSLW"
FT   gene            432591..433520
FT                   /locus_tag="Xcel_0368"
FT   CDS_pept        432591..433520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0368"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH0481 ABC transporter
FT                   (permiase)"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29407"
FT                   /db_xref="GOA:D1BVD6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVD6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ29407.1"
FT                   /translation="MTELEDRPDIAAVRTSLTQIKDTPGTVVFRWFNYTFLTLLSLVTV
FT                   YPFVNIIAKSFSSDGAIAAGKVNIWPVGFNLTTFQAVVSDSMFWLNYRNTVVYTVVGTM
FT                   IAMAITTTFAYALSRQNLRGRGPLIGLAVFTMFFSGGLIPNYLLVTQWLGMRNTIWAIV
FT                   LPGALSVFNLLVMKAFFENFPAELEEAAALDGLSTYGIFFRVVLPLSKAVIATMILFYA
FT                   VSQWNSWFGAFLYLDDKRMFPVMMYLRNLIASVTGAQEVTGSVDDAVQIGANIQAVTML
FT                   LTVLPIICIYPFVQKYFVSGVMLGSVKG"
FT   gene            433586..435256
FT                   /locus_tag="Xcel_0369"
FT   CDS_pept        433586..435256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0369"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bha:BH0482 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29408"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVD7"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACZ29408.1"
FT                   /translation="MRKIRKSSAAVATVATLALALTACSSGGNEAPETEGTEAAGETEL
FT                   IGADQSVGAMENFAAGTAFKATEPLEFSLMYRDHPNYPVSDDWSIFANLEANQNVTFNR
FT                   TDIPLSDWDNKRSLLIGAGDFPDITTVFYPGQESQFVASQALLPVSDYIDYLPNFKQKV
FT                   EEWELQDELDTHRQDDGKYYILPGLRQSPDVQYSVCINDDLWSQAGITEDPATWDAFAE
FT                   DLAKVKEATDVTYPFSDRWNENPAPLGALQKIMGASFDTVAGWDYSPTVFNEAAGEFEL
FT                   TATTDGYKEMVTYLAGLVADGLLDPEITQVDDIAIQKFLNGESAAISCNTQVVQSDLRD
FT                   KAAELNTTINTHLIVLPAGPAGNVISGSRLAQGVVLNGDVAEKPYFKALLQFVDWLYFS
FT                   DEGIEFAVWGAEGETFEREGDKRVLNADINGFNQNLDATKKLQADFGYFNGVFMAGTGS
FT                   TDDLIQSTMTEEIAEWTSTVLANSELRPTNPASPMDEAQLEQLGLLEAQVKDAVNTATA
FT                   EFITGKRSLDDWDAFVAQINQLGGEQIVQNYNEAFQKNQ"
FT   sig_peptide     433586..433672
FT                   /locus_tag="Xcel_0369"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.425 at
FT                   residue 29"
FT   gene            435398..436927
FT                   /locus_tag="Xcel_0370"
FT   CDS_pept        435398..436927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0370"
FT                   /product="Xylan 1,4-beta-xylosidase"
FT                   /EC_number="3.2.1.37"
FT                   /note="PFAM: glycoside hydrolase family 39; KEGG:
FT                   bha:BH1068 beta-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29409"
FT                   /db_xref="GOA:D1BVD8"
FT                   /db_xref="InterPro:IPR000514"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVD8"
FT                   /inference="protein motif:PRIAM:3.2.1.37"
FT                   /protein_id="ACZ29409.1"
FT                   /translation="MSTVVVPQTPIATQSDAWRKVVGTCHMVMGLRKDYLDSLRVVQAE
FT                   IGFEHIRGHGIFHDWMGVLRRYDVAGHAGTRYVWTYLDQIVDAYLEVGIKPFLELGFMP
FT                   EALASGPETVFWWKGNITPPADYREWNALVAATLRHLIARYGRDEVLSWPVEVWNEPSL
FT                   PEFWKDASKAEYFRLYEETAKTVKDVDAGFQVGGPATSPQADDWYVPFAEHTDATDTPV
FT                   DFFSFHAYATGPAQHVPFGVYQTMHGAGSLLEQFARPRTILGGHRLASVPHHVTEFNTS
FT                   YRPDNPVHDTAYNAAYLAPTLVGGGDLVDSFSYWTFSDMFEEQGVPAAIFHGGFGLLTH
FT                   RQIKKPTYHLYAFMARLGTQVLARGDDHLVTRHDDGRITVLAWQPVGGTDDPTEPDTHT
FT                   LRLSIPLARPDGTTPATAYVHRRRVNNHDGNAFTAWQQLGRPASPTTRQLDRLYEAAEP
FT                   TVTHHATDVAPGIGRIDLPLTLAHHEITLIEIDPVTDETPTWTDDTRILGR"
FT   gene            complement(437140..439179)
FT                   /locus_tag="Xcel_0371"
FT   CDS_pept        complement(437140..439179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0371"
FT                   /product="Alpha-glucuronidase"
FT                   /EC_number="3.2.1.139"
FT                   /note="PFAM: Glycosyl hydrolase 67 middle domain protein;
FT                   glycosyl hydrolase 67 C-teriminal domain protein; KEGG:
FT                   bha:BH1061 alpha-glucuronidase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29410"
FT                   /db_xref="GOA:D1BVD9"
FT                   /db_xref="InterPro:IPR011099"
FT                   /db_xref="InterPro:IPR011100"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037054"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVD9"
FT                   /inference="protein motif:PRIAM:3.2.1.139"
FT                   /protein_id="ACZ29410.1"
FT                   /translation="MTTAQVDPAVHPAAHPAWLPEAAFAPLGSRRIAVEIAEREWSRLE
FT                   AEVAATVRAEVEAAVATHGGAVVTPDDAPDLVLAVIAHNDRDAEAFTVARTNGVTRVTA
FT                   ATPRGLLYGLFHVVRLGEAAFEHGDLDVERHAPATSLRMLDHWDNIVVHPAMGQVERGY
FT                   SGGSIFYDDGVVREDLSRVAQYARLLAASGINRVAINNVNVGPLETRLIDDLLPDVVRI
FT                   ADVFRPYGITTHVSVSWASPVRLRGLPTSDPFSPEVRQWWAGAADRVWAAIPDFGGFVI
FT                   KADSEGQPGPFAYGRTHADGANMLAAAVAPHGGLIHWRAFVYNHEQDWRDRKTDRAKAA
FT                   FQHFAPYDGTFADNVIVQIKHGPLDFQVREATSPAIAAMPNTRVAAEFQVTTEYLGHQK
FT                   HAVYLGRQWSELLSFPYWGEGSATMADIAVGRGPGGHAGGFAAVSNVGDDVFWTGHPFS
FT                   QANLYAWGRLTWDPTADPIAILDEWTGLTFPGAPAEVRSTIHTILDESWETYEMYTAPL
FT                   GVCFMVYPHTHYGPSPDGYEYTPWGTYHFADRDGVGVDRTVATGTGYTAQYPEPWSSVY
FT                   ESVETCPDELVLFFHHVPYTHVLHSGKTVIQHVYDTHFDGLERVRSSIAAWEAAAGEFP
FT                   ADLAARVTDRFAEQLRSTTDWRDIINTYFLRKSGIPDAQGRTIY"
FT   gene            439343..440320
FT                   /locus_tag="Xcel_0372"
FT   CDS_pept        439343..440320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0372"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: vei:Veis_1391 periplasmic
FT                   binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29411"
FT                   /db_xref="GOA:D1BVE0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVE0"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACZ29411.1"
FT                   /translation="MVTVRDVARAAGVSISTVSRALSAPEMVAAPTRDRVAAIAAELGY
FT                   QPNRAAAGLRAGRTGALGLLVPDLANPYFAAVAKGVAERAREHGLGVFVVDSDEDPAVE
FT                   VEVLRSLAHQTDGVILASPRAVEADREAVGAKPVVVVNQDGPLAVVTDVAAGVRLALEH
FT                   LRGLGHRRIAYVGGPATSWSDARRRAALGDADVVALGPHHPTVAGGAAAADAVVASGAT
FT                   AAITFNDVVAVGLVRAVRERGLRVPEDLSVVGCDDTFLAALVTPALTSIGTDLREVGRS
FT                   ATELLVGRLTAAPGSGPDDAAPATITLPGTLTVRDSTTTAPPTP"
FT   gene            complement(440330..441541)
FT                   /locus_tag="Xcel_0373"
FT   CDS_pept        complement(440330..441541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0373"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   pca:Pcar_1523 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29412"
FT                   /db_xref="GOA:D1BVE1"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVE1"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACZ29412.1"
FT                   /translation="MSLNSSPRGLRVLSVYEGFFSGGARQLHSTVVAGLHAGGRQRHAA
FT                   LSIHAEIRRENTLQRMVDDQRFRMLRSAGVHVSTVGRRPDDGLDPRVFLPAELERAAAE
FT                   VRGAHVVMSLKEQPLRLTNALDVARPVVACLHRSDPEHQGSALGDLLLAARTGRLAAVV
FT                   CCAESTRDAYRAAGVPDSLLHVVPNGIDLTRFRPVRVPRRRALRGALGLPGDATVVVFA
FT                   ARFDAMKNPALFIAAARQFLERDPAGHVVLCGAGMSEANPDLMVELGLAFGDRPDLLDR
FT                   VHALGVRPDMEQLYAVADVVALTSVFGEASPLCLMEGAMCGAIPVTTPVGDSARTVDGI
FT                   GFVTGFDAAEIAETWIEAAARRDELAGALTAARPRFSHVRMLAGYAQVLESAERGAGAR
FT                   FAVA"
FT   gene            complement(441608..442273)
FT                   /locus_tag="Xcel_0374"
FT   CDS_pept        complement(441608..442273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0374"
FT                   /product="Uridine kinase-like protein"
FT                   /note="KEGG: phosphoribulokinase/uridine kinase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29413"
FT                   /db_xref="GOA:D1BVE2"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVE2"
FT                   /inference="protein motif:COG:COG0572"
FT                   /protein_id="ACZ29413.1"
FT                   /translation="MAGVSTAPPSDDRSVPAAHPRPRVGVVLLTGPSGSGKTALTRRLG
FT                   LPVVRLDDFYLDGDHPDLPHRFGIVDWDDPRSWDGKGALAALCTLAADGRAEVPVYDIP
FT                   SNARTGMGLVDAAGSTVVIAEGIFAAQLVGACRDAGILADAICLRRPAIVTFWFRLLRD
FT                   VAEARKPVGTLLRRGWALLRSEPAMIRNWVALGCRATSVGEAEDAIRALAGQDSPAAS"
FT   gene            442371..443075
FT                   /locus_tag="Xcel_0375"
FT   CDS_pept        442371..443075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0375"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG: scl:sce0751
FT                   GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29414"
FT                   /db_xref="GOA:D1BVE3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVE3"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACZ29414.1"
FT                   /translation="MRTHERVLAQIEENLRTGAWALGERLPGERALAEQMGVSRPSVRE
FT                   AVRVLEAMGIVRTAVGSGPDAGATVVDRPAAGLGAAVRLHIASGTLPVRDVVATRAALE
FT                   TWAVGQAAARFDPDTDLTEAQRLLEEMTDPDLTAAEFVQLDQQFHLTLVQLGGNQLVEA
FT                   ILGGLRTAVGHYVTAGVERIEAWDVVSNRLCAEHRALFAAIVGRDTGAAEKLAHDHIWG
FT                   FYEETGLASENA"
FT   gene            443122..445383
FT                   /locus_tag="Xcel_0376"
FT   CDS_pept        443122..445383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0376"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein;
FT                   Berberine/berberine domain protein; Luciferase-like
FT                   monooxygenase; KEGG: pol:Bpro_1407 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29415"
FT                   /db_xref="GOA:D1BVE4"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVE4"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ACZ29415.1"
FT                   /translation="MTDYGHDLAFGSFITPTHQDPQQPVRLARLSEDVGLDLVTFQDHP
FT                   YQPAFHDTWTLLTWVAAATERVTVSGNVLNLPLRPPAVLARAVASLDLLSGGRAALGIG
FT                   AGGFWDPIVAMGGTRLSPGESVDALGEALDVIRELWDTTDRRAVRVEGEHHRVVGAKRG
FT                   PAPAHDVPIWVGAYKPRMLRLVAEKADGWLPSAPYLKDGDLARGNAVIDEAAVAAGRDP
FT                   AEIRRLLNLGAPGGSTEQWIDELVRLAVEDGIGTFIAMGDDPDVIRRFGSEVAPAVREA
FT                   VAAERASRGTVPAASRRGAAAVALRREGIAYDDVPRSLQARAVEPGDKAYAGLRHNYLR
FT                   SGAPGLVLRPRDAEEVADAITFARTQVGASHGGVELGVRSGGHGISGRSTNDGGIVVDL
FT                   GALDGIEVLDEATRRVRVGAGATWGEVAAALQPHGWAITSGDYGGVGVGGLATTAGIGL
FT                   LGRSQGLTIDHVVAADVVTADGRLVRASADENPELFWGLRGAGANLGAVTSFELEAGAL
FT                   GDVVYSQMTLDAADTAGLLERWGAVVESAPRELTSFLILSPPRRGQQPVAQLMTVWAGE
FT                   DTDAAITQLEALADSGPLLAHQAYLLPYTGVVQPAERHHAGGGDPAVRSTLVTHLTDDV
FT                   TRAFEKVAWSGEAYFLQVRATGGAAHDVAPDATAYAHRHQNFLLTAMGASQPWLDPLWD
FT                   ELMGPHADGLYLSFDTDTRAERLADAFPGRTLDRLRALKAQWDPSCVFRSNFPIPPLGA
FT                   "
FT   gene            445437..446498
FT                   /locus_tag="Xcel_0377"
FT   CDS_pept        445437..446498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0377"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: xac:XAC3199
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29416"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVE5"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACZ29416.1"
FT                   /translation="MPIAPRYLAAEDRYATMTYRRTGRSGLDLPALSLGLWHNFGDTTP
FT                   FQTQRDVARRAFDLGITHFDLANNYGPPYGSAEENFGRILEKDLHPYRDELIVSTKAGY
FT                   DMLPGPYGDHGSRKYLLSSLDASLERMGLDYVDIFYHHRPDPSTPLEETMGALAAAVHS
FT                   GKALYVGVSNYSAARTREAAQILDDLGAPLLIHQPSYSMFNRHVENASLVDGYDGQQSE
FT                   SLLDVVEDLGVGTIVFSPLQQGLLTGRYLSGSAPAGSRAARPDSPFLSASNLSETYLER
FT                   AHALNEIAQGRDQSLAQLAVSWVLRDNRVTSALVGASSVAQLEDTVGALAAAPLTDEEL
FT                   AAIDPYAVDGTAR"
FT   gene            446583..447488
FT                   /locus_tag="Xcel_0378"
FT   CDS_pept        446583..447488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0378"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: bvi:Bcep1808_1562
FT                   ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29417"
FT                   /db_xref="GOA:D1BVE6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVE6"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACZ29417.1"
FT                   /translation="MAVCWFAGLTTLDVVHRAPAPPTRNGKVTATRQDVAAGGPAANAA
FT                   VTAAALGVRAILVTALGQGPVAAAARADLEAHGVEILDTAAPDFPLAVSAVLVDERTGE
FT                   RSVVSADGALATAPPPATESLHALPHPDAVLLDGHHPQIARAVLTFVQAANPRPHLLLD
FT                   AGRWRPIFAELLPHADIAALSDDFRVPDAPDTGAGVSDTAAAVLATGASAVVVTHGPAP
FT                   VEWHTADGGSGTVPVPATDARDTLGAGDAFHGALTAAVATGEALPGAIIRASAVASTRV
FT                   AVVGPRAWLTRLGPTRLVVE"
FT   gene            447629..448162
FT                   /locus_tag="Xcel_0379"
FT   CDS_pept        447629..448162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0379"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: scl:sce6005 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29418"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVE7"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ACZ29418.1"
FT                   /translation="MALLALLDEGPTHGFDLKRRYDALLGQERELKYGQVYSTLARLER
FT                   DGLADGVGVEAGSGADRKLYAITAHGITELDHWLATPAPATGRPAEVFTRVVLALVSGR
FT                   SADQVLDAHRRAYLDRMRELTARRHDGDVVDRLAGDYEIAHLEADLRWIELASARLTTI
FT                   AAQVRAAGAKGSPA"
FT   gene            448159..448890
FT                   /locus_tag="Xcel_0380"
FT   CDS_pept        448159..448890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0380"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: aeh:Mlg_1439 lipoprotein releasing system,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29419"
FT                   /db_xref="GOA:D1BVE8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVE8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ29419.1"
FT                   /translation="MSEIVLEGRRLTHSYGNTPVLGDVDVAVRAGEVVAVMGPSGSGKS
FT                   TLLHLLAGLLKPDAGEVWLAGQRFDSLSERRRSDRRLRELGFVFQFGDLVPELTVGENV
FT                   ELPLRLLGTRPARARARAHEMLDRLGVVEHAGKRLSEVSGGQAQRAAVARALVHTPPVI
FT                   LADEPTGSLDTTTGELVLEAFVQAAKDQGTAVVLVTHELRVASWAARDVLLRDGRIVGA
FT                   TGATSGPPATSGPLAAAGAPA"
FT   gene            448887..450803
FT                   /locus_tag="Xcel_0381"
FT   CDS_pept        448887..450803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0381"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A2047 ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29420"
FT                   /db_xref="GOA:D1BVE9"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVE9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29420.1"
FT                   /translation="MTALLALGLRLARAGGPLRAWSIALGNAVGVVLLLVATAVPVAMY
FT                   PRLEDRLLNLPGILAIVIFLLVPGAVLLVMVGRLSSGLRDRRLAALRVIGLSPLRTRVV
FT                   AAVENGVLALAGAIVGAALYAVAAPVSGTALVGAGAVAQPLAVTPVALVATVAVVALVS
FT                   AGAATSSTWNSTMPGQTRSEARPTTPRPWRLAVLVAGLAPLAWLGSVDASVKDPGLVTA
FT                   LLLGGTAVTGVGIALVTPLGASWASRLLVRSDGVTTRLAGRAIQTDSASAGRVVAGFGV
FT                   AVFLSTGALGVLGAFETTPQYVDAIRSYGPGPQKVFVGTMDGEAPIPEEDVAALLALPG
FT                   VHGIAPAWVDASYLECGTDMPCGSVLVGTCAQLELAFAMTGCDDSRASIITPVGEAVGN
FT                   SLFSAPGPGPGLVVGDPLTLFDNDGNAVQTLTLDGAAVIEDWPRQLREWVWPSNALAFV
FT                   PVAMLDDWYGGPVSVKAVADGGAAVSARIEDWAAERGLAAYQPADHDYRQVQGMRAAVW
FT                   GLCGIAVAVALIVFALGGVDRAQERRRSVARQAVVGVPGRVLLGSQLLQAVIPVLVAFA
FT                   LALGAGVVGVWGYSSIAGSTFLLTGTAWTGLILIAGLGGLLAALSTVPLARTRLTPELL
FT                   RRE"
FT   gene            450851..451588
FT                   /locus_tag="Xcel_0382"
FT   CDS_pept        450851..451588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29421"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVF0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29421.1"
FT                   /translation="MWRRFGQMDGGGLYRQGGVMSERPSIVVLSGRGRHEDPWHDHAAT
FT                   SHALANVLAPVGDVVVRSTLPGVFDLDGVGLLVLNLGRPVPGYVEAQIDGPPEGWERQV
FT                   DGLVGWARDGGSVLAVHQTALAVPGSDAFGEVLGGRWVEGVSGHPEIGAMRLTLASGTH
FT                   PVTDRLGGVDAFDERYCGLRVAPTSQVLGWVHDDDGEPHPALWTTQAHGGRTVYSALGH
FT                   DARSYESPSHQELLVRAVRWLVA"
FT   gene            complement(451585..452091)
FT                   /locus_tag="Xcel_0383"
FT   CDS_pept        complement(451585..452091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0383"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   tbd:Tbd_2407 RNA methyltransferase CspR"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29422"
FT                   /db_xref="GOA:D1BVF1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVF1"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ACZ29422.1"
FT                   /translation="MNPHLEAPAAPDEPFAHVVYFEPRIAGNTGSAIRLAAVTGARLHL
FT                   VEPLGFDLEESKLRRAGLDYHDLAVLTVHPSFDAAMDALPGRRVFAFEVGATTSYTSVA
FT                   YQPGDVLLFGPEPTGLPPSVLDHPRITERVVLPMLPGRRSLNLTNAASIATYEAWRQLG
FT                   FPGAP"
FT   gene            complement(452088..453050)
FT                   /locus_tag="Xcel_0384"
FT   CDS_pept        complement(452088..453050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0384"
FT                   /product="protein of unknown function DUF808"
FT                   /note="PFAM: protein of unknown function DUF808; KEGG:
FT                   csa:Csal_0752 protein of unknown function DUF808"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29423"
FT                   /db_xref="GOA:D1BVF2"
FT                   /db_xref="InterPro:IPR008526"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVF2"
FT                   /inference="protein motif:PFAM:PF05661"
FT                   /protein_id="ACZ29423.1"
FT                   /translation="MSAGLLGLLDDVAAIAKAAAASLDDVTAAAGKATAKAAGVVIDDT
FT                   AVTPQYVTGVTPDRELPIVKKIALGSIRNKLLIILPVALLLSWVAPWALAPILMLGGLY
FT                   LAYEGAEKIWEKIRGHEAAHDAPGAVDPSTPVAVQGAAAEKTLIGGAVRTDLILSAEIM
FT                   VISLNEVAHEGFWQRLAILVVVALIITVGVYGVVGLIVKMDDIGLALAKRRSRGLQRFG
FT                   NALVVGMPKVLGVIATVGTIAMLWVGGHILLNGAHELGWTAPFDWMHGIEHSIQDAVAG
FT                   VGGILSWLFDTLISAIVGLAVGALAVAALHALPFGRKHA"
FT   gene            complement(453090..453353)
FT                   /locus_tag="Xcel_0385"
FT   CDS_pept        complement(453090..453353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0385"
FT                   /product="Transglycosylase-associated protein"
FT                   /note="PFAM: Transglycosylase-associated protein; KEGG:
FT                   yen:YE2879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29424"
FT                   /db_xref="GOA:D1BVF3"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVF3"
FT                   /inference="protein motif:PFAM:PF04226"
FT                   /protein_id="ACZ29424.1"
FT                   /translation="MWLLSWIIVGLVMGAIARAVLPGRANGGWLVSLLVGVVGAIVGGF
FT                   IGRAFGADPNQSFWSFSTWFWAFVGSLVVLFVWGLLTGRKRT"
FT   sig_peptide     complement(453294..453353)
FT                   /locus_tag="Xcel_0385"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.827) with cleavage site probability 0.456 at
FT                   residue 20"
FT   gene            complement(453437..455296)
FT                   /locus_tag="Xcel_0386"
FT   CDS_pept        complement(453437..455296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0386"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (GTP); KEGG:
FT                   pzu:PHZ_c2232 phosphoenolpyruvate carboxykinase (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29425"
FT                   /db_xref="GOA:D1BVF4"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVF4"
FT                   /inference="protein motif:PRIAM:4.1.1.32"
FT                   /protein_id="ACZ29425.1"
FT                   /translation="MSTTIDHPATTTARAVVVPADGSVAAWVAEVAALTQPDAVVWCDG
FT                   SATEKQRLLDEMVESGTLIKLAKRENSYLARSHPSDVARVESRTFICAEREEDAGPTNN
FT                   WRDPAFMGDELRAVFTGSMRGRTMYVVPFSMGPLGGPISQVGVEITDSPYVVVSMHVMT
FT                   RVSREVLDLIDAGQQWVPAVHSVGAPLAPDDVDVPWPCNDTKYIVQFPESREIWSYGSG
FT                   YGGNALLGKKCFALRIASVMGRDEGWLAEHMLLVRVTAPTGRRYHLAAAFPSACGKTNL
FT                   AMLQPTIPGWSVETLGDDIAWMRPDDDGALRAINPEAGFFGVAPGTGVETNPTAIATLT
FT                   HDVIFTNVALTDDGDVWWEGLTPEAPEHLIDWTGADWTPDSGRPAAHPNSRFTVAAAQC
FT                   PSIAPDWDDPAGVPVDAIVFGGRRATNVPLVTQAFDWDHGVFLGATISSERTAAAEGTV
FT                   GELRRDPFAMMPFCGYAMPDHWAHWLAVGDRLNPARQPAIFQVNWFRKGSDGRFLWPGF
FT                   GENSRVIAWMVDQLDAARGQRPGDDSATSSPVGLLPAPGALDVDGLDLPAADLAELFDV
FT                   DPAAWLQEAALTEAFFRGFDGRVPARLTEQLRGLHARLSRALP"
FT   gene            455432..456892
FT                   /locus_tag="Xcel_0387"
FT   CDS_pept        455432..456892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0387"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: acr:Acry_1500
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29426"
FT                   /db_xref="GOA:D1BVF5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVF5"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACZ29426.1"
FT                   /translation="MPDGPDLLTLGRRVRHLRTRRGLTLDALGAAVGCTPSLLSLIENG
FT                   KREPRLSLLRALAEALRVEVGDLLAAEPPDRRAALEIDLERAQRGPLFGELGLPQVKPS
FT                   QKLPMPVLEQLVGLHAELARREEEAIATPEEARRANTELRLGRQARDNYFPEIEDLAED
FT                   LVTRSGYPGGGAVSHRTVARLAESLGFELLHVADLPRSARTVTDLKNGRIYVPQASTPG
FT                   GHGLRSLALQAIAHRVLGHERPRSYGEFLRQRVEITYFAAASLMPRTASVDFLAARKRE
FT                   KDLAVEDFRDAFGVTHEAAAMRLTNLATVHLAIPLHFLRVGDDGALFRGYANDGMPLPQ
FT                   DVTGAIEGQLVCRKWAARAVFERRDRATEYYQYTDTPAGTFWDSVQMGTRGPDDAGAFS
FT                   ITVGVPYAHAKWFRGRDTQLRRSSTCPDPACCQRPPADLADRWAGAAWPSARMHQQILA
FT                   ALPRGRFPGVEDAELFAFLDRHAPQDAG"
FT   gene            complement(456958..457470)
FT                   /locus_tag="Xcel_0388"
FT   CDS_pept        complement(456958..457470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0388"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mucin-associated surface protein (MASP)"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29427"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVF6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29427.1"
FT                   /translation="MRRTVAGTALVLALALSGCTSPGSTAEPGGAPAAEAAEVAEVAGE
FT                   GKLDIAAAAERFVAITEPYEKVMAQYHEAETDDAPLETQVGLAGATASALRARVEGLRG
FT                   TTWPDEVAADLAKLAVADEKAAAEWEAAGTAASVEEAYDAAGRAMAFNTLPEVDAVRTA
FT                   LGIPAGE"
FT   sig_peptide     complement(457390..457470)
FT                   /locus_tag="Xcel_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.936 at
FT                   residue 27"
FT   gene            complement(457603..459117)
FT                   /locus_tag="Xcel_0389"
FT   CDS_pept        complement(457603..459117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0389"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: acr:Acry_2384 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29428"
FT                   /db_xref="GOA:D1BVF7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVF7"
FT                   /inference="protein motif:TFAM:TIGR01311"
FT                   /protein_id="ACZ29428.1"
FT                   /translation="MPDYVLAIDQGTTSSRAMIFDHGGQVVSTGQLEHDQIFPRAGWVE
FT                   HNPDQIWNNVREAVGIALSRANVTYTDIAAVGITNQRETAVVWDKTTGKPVYNAIVWQD
FT                   TRTQAIVDELGGDVGADKYKAIVGLPLATYFSGPKVKWILDNVEGAREAADRGDLLFGN
FT                   TDSWVLWNMTGGVDGGVHYTDVTNASRTMLMDLDTLSWREDIASDMGIPLSMLPEIHSS
FT                   SEVYGKGRQGGLLPGVPIAGILGDQQAATFGQACFEVGTAKNTYGTGNFMLLNTGTEKV
FT                   PSKNGLLTTVCYKIGDAPQRYALEGSIAVTGSLVQWLRDNLGLFSDAPDVEWLARKVED
FT                   NGGAYFVPAFSGLFAPYWRPDARGALVGLTRYVNKNHIARAALESVAYQTREVLEAMRA
FT                   DSGVELTELKVDGGMVADELLMQFQADQLGVDVVRPKVAETTALGAAYAAGIAVGYWSG
FT                   ESDVTDNWAEDRRWTPSMDQDERERLYRQWKKAVTKTFDWVDVDTQ"
FT   gene            complement(459160..459894)
FT                   /locus_tag="Xcel_0390"
FT   CDS_pept        complement(459160..459894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0390"
FT                   /product="major intrinsic protein"
FT                   /note="PFAM: major intrinsic protein; KEGG: azc:AZC_2711
FT                   glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29429"
FT                   /db_xref="GOA:D1BVF8"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVF8"
FT                   /inference="protein motif:PFAM:PF00230"
FT                   /protein_id="ACZ29429.1"
FT                   /translation="MLLDAFWSEVIGTATLILLGAGVVANVILPKNKGFGPNWLLINFG
FT                   WGFAVFAGVYAAFSSGAHINPAVTVGLWVADLPFYAGDAGEIAPNLSNALVYFGAQFLG
FT                   AFIGAVLAFLAYKKHFDEDADSATKLAVFSTGPAIRSYGWNLVTEILATFVLVFFVVVN
FT                   GRTPSQLGPLAVALIVVGIGASLGGPTGYAINPARDLGPRIAHFVLPIKGKGSSDWGYS
FT                   WVPVVGPIIGAILAGLLGAALT"
FT   gene            complement(459906..461654)
FT                   /locus_tag="Xcel_0391"
FT   CDS_pept        complement(459906..461654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0391"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   vei:Veis_2018 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29430"
FT                   /db_xref="GOA:D1BVF9"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVF9"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACZ29430.1"
FT                   /translation="MATNRLTAESREQALAALEGSTSPTAELDVLVVGGGVTGAGIALD
FT                   AVTRGLSTAIVEAQDWASGTSSRSSKLVHGGLRYLQMLDFHLVHEALTERDLLLKELAP
FT                   HLVRPVPFLYPLEHRIWERAYVGTGIALYDTLASLAPGKRAMPLHRHLTRSQMAKKFPD
FT                   LAHDAAIGAVQYWDASVDDARLVTTLVRTAAGYGAHAASRAQVAALTQSATGAVNGAVV
FT                   VDLETGKRITVRARSVINATGVWTEQTEALAGSEGGLHVLASKGIHIVVPRERIRGKVG
FT                   LILQTEKSVLFIIPWSRYWVIGTTDTPWVEDLRDPVASATDIDYVLEHANAVLAHPLTR
FT                   DDVIGTFAGLRPLLQPGTKEGTSSAKVSREHTVATPTPGLSVIAGGKLTTYRVMAKDAV
FT                   DHAIGQRAAGLPSITHRIPLVGAVGLQAVARLARSWAKRYGWSPSIVDHLLHRYGSDLT
FT                   ELVELCETDPGLARPLEHASAYLRAEIHFAVTHEGALHLEDVLLHRTRLVYEVPDAGLA
FT                   ALPEIVDVVAPLLGWDDATKEAETAAYRARIEAYDTAATLPDDATAQAARLHVGDVAGM
FT                   VPLESD"
FT   gene            461763..462278
FT                   /locus_tag="Xcel_0392"
FT   CDS_pept        461763..462278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0392"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   dds:Ddes_1675 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29431"
FT                   /db_xref="GOA:D1BVG0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVG0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACZ29431.1"
FT                   /translation="MHVTIRPALPADVRTVRTLVDPYAQRRILLAKELVGYFEAVQEFM
FT                   VAEVPAGSSGSREVVGCGALHVMWDDLAEIRTLAVAPEHLGTGVGHALVSALVDRAAAM
FT                   GLSRLFCLTFEVDFFRRHGFEVIEGTPVSTDVYAELLRSHDDGVAEFLDLARVKPNTLG
FT                   NTRMLLTL"
FT   gene            462399..462548
FT                   /locus_tag="Xcel_0393"
FT   CDS_pept        462399..462548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29432"
FT                   /db_xref="GOA:D1BVG1"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVG1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29432.1"
FT                   /translation="MFTVMAAAADVMMAAQAGSLSSTLTVVGLVAVLVGIASLQAVSMW
FT                   RTQN"
FT   sig_peptide     462399..462452
FT                   /locus_tag="Xcel_0393"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.605) with cleavage site probability 0.481 at
FT                   residue 18"
FT   gene            complement(462732..464477)
FT                   /locus_tag="Xcel_0394"
FT   CDS_pept        complement(462732..464477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0394"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: HhH-GPD family protein; helix-hairpin-helix
FT                   motif; SMART: HhH-GPD family protein; iron-sulfur cluster
FT                   loop; KEGG: nar:Saro_0960 A/G-specific DNA-adenine
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29433"
FT                   /db_xref="GOA:D1BVG2"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVG2"
FT                   /inference="protein motif:PFAM:PF00730"
FT                   /protein_id="ACZ29433.1"
FT                   /translation="MVRLEAERDAVRVDAARAVVLPDAGRPVVRVPADRASVDGDAFFD
FT                   EAVFDAVFDGAAFDVFAFDGVAPLDDEPFAGVAVLARGVAAPGACSRFTETTRWSLFAL
FT                   RARPVAGPDFFAVVPDCRDDDCPAADFPEAGFPDADFADDCRDADCRADASPRPWADCP
FT                   RRPDRAGAERCAGAERDVLEPRGSPELRDVLEPRDDAPPPERAVCPERCPVPLERCPVP
FT                   RAPEPRAALPPAERSRSAGVTEPPVGRGVGHKVRRRRRRTGEPRRRTSHRAASHGYGVP
FT                   VPAPDQPPEHPSRALVERVVRWFDGARRDLPWRAADRTPWGVLVSEVMLQQTPVVRVEP
FT                   AWRAWMERWPTPSDLAAASTADVLRAWDRLGYPRRALRLQECARVLVERHDGAVPDDEA
FT                   ALRALPGVGEYTAAAVRAFAFGRRAVVVDTNVRRVLARAVGGVALPAPSPTAAERATAT
FT                   AVVPHDDDAAAAWAAASMELGALVCTARSPRCAECPVRDLCAWRAAGCPGDAHAHRRKT
FT                   QAWHGTDRQCRGRIMAALRAADAVQGRDALGAASPDETQVDRCLVGLLADGLVVRTPEG
FT                   YRLPD"
FT   gene            464572..465276
FT                   /locus_tag="Xcel_0395"
FT   CDS_pept        464572..465276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0395"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ZNF219; zinc finger protein 219"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29434"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVG3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29434.1"
FT                   /translation="MPVIVLGLLVGLGWTAGYGIGQGVAWVRDVWPDPVPRLVADKVAA
FT                   PEPADVGGPIQACPASSLTLAAIPDAMHVQPGQTISFDVSITNSGRRPCLVNAGDASRQ
FT                   LVVTDAEGVTVWTTAHCGTGARDLLLGPGDVRQSTLRWSGRASVEGACTTGQDAVPPGT
FT                   YTAQLVMADVLGAKSTPATITIEAPPPPPEPTPDPTTEPPAPTPDNEPTAEAEPTDDQT
FT                   AGNEPADDDPAG"
FT   gene            complement(465459..466544)
FT                   /locus_tag="Xcel_0396"
FT   CDS_pept        complement(465459..466544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0396"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; helix-
FT                   hairpin-helix motif; KEGG: bsu:BSU00880 DNA integrity
FT                   scanning protein DisA"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29435"
FT                   /db_xref="GOA:D1BVG4"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVG4"
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /protein_id="ACZ29435.1"
FT                   /translation="MVSTPAHRDELVRETLAAVAPGTELRDGLERILRGRTGALIVLGL
FT                   DKTVEEMCSGGFVLDVAFSATRLRELSKMDGAVVLDRDATRIRRAAVQLLPDPTIETSE
FT                   SGTRHRTAERVAKQCGFPVISVSQSMRIVALYVSDSRHVLEDSDTIMGRANQALATLER
FT                   YRARLDEVSGTLSALEIEDLVTVRDVCAVVQRLEMVRRISEEIDGYVIELGVDGRLLAL
FT                   QLDELIGGIGSDREFVVRDYVELERTGKSFLDVQAALSSLDSSQLLDLGQIGRVLDLPG
FT                   AGLALDAAVAPHGYRLLSKVPRLPAAIIDRLVAHFGGLQKLLAASVDDLMAVDGVGEQR
FT                   ARAVREGLSRLAESSILERYV"
FT   gene            complement(466634..468130)
FT                   /locus_tag="Xcel_0397"
FT   CDS_pept        complement(466634..468130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0397"
FT                   /product="DNA repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: DNA repair protein RadA; TIGRFAM: DNA repair
FT                   protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29436"
FT                   /db_xref="GOA:D1BVG5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVG5"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ACZ29436.1"
FT                   /translation="MGAPTVAAVSTPTSSRSRSTSSRAGAKAARPAYRCTECGWAAAKW
FT                   VGRCGECQAWGTVAEDGPAASGPRTVAVTPVRSAARPIAEIDVESARSAPTGVDELDRV
FT                   LGGGLVPGAVVLMAGEPGVGKSTLLLEVASQYARGVGAPKGGLRAVGGERTVLYVTGEE
FT                   SAGQVRLRAERVGALAPTLLLAAETDLGTVLGHVEATSPALLVVDSVQTIASAEVDGVA
FT                   GGVSQVREVAAALIAVAKERQVPVLLVGHVTKDGTVAGPRTLEHLVDVVCQFEGDRHSR
FT                   LRMVRAVKNRFGPTDEVGCFELTETGITGLTDPSGLFLSHLGAGVPGSCVTVTLEGRRP
FT                   LALEIQSLVAPSPLANPRRTTNGMESSRLAQILAVLHRHASLRLADQDVYLSTVGGARA
FT                   GEPAADLAAALAIVSARTGDALPAGTVAFGEVGLAGDVRPVTGIDRRLSEAARLGFVRA
FT                   VVPPGTRAGLSARSAAGLELLESAHVAEAVDAVGLGRSGR"
FT   gene            468218..468871
FT                   /locus_tag="Xcel_0398"
FT   CDS_pept        468218..468871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0398"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29437"
FT                   /db_xref="GOA:D1BVG6"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVG6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29437.1"
FT                   /translation="MTHDQQPEARPRSEAAHGARPAAEVFRRRRILIASAAGALVLVVA
FT                   VLTAFVWPGYALPEPLPTPTVTVTAPVPTPTVSPAERTGEETALTTALPDEVLQFVQRG
FT                   IENLPAWQDDHQAIESWTVTYADGTGDDATTITLQVGQWSDADAAASFAGAQVKAAGTP
FT                   TKEGDVLVDGEVVGTYALIPDGDDAVLWWSNATVVFRAQGPADELEAFYGEYPL"
FT   gene            468912..469736
FT                   /locus_tag="Xcel_0399"
FT   CDS_pept        468912..469736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0399"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="KEGG: afw:Anae109_1387 pyrroline-5-carboxylate
FT                   reductase; TIGRFAM: pyrroline-5-carboxylate reductase;
FT                   PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; Ketopantoate reductase ApbA/PanE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29438"
FT                   /db_xref="GOA:D1BVG7"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVG7"
FT                   /inference="protein motif:TFAM:TIGR00112"
FT                   /protein_id="ACZ29438.1"
FT                   /translation="MNLDQTRLALLGTGNMGEAVLAGALRAGVAPANVVATSRRAERVA
FT                   EVAARHGVRTTLDNVEAVRDADVVVVAVKPKDVGALLTSVGDALAPHAVVVSVAAGLSA
FT                   AFFEGRLPGRQPVVRVMPNTPAAIGAGMSAVSRGTHATDDDVALVLAVLEGTGDAVEVP
FT                   EAYQAASGAVAGSGPAYMFYVLDALAEAGVAVGLSRDLASRLAVQTMLGSARLIAETGE
FT                   HPALARERVTSPGGTTVQGLRALDEGGVRAAFIAAVEAARDRTNEIAAELEG"
FT   gene            469738..470778
FT                   /locus_tag="Xcel_0400"
FT   CDS_pept        469738..470778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0400"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: scl:sce3317 HTH-type transcriptional repressor
FT                   PurR; PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29439"
FT                   /db_xref="GOA:D1BVG8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVG8"
FT                   /inference="protein motif:PRIAM:5.1.1.1"
FT                   /protein_id="ACZ29439.1"
FT                   /translation="MAVARPPAMADVAARAGVSHQTVSRVLNAHPSVRPETRERVLAAI
FT                   AELGYRRNSAARALVTARTTTVGLLTSGSAHFGPASTVLATEAALRQEGYFVSTSSPDS
FT                   YDPAAAAAALERLVDQGVEGIVAVCPVQDVAEAIDDLDPPCPVVVVAARRDEQTGGKAR
FT                   YVHADQYRGAQEATEHLVDLGHTHVVHLAGPERWFDAIERAAAFRDVTATRDVEAQVVQ
FT                   ARGWSARRGYELGLSLAEQAGRPGGPTGFFAANDLIAIGLLRAFWERGLRVPDDVSVVG
FT                   FDDIEESAFLVPALTTVRQPFEALGRAAVRALLEAWGAAAGASLPRTASVIAPELVVRG
FT                   STAARG"
FT   gene            470840..472453
FT                   /locus_tag="Xcel_0401"
FT   CDS_pept        470840..472453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0401"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG: asu:Asuc_0493
FT                   carbohydrate kinase FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29440"
FT                   /db_xref="GOA:D1BVG9"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVG9"
FT                   /inference="protein motif:PFAM:PF00370"
FT                   /protein_id="ACZ29440.1"
FT                   /translation="MLVNNETLTRDDVVAGRTTLGIELGSTNIKACLVGPDQTTVAVGS
FT                   HTWENQFVDRVWTYSLDAVHEGLAAAFAALAADVRQRYGVPLTTVGALGVSAMMHGYLA
FT                   FDAEERLLVPFRTWRNTSTGPAAAALTEALGFNVPLRWSASHLYQAILDGEEHVGQIAS
FT                   LTTLAGYVHRRLTGRHVLGVGDASGMFPIDPATGTYDAGMLATFDSLAAGHGFPAPLGD
FT                   LLPAVLPAGAPAGMLTAEGAALLDPTGTLAAGIALCPPEGDAGTGMVATNAVAPRTGNV
FT                   SAGTSIFAMVVLERPLARVHEEIDVVTTPSGDPVAMVHCNNGSSELGAWAGVFGEFAAA
FT                   IGSDVGQDAVFAALLGAALQGEPDGGGLLAYNYLSGETITGLDEGRPLVLRTPGSRLTL
FT                   ANFARTQVYSVFGTLALGMRTLADEDVAIDSLLAHGGLFRTEGVAQRLLAAAVDAPVAV
FT                   ASTAGEGGAWGIAVLAAYAAAVAGGEPRTLAAWLDEVVFAGAATVVAQPEPADVAGLRT
FT                   YLETYEAGLPIQHAAITATH"
FT   gene            472469..473140
FT                   /locus_tag="Xcel_0402"
FT   CDS_pept        472469..473140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0402"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: asa:ASA_2398 L-ribulose-5-phosphate 4- epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29441"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVH0"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ACZ29441.1"
FT                   /translation="MSVPDQIRADVDAAKERVAALHAELPRWELVVWTAGNVSERVGDY
FT                   FVIKPSGVSYDDLDAEAMVVCDLDGNLVEGTRSPSSDTAAHAYVYRHMDHVGGVVHTHS
FT                   TYAAAWAARGEEIPCVLTMMADEFGGPVPVGPFAIIGDDSIGRGIVETLTNHRSPAVLM
FT                   ANHGPFTIGRDARAAVKAAVLLEEVARAVHISRQLGEPQPIPQDAVDALYARYQNVYGQ
FT                   H"
FT   gene            473199..474710
FT                   /locus_tag="Xcel_0403"
FT   CDS_pept        473199..474710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0403"
FT                   /product="L-arabinose isomerase"
FT                   /EC_number="5.3.1.4"
FT                   /note="PFAM: L-arabinose isomerase; KEGG: scl:sce3310
FT                   L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29442"
FT                   /db_xref="GOA:D1BVH1"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVH1"
FT                   /inference="protein motif:PRIAM:5.3.1.4"
FT                   /protein_id="ACZ29442.1"
FT                   /translation="MSKPYADREVWFFTGSQDLYGEETLRQVAEQSQEVAAALDAAADV
FT                   PARIVWKPVLKDAASIRRAMLDANADDRVLGVITWMHTFSPAKMWITGLDALRKPLLHL
FT                   HTQANVELPWDTIDFDFMNLNQAAHGDREYAYIAARLGVARTTVVGHVSNPAVQQRVGT
FT                   WVRGAAGWAATHELTLARFGDNMRNVAVTEGDKTEAELRFGVTVNTWGVNDLVAAVDDV
FT                   SDADVDALVAEYEELYDVVPELRKDGERHESLRYAARQEIALLNFLESVGAKAFTTNFE
FT                   DLGDLRQLPGLAVQRLMAAGYGFGAEGDWKTAVLVRAAKVMGEGLPGGASLMEDYTYDL
FT                   TPGSELILGAHMLEICPSLTTAKPRVEIHPLGIGGKEDPVRMVFNADAVDGAVVVSLAD
FT                   MRDRFRLTANVVDVVTPPADLPHLPVARAVWKPRPSFAVSAEAWLTAGGAHHTVMSTAA
FT                   GIEAFEVFAEIARVELLVIDEDTTRRGFKDQVKWNAAYHRLAQGL"
FT   gene            474854..476020
FT                   /locus_tag="Xcel_0404"
FT   CDS_pept        474854..476020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0404"
FT                   /product="xylose ABC transporter, substrate-binding
FT                   protein"
FT                   /note="KEGG: ret:RHE_CH03165 xylose ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29443"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVH2"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH03165"
FT                   /protein_id="ACZ29443.1"
FT                   /translation="MKRLTRVFTAATAATLALGLAACGGGGAGGGDDVGTGDGDGAAAA
FT                   SDITVGVAMPTQTSERWIADGNSVREGLEEAGFEVNLQFANDDIPTQQQQIDQMITQGA
FT                   DILIVASIDGTALANQLQAAADAGIPIISYDRLIRDTENVDFYVTFDNFQVGVDQATSL
FT                   LTGLGVLDADGNETGETGPFTIELFAGSLDDNNAHFFFDGAMTTLQPFIDAGTLVVGSG
FT                   QTSIDQAATLRWSQETAQRRMEDLLTAHYGGGSEPLHGVLSPFDGISRGIITALQNAGM
FT                   GPSIADGLPVVTGQDAEIASVALIDQGIQYSTIFKDTRLLAEQAVIAAQAFADGRTPEA
FT                   NNTTDYDNGMMIVPSFLLPVSIVTADDIQSVLIDSGFFTQEQVDRGQM"
FT   sig_peptide     474854..474940
FT                   /locus_tag="Xcel_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.365 at
FT                   residue 29"
FT   gene            476115..477659
FT                   /locus_tag="Xcel_0405"
FT   CDS_pept        476115..477659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0405"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mes:Meso_0839 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29444"
FT                   /db_xref="GOA:D1BVH3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVH3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ29444.1"
FT                   /translation="MSSTILEMQDITKNFPGVKVLKDVSLKVAEGEIHAICGENGAGKS
FT                   TLMKVLSGVYPHGTYDGRILLRGQEVAFGGIKDSEAQGIVIIHQELALVPHLSVAENIF
FT                   LGNEVVQRGLIDWHRANAEASALMERVGLSELPVTPVGQLGVGKQQLVEIAKAISKDVS
FT                   LLILDEPTAALNDSDSEHLLGLLRELKAQGITCIIISHKLGEIEDIADSTTIIRDGAVV
FT                   ETIDMHGPDATQDRIIRGMVGRDLDQRYPERSVTVGDVVFRVEDWHVHHPTQPRVLVEK
FT                   ASFDVRAGEVVGIAGLMGAGRTELAMSLFGRSYGRDVSGKVYLHGKEIDTRTVGSAIAN
FT                   GLAYVSEDRKHYGLNLIQDIRTNVTAAGLGKISSRGFVNGNEEIAVAEQARKAMRIRTP
FT                   SVMQTVGNLSGGNQQKVVLSKWLYTDPEVLILDEPTRGIDVGAKFEIYTIINELAAQGK
FT                   AVVVISSELPELLGTCDRIYALAYGRITGQLPVAEATQERLMELMTIEKTSKEAVR"
FT   gene            477656..478837
FT                   /locus_tag="Xcel_0406"
FT   CDS_pept        477656..478837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0406"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: bha:BH3440
FT                   L-arabinose ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29445"
FT                   /db_xref="GOA:D1BVH4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVH4"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACZ29445.1"
FT                   /translation="MNVAADVKDLFTRNLRTSGIYIAFVAIVLLFTVLTDGMLLQPGNL
FT                   TNLVLQFSYVLILALGMILVIVAGHIDLSVGSVVALAGAVSAVVVIRHGAPWWVGVLAA
FT                   LGVGLLVGAWQGFWVAYVGIPAFIVTLAGMLLFRGMTFRVLDNVSLSPFPAEYQKIASG
FT                   FVNGLLGGDGYDVFTLLIGVFAVVGFAWTQWRARQGRLQYRQPVEAMGLFITKIVVVAA
FT                   VVMAFAWQLAHARGLPIVLIILAVLILTYQVVTTKTVFGRHIYAIGGNLPAAMLSGVKV
FT                   KRVNFWIFVNMGLLAGVAGAVFSSRSNGAQPGAGNMFELDAIAACFIGGASTSGGVGRV
FT                   TGAMVGGLVMAVMSNGMQLMSVGQSTQQIIRGLVLLLAVAFDIYNKRRAGATR"
FT   gene            478911..480812
FT                   /locus_tag="Xcel_0407"
FT   CDS_pept        478911..480812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0407"
FT                   /product="protein of unknown function DUF1680"
FT                   /note="PFAM: protein of unknown function DUF1680; KEGG:
FT                   hypothetical protein ; K09955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29446"
FT                   /db_xref="GOA:D1BVH5"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVH5"
FT                   /inference="protein motif:PFAM:PF07944"
FT                   /protein_id="ACZ29446.1"
FT                   /translation="MTSPVRPSTGALRPLGLHDVTIDGGFWGERQALNAAATIPHVEAW
FT                   LERLGWTGNFDAAVEGRLPADRAGREFSDSEIYKLLEGMAWEIGRTGSVGLEARFTALA
FT                   ARVSAAQEPDGYLNTMFGRPGQKPRYSDLQWGHELYCFGHLIQAGVARARTHGHDAFVE
FT                   TVVRAADHVCEQFGPDGDQRVCGHPEIEVALAELARVTGERRYLDQARAFVERRGHGVL
FT                   GDIELGTAYFQDDVPVRETEVFAGHAVRALYLAAGAVDVALETGDDELLAAVAAATTRT
FT                   LARRTYLTGGMGAHHEGESFGVDFELPPDRSYSETCAGIASVMLNHRLLLATGEARYAD
FT                   AVERTLFNVVATSPAADGRGFYYTNTLHQRVPGKEVVPDEVSPRASSSLRAPFFAVSCC
FT                   PTNLTRTFASLGAYVATASDDGVQLQQYAPGAVRASLPAGPVELAVRTAYPADGRIEVE
FT                   VVQAPVGAWDLTLRVPAWAVGATVAVDDGAPAPADPGYVTVAGPGAGGVVVLDLPMAPR
FT                   WTFPDPRIDAVRGQVAVERGPIVMALESVDLESVDLDSVGLGADVGAVRVRTDVAPRVH
FT                   DGRVQVPVTVVEVADGDWPYGQAAGPAAGQERCVDLVEYHAWAERGPSTMRVWMPVR"
FT   gene            480882..481889
FT                   /locus_tag="Xcel_0408"
FT   CDS_pept        480882..481889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0408"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: psp:PSPPH_2128 ribose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29447"
FT                   /db_xref="GOA:D1BVH6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVH6"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ACZ29447.1"
FT                   /translation="MVVTMQDVAARAGVSVKTVSNVVNDYPYIRPATRARVEEAIAALG
FT                   YQVNVAARNLRQGRTGMIGLALPELRVPYFAELADSVMRAAEAQGLVLLIEQTGSVGEH
FT                   EAEVLHGPRRRFTDGLLFSPVAMDPRDHPELDVDYPLVLLGERVFDAGVDHVTMANVEG
FT                   ARAATSHLVERGCRHIAVIGVHPGEAMGSAALRFDGYLQAVRAAGREFNPRHAGVAQRW
FT                   VRSTGAVAMAQVLDSGVPVDGVFAMNDALALGALHVLHSRGLRVPDDVAVIGFDNIDDT
FT                   EYSEPPLSSIDPGREQIADQAVGLLVARIAGSTAPPRQVVADFALVERESTAPV"
FT   gene            482006..482908
FT                   /locus_tag="Xcel_0409"
FT   CDS_pept        482006..482908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0409"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bsu:BSU28740 integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29448"
FT                   /db_xref="GOA:D1BVH7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVH7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ29448.1"
FT                   /translation="MLKRLMFSQKAAPYLFVLPFVLTFGIFWAFPLGRSVIMSGQNILP
FT                   GQVENVGFANYERLFGDRLFWLAMGNSLRYTILTLVLLIPIPLFLAVLVNSKIGSPRLK
FT                   AFFKSAMFIPALTSVVVAGIVFRLMFSESSTALMNQIIGVFGLEPTKWLKNDLTGLAAL
FT                   LIVALWRWTGVNMMYFLAGLQSIPQEYYEAADLDGASRWQQFRYVTLPQLRPTLIYVVT
FT                   ISVYGGMAMFLESFMLWGGNNSPQNIGLTIVGYLYRQGIEKNDLGYASAVGVVLLVVIL
FT                   AINLTQLSFNGMFRKEATR"
FT   gene            482905..483771
FT                   /locus_tag="Xcel_0410"
FT   CDS_pept        482905..483771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0410"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bsu:BSU28730 integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29449"
FT                   /db_xref="GOA:D1BVH8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVH8"
FT                   /inference="protein motif:PRIAM:3.6.3.17"
FT                   /protein_id="ACZ29449.1"
FT                   /translation="MSRRAPALTRLPARRRPAAIGMTVAFVVVGALALIPFWAMLVGTF
FT                   QDGEMLIRYGLNLGLDPANAHLRNYVMLFTDSGPYFTWFANSIVLTVIQVVGTLLISAF
FT                   VAYGFAMYDFRFKTTLFILVVVLMTIPFEMLMLPLYVQTNAMGLSDNYAAILLPFLAQA
FT                   MTIFFFRQYLVGIPREILEAGRVDGVTEFGIFFRLVVPLMKPAFAAMAILNGMASWNNF
FT                   LWPLLVLRSPEKYTLPIGLNTLLTPYGNNYSLLIVGAFFSLIPILLLFLAFQRFFIQGM
FT                   TAGAVKG"
FT   sig_peptide     482905..483006
FT                   /locus_tag="Xcel_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.839 at
FT                   residue 34"
FT   gene            483799..485148
FT                   /locus_tag="Xcel_0411"
FT   CDS_pept        483799..485148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0411"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bha:BH0905 L-arabinose transport system
FT                   (sugar-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29450"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVH9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACZ29450.1"
FT                   /translation="MKLTRTLAATAAVAALALTSACSQPSAGTPDDEYSSTVDQKAGAD
FT                   ATTLSLWTFVELHGAFYETMAAHWNEQNPDKQVKLDVNVMPYDDMHNKLQLALNSGDGV
FT                   PDLVDIELGKFPNFTKGTPPLEDLTAYAEPYAADLVQARLDLYSKAGKTYGFDFHVGTT
FT                   LAFYNTELLDAAGVDYTSITTWDDYQAAGVKYHEATGKSFATADTSALWQANLLLGQLG
FT                   GDYLDADGTVTVDSPEVVEAFDILKGMQDSGAASVPPGGQPDTEEAYGAINSGDFAAMI
FT                   MPEWFMSRFTAYMPELKGKIAIAPAPVVAGAKVKTVGGGGTGTAVPSAGEHADLAAEFI
FT                   AYAKLSKDGNVEIWQTLGFDPMNTSMWEDESITHDPSNEYVQYFQTNPFDVLNEVSDSI
FT                   GLLVSSTSENAPSVGNLFTTETLNNIFESGTPVADALAQAQSDLKNELGQ"
FT   sig_peptide     483799..483882
FT                   /locus_tag="Xcel_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.791 at
FT                   residue 28"
FT   gene            485255..486769
FT                   /locus_tag="Xcel_0412"
FT   CDS_pept        485255..486769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0412"
FT                   /product="Alpha-N-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /note="PFAM: alpha-L-arabinofuranosidase domain protein;
FT                   KEGG: bha:BH1861 alpha-L-arabinofuranosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29451"
FT                   /db_xref="GOA:D1BVI0"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVI0"
FT                   /inference="protein motif:PRIAM:3.2.1.55"
FT                   /protein_id="ACZ29451.1"
FT                   /translation="MLPVSITLDPAFRVGPVRRRTFGSFVEHLGRCVYTGIHDPEHPTA
FT                   DADGFRKDVVELTRDLGVSTVRYPGGNFVSGYRWEDGIGPVEQRPRRLDLAWHSTDPNT
FT                   VGVDEFVRWSRAADVEPMMAVNLGTRGVQEALDLLEYCNVKGGTRWSDLRRQNGSPEPH
FT                   DIRMWCLGNEMDGPWQIGHKTAYEYGRLATETARAMRMIQPDLELVACGSSGVPMPTFG
FT                   EWERIVLGETYEYVDMISAHAYYWEEDGDLGSFLASATDMDHFIESVAATADAVRAHKK
FT                   VSKRIHISFDEWNVWYQHRAESKPPTGDDWPVAPVLLEDRYNVADAVVVGNLLISLLRH
FT                   TDRVHAASLAQLVNVIAPIMTEPGGRAWKQTIFHPFAQASRYARGDVLRVALDVATYET
FT                   AKFGDVALADAVATYDAETGEVALFAVNRSTTQPARLDVDLRSIPGLELVEASVLANPD
FT                   HQWQATADDDSSVAPRANATAQVADGRLTLEVPPVSWNVVRLAVRG"
FT   gene            486833..487195
FT                   /locus_tag="Xcel_0413"
FT   CDS_pept        486833..487195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0413"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: bha:BH3492 GntR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29452"
FT                   /db_xref="GOA:D1BVI1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVI1"
FT                   /inference="similar to AA sequence:KEGG:BH3492"
FT                   /protein_id="ACZ29452.1"
FT                   /translation="MFSGETPVFQQLAAKIADDIVAGVYPEETAVPSATDFAAFHRMNP
FT                   ATASKGVNLLVDLGALYKRRGVGMFVAPGARVLLKKARREQFQAQYVRPFLAEARLLGI
FT                   GRDELHQMIDEEVGQS"
FT   gene            487192..488097
FT                   /locus_tag="Xcel_0414"
FT   CDS_pept        487192..488097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0414"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bha:BH3493 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29453"
FT                   /db_xref="GOA:D1BVI2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVI2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ29453.1"
FT                   /translation="MTNVIELQSVTRAFGGPRALDDVTLTVPAGSIVGLLGRNGAGKTT
FT                   LMSLIAGQDRPSSGRVAVFGQNPFENESVLSRVRFVRDNQRYPDGYTLRHVLRIAPTYA
FT                   PNWDADVAAELADAMRIPDKVPVKSFSRGQLSAVAILLSLAARAPVTLLDEPYLGLDVT
FT                   ARARFHDVLIRDYVAHPRTVVLSTHLIEESEALFDRVIIMDRGRVRADLPSEQVPTHAF
FT                   VLSGPGEAVDRLATDRTVLSTHAVPGLKSVTVHGAPEVGLVADAASSGVQVSAASLQEL
FT                   VAAFGADSREPVTLANGPRS"
FT   gene            488094..488804
FT                   /locus_tag="Xcel_0415"
FT   CDS_pept        488094..488804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0415"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpt:Bpet0035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29454"
FT                   /db_xref="GOA:D1BVI3"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVI3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29454.1"
FT                   /translation="MNAVSSAVALHLNQRTKTFLVPLWIAAIVGVVSVLIALIFWRSGS
FT                   QPGSAEWVQGSQSNPGVIYALGGFLVYFGVASVATTYPFALTLGSTRRAFVAGTLVWQA
FT                   IVAAYVAVVFLVLSVVELATNHWFVGFYVFDIHALGAGDPGRLLPTVFLGVLSFLAVGA
FT                   VFAAAWVRFGPRGPQLLGLGVFVTLGIGLAVIIPDIAGIAAAFELWWLAIAAGAVVVLA
FT                   SLGTWLLLRSAVIR"
FT   gene            488894..489580
FT                   /locus_tag="Xcel_0416"
FT   CDS_pept        488894..489580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0416"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mlo:mlr3851
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29455"
FT                   /db_xref="GOA:D1BVI4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041678"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVI4"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACZ29455.1"
FT                   /translation="MNGPVADESGTRRGRRPAGRETRGEILAAARVVFLEQGYDATSVR
FT                   AVARRAGVDPGTVRHWFGDKARLFAAALGMSDVDPGAVARDAIEGPLDGIGTRLVRHVL
FT                   ETWDADDGGAGIRLALPVALADPEKRALLPQYLGTEILGPIAARLDPASARLRASLAAT
FT                   QMVGVLLARYVIGVEPIASLPAARVAELVGPTLERYLVGSFDPMPTSGAPLASEPAPEH
FT                   NSPHGE"
FT   gene            489570..490325
FT                   /locus_tag="Xcel_0417"
FT   CDS_pept        489570..490325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0417"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sbp:Sbal223_2832 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29456"
FT                   /db_xref="GOA:D1BVI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVI5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ29456.1"
FT                   /translation="MVNNSGGPAIRARGLRVVRGGTTVLDGLDLDVPAGQVVGLLGPSG
FT                   SGKTTLMRSVVGVQANVTGDLTVLGEPAGTPGLRRRVGYVTQAASVYTDLSVTENLAHF
FT                   AALAGLRGGAARSAVAQAVTAVDLGGHEKQQVVSLSGGERSRVSLAAALVGDPELLVLD
FT                   EPTVGLDPVLRRDLWTMFHRLAEQGRTLLVSSHVMDEATRCDRLLLLRDGELVADTTPD
FT                   ALLAQTGAPDAERAFLALIDRTDATGGAR"
FT   gene            490322..491044
FT                   /locus_tag="Xcel_0418"
FT   CDS_pept        490322..491044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0418"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG:
FT                   bcb:BCB4264_A2507 putative ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29457"
FT                   /db_xref="GOA:D1BVI6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVI6"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACZ29457.1"
FT                   /translation="MSLTLATAGRVLGQLRHDRRTVALIMVLPCLIVGLVAWMFDGTPV
FT                   LDQFGPVLVGFFPLFVMFLVTSVTTQRERASGTLERLMTTPIRKGEFVAGYALAFGALA
FT                   AVQAVVVVGFALLVGMDVAGSLGLVLLVALLDAVLGCTLGLAASAAARTEFQAVQMMPA
FT                   VIIPQLVTAGILLPRDQMPEVLEWISRVLPLTYAVESLQQLAAGAGWADVRGAIAVVVV
FT                   WIVGAGVLGVLTLRRRTE"
FT   gene            491182..492183
FT                   /locus_tag="Xcel_0419"
FT   CDS_pept        491182..492183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0419"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: rpi:Rpic_4095 periplasmic
FT                   binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29458"
FT                   /db_xref="GOA:D1BVI7"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR033893"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVI7"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACZ29458.1"
FT                   /translation="MARKNFRSTAVAAVAATALFALGACSSGSSANTGDGAEGNGDDLI
FT                   TIGFAQVGAESGWRTANTKSIQDTLTTENGFDLKFSDAQQKQENQIQAIRSYIAQNVDV
FT                   IAFSPVVESGWDAVLQDAKDAGIPVILTDRAVDSEDDSLYVSFIGSDFVEEGHRVGEWV
FT                   SENLGTESINVVELQGTTGSAPAIDRKEGFEDAIAGNSNVTVIDSQTGNFTRAEGKTVM
FT                   EGFLQAHDDIDVVFAHNDDMGLGAIEAIEAAGKKPGVDIKIVTIDGVKDGMTALADGKF
FT                   NYIVECNPLLGPDLAEIAKKVVAGESVEKRIVTHDDAFDQEGAKAALPNRQY"
FT   sig_peptide     491182..491277
FT                   /locus_tag="Xcel_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.888 at
FT                   residue 32"
FT   gene            492482..494005
FT                   /locus_tag="Xcel_0420"
FT   CDS_pept        492482..494005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0420"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bpy:Bphyt_4809 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29459"
FT                   /db_xref="GOA:D1BVI8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVI8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ29459.1"
FT                   /translation="MHDPESVVEMRGITVEFPGVRALDAVDLTLRRGEVHALMGENGAG
FT                   KSTLIKALTGVYTPTAGSVVVDGAAVAFSGPGDAQAAGVSTVYQEVNLCPNLTVAENIM
FT                   LGHEPRRFGSIDVRAMRRTAAELLARLDVHVDPASSLGAHSLAVQQLVAICRALVVDCK
FT                   VLVLDEPTSSLDAGEVERLFEVMRRLRDDGVAILFVSHFLEQVYEISDRMTVLRNGRLV
FT                   GEYTTAELPRRDLVHHMIGASFEELERLGDAPKRADVVLAQDPLLQAVALGRKGSIRPF
FT                   DLDVHAGEVVGLAGLLGSGRTELARLLTGVDRPDTGQVLVDGRPVRMTTPRASLRRKIA
FT                   YSSEDRKAEGLVGDLTVRENIVLALQADRGWLRRLPDRTVDEIVDRYIKALDIRPANPA
FT                   ALVRNLSGGNQQKVLLARWLATAPRLLVLDEPTRGIDVGAKAEIQRLVAELAADGMGVV
FT                   FVSAELEEVLRLSHRVAVLRDRVKVGELVNSDDVRLGDVVDLIASGEAP"
FT   gene            494002..495033
FT                   /locus_tag="Xcel_0421"
FT   CDS_pept        494002..495033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0421"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG: scl:sce3306
FT                   ribose/xylose/arabinose/galactoside ABC-type transporter
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29460"
FT                   /db_xref="GOA:D1BVI9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVI9"
FT                   /inference="protein motif:PRIAM:3.6.3.17"
FT                   /protein_id="ACZ29460.1"
FT                   /translation="MKDLVRHRLFWPVVALVALLAANTVKKPSFLALEVIDGHLFGATI
FT                   NLLRQGAPLLLVALGMTLVIATRGIDLSVGAVVAIAAAVGLTTVAGSADPGSLGAVLVA
FT                   FATALGVCVLAGLWNGFLVSVLGIQPIIATLVLMTAGRGIAMLITDGQITTVTSGPFKA
FT                   IGSGFWLGLPIPVLLAAAVMVAVALLTRRTALGMLVESVGVNPEASRIAGVGSRTIVWT
FT                   VYVVCALFSGLAGLMIAANTMAADANNAGLFIELDAILAVVIGGTSLAGGKFSLSGTLV
FT                   GVLVIQTLTLSVTMLGIATSVTPLFKAAVVIAVCLAQSPAVRERFAARRRRRVAPAAAV
FT                   EVA"
FT   gene            495033..496022
FT                   /locus_tag="Xcel_0422"
FT   CDS_pept        495033..496022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0422"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rpi:Rpic_4098 monosaccharide-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29461"
FT                   /db_xref="GOA:D1BVJ0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVJ0"
FT                   /inference="protein motif:PRIAM:3.6.3.17"
FT                   /protein_id="ACZ29461.1"
FT                   /translation="MTTLAGTRPRSFHLDRRYLPVIGTLVVVLLIFAVGGSRYDGFVTG
FT                   RVISNLFLNNAHLVVLAVGMTFVILTGGIDLSVGAVVALSGIVAAVLFEAGLPAVVVIP
FT                   TVVLVGSVIGLLIGVMVHVFGVQPFVASLAAMFLARGLCYVLAPQSVPIRDETFVALSD
FT                   WSLRSDSGWRVTSAVLIALATLAVAVWVLHRTRFGRTVYAIGGGEQSALLMGLPVGRTK
FT                   VLVYVVSGTCAGIGGLLFAMYSRSGYSLTGVGMELDAIAAVVIGGTLLTGGTGFVLGSL
FT                   LGVLVLGLIQSIITFEGTLSSWWTRIVIGALVLVFVVLQRVLVGRRVT"
FT   gene            496465..497358
FT                   /locus_tag="Xcel_0423"
FT   CDS_pept        496465..497358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0423"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rle:pRL100399 putative
FT                   permease component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29462"
FT                   /db_xref="GOA:D1BVJ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVJ1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ29462.1"
FT                   /translation="MSAPPAPAPPARPPRTDGVPADGSVRVGVDDRFHRAPSRPAGLQR
FT                   VTQVAGRAIGPLFVLALWWVASAQAWVSPILLPAPGTVWAAAVDLVSSGKLQDNLGVSL
FT                   GRAMTGLGIGLVVGVTLALLTGLSKVAELLVDSNVQMVRSMPILALQPLVIVWFGIGEP
FT                   TKILLVALAVTFPVYINTHAAIRAVDARFVELATTRGLGRLALVRHVVLPGALPGFLTG
FT                   LRFATSISWLVLVVAEQINATAGIGYLMTQARTVARTDVIIVGLVVYALLGLLSDTIVR
FT                   LVQRKALSWSSTLQAR"
FT   gene            497331..498095
FT                   /locus_tag="Xcel_0424"
FT   CDS_pept        497331..498095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0424"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: scl:sce0167 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29463"
FT                   /db_xref="GOA:D1BVJ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVJ2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ29463.1"
FT                   /translation="MVIDAPGTLTPPAGGTAAVQQPVVVEARGITRAFDGRGVLHGIDL
FT                   TVRRGEFVALLGRSGSGKSTLLRILAKLDTEATGTIKVPAQPGVAFQDSRLLPWARVLP
FT                   NVLLGLRDGDARERARTLLDDVGLGDRARAWPRQLSGGEQQRVALARALAGAPELLLMD
FT                   EPFGALDALTRIRMHRLLRELVSRYSPSVVLVTHDVDEAVLLADRVLVLTDGRLSLDEQ
FT                   IDLPVVGRRSHPGFVALRSRLLTELGVGDDDH"
FT   gene            498152..499198
FT                   /locus_tag="Xcel_0425"
FT   CDS_pept        498152..499198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0425"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /note="TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; SMART:
FT                   extracellular solute-binding protein family 3; KEGG:
FT                   bur:Bcep18194_B1761 ABC transporter, substrate-binding
FT                   protein, aliphatic sulphonates"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29464"
FT                   /db_xref="GOA:D1BVJ3"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVJ3"
FT                   /inference="protein motif:TFAM:TIGR01728"
FT                   /protein_id="ACZ29464.1"
FT                   /translation="MPTHHRRHRTGTIATALAALAALTLAACSSDAGAATPNTSGAADA
FT                   SDTGTGVTLRFGELGSALTQQALLEAAGEFDDLPYEVEYSLFPAGPAFMEAVPSGAVDL
FT                   SIQADTPSIFAQVGGIPIKVVGVQASVKTGESFVEIVANPDSGITSVADLKGKKVAVLP
FT                   ATILQYTVVRALEEAGLSYDDITPVELPLTDAPAALAKGDVDAVASLDPTLAQLKASGA
FT                   VVVGTGLGITSGYSYVVATDAALADAAKSEAIADYLGRLGRAEEWAVAHGDEWAAISSE
FT                   LTGLPVELAQAAQERSAAGWVAIDDQVIALQQEQADAYTALGLIQTPLDVSAYYDDRFN
FT                   DVLTGGTK"
FT   sig_peptide     498152..498256
FT                   /locus_tag="Xcel_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.817 at
FT                   residue 35"
FT   gene            499195..501513
FT                   /locus_tag="Xcel_0426"
FT   CDS_pept        499195..501513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0426"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: pzu:PHZ_c0420 arylsulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29465"
FT                   /db_xref="GOA:D1BVW2"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVW2"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACZ29465.1"
FT                   /translation="MTAQHPDVPAHARGYDRFPGRIGTTARESTRAWPRPKGARPGTPN
FT                   VVVVILDDMGYSDVAPYGSEIPTPHLTALAERGYRLTNYHTTPVCSPARAAILTGLNPH
FT                   RAGFASVANSDPGFPNLRLEIDQDVATLPESLRAAGYATYAFGKWHLTRDALMHDGADK
FT                   SSWPLQRGFDHFYGTLEGLNSFFHPNQLVRDNTPVDRDDWPADYYLTDDLTDDAISQLA
FT                   TLRAQEPDKPFFLYFAHHAMHGPLGAKAEDIAAQRGAYAAGWDEVRRARHARQLELGLF
FT                   PPQTPLPPSATEPGFDVPAWDGLDADTQDLYARYMEVYAAMVANVDENLGRLLGVIEDL
FT                   GELDNTIVVFTSDNGGTAEGGPEGTRSYFSRFVHVAGLPQDWEADVARDRDVIGTPRSM
FT                   VHYPRGWGQVSNTPFRFYKGQTHAGGVRVPFLVSWPAGLPKAADDDGLRRQYQYVTDLT
FT                   PTLLDLVGVERLATRQGLPTQEIDGVSLRPVLAEPAAASTHPEQYAEFGGSRGFYRDGW
FT                   KLVSLHTPGRSITAPQWELYHVDEDPNELVDLAAKEPERVAELSAAWEDAAWRNTVFPL
FT                   GAAFAPGRRPAEKALERPVRLLPSTRRLERYRSSKLTSLRSFEVLAEVLEPGEGVLVAH
FT                   GDQGGGYALYVEEGVLHLAFNEYGRLHEAPLGAFTTGEVRASFTWLPEFRWRIEVTVDG
FT                   EARGGLDSVAMLLGMAPFSGIDVGVNRGGPVHWGVYERHGSFRFTGRLAAVTYEPGEHA
FT                   AYDVAQVAAVEEDVAEYYD"
FT   gene            501704..507823
FT                   /locus_tag="Xcel_0427"
FT   CDS_pept        501704..507823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0427"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="PFAM: Fibronectin type III domain protein; SMART:
FT                   Fibronectin type III domain protein; KEGG: sse:Ssed_4139
FT                   putative outer membrane adhesin like proteiin"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29466"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVW3"
FT                   /inference="protein motif:PFAM:PF00041"
FT                   /protein_id="ACZ29466.1"
FT                   /translation="MSGRTVGLLSRLRANHRKAVSTGTVFALAAGLVTAAVLTDGEASA
FT                   DLQLNDAGVWVTNQSSGLVGRFNTSAGTLDGTLLAGSAAFDVDQQARYVLVADDGSSTA
FT                   SAVDVARLEFSSTTKVPAGARLAMGGGVVAVVDDESGSLWVTTLDGLPGLDPAKTDPTA
FT                   ELDGAAEVVVSETGVVHAVVPDRDVLWTVKPGADPETKTLDLMQRGDDVVLTTVGDDAV
FT                   VLDRTRGRLRLPGGDTVEVVNAQGAQLQQPGPEADTVVYATSSALVEQPLRGGDATLRQ
FT                   ASGMPAAPVRVAGCLYGAWSGTGQILRDCEGTDRDVDDALEDLDQTAVLRYRVNRDAVV
FT                   LNDLAAGTVWIAMDQFERVDDWETTQPDEGEQDGTSPDKTTPEMVDSTVVDREKQTPPT
FT                   AQDDEFGVRPGRATVLDVLSNDMDRDGDVITATRTGDQPAPITIEEVLDGAALQAVVPE
FT                   DATGTVQFPYTVSDGRGGTDDAQVSLRVVPWGENADPFQLGEPVLRVQKGGRGAIRVLP
FT                   YFRDPDGDDIYLATASVSVDGDEARAYPDGLVEFRDGGSATGRKNVTVTVGDGHGGVVE
FT                   GTLWVDVINSQEPPVAVGDHVAVLAGQPVTVEPLANDSDPNGDSIRLVSVSEAAPAQIT
FT                   PNYDAGTFSFLARDPGSYDVLYQVSDGPSTTTGVVRVDVRAPDAASGAPVVVSDTVMLS
FT                   AGGTALVDVLANDTDPAGGVLVVQSFEVPDDAGLSVTVLAHQVLRISESRRLAESVVIR
FT                   YTVSNGTQVATGEVRVLPVPAPDRLQPPNAEPDEVTVRVGDYVTIDALANDTHPDGLEL
FT                   TIADDLEQGVDPEQGEIFVSEGMLRFRAEAQEGTAYAIYKVRDPNGQEDSAQVTIHIRG
FT                   GDDNQAPTPPDVAARVITGGVVRVRIPLDGIDPDGDSVQLVNIVAPPALGIAEIVDGRF
FT                   IDFQATRGAIGQDTLTYSVVDARGAKAQGVVRIGIAPPATTNHAPIAEDDVVWARPGRT
FT                   VSAAPLGNDSDPDGDQYGLVGGGIEAADPLDPKVEGERIVVRTPEEEGAYGFYYTIEDT
FT                   WGARAMGAVTLEVSLDAPLQAPIARDDIVLDSAITFDQTSVTVPLLDNDEDPDGAASEL
FT                   EVAVDADTATVTTTSDDETVVEVRLTAQRQVITYTVTDQDGLQGKAFLLVPAGKTPELA
FT                   DELREEDEELTEDQAELTGPAPMLKANFSPLEVKSGEPLTVDVADAVVVAEGGAARIAD
FT                   PATAKAVAGSVVVQDERRLVYTSAEDYVGPAAVSVLVTDGLGSSPQDADHTLVIQVPIT
FT                   VLPPDNLPPEPGQPSGQVAAGEESTVDLGRFATDPNDDALTFALGTLPDGLSATLTGSV
FT                   VTLEAAPDLVKGVGLTVPFTVSDGANPSVDGELAVTVVASIRPLAKANPDSVEGAHQGV
FT                   PVSVPVLANDMDPFDPKGLELISAVVQTGQGSTELDGDEVIITPAPTFVGTLVASYRIQ
FT                   DATKDPDRLVEGTVTVTVLGVPEAPAAASIEEVRSKTVVLSWTPPQNNGAPITGYTVTS
FT                   SQGDVFDCATTTCTLDGLTNNVTYTFTVVATNEVGPSDPSPASAPARPDEKPDPPAAPK
FT                   LAFGDGSLTVTWTNATYTDRSPISEVNLQISPAPPSGALQKKGLTGETTVWEGLENGVA
FT                   YKVQVQAVNAAPDPSEWGEWSTEMVPAGKPDAPGAPTASRTASGAVNVKWNAPASNGDA
FT                   ISNYYVDVYRDGSLVQENVDLKTATSHDFTGLTTTASYTFAVSAKNKAGEGATSSRSNA
FT                   AIPYGAPKAPTNVKATDNKGVPTVTWSAADGNGSPVIDYTVTASGGKTMTTTGTSVNFT
FT                   GLTAGTTYTFTVTARNLGGTSSASAASGGVKAYGLPSAPSVTWTKTTATDGYFTVNAPS
FT                   SWNGDTGTVSWSLSGSETKSGTGTGRIDITGGHSKSYKVTTSATNGAGTTTGGTATGTT
FT                   DAPPPPPNPQVRVTNSGRPGTYNNDCVSACQTFLLQANADFPSGKHTFVCYNSSGGDHA
FT                   FGTAMETTLNANGTVELNCYLGYTGGADVWVSVDGHLNYSVRTTWFR"
FT   sig_peptide     501704..501811
FT                   /locus_tag="Xcel_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.965 at
FT                   residue 36"
FT   gene            complement(507925..508602)
FT                   /locus_tag="Xcel_0428"
FT   CDS_pept        complement(507925..508602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0428"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; KEGG: pol:Bpro_0214
FT                   TrkA-N"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29467"
FT                   /db_xref="GOA:D1BVW4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVW4"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACZ29467.1"
FT                   /translation="MADRTKKEPERDAGVLVIGLGRFGSAIAVTLDRLGQDVLAVEHDE
FT                   TKVAQYSGRLPLVQADATNPEALEQLGARDFGMAVVGIGSSLEASVLVTANLVDLGTPQ
FT                   IWAKAVTAEHGRILQRIGAHHVVYPESDAGARVAHLVSGKMLDYIQVEDDFVIVKMRPP
FT                   MEMQGFTLAQSDVRRRYGVTVIGVKSSGREFVYATPETRVAASDFIVVSGHEDVLERFS
FT                   SRP"
FT   gene            complement(508689..510074)
FT                   /locus_tag="Xcel_0429"
FT   CDS_pept        complement(508689..510074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0429"
FT                   /product="H(+)-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /note="PFAM: cation transporter; KEGG: azo:azo3092 putative
FT                   potassium uptake protein, membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29468"
FT                   /db_xref="GOA:D1BVW5"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVW5"
FT                   /inference="protein motif:PRIAM:3.6.3.14"
FT                   /protein_id="ACZ29468.1"
FT                   /translation="MAQVKRNLLGLRELVDRVARRSPARLALAVFLGVCVLVTLLLSAP
FT                   WATASGHRAPFVDALFTAVSAVCVTGLTVVDTATYWSTWGLVSILVAIKVGGFGVMTLA
FT                   SILGLAVSRRIGLTQRLLTASETRTDRLGEVGSLVRVVIVTTTTLELVVAAMLLPRFLA
FT                   LHESVGTAVWHSVFYGVSAFNNAGFVPTSEGLTPHVGDWLLDLPIILGVFVGALGFPVV
FT                   LNIMNTRRKGYRGWNRWSLHTKLTIVTSLALVALGWLLMAVLEWNNPATFGPLPTNEKV
FT                   LASLFAGVMPRSAGFSAVDVGAMHEGTWVVTDALMFVGGGSASTGGGIKVTTLAVMLLA
FT                   IRAEARGDRDIEAFGRRIPSDTLRVAIAVVFLGATAVLVTTIALMEITGLPLDRVLFEV
FT                   ISAFATCGLSTGITADLPDAGKYLLSALMFVGRTGTMTFAAALALRDRRRIVRFPEERP
FT                   IIG"
FT   gene            510146..511318
FT                   /locus_tag="Xcel_0430"
FT   CDS_pept        510146..511318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0430"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   bsu:BSU29710 acetoin dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29469"
FT                   /db_xref="GOA:D1BVW6"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003085"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVW6"
FT                   /inference="protein motif:PFAM:PF00850"
FT                   /protein_id="ACZ29469.1"
FT                   /translation="MPLARLVWSPELLQYDFGRGHPMSPARLDLTMRLADELGLLTSRD
FT                   LEVVAVPPASDAVLETVHDAAYVAAVRAADAGRPAPERGLGTEDDPVFAGMHDAAARLV
FT                   AGSVDVADAVWDGRVLHGLNVAGGMHHAHRDAASGFCIYNDAAAAVQRLLDAGAQRVAY
FT                   VDLDAHHGDGVEAQFWDDPRVLTVSIHQDGSTLFPGTGSPADVGGAGAEGSVVNLALPP
FT                   RTGSEGWLRALDAVVPALLREFRPQVIVSQHGADAHAKDPLSDLRVGIDALRQAARVLH
FT                   DLSHELADGRWVALGGGGYAVVDVVPLVWSSLVAEALHAPLDLAQPLPPAWREHVAQAS
FT                   GLTAARYLGIETAEWRRWAAGYDPADDVDRAVLATRKHVFPLWGLDPYQD"
FT   gene            complement(511388..512446)
FT                   /locus_tag="Xcel_0431"
FT   CDS_pept        complement(511388..512446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0431"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   rle:pRL100402 putative sulfonate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29470"
FT                   /db_xref="GOA:D1BVW7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVW7"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACZ29470.1"
FT                   /translation="MSSRFLWYIPNHTRPGHRGEPVIPEHNSLDHLTEHARALEDSGWE
FT                   GALLGTSWGRPDTFTVAAALAARTTTFKPLIAVRPGYWRPAHFASSAATLDHLTGGRAL
FT                   VNIVSGQDDLAAYGDVEGDQAHRYARTKEFLQIVRRLWTQEEVTYAGEHFSVAGSRLEL
FT                   KPVTVGERRHPTLYFGGASDAAQRVAAAEADVQLFWGEPLDGVAERIARLRALEQELGR
FT                   EHAPLEFGLRITTVVRDTTDEAWAAAEDKVAALSATGSGRRGNRPTAVGQQRLLDLAAR
FT                   GEVLDDILYTTPGRLGAGGAATTWLVGSAQDVAKALQRYEDLGVTHFVLSDTPYLPEIE
FT                   RQGRELLPLLRG"
FT   gene            complement(512457..513488)
FT                   /locus_tag="Xcel_0432"
FT   CDS_pept        complement(512457..513488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0432"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: rle:RL2983 putative
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29471"
FT                   /db_xref="GOA:D1BVW8"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVW8"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACZ29471.1"
FT                   /translation="MTTYRTLGRTGVHVSPLTLGTMNFGAWGGTSHDESIAVIHAALDA
FT                   GINVVDTADVYSAGESEEIVGKALRGRRDDVVLATKFHGRLGEDINHAGNSRRWIVREV
FT                   EASLTRLQTDHIDLYQVHRPEPGIDIDETLGALTDLVRQGKIRYFGTSTFLPGQLVEAQ
FT                   WVAEKRHRERPVTEQPPYSILARGVETEVLPIAQQYGLGVLPWSPLAGGWLSGRDEAAA
FT                   ANSPRRARKPGRHDPALPANVLKAAAVEGLEKLAAEAGLTLVQLALGFVLEHPAVSSAI
FT                   VGPRTRAHLDAALAATDVRLSSDVLDEIDRIVPPGVTLNPADAGYQPPSLTDAATRRRP
FT                   AAR"
FT   gene            complement(513490..514908)
FT                   /locus_tag="Xcel_0433"
FT   CDS_pept        complement(513490..514908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0433"
FT                   /product="monooxygenase"
FT                   /note="KEGG: scl:sce0168 monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29472"
FT                   /db_xref="GOA:D1BVW9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVW9"
FT                   /inference="similar to AA sequence:KEGG:sce0168"
FT                   /protein_id="ACZ29472.1"
FT                   /translation="MTHRPGHLILNAFLMSTGHHEASWRLPASPAGAESLSIAHFQQLA
FT                   RIAEAGTLDSVFFADSPQLWGDIGRRPAGTLDPIVVLTALAAVTERIGLIGTASTTYNS
FT                   PYNLARRFASIDHVSGGRAGWNVVTTAGPAAARNFGLDEQPLHATRYERAAEFLDVAFG
FT                   LWDSWEEDAVIGDKASGVWGDNDKVHAIDHVGTHFSVAGPLTTHRTPQGRPVIVQAGSS
FT                   EDGKELAARYAEAVFTAHQTFEDTHAFYLDLKNRAVTHGRDPEGIKILPGIVPVIGSTE
FT                   AEAQALERELDDLIVPRYAVAQLARTLRVSPDDLPLDGHLPADLPDEDEIEGAKSRYTL
FT                   IVQLARRENLTVRELVGRLGGGRGHRTFTGTPEQVADTIQAWYDDGAADGFNIMAPVLP
FT                   SGLETFVDHVVPILRARGLFRTAYEGTTLREHYGLDVPANRWTAARTPAATPAITQAAT
FT                   PATSPTASLATTGA"
FT   gene            complement(514905..515780)
FT                   /locus_tag="Xcel_0434"
FT   CDS_pept        complement(514905..515780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0434"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: scl:sce0167 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29473"
FT                   /db_xref="GOA:D1BVX0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVX0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ29473.1"
FT                   /translation="MAQDLGGLRRSAAEVRAEERGTRHSGAQPQSDPEILGLKGNHQAD
FT                   GPTDPVVVRDLVRAYGDAPVLDHLDLRIAPGEFVAILGRSGSGKSTLLRALAGLDRDVP
FT                   GTGEITVPRSVSVVFQDSRLLPWARVLDNVVLGLEASTGLSRAEARRAGAAALAEVGLA
FT                   GRERAWPGELSGGEQQRVSLARSLVRSPELLLADEPFGALDALTRTRMHGLLRDLLARH
FT                   RPAVLMVTHDVDEAIVLADRVVVLDVGRIAAERSPADHPDPRALRAELLAALGVENATP
FT                   DPHARQEIPA"
FT   gene            complement(515756..516619)
FT                   /locus_tag="Xcel_0435"
FT   CDS_pept        complement(515756..516619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0435"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: scl:sce0166 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29474"
FT                   /db_xref="GOA:D1BVX1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVX1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ29474.1"
FT                   /translation="MTATITAPGATSLRTSARPTTTADVRPAARTRLRLGRPIKGAGLL
FT                   GVTALALIWVVGAATGFIDPRVLSAPWTVVTTGADLIADGRLQENLLVSLHRSALGLFF
FT                   GVSIGLVLALIAGLSRLGDALLDGPIQVKRSIPNLALLPLLILWFGIGEEMKVITIAIG
FT                   VFLPIYIHTHNGLRSIDARFVELAETVSLPRAQFIRRVVLPGALPGFLLGLRFAVTGSM
FT                   LALVVVEQVNATAGIGYMMELARTYGQTDVIVVGLVVYGVLGFSADSAVRLLQRRALSW
FT                   RKTLED"
FT   gene            complement(516616..517740)
FT                   /locus_tag="Xcel_0436"
FT   CDS_pept        complement(516616..517740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mll9181 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29475"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVX2"
FT                   /inference="similar to AA sequence:KEGG:mll9181"
FT                   /protein_id="ACZ29475.1"
FT                   /translation="MPTHAPPSTSGRPRRATRTRSVAAAGAIAVVVGLLTGCSGRAQAD
FT                   TTTTAALTDPLPTSVPADTTLVIGDPTTQFALELAGDEIDAPLDFEVEWANISGGPQSL
FT                   EAFRARSLDVSAVAEIPSLQATWTGVPVRNIAALYKENWDTAPTYKLASAPGVTFDSLE
FT                   DLAGKRIAYSPGQAQGALVLKALVAAGLTQDDVTLVELPSTGDVYPTALAAKEVDVAPV
FT                   GGTAVKRYLGKYEADGAGAIDHHLRDDASHLYAPVEVLDDPAKLAALRQYVAAWAKAKI
FT                   WVSDHPEEWKQKYYIEDQGLNEEDAQYLIDHATVPDIPEDWAEGIERTQETIDLLSKEQ
FT                   EREPLVATDLFDTRFTEVAFQAAQEQREADGSAP"
FT   sig_peptide     complement(517606..517740)
FT                   /locus_tag="Xcel_0436"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 45"
FT   gene            518196..518294
FT                   /locus_tag="Xcel_0437"
FT   CDS_pept        518196..518294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0437"
FT                   /product="Protein of unknown function DUF1713"
FT                   /note="PFAM: Protein of unknown function DUF1713"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29476"
FT                   /db_xref="InterPro:IPR013177"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVX3"
FT                   /inference="protein motif:PFAM:PF08213"
FT                   /protein_id="ACZ29476.1"
FT                   /translation="MGSVIKKRRKRMAKKKHRKLLRKTRHQRRNKK"
FT   gene            complement(518397..519203)
FT                   /locus_tag="Xcel_0438"
FT   CDS_pept        complement(518397..519203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0438"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB (PSPase-
FT                   like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: afw:Anae109_1214 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29477"
FT                   /db_xref="GOA:D1BVX4"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVX4"
FT                   /inference="protein motif:TFAM:TIGR01490"
FT                   /protein_id="ACZ29477.1"
FT                   /translation="MSDAAAPRKQVAAFFDVDNTVIRGASAYHIARALYQRKFFGTVDL
FT                   VRFAIIQARYLMFGESKDQIDEVRSRALGLIAGRSVAEVTAVGEEVYDTVLELRIFPGT
FT                   KKLLDEHIAAGHQVWLVTATPVEIGRLIARRLGATGCLGTVAEHKDGYYTGRLIGDLMH
FT                   GSVKADSVRELAEREDLDLEASYAYGDSLNDLPMMVAVGHPCPINPDGRLRRHARDIGW
FT                   PIREFRGRRHRVAGRSVKTASWAGAAWVVGLVARAVQRQVRKRLAP"
FT   gene            519269..519511
FT                   /locus_tag="Xcel_0439"
FT   CDS_pept        519269..519511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0439"
FT                   /product="glutaredoxin 2"
FT                   /note="PFAM: glutaredoxin 2; KEGG: bxe:Bxe_A1082
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29478"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVX5"
FT                   /inference="protein motif:PFAM:PF05768"
FT                   /protein_id="ACZ29478.1"
FT                   /translation="MVLFTRAGCHLCDDAREVVARVCGTLGETWHEVDVDTGPESATLR
FT                   DRYGDYVPVVEVDGVQQGFWQVDGDRLARRLTGRR"
FT   gene            519549..520199
FT                   /locus_tag="Xcel_0440"
FT   CDS_pept        519549..520199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0440"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; Rex DNA-binding
FT                   domain protein; KEGG: sfu:Sfum_1603 redox-sensing
FT                   transcriptional repressor REX"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29479"
FT                   /db_xref="GOA:D1BVX6"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVX6"
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /protein_id="ACZ29479.1"
FT                   /translation="MIETGEAAVPAATVARLPHYLRALRDLQAAGVRTTSSTELAEASG
FT                   VGSAQLRKDLSYLGSFGTRGVGYDVGSLTAVIAGALGLGSTHRLAIIGIGNLGQALANY
FT                   SGYTKRGFEVVALLDVSPAVVGSRPSGGLAVEPLDELEKVIADKGVTMVVIATPGPAAQ
FT                   SVAERVVASGVREILSFAPVALQLPDDVVVRSVDVAGELQILAFHAAARAAAR"
FT   gene            complement(520278..520829)
FT                   /locus_tag="Xcel_0441"
FT   CDS_pept        complement(520278..520829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0441"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: bba:Bd2836
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29480"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVX7"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ACZ29480.1"
FT                   /translation="MATQLPGDLTAGTYVIDASHSTASFSVRHAGIAKVRGTIAIASGT
FT                   ITVGENLEASTVTAVLDAASVNTGDANRDQHLTSADFWHAEANPTWTFASTTVKVDGNE
FT                   LVVVGDLTINGVTNQVELPTEFAGTATDPFGNARAGFEAEIEISRADYGLTWNAALEAG
FT                   GFLVGDKVKIALDISAIKQA"
FT   gene            520938..521456
FT                   /locus_tag="Xcel_0442"
FT   CDS_pept        520938..521456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0442"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29481"
FT                   /db_xref="GOA:D1BVX8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVX8"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACZ29481.1"
FT                   /translation="MTEPRWLNERQQRSWRAYLEGTVRLVAALDRAHDDGVPLSLGEYH
FT                   LMVQLSEAPERTLRMSELAEYLALSRSRLTHTVDRMERRGLVERRPVPGDRRGVNCVMT
FT                   DAGWDLLVASAPHHVEAVRRFLVDVLTPEEFETLGRAMAKVAQEAKQAQDGKQAQDGKP
FT                   APEATQPPA"
FT   gene            521531..522181
FT                   /locus_tag="Xcel_0443"
FT   CDS_pept        521531..522181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0443"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: mno:Mnod_1087
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29482"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVX9"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACZ29482.1"
FT                   /translation="MVSTTVHLLRHGEVHNPGRVLYGRIAGYHLSERGHEMARTVATAL
FT                   SGQGRDVVAVIASPLQRAQETAAPIAAAFKLTTGTDDRLVEAGNRFEGTTIGAKPWQLL
FT                   HPRWWPLLRNPRTPSWGEAYREQADRMQAAVDDARRAHAGHEVVLVSHQLPIWVTRLAY
FT                   ENKKLWHDPRKRQCTLCSLTSLHFDDDELVGIEYSEPAGHLAASLSKGAWSVK"
FT   gene            522235..522765
FT                   /locus_tag="Xcel_0444"
FT   CDS_pept        522235..522765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0444"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen; KEGG:
FT                   scl:sce9086 thioredoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29483"
FT                   /db_xref="GOA:D1BVY0"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVY0"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ACZ29483.1"
FT                   /translation="MLVAGCAQESGAGDVVDAGFVSGDGSTQQWVPDKRKEPVVVEGED
FT                   FAGAAVSTADWAGDVVVINTWYAGCAPCRAEAPDLVALATEREADGVRVLGINTQDDAG
FT                   AAQAFERTFAVPYPSVADSSGQVIARLSGVVPLQAVPTTVVLDREHRPAARIIGQADPS
FT                   TLDAILDEILAEG"
FT   gene            522765..523517
FT                   /locus_tag="Xcel_0445"
FT   CDS_pept        522765..523517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0445"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: oca:OCAR_5474 C-type cytochrome biogenesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29484"
FT                   /db_xref="GOA:D1BVY1"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVY1"
FT                   /inference="protein motif:PFAM:PF02683"
FT                   /protein_id="ACZ29484.1"
FT                   /translation="MGNAFATTAFSGSMLLAVPVAILAGLVSFASPCVLPLVPGYVGYV
FT                   SGMAASNARGTRPARGRVLSGVALFVAGFTAVFVVLMAAAGAVGSYLVRWEDVLTRVLG
FT                   VVVILLGLAFLGGIPFLQRERRLHLSPRAGLWGAPLLGIVFGLGWTPCIGPTLGAVQAL
FT                   ALDEASVGRGVALGIAYCLGLGVPFLLVALGLQSSQRMLGFLRTHRLAIMRLGGGLLVL
FT                   IGLALVTGLWGTVTGAIQGWVGGWRTVV"
FT   sig_peptide     522765..522857
FT                   /locus_tag="Xcel_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.713 at
FT                   residue 31"
FT   gene            523517..525334
FT                   /locus_tag="Xcel_0446"
FT   CDS_pept        523517..525334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0446"
FT                   /product="ResB family protein"
FT                   /note="PFAM: ResB family protein; KEGG: dal:Dalk_1265 ResB
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29485"
FT                   /db_xref="GOA:D1BVY2"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVY2"
FT                   /inference="protein motif:PFAM:PF05140"
FT                   /protein_id="ACZ29485.1"
FT                   /translation="MGERMRYVPEGLIDPDPVVEPSPVVEPVETTSSSSDGVVSTSSTT
FT                   GGGGSTTGLPRIGVRGWLRWTWRQLTSMRVALLLLMLLAVAAVPGSVLPQRGQSPAAVL
FT                   QYLRDHPTSGEWLDRLGFFDAFTSPWFSAIYLLLFVSLVGCILPRAAQHARNLRGRPPR
FT                   TPARFTRFPAQASGTSSASPDDVATAVAAVLRRGRVFRVDVGAEEARGERPATRTVAAE
FT                   RGYLRESGNLVFHLALLGLLVSVAAGQLFHYRGQAIITEGRGFANAVVDYDTFDKGAWF
FT                   RPESLSPFSLTLDAFTSEFASDTVAFAQARDFTAFVTVTAAGGVGQSEHTIKVNRPLTV
FT                   DGAKIYLQGNGFAPEVTVRDASGEIAFAGRVPFIPEDSVYTSRGVIKVPDVAPGLEQIG
FT                   LTGYFLPTAVIDDDGSARSVFPQPDNPLLVLQVWTGDLGLDDGVPQNVYRLDTANMTAA
FT                   GDDSGSRAQVIVAPGETVDLPDGLGTLTLGADVPRYIALDLRYDPSLAWVLTFALLGLA
FT                   GLGVSLFTPRRRVWLRAWPLPDGGTRVELAGLARGDDAGLQGEVDRALAAVPGLTPDEG
FT                   TPTGPDHPAPDDSAPGAPPRVAHTQEDPR"
FT   gene            525331..526296
FT                   /locus_tag="Xcel_0447"
FT   CDS_pept        525331..526296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0447"
FT                   /product="cytochrome c-type biogenesis protein CcsB"
FT                   /note="TIGRFAM: cytochrome c-type biogenesis protein CcsB;
FT                   PFAM: cytochrome c assembly protein; KEGG: pca:Pcar_2228
FT                   ABC-type transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29486"
FT                   /db_xref="GOA:D1BVY3"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVY3"
FT                   /inference="protein motif:TFAM:TIGR03144"
FT                   /protein_id="ACZ29486.1"
FT                   /translation="MTTAELSTLLVWGAATALAIAMVAYAVDLARRTEVRAERRVAEPA
FT                   LVGSTTPGRDASATVPATVAGAAPRRRAAGIGSSTAWLGTALLLVAIVLRGVAAGRTPW
FT                   ANMYEFALTGSFVALAVYLGISTRRDVRFLGAFVTGLATLFLVLALNVFYVAATGVQPA
FT                   LQSYWLVIHVGVAITATGVFTVAFVTSALQLLRTARDGGSAWLGTWHWLDRLPTPVSLE
FT                   GLSFRLNAVGFVLWTFTVIGGAIWAEDAWGRYWGWDPKEVWSFVIWVVYAAYLHARTTR
FT                   GWSGSRAAWFVVVGYACVLFNFTGVNLIFNGKHSYSGLTD"
FT   sig_peptide     525331..525411
FT                   /locus_tag="Xcel_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 27"
FT   gene            complement(526323..526682)
FT                   /locus_tag="Xcel_0448"
FT   CDS_pept        complement(526323..526682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29487"
FT                   /db_xref="GOA:D1BVY4"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVY4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29487.1"
FT                   /translation="MPRVILTLAIIGLAVYALADLAGARKEETGGLPKWLWAVLIVAVP
FT                   LIGATAWIIFRRASGPVRPAQRGYGAYRPDGTPGKGPQRDGPLAPDDDPEFLWRLEQER
FT                   RRREGRKEDTGDTPA"
FT   sig_peptide     complement(526623..526682)
FT                   /locus_tag="Xcel_0448"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.982 at
FT                   residue 20"
FT   gene            526713..527012
FT                   /locus_tag="Xcel_0449"
FT   CDS_pept        526713..527012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29488"
FT                   /db_xref="GOA:D1BVY5"
FT                   /db_xref="InterPro:IPR025323"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVY5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29488.1"
FT                   /translation="MVAAYPGFVPLVVYTLLRLVVLVAAFFVILWAGAQPLVAGVLAVV
FT                   VASAVSYLFLRRQRDATAVWIAQRVERRKGATPRRGFARTVAEDEAAEDAATER"
FT   gene            complement(527165..528040)
FT                   /locus_tag="Xcel_0450"
FT   CDS_pept        complement(527165..528040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0450"
FT                   /product="1,4-dihydroxy-2-naphthoateoctaprenyltransferase"
FT                   /note="TIGRFAM: 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase; PFAM: UbiA prenyltransferase; KEGG:
FT                   mxa:MXAN_3530 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29489"
FT                   /db_xref="GOA:D1BVY6"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVY6"
FT                   /inference="protein motif:TFAM:TIGR00751"
FT                   /protein_id="ACZ29489.1"
FT                   /translation="MATPAEWVAGARPRTLPAAAAPVLIGSGAAALAGSFLVGRALLAL
FT                   GVALALQVGVNYANDYSDGIRGTDLDRVGPLRLTASGIARPGQVKTAAFAAFGVAGVLG
FT                   LLLTWLSGHWWLLAVGAVCILAGWYYTGGKKPYGYAGLGEVGVFVFFGLVATLGTTFTQ
FT                   AGRITGPSVLGAVGVGLIACALLMVNNVRDIPTDVVAGKRTLAVRLGDARARRAYVTMV
FT                   GLPLLLGALCAFWSPWALLVLLLGLPAVLLSLPVLAGARGRLLVPVLAGTGMYELAYGV
FT                   LLAVGLALGA"
FT   sig_peptide     complement(527939..528040)
FT                   /locus_tag="Xcel_0450"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.625) with cleavage site probability 0.581 at
FT                   residue 34"
FT   gene            complement(528135..529421)
FT                   /locus_tag="Xcel_0451"
FT   CDS_pept        complement(528135..529421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0451"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   scl:sce3015 O-succinylbenzoate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29490"
FT                   /db_xref="GOA:D1BVY7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVY7"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACZ29490.1"
FT                   /translation="MPATVSMLERQLRVALDGGPAVAPLPRLHDGDLPPGTALVVRTSG
FT                   STGTPREVALSADALRASATATHERLGGPGRWVLTLPATHVAGLQVVVRSLLAGDAGVP
FT                   SPLVAAAPDARFTPAALAALLAPALDDGAPVHVSLVPTQLHRILAAADDPATGPGGTGA
FT                   LDALARCTSVLLGGAATPAPLLARATAAGVRVVRTYGMSETAGGCVYDGVPLAGARVRV
FT                   VPQGAPTSSGDVGSGEVGVVELGGPMLAAGYVGDATATARAFRADDSPSPGSRGARWFR
FT                   TSDLGVLGPDGVLSVLGRADDVVVTGGVNVAPAAIEAVLAEVLPALLGVSAVEPCVVGV
FT                   PDDEWGHAVVAVVALRGASGYGTPDDVGGRSLAPLPGDLLAPVRAAVAERLGAASAPRR
FT                   VYLTDTLPVRGPGKTDRREVARAAAAAHP"
FT   gene            529519..530580
FT                   /locus_tag="Xcel_0452"
FT   CDS_pept        529519..530580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH0638 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29491"
FT                   /db_xref="InterPro:IPR021416"
FT                   /db_xref="InterPro:IPR023158"
FT                   /db_xref="InterPro:IPR035328"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVY8"
FT                   /inference="similar to AA sequence:KEGG:BH0638"
FT                   /protein_id="ACZ29491.1"
FT                   /translation="MTRRTLATVAGALTALLAVTACSAQEPPAVTVTATPESTATRGTP
FT                   PEPAPEPSVWPLTGVPADEVAQRPALAVKIENSREARPQTGLEYADIVWEEVVEGGITR
FT                   FVAIYHSQLPETVSPVRSARPMDPAIVAPLGGILAYSGAQPQFIDAINAAGIQSVIMDA
FT                   GHPGFARDRSRRAPHNVVGTLQTFLDQAAADRAVPPPAQFVYAEDPGQGTATVSGTAAG
FT                   QVAVTMSRGQRSVWDWNAERGVYELSNGATPSVSTSGARHSANNVLLIGAQMHNTPWLD
FT                   PAGTPVPETVLVGSGEGLLASGGKSVPVTWSKESTAALLVITDADGAEVQLEPGTTWVH
FT                   AVPVNSSGSWAIQ"
FT   sig_peptide     529519..529593
FT                   /locus_tag="Xcel_0452"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.930 at
FT                   residue 25"
FT   gene            complement(530841..531203)
FT                   /locus_tag="Xcel_0453"
FT   CDS_pept        complement(530841..531203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29492"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVY9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29492.1"
FT                   /translation="MTYTTTPVSVRTLEQRIRNLEGSGELALRRRIAMALVVVGQMLPE
FT                   GAIKGGSAMALRYGRATRFTRDLDAARVQTLAGFRSEFEESLARGWAGFTGRLITRPAP
FT                   RPTGVPPAYVMQSETA"
FT   gene            complement(531200..531742)
FT                   /locus_tag="Xcel_0454"
FT   CDS_pept        complement(531200..531742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_4574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29493"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVZ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29493.1"
FT                   /translation="MADEVRYRDIVREVALDHFGYVTTRAAAAAGVPAVELPKLAARGG
FT                   LENVAYGLYRVPDIPPHPFDQFAEALLRVGDGAYLHGESVLALLGLADVNARRIKVATP
FT                   RRARPTLPPFIEVTRTRAGEDTTVYEGLESQCVADAILECRDQIETRRLNDAAKAAREQ
FT                   GLLTTHEWHRVRKELQS"
FT   gene            complement(531823..532791)
FT                   /locus_tag="Xcel_0455"
FT   CDS_pept        complement(531823..532791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0455"
FT                   /product="naphthoate synthase"
FT                   /note="TIGRFAM: naphthoate synthase; PFAM: Enoyl-CoA
FT                   hydratase/isomerase; KEGG: sat:SYN_02400 naphthoate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29494"
FT                   /db_xref="GOA:D1BVZ1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVZ1"
FT                   /inference="protein motif:TFAM:TIGR01929"
FT                   /protein_id="ACZ29494.1"
FT                   /translation="MTSPLPPRVSETFDPARWRLVAGFEGLTDLTYHRGVERSGDGERD
FT                   LPVVRVAFHRPEVRNAFRPHTVDELYRVLDHARMTSDVGTVLLTGNGPSTKDGGWAFCS
FT                   GGDQRIRGRSGYQYTTAPDGGGDVETRDAVDPARAGRLHILEVQRLIRTMPKVVIAVVD
FT                   GWAAGGGHSLHVVADLSIACREHARFKQTDADVGSFDGGYGSAYLARQVGQKRAREIFF
FT                   LAREYSADDAERWGAVNEVAEHDDVETLSLDYARTIATKSPQAIRMLKFAFNLADDGLM
FT                   GQQVFAGEATRLAYMTDEAVEGRDAFLEKRDPDWSQFPHYF"
FT   gene            532903..533076
FT                   /locus_tag="Xcel_0456"
FT   CDS_pept        532903..533076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29495"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVZ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29495.1"
FT                   /translation="MSNLLTREVLDSAVIDRDVSQDLYTYDADVRGRDADGNTPRVIGT
FT                   LDFHPWLHEFTD"
FT   gene            533118..534167
FT                   /locus_tag="Xcel_0457"
FT   CDS_pept        533118..534167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0457"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: xcv:XCV3980 putative chloromuconate
FT                   cycloisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29496"
FT                   /db_xref="GOA:D1BVZ3"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="InterPro:IPR041338"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVZ3"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ACZ29496.1"
FT                   /translation="MSRGPVSSPVVWSTPLRTRFRGLDSRDGLLLRGEAGWGELSPFWD
FT                   YDDVESSTWLRCAREAAELGWPTPRRATVPVNVTVPAVGPDRARALVLASGGCRTAKVK
FT                   VAQRSTSSGAVHGPRGELEPLAAEVERVAAVRAALDELYGPGVGRIRVDANGGWTVDQA
FT                   VTHLRALDDAAGGLEYAEQPCATVEELAAVRRRLDVPIAADESIRRAADPLRVVALDAA
FT                   DVVVLKVQPLGGVRACLELAERVGLPVVVSSALESSVGLAAGVALAAALPELPYACGLA
FT                   TSQLLVHDVVADPLLPVDGALPVLAAGDPRLAPDAAALAEATPTDQVRADWLARAARLG
FT                   DLLAAEVVR"
FT   gene            534164..536200
FT                   /locus_tag="Xcel_0458"
FT   CDS_pept        534164..536200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0458"
FT                   /product="thiamine pyrophosphate protein TPP binding domain
FT                   protein"
FT                   /note="PFAM: thiamine pyrophosphate protein TPP binding
FT                   domain protein; KEGG: mxa:MXAN_3528
FT                   2-succinyl-6-hydroxy-2,4- cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29497"
FT                   /db_xref="GOA:D1BVZ4"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVZ4"
FT                   /inference="protein motif:PFAM:PF02776"
FT                   /protein_id="ACZ29497.1"
FT                   /translation="MSGRAAEPSATSAAIGAARALVAELRMQGVRDVVLAPGSRSAPLA
FT                   YALAQAADAGELTLHVRVDERAAGFLALGLARGTALPAHLWGAARPVAVVTTSGTAVAN
FT                   LHPAVLEAHHTGVPLLLLTADRPHELRGTGASQTTDHVGIFGTAVRFAADVPAPDGRDG
FT                   EVRDLLATAGRALAAALGLRDRNPGPVHLNLAYREPLHPTGPALPGVELSGAASASAPP
FT                   GTDITTSAAGVSGAGRAPARRDPDKPGDPDKPGDPDRPGGSDGAAQEVGPGSDGFRRAV
FT                   VVPPAPGPGSDPALYGDPARTLVVAGDGAGPAARALAEAQGWPLLAEPSSGACGGPNAV
FT                   RAYRSLLGVAELSGEVEHVVVLGRPTLSRPVQRLLARPDVVVTVVAPGGAPWPDAARNA
FT                   ERVVDALHERWFTPAPGERTFLDRWLAASQAAADVVVAATAPGASPDVDDAAARPAARF
FT                   DAEPFAALAVARAVAAATGPDDVLVVGSSSPVRDLDLVLGLDGEPGIVLANRGLAGIDG
FT                   TVSTAYGVALAAARQGRRTRALMGDLTFLHDVGGLLRGPLEPAADLQLVVVNDDGGSIF
FT                   ATLEHGELAAASEAGSRTFERIFGTPHGVDLGPLCAGYGVAHRLVGDVDGLREALAAPA
FT                   SGTEVVEVRVPRRDRLVEARALHQAIVAAARVAPAAAQGAPAN"
FT   gene            536292..538046
FT                   /locus_tag="Xcel_0459"
FT   CDS_pept        536292..538046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0459"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: afw:Anae109_2046 protease Do; PFAM: peptidase
FT                   S1 and S6 chymotrypsin/Hap; PDZ/DHR/GLGF domain protein;
FT                   SMART: PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29498"
FT                   /db_xref="GOA:D1BVZ5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVZ5"
FT                   /inference="protein motif:PRIAM:1.3.1.74"
FT                   /protein_id="ACZ29498.1"
FT                   /translation="MSTENHDQPVAPEGSAAAAPEPERAAAQQPQQSQPPQQGAAQPAT
FT                   AQPAPPQPAQPAATLPQPVQSVSAPTAHPQAHETQELHPQQHATAPYPQQYGAPQPPQQ
FT                   PQQPQPRYGQYAPHPGHGPYGHPGQPPAAVPPHAPYPQQGPAQPGSGFANPYAASSSGA
FT                   PGEPGEPRTTERAPRGWAPLITTAVITALLASGGTALAVTALQDDARPTSIAGIGDPGQ
FT                   VDTAPVTESTVTNPDWQAVTAAVSQSVVAIEMSSQQGSGLGSGLILDTDGHILTNNHVV
FT                   AGATDDVVQVTLTDGRLFKADIVGTDPTTDLAVVKLQDPPSGLRPVALGNSDALTVGEP
FT                   VLAVGNPLGLANTATTGIISALDRPVTASGDSSQEPVTTNAIQIDAAINPGNSGGPLFN
FT                   AQGQVIGITSSIATLSGGGSLTGQSGSIGLGFAIPVNLAKNISGQLIEDGAAQHAFLGV
FT                   SMTDGTATADGITRRGAQVRQVTAGSPAAGAGIQPGDVIVAIGDQPVSGASSLTGFVRE
FT                   QQAGQEVSLTVVRDGRALQLDVTLVVRDEPTQEPQPEQQLPQTPEGDQSEQGSSGGQGS
FT                   LWDRLFGN"
FT   gene            complement(538074..538784)
FT                   /locus_tag="Xcel_0460"
FT   CDS_pept        complement(538074..538784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0460"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mxa:MXAN_5545
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29499"
FT                   /db_xref="GOA:D1BVZ6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVZ6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACZ29499.1"
FT                   /translation="MSPALQRPAGRSGRTRLSPAERRQQLLALGVGWLTDRPLEAITVE
FT                   DLAGAAGVSPGLVFHYFGTRQGLHLEIVRTARDAMLHATEPDPALPARERLRDVLARFV
FT                   TFVQEHDATFYSVVRGASSGDPRVRETVQRARDVLTRHATAVVVELGVEPTPLVDVAVR
FT                   AWISLAEQALVDAASDDAIATEDLVAFLERSAFATVAAATGATTSDGAATSTGAATSTG
FT                   AATSDSTPKGPGVV"
FT   gene            538927..539520
FT                   /locus_tag="Xcel_0461"
FT   CDS_pept        538927..539520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29500"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVZ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29500.1"
FT                   /translation="MRLSSLTRTRKGRVLIALVPTVAALAFVGGGVAQGVVPVSMAVSG
FT                   QQFKISADKLQGTGFSQYAGVAVEADKKTQHPAAIANITEAKLYNLCQSIKTPFGVSLL
FT                   IEAGTNPQRPVEATGLQIGMDNLAGDATFNAIRIGVDASTVTTAGKGDAKDFAMDSDTV
FT                   TIDNLKQVSWSTQAAVFKLTDLKLGINMEGKECF"
FT   sig_peptide     538927..539034
FT                   /locus_tag="Xcel_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.464 at
FT                   residue 36"
FT   gene            539511..540914
FT                   /locus_tag="Xcel_0462"
FT   CDS_pept        539511..540914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29501"
FT                   /db_xref="GOA:D1BVZ8"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29501.1"
FT                   /translation="MLLRQRFRQWRQGRPFWGASLTILAGLELFVSSRLDLALGGMVLQ
FT                   FGFAGMQTTIIPLVMVLAGVLVMFQPVHHIFYGVITLALSVYSLVAVNLGGMGVGLVLG
FT                   VAGSIVVVSWMGRDDVAASPAPPPAGPAASNALADDDAVLLFDDGPPRDSSARWSVAAT
FT                   VSVALAASTLGGGTALGGPCILGFILCNLPTPSESPSPTPSDSEGTGSPEPAPPSPSDL
FT                   PADAGDGLGDGVGDVVGGVVDGVGDVVGGVVDGVGDVVDDVVGGVGEAAGAADGAADGG
FT                   TDAAADDGGDAASTDTGLTVDVPQDLPLPDDEALPVVLGGNEDVDVYAVPAELKATDLE
FT                   ISGIQAVALVSVPVGPGSGERRNAIKLVADHVRVTGFHLRTYAGANDRHAGTETTADYV
FT                   TMDGDATMYITSITLDGPDGNPLTIDADAPPPTLTSLVLAAVNPTVGLLGATSDSQVWS
FT                   GFHERVWAS"
FT   gene            540983..541657
FT                   /locus_tag="Xcel_0463"
FT   CDS_pept        540983..541657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0463"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpo:Mpop_2092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29502"
FT                   /db_xref="InterPro:IPR007367"
FT                   /db_xref="UniProtKB/TrEMBL:D1BVZ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29502.1"
FT                   /translation="MTAHEFDMRRVPLYSVAEAARIVGTPSSTLRNWAHGSVYKGLDGN
FT                   QHVAEALITTTGAGRGPVIPFVGLGEAYVRAAFRAAGVPMQRIRPALARLEKEFGLHQA
FT                   LARERLLTDGAEVLYRYSVEDTPELGELVVVRNGQGVFNEVVEQYLKTITYRDGLVAAI
FT                   ELPQFAPRVVVNPTQNFGQPTHSATGVPIHAIQGRLAAGEPAGEVGADYGISVADVLAL
FT                   AA"
FT   gene            541744..542082
FT                   /locus_tag="Xcel_0464"
FT   CDS_pept        541744..542082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29503"
FT                   /db_xref="InterPro:IPR041375"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW00"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29503.1"
FT                   /translation="MARHDDERKVCAAASEAIADVDWIREASELGEVILTKDVRIARVP
FT                   IEAAVVVNCDAKVFAMASSRITGPQMLERLLRHQEAIHRWARQAPPPFVVGVYENRIAR
FT                   LTLARLDV"
FT   gene            542271..543773
FT                   /locus_tag="Xcel_0465"
FT   CDS_pept        542271..543773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0465"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: reu:Reut_B3642
FT                   multi anti extrusion protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29504"
FT                   /db_xref="GOA:D1BW01"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW01"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACZ29504.1"
FT                   /translation="MQNLTVGPPTRLILAFTVPLLVGNVFQQIYVFTDAAVVGRLLGLE
FT                   ALAAVGASGSLMFLLIGFSWGASAGLAIPVAKAFGAGDMRGVRRYVAAGAYISAAIAAI
FT                   VTAVGVIFAKDLLALLNTPAEIIDMSATYLAVTFAGASVTVAFNFLSATIRALGDSKTP
FT                   LYFLMASSVLNALLVALLVGVFHWGVAGAAGATILAQGAAVAACLALVIRRMPALHLSR
FT                   EDWAAGRRALREPMRTGLPMGFQMSVIAVGALVLQLAVNGLGATAVGAFTASMRVDQLA
FT                   VAPLNSFGIAMVTFVAQNRGAHQWHRIRVATFRTSMVAVGVALALGAVLVTFSQPIIGL
FT                   FVGPDQPEVMAMARTFFLVSGGLYPVLALLFVLRNVVQGMGLSTVPTVAGALELVMRAL
FT                   AAIVLVGAFGWVGVAWAAPLAWIGALIPVALAWFRQRGLLLERERTDHATPRPPHEAAE
FT                   PAAPAPAPALAVAAAPAAAVIDVAAPPADALPTLAGPVPADT"
FT   gene            complement(544002..545345)
FT                   /locus_tag="Xcel_0466"
FT   CDS_pept        complement(544002..545345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0466"
FT                   /product="isochorismate synthase"
FT                   /note="TIGRFAM: isochorismate synthase; PFAM: Chorismate
FT                   binding-like; KEGG: scl:sce5042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29505"
FT                   /db_xref="GOA:D1BW02"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW02"
FT                   /inference="protein motif:TFAM:TIGR00543"
FT                   /protein_id="ACZ29505.1"
FT                   /translation="MSGSALPQPAFPAGSAPDGGRAVGAQPLVVRTAPISLPDGGLTTL
FT                   VDLLPDAKPLAWVRRGDGIVGWGEALRITTTGEARFSDADAAWQSLLDRAVVRDDVRLP
FT                   GTGPVAFGSFAFDATSDDGGVLVVPRVVVGRRGDRAWITTIAAGLDAAPTAALLDPARR
FT                   TPVTGPGAVTESDGAVAAADWPAIVADAVERIQAGRLEKVVLARDVVATTGRALDPRWL
FT                   LRRLAAGYEATWTFSVAGMVGATPELLVRSEKGLVASRVLAGTIRRAPGMTDDDALLHA
FT                   AQLARSSKDLEEHEHAVVSVARALEPFCTSMNVPEQPFVLHLPNVMHLASDVTGVLDRD
FT                   ATPSSLALAAALHPSAAVCGTPTVPARDLIREIEGMDRGRYAGPVGWTGADGDGEWGIA
FT                   LRSARLDDADPRRVRLFAGCGVVAASDPAAELAESEAKLVPMRWALRG"
FT   gene            545785..546480
FT                   /locus_tag="Xcel_0467"
FT   CDS_pept        545785..546480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0467"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   sfr:Sfri_0475 ubiquinone/menaquinone biosynthesis
FT                   methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29506"
FT                   /db_xref="GOA:D1BW03"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW03"
FT                   /inference="protein motif:TFAM:TIGR01934"
FT                   /protein_id="ACZ29506.1"
FT                   /translation="MARASLEKKPAEVASMFDGIAERYDLVNDVISLGQDRRWRKVVRD
FT                   SVAALPGEKVLDLAAGTGTSSEPFELDGAYVVPSDISFGMLSVGKRRRPDLPFVAGDAT
FT                   ALPFADGAFDAVTISFGLRNVVDTAGGLREMLRVVRPGGRIVVCEFSTPTWGPFRTVYQ
FT                   EYLMRALPVVAGAVTRDKGSYEYLAESIRSWPDQAGLAHLMLDAGWEHVAYRNLSGGIV
FT                   ALHRASKPA"
FT   gene            546698..547993
FT                   /locus_tag="Xcel_0468"
FT   CDS_pept        546698..547993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0468"
FT                   /product="geranylgeranyl reductase"
FT                   /note="TIGRFAM: geranylgeranyl reductase; PFAM:
FT                   monooxygenase FAD-binding; FAD dependent oxidoreductase;
FT                   Lycopene beta and epsilon cyclase; KEGG: lch:Lcho_0390
FT                   monooxygenase FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29507"
FT                   /db_xref="GOA:D1BW04"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW04"
FT                   /inference="protein motif:TFAM:TIGR02032"
FT                   /protein_id="ACZ29507.1"
FT                   /translation="MRAGSHDDADVIVVGAGPAGSSTAHWCASAGLDVLLLEKSAFPRD
FT                   KICGDGLTPRAVAELARMGVALDPDDGWIRNEGLRVLAGRRSWELPWPEVTAFPGYGSA
FT                   MARATLDHRLAQHAQRSGAKLVERTKVTGPLLDERSGRTVGVVAQSADRREVVYRAPVV
FT                   VAADGVSSRFATALGITRRDDRPMGTAYRTYFRSEGTSRHADAWMESHLELWSGEPGRS
FT                   DLLPGYGWIFALGDGTVNVGLGSVSSTPARQSAVGHDYRALLQQWTRNTPEDWGFTPEN
FT                   QVGPIRGAALPMGFNRTPMYRDGTILVGDAAGMVSPFNGEGIAYALQAGRVAADAIAQA
FT                   RTRTTDAAREAVLGGYAERMRADLGGYYTLGRAFVRLIEHPAIMRFGTRYALPVPVVMQ
FT                   FVVKLLSDCYEPRGGDWVDRLISALTRVVPAA"
FT   gene            548070..548432
FT                   /locus_tag="Xcel_0469"
FT   CDS_pept        548070..548432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0469"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3; KEGG: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3 ; K00330 NADH dehydrogenase I subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29508"
FT                   /db_xref="GOA:D1BW05"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW05"
FT                   /inference="protein motif:PFAM:PF00507"
FT                   /protein_id="ACZ29508.1"
FT                   /translation="MTNPYVPVLVLMAVAAVLALGGVGASAVIGPKRYNRAKLEAYECG
FT                   IMPTPHAVGGGRMPIKYYLVAMTFIVFDIEVVFLYPWAVSFTWLAGFGVVAALTFLALI
FT                   TVPFVYEWRRGGFDWV"
FT   sig_peptide     548070..548153
FT                   /locus_tag="Xcel_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.912 at
FT                   residue 28"
FT   gene            548445..548996
FT                   /locus_tag="Xcel_0470"
FT   CDS_pept        548445..548996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0470"
FT                   /product="NADH-quinone oxidoreductase, B subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: aba:Acid345_2252 NADH-quinone oxidoreductase,
FT                   B subunit; TIGRFAM: NADH-quinone oxidoreductase, B subunit;
FT                   PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29509"
FT                   /db_xref="GOA:D1BW06"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW06"
FT                   /inference="protein motif:TFAM:TIGR01957"
FT                   /protein_id="ACZ29509.1"
FT                   /translation="MGIEEAPSGFLLTTIEDLAGYLRKASLWPVTFGLACCAIEMMAAG
FT                   ASRFDLSRFGMEVFRASPRQADLMIVAGRVSQKMAPVVRQVYDQMSEPKWVLSMGVCAS
FT                   SGGMFNNYAIVQGVDHIVPVDIYLPGCPPRPEMLINAILALHQQIADAPLGVNRREAAQ
FT                   AAEAAALDATPTFQLKGLLR"
FT   gene            548993..549844
FT                   /locus_tag="Xcel_0471"
FT   CDS_pept        548993..549844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0471"
FT                   /product="NADH (or F420H2) dehydrogenase, subunit C"
FT                   /note="TIGRFAM: NADH (or F420H2) dehydrogenase, subunit C;
FT                   PFAM: NADH dehydrogenase (ubiquinone) 30 kDa subunit; KEGG:
FT                   sme:SMc01914 NADH dehydrogenase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29510"
FT                   /db_xref="GOA:D1BW07"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW07"
FT                   /inference="protein motif:TFAM:TIGR01961"
FT                   /protein_id="ACZ29510.1"
FT                   /translation="MSENDKPVVEPVEATSSGAGVVSTGSTTGGGSTTGGGSTAGGGST
FT                   TGSGSTTGTAGSRPQGEAFDVRQGMFGPGDTGDTSGYGGAVTVVRFPGASERPYGGWFD
FT                   EAVDVLAEVLAEQGIGFDQAIERVVVDPPGKHAELTLWVAREHLLAVARALRDDQDLRF
FT                   ELSLGVSGVHYPHDAGRELHAVYHLTSVTHGRRLRLEVATADADRHIPSTTSVYPTNDW
FT                   HERETYDFFGIVFDGHPGLARIEMPDDWPGHPQRKDYPLGGIPVEYKGATVPPPDTRRS
FT                   YS"
FT   gene            549841..551184
FT                   /locus_tag="Xcel_0472"
FT   CDS_pept        549841..551184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0472"
FT                   /product="NADH dehydrogenase I, D subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: sus:Acid_0111 NADH dehydrogenase I, D subunit;
FT                   TIGRFAM: NADH dehydrogenase I, D subunit; PFAM:
FT                   NADH-ubiquinone oxidoreductase chain 49kDa"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29511"
FT                   /db_xref="GOA:D1BW08"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW08"
FT                   /inference="protein motif:TFAM:TIGR01962"
FT                   /protein_id="ACZ29511.1"
FT                   /translation="MTAHTFQATRAADESMPAGAAYFEASGGDWDEIAREVVGEERIVV
FT                   NMGPQHPSTHGVLRLMLEIDGETVTEARAGVGYLHTGIEKNMEFRTWTQGTTFCTRMDY
FT                   LAPFFQEEAFCLATETLLGVTDDVPERASVIRVLMMELNRIASHLVCLGTAGNEMGATT
FT                   VMTVAFTGREEILRIFEAVTGLRMNHAYIRPGGVAQDVPEGIEDQVRKAVPQIKHYLGQ
FT                   LGDLMLANPIFKARLVGTGSLNLAGCMALGITGPVLRSAGLPYDVRKAFPYSGYETYDF
FT                   DVPVSENADCYDRVVLRLEECYQSLKIVEQALVRLEQNKGAPTMIADKKIAWPALLAVG
FT                   ADGQGNSLEHIKKIMGTSMEALIHHFKIVTEGFRVPAGQAWQTVEHPRGELGVHVVSDG
FT                   GTRPYRAHFRDPSFNNLQAVSVMCEGGQVADVVVSVASLDPVLGGVDR"
FT   gene            551181..552089
FT                   /locus_tag="Xcel_0473"
FT   CDS_pept        551181..552089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0473"
FT                   /product="NADH-quinone oxidoreductase, E subunit"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, E subunit;
FT                   PFAM: NADH dehydrogenase (ubiquinone) 24 kDa subunit; KEGG:
FT                   scl:sce4224 NADH dehydrogenase (ubiquinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29512"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW09"
FT                   /inference="protein motif:TFAM:TIGR01958"
FT                   /protein_id="ACZ29512.1"
FT                   /translation="MTYDAEVLTSLKSDAEAIVARYPDPRSGLLPMLHLVQSIDGFVSP
FT                   DGIRFCAEQLGLTPAEVSAVATFYTQYKRHPNGTYTVGVCTNTLCAIMGGDAIFDELSE
FT                   HLGVGHDETTEDGAITLERVECNAACDYAPVMMVNWEFFDNQTPESAAAVADDLRAGKP
FT                   VRPTRGADSVCTFKQMSRVLAGFPDGRADEGGAPGEPSLAGLRLARENDWTAPPVERAE
FT                   PSPVVEPAPPVVEPAPPVVEPVETTPKHDDEDSTSSTAGSAPADGPPTTGAPGSSAERK
FT                   PTTSSDVTPGDAPGAEKGEAR"
FT   gene            552086..553432
FT                   /locus_tag="Xcel_0474"
FT   CDS_pept        552086..553432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0474"
FT                   /product="NADH-quinone oxidoreductase, F subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: sme:SMa1525 NuoF2 NADH I chain F; TIGRFAM:
FT                   NADH-quinone oxidoreductase, F subunit; PFAM:
FT                   Respiratory-chain NADH dehydrogenase domain 51 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29513"
FT                   /db_xref="GOA:D1BW10"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW10"
FT                   /inference="protein motif:TFAM:TIGR01959"
FT                   /protein_id="ACZ29513.1"
FT                   /translation="MTTLTPVLTDTWDAERSWSLDTYLAHDGYEGLRKALTMAPADIVA
FT                   AVKESGLRGRGGAGFPTGMKWGFLPPDDGKPRYLVVNADESEPGTCKDIPLMMASPQHL
FT                   VEGVAITSVAINCHHAFIYVRGEVLHVYRRVLAAVQEAYDAGYLGKDILGSGFDLDVTV
FT                   HAGAGAYICGEETALLDSLEGRRGQPRLKPPFPAVEGLYARPTVVNNVESIASVPSIVR
FT                   NGAAWFASMGTEKSQGMGLFSLSGHVTRPGQYEAPLGITLRELLDMAGGIRAGHTLKFW
FT                   TPGGSSTPMFTDAHLDVPLDYESVGAAKSMLGTRALQIFDETTCVVRATSRWMDFYAHE
FT                   SCGKCTPCREGTFWMKQVLARIEAGGGVDGDLELLVDLCDNILGRAFCALGDGATSPVT
FT                   SSIELFRDEYQAHIDGHACPFDPTASALFAYTPKTRSGVMSTTGAVGGH"
FT   gene            553432..556038
FT                   /locus_tag="Xcel_0475"
FT   CDS_pept        553432..556038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0475"
FT                   /product="NADH-quinone oxidoreductase, chain G"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, chain G; PFAM:
FT                   molybdopterin oxidoreductase; ferredoxin; molydopterin
FT                   dinucleotide-binding region; KEGG: smd:Smed_3617
FT                   molybdopterin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29514"
FT                   /db_xref="GOA:D1BW11"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW11"
FT                   /inference="protein motif:TFAM:TIGR01973"
FT                   /protein_id="ACZ29514.1"
FT                   /translation="MTATADKSATGAPAPVETVTLTIDDVQVTVPKGTLVIRAAERVGI
FT                   EIPRFCDHPLLEPVGACRQCLVEVATPDREGNVRPMPKPQASCTLEATPGMVVRTASTS
FT                   PVADKAQEGIMEFLLMNHPLDCPVCDKGGECPLQNQAMSNGRPDSRFIDVKRVFRKPLP
FT                   VSTEILLDRERCVLCQRCTRFSDEIAGDAFIALQERGAHQQIGRFDVDVLGFAHEGVDG
FT                   EDDGAGTAAEPTTGDAARTPDGTPFASYFSGNTIQICPVGALTNASYRFRARPFDLVST
FT                   PGIAEHDSSGAAIRVDHRRGTVMRRLAGDDPVVNEEWITDKDRFAFQWQSAPDRITTPL
FT                   VREDGELRPASWVEALELAAEGLAAARERGGVGVLPGGRLTVEDAQAWSRFARTVLGSD
FT                   DVDQRARVHSAEEAAFLAHAVAGTGIGVTFGDLEHAPLVLLAGLEAEEEGGYLFLRLRK
FT                   AVRTNGLRVLGLAPFASRGLRRLHGTLLASAPGREAEWLGAVAAKAGGGLLPADLPADD
FT                   ARAIADAAAGLSEPGAVILVGERLAGSPGAYTAVQTLAAATGARVAWVPRRAGERGGLD
FT                   AGLLPGLLPGGRPLTDPAARAEVARAWGVDEATLPATPGRDLTGILAGLEDGSLGGALV
FT                   GGLELADLPDPAAARRALAAAGFVVSLEVRASEATTFADIVLPVAPPVERAGAWVSWEG
FT                   RVRAFPQALESAALPDHRVLTALAAQAGVPFDAGVVFPAWTGARADAPASEPADLPRLE
FT                   PGTVVLASWHLLLDDGALQDGEPHLAGTAKRPVARLSAGTAAAVDVFDGDQVTVSTERG
FT                   SLTLPVVVTEMVDHVVWLPLASKGCRVHDTLGASPGDVVHIAAATSPDHRGNGGAA"
FT   gene            556035..557345
FT                   /locus_tag="Xcel_0476"
FT   CDS_pept        556035..557345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0476"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase subunit
FT                   1; KEGG: mag:amb2780 NADH:ubiquinone oxidoreductase subunit
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29515"
FT                   /db_xref="GOA:D1BW12"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW12"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ACZ29515.1"
FT                   /translation="MIPGVQADFSADNGWTFLVKAVLILVFLLVSVLIAIWFERKVVGR
FT                   MQVRPGPNVHGPFGLLQSLADAMKLLLKEDMNVTAADRIVYLLAPMISVFCSLLVFAVV
FT                   PFGPEVRLPFTDWSTPAQLTDFPVAVLYVLACASVGVYGIVLGGWSSGSTYPLLGSVRS
FT                   TAQVISYELAMGLSLVSVFILAGSMSTSTIVEQQTSRWFFLPLLPAFVVYVISMIGETN
FT                   RLPFDLPEAEGELVSGYMTEYSSMKFAWFFLAEYINMLNVSAVAVTLFLGGWRAPWPLS
FT                   AINDGMLNTGWWPVLWFLAKVWLLMFVFVWVRGTLLRLRYDQFMVFGWKVLIPVALGWV
FT                   VLLSIVQYTRIGAGIDQGTLVTVLVIVGVVLVALITFWPEKAKPEEPAGPETFDAFADG
FT                   YPVPPLPGQVLPPSPRRRPVTVDATSATSDDSREETR"
FT   gene            557342..558244
FT                   /locus_tag="Xcel_0477"
FT   CDS_pept        557342..558244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0477"
FT                   /product="NADH-quinone oxidoreductase, chain I"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, chain I; PFAM:
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   sus:Acid_3879 NADH-quinone oxidoreductase, chain I"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29516"
FT                   /db_xref="GOA:D1BW13"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW13"
FT                   /inference="protein motif:TFAM:TIGR01971"
FT                   /protein_id="ACZ29516.1"
FT                   /translation="MSDYQPLRPTKGPLGKLLAPVAGFGVTLGSMFRPTVTEQYPFEKV
FT                   PTPRRYHGRHQLNRYADGLEKCIGCELCAWACPADAIYVEGADNADVLAETGGGQVSPG
FT                   ERYGRVYQINYLRCIFCGLCVEACPTRALTMSNDYELAGPTRAGMIYEKQDLLAPPAEG
FT                   TLATPHPMVEGTTDTDYYQGSVTAPTAEQVDWVREHRPDDPTLEAATAVVQGSRPAPQP
FT                   TVHTLRPPATKATATREAARGGHAGDRTTDAPGGPLSAALDAPGSTARARATVGPRLAA
FT                   GSAREGSTETGSTHEGGAR"
FT   gene            558241..559146
FT                   /locus_tag="Xcel_0478"
FT   CDS_pept        558241..559146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0478"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6; KEGG: cti:RALTA_A1043 NADH:ubiquinone
FT                   oxidoreductase complex I, chain J"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29517"
FT                   /db_xref="GOA:D1BW14"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW14"
FT                   /inference="protein motif:PFAM:PF00499"
FT                   /protein_id="ACZ29517.1"
FT                   /translation="MTTTAGEAALFGVLAPLMVIAALGLLFAKRAVHAAMCVVFVMISL
FT                   AILYVANEAPFLGIVQVVVYTGAVMMLFLFVLMLVGVDAADSLTETIRGQRWIGVLFGA
FT                   GLLVVLLTVLARTDLPPAIGLDLANAQTNPTGLAAILFGDYVIGMEVIGVLLVTAALAG
FT                   LVLTHRRRLGPRRSQRTMAAERVAGLPDGQVLTPLPAPGVYAQNNAMDTPALGPDGQPL
FT                   EHSVPRVLRIRGQQRTAADVLAAEETLRARLGLPAVATAEPAVPPVIEPGVRDGGGVVS
FT                   TGSTTGGGSTTGVDDEEVRG"
FT   sig_peptide     558241..558306
FT                   /locus_tag="Xcel_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.701) with cleavage site probability 0.281 at
FT                   residue 22"
FT   gene            559146..559445
FT                   /locus_tag="Xcel_0479"
FT   CDS_pept        559146..559445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0479"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   gbm:Gbem_3916 NADH-ubiquinone oxidoreductase chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29518"
FT                   /db_xref="GOA:D1BW15"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW15"
FT                   /inference="protein motif:PFAM:PF00420"
FT                   /protein_id="ACZ29518.1"
FT                   /translation="MDVTNYLVLAVILFAIGATTVLLRRNAIVVFMGVELMLNATNLAF
FT                   VTFARIHGDLTGQVLAFFVMVVAAAEVVVGLAIIVTIFRTRRSASVDDVNLLNG"
FT   gene            559544..561463
FT                   /locus_tag="Xcel_0480"
FT   CDS_pept        559544..561463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0480"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: ppd:Ppro_3182 proton-translocating NADH-
FT                   quinone oxidoreductase, chain L; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain L;
FT                   PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   NADH-Ubiquinone oxidoreductase (complex I) chain 5/L domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29519"
FT                   /db_xref="GOA:D1BW16"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW16"
FT                   /inference="protein motif:TFAM:TIGR01974"
FT                   /protein_id="ACZ29519.1"
FT                   /translation="MQTLGLAPWLVGFPLLGAAILLLGGRRTDRWGHWLGVVASTASFA
FT                   VGLTLLLGLLQRPAADRVQVHSLGTWLEAGPLSVDAAFRVDPLSLTFVLLVTFVGTLIH
FT                   VYSVAYMEHDKDRRRFFGYLNLFVAAMLLLVLADSYLLLFVGWEGVGLASFLLIGFWDH
FT                   RIENAVAGKKAFVMNRVGDMGLIVAMMLMVWQFGSVSFGDVLGAADGLQEGAATAIGLM
FT                   LLLAACGKSAQFPLQAWLGDAMAGPTPVSALIHAATMVTAGVYLLVRSAPVLEAAPAAQ
FT                   LVIVIVGAITLLFGAIVGCAKDDIKKALAASTMSQIGYMMLAAGLGPIGYAFAIFHLVT
FT                   HGFFKAGLFLGAGSVMHAMDDTVDMRRFGGLSRVLPVTAITMGLGWLAILGIPPFSGFF
FT                   SKDKIIEAAFVGEGWRPWVFGIVTLVGAGITAFYMSRLFFMTFAGRRRWPADDGGHGAH
FT                   DPRGAHDPHEAPALMVWPMVVLAVGSVGLGFLLQLGGRFTTWLEPVTGHVEHHDPVLPV
FT                   PVIMTTTLVLVVLGAWLAFRLYAMGPVPVEAPRSNVLVRAARRDLYQDPVNEAVAMLPG
FT                   QVVTRTLVYADRTAVDASFLQLASGVRRSGEGLRRAQNGYVRTYAATSLGGLLVVAAIV
FT                   WALA"
FT   gene            561480..563063
FT                   /locus_tag="Xcel_0481"
FT   CDS_pept        561480..563063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0481"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: dds:Ddes_1656 proton-translocating NADH-
FT                   quinone oxidoreductase, chain M; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain M;
FT                   PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29520"
FT                   /db_xref="GOA:D1BW17"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW17"
FT                   /inference="protein motif:TFAM:TIGR01972"
FT                   /protein_id="ACZ29520.1"
FT                   /translation="MSFPWLTALIAWPLVAALATATTGRGRTLGAGRARQVALVGSLVE
FT                   LALGVGAFLAFDTARAAEHQLLETHRWIPSIGASYAVGVDGVALLLVGLSVGLVPLVIL
FT                   AAWKEQGGDLARLRTYLATVLVLQSFMVAVFAARDVFLFYVLFEAMLIPVYFLIGGFGQ
FT                   GAQRRYAAVKFLLYSLAGGLVMLVAVIALYLQVPAAERGPQTFLVDNLSGLELGTTAGR
FT                   LMFCGFFLAFAIKAPLVPVHSWLPDVAENATPGTSTLLISVLDKVGTFGMLTLCLPLFP
FT                   EAARWAAPAVVVLAVVSILYGAILAIGQTDLLRLIGYTSVSHFGFIVLGIFTFTATGTA
FT                   GASFMMLNHGISTGALFLVAGFVIARHPERSQRIADYGGLRIAAPILGGSFLVAGLSAA
FT                   ALPGLATFGSEILVFLGAFSAVQWAGIVAVPAVVLAAIYVLLTYQRIFTGTVPAGLSPD
FT                   GRVPDLDGRERTVAGVLIALLLLLGFVPNLGLQYVDAPATTTIEQVGVDDPPPVLRAAP
FT                   APDGPKEVAA"
FT   sig_peptide     561480..561545
FT                   /locus_tag="Xcel_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.721 at
FT                   residue 22"
FT   gene            563060..564793
FT                   /locus_tag="Xcel_0482"
FT   CDS_pept        563060..564793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0482"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain N"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: gsu:GSU0351 NADH dehydrogenase I, N subunit;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain N; PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29521"
FT                   /db_xref="GOA:D1BW18"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW18"
FT                   /inference="protein motif:TFAM:TIGR01770"
FT                   /protein_id="ACZ29521.1"
FT                   /translation="MNDFIPPIIDWAAVSPVLIVLGAGVIGVLVEAFVPARARRVVQLA
FT                   LSLGALAGAVVAVGLLWETVRAGALLTVGDSYDLTPFGLAIQGIVAILAFLAVLVMADR
FT                   SGGQDAFAPTAAAVPGSRYEEDARRAGLEQTEIFPLTLFSTGGMLLFAATDDLIILFIA
FT                   LEVLSLPLYVLCATARRRRLLSQEAAFKYFLLGAFASALTVFGIALLYGFAGSVHLPVI
FT                   ADALAGRGDSPLAGLHVLAVTGIVLVSAGLLFKVGAAPFHTWTPDVYTGAPTPITGFMA
FT                   ACTKAAAFGALLRVLFYLGEGFDAPTRHEVQVLLWSVAILTMVIGTVVGVVQTDIKRLL
FT                   AYSSIAHAGFVLVALVAFDEVAASAVLFYLLAYGLATVGAFAVVSLVRERIATPGDGAG
FT                   SEQGALHDSVILGEATHLAQWAGIGRKAPWLTAAFVLFLLSMAGIPLTAGFVAKFGVFS
FT                   AAVSAGAWPLALAGVVASAISVFFYVRIIVLMVLTPAPDAAVTGQDDGAASAGTGAAPG
FT                   GGAAATLTQARPVARAVVTVLTGWGPATVVVALCAIGVVLLGVMPSWVLDLAAGAAKFV
FT                   P"
FT   gene            564790..565821
FT                   /locus_tag="Xcel_0483"
FT   CDS_pept        564790..565821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0483"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: tgr:Tgr7_3205
FT                   octaprenyl-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29522"
FT                   /db_xref="GOA:D1BW19"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW19"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ACZ29522.1"
FT                   /translation="MSLSHQPAASSAMAIPLSDPALAARLAERMAVVEQSLADAVANAD
FT                   RLADDVAHHLVAAGGKRLRPFLTLLAGELGDGARTELVDAAVVVELTHLASLYHDDVMD
FT                   SAPLRRGAPSVHSVWGNSVAILVGDLLFARASARVAGLGPEAVRLQAETFERLCLGQLH
FT                   ETTGPAEGEDPAQHYLQVLADKTASLLATSARLGAMFGGAPAEQVEVVAAYGEKVGVAF
FT                   QIADDVLDLASTGSESGKTPGTDLRERVPTMPVLLLRQRLARGEGDADDAALVAALDGD
FT                   LSSDAVLADVVERLRAHEVLTQTRELAARFAREAAAELAPLPHGPVREALESFATALTD
FT                   RAS"
FT   sig_peptide     564790..564861
FT                   /locus_tag="Xcel_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.845) with cleavage site probability 0.840 at
FT                   residue 24"
FT   gene            565944..572027
FT                   /locus_tag="Xcel_0484"
FT   CDS_pept        565944..572027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0484"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="PFAM: Fibronectin type III domain protein; SMART:
FT                   Fibronectin type III domain protein; KEGG: ade:Adeh_3063
FT                   VCBS"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29523"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW20"
FT                   /inference="protein motif:PFAM:PF00041"
FT                   /protein_id="ACZ29523.1"
FT                   /translation="MSVRGGPGGRKTVASTTALAVAAAGLVTAAVLYDGEAQAEVALND
FT                   SGVWVTKTSAGLVGRFNTQSQALDGVLLAGSSSFDVEQQAQRVFLTEPASASATVIDPA
FT                   HVELGGVVRAPKGSLIASGAATTAVLDPSSGHLWVLPFSSAASFDPDEHDPAATVKGPQ
FT                   ALTVSQDGTVLAVGSGSDPALVVVPTTANGTPDEAAEHDLAVDTGATLAVTAVGDKAVV
FT                   LDRTGGRVLLPGGDEVPLEGASEAQLQQPSAPSDHVLIATGTGLVSQPLGGGTAVTRRA
FT                   SGLPAAPVQLGGCAYGAWSGSGQVLRDCEGTDHDVDDTLEGLSADARLAYRVNRDAIVL
FT                   NDLASGTLWLAAEEFELVDDWEQTTPKDAEGESQESDETTPELVDQVITDRSLPNRPPV
FT                   AGNDELGVRAGRTTVLDVLSNDVDPDGDVLTAAVNGGPTGTVVPVLGGAALQADLPADA
FT                   TGTFSFSYTVSDGRGGTDQADVSVRVVPEDENAAPEQTGGKPVLVMARGGVASIDVLPY
FT                   FRDPDGDSLVLSSADATVAGDEARFRPDGRVELHDGGGSTGRKIVELTVTDDHGMSAEG
FT                   QLLVDVVATDEPPVPRNDHVVVVAGQAVTVEPLANDTDPNGDVLRLVRVDEQAPAQITP
FT                   NFAAGTFRFVSVEPGSYDITYQVSDGPNASTGLVRVDVVMPPDDAGAPVAVADEVLLPA
FT                   GGAALVDVLANDTDPAGGVLVVQSVNVPHDAGVTVAVLAHHVLRVTEVRRLAAPVRITY
FT                   TVSNGVRTSVGAVQVIPIPEPDTLRPPDAAPDEITVHTGDVVTIPVLANDTHPDGLELS
FT                   LAPELVETPDAALGEAFTAQNTVRFRAGDQAGTAHLVYEVTDPHGQRDSAQVTVRVVDS
FT                   VENAAPQLPDVEARVLAGGTVRVVPPLAGTDPDGDLVTLDAIATPAAKGSATIVDGAIE
FT                   YAAGATSSGPDTFTYRVVDTRGATAFGTVRVGIAQPADTNQPPVALDDAVRVRPGRTVA
FT                   VDAAGNDSDPDGDSIGLVPGSLEGAEELAAKVVDGKIVLTTTEEEGVRTLYYGVEDPFA
FT                   ARATGAVTVDVDSEAPLLRPVAYDDVVVPADVTGDTVTVEVLANDVDPDGVAAELEVSV
FT                   DEATLAAGVRVEGSSLVIPVAGRAQVVTYTVTDRDGLTARAFVRVPRDGTGPRLRDGLA
FT                   LEVVQGEPLTLELADVVVVGAERTARLTDEDQVAAVPGTVVVQDADTLTYTPPADHTGP
FT                   ATVSFEVADGPDGSPDTRTALLVAPVTVVAPDNLPPAFEGTPALEVAVGEEGTVDVARF
FT                   VRDPDGDPLTVRVTGEVQDLTTSVEGTRLVAQATTKLTKGARLTVPVEVTDGKNPPVAG
FT                   TVEVAVVASTRPLLVANDDVVDGAHQGAPVSVDVLANDSNPFEGGDRTVVSTTVETGTG
FT                   TAEVQGSDVVVTPDAAFVGRMVVRYTVADATNDEDRYVEGRIQLTVLGRPGTPKAPVVE
FT                   EVRSETVVLTWEPPIDNGSEITGYTVTADDGTTTDCPTTTCTIDGLTNTRTYTFTVTAT
FT                   NAVDDSDPSPASAPATPDASPDPPQPPTLEFGDQALTVSWTNATYTDRSQIQCVDLEIS
FT                   PAPASGAVEKTCLSANTVVWDGLENGTAYQVRARAKNDAPDPSEWGAWSDPETPAAPPE
FT                   APAAPDATRVDTALGGKVTVTWKEPAGNGDATHGYRLAVLKDGVQADLIEVTGLSAGVT
FT                   GLDPTASYTFTVVAWNKAGDSPASSPSAAVVPHGTPVVPGPVTASIPDPANTSGRLTVT
FT                   WTGIGGSEFYGPGPYYQVSANGGAAVTATSPHVYTGLSNGTSYTFRVRACNQYQCSAWS
FT                   AASNAQTPFTTPGTPGVSVTRSDPKHVTVTVSTPGNGGESIDKIEYRVNGGAWKTYSGA
FT                   TTAGGAYGTTYKVEARACNAAGCGGLGSGQYTTDHDPAGVSMVVSKGASTSGQDGCYDD
FT                   VYPDTQDCHRLHLEVRKGTRNTTVHYTCWTTNDYYGRAESPRQYAPTGNDVLSFTTDGN
FT                   GSFSGDLGCQHTYVGDSAWIKTYDPNWGESNHKPW"
FT   sig_peptide     565944..566033
FT                   /locus_tag="Xcel_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.977 at
FT                   residue 30"
FT   gene            572050..573033
FT                   /locus_tag="Xcel_0485"
FT   CDS_pept        572050..573033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0485"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; KEGG: bce:BC2117 MoxR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29524"
FT                   /db_xref="GOA:D1BW21"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW21"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ACZ29524.1"
FT                   /translation="MTSMTPEQAAWFAQTFDRLVGNVGQALLGKNDVVRLAFTCMLAEG
FT                   HLLLEDAPGTGKTAMARAMAATVHGSNNRIQFTPDLLPSDVTGVTIYDQKTGRFEFHQG
FT                   PVFASIVLADEINRASPKTQSALLEVMEEGRITVDGTGHSVGRPFMVIATQNPIEQAGT
FT                   YRLPEAQLDRFLMKTSVGYPDRASTMEILSGSAVRDRSTALQPVVTTQAVVEMADLAAT
FT                   AYVDQAVLEYISQLAEETREAPEVRVGVSVRGALALVRCAKVWAAAHGRHYVLPDDVKE
FT                   LAHPVWAHRFTLDAEAEFAGATPDAILARILTTVAAPQERAQAKAG"
FT   gene            573033..574298
FT                   /locus_tag="Xcel_0486"
FT   CDS_pept        573033..574298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0486"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   sus:Acid_7892 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29525"
FT                   /db_xref="GOA:D1BW22"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW22"
FT                   /inference="protein motif:PFAM:PF01882"
FT                   /protein_id="ACZ29525.1"
FT                   /translation="MARTDLPGTTRAAYATVRVALRRAWDPAAALLRRVTAPLTAVASA
FT                   YGIAAFVVAIAAWVAGLTLAWQELMVVAQVLSVTLVAAVAFVLGRFRYTVALDLAQSRV
FT                   TVGDRAVGRLVVRNETARALLPSVMEVPVGQGAAAFPVPRLRPGREHEEVFTIPTRRRS
FT                   VISVGPVRSVRADPLGLLRREMSWTEPQELYVHPVVKSLSGSSTGFLKDLEGRVTQDIS
FT                   NSDVSFHALRDYVPGDDRRHIHWKTTARTGQLMVRQFEETRRSHLAVLLSTRAEDYASD
FT                   DEFELAVSVCGSLGLQAIKEDRGVTVLVNSGSLRGDHRTRLLDDLARIERTPSRTRLAD
FT                   VARLAAHSVTDASVVAFVVGSGVPPADLRAASARMPQDVTVMALQCVPGASLSRRTIAE
FT                   LTVLTLGGLGELPLALRRVNEA"
FT   gene            574295..576841
FT                   /locus_tag="Xcel_0487"
FT   CDS_pept        574295..576841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0487"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; SMART:
FT                   transglutaminase domain protein; KEGG: cti:RALTA_B0173
FT                   putative protease, transglutaminase motif"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29526"
FT                   /db_xref="GOA:D1BW23"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW23"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ACZ29526.1"
FT                   /translation="MSERTPVNDPTSSGTTRGSRRVRGVSGTTTPGLTTASRRATAGDG
FT                   ADVQRARTLAGLADGLVMLLLLGAAAVGFGPAWGTTGYLLPTVGGAVLGLLVAWLAAVR
FT                   RWGAITTAVAAVVAYLVLGGPLALPGTTTAGVVPTLGTVRELALGAVQGWKEFVTTVPP
FT                   LHSFPELAVVPFLVLFLAALLAGTIAWRARWAAWALAPVGAALVTAILLGTVEVAFPVV
FT                   QGLVVAVVGLLWGALRVVEARVGRHTVTTEASREASRRLRWYRFRTGATILGVGAIAAA
FT                   LGAPVLTPAQPRTVLRTVIVPPLDLHEFVSPLTSFRRYANDERETELLRVTGLPAGQRV
FT                   RLATLDTYDGVVVDASSDQPGSGVYTRAGTEIATANPARSTTLDVEILGYSGPWMPEAG
FT                   SLTGIDWTGPRADELLAGTYYDELTRTALTTAGLRAGDTYRLQAQLVDAPGEENLLQAT
FT                   IATDTKVPPVDDSRMPVAAAAKAAQFMGEETDPVKRLFALRDGLIATGVLSSGLEDQAP
FT                   SRPGHFAERIDTLLGADEMVGDDEQFAVALVLMAREAGIPARVTMGFYADPEEDEREDG
FT                   ETYTVVGGDVHAWAEVPFDGYGWVPIDAVPDEDNKIQPEPQSQKVPKPPVLQEPEPPEE
FT                   PADDVPGEVQDEDEEEQEAEGFDWALAGLVAIAVGVPILLVLGPVLTVLALKARRRKRR
FT                   RTTGPFADRVSGGWREVVDTATDLGAAVPAGSTRRESAGTLATVLGDHGHVALAHRADA
FT                   TVFGATEPTNVDVEAYWQDVEAVVGRMRGSVNRRARWRAALSLRSLRAARTARATARAA
FT                   ARAGRLGVVGRPVASVLERLRLPHLPRLDPRKRNTR"
FT   gene            576838..578373
FT                   /locus_tag="Xcel_0488"
FT   CDS_pept        576838..578373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0488"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; Forkhead-
FT                   associated protein; KEGG: predicted gene, 100042292"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29527"
FT                   /db_xref="GOA:D1BW24"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW24"
FT                   /inference="protein motif:PFAM:PF06271"
FT                   /protein_id="ACZ29527.1"
FT                   /translation="MTDTTCAACGSTQAAGAAWCAVCGTAFPRTGAPAPAAPAPAAGPP
FT                   VPAVPAPVYTGTTEPERIAATVRGFSAPPPAPDPAPELAGTGRRFAAFVLDSIAIGLLP
FT                   VVVMVVGVVRSGIPLDGTVVMVSQAEADELVATLVRTYVLAGALALAGWVALVVVEGRT
FT                   GRTPAGLLLGLRTVDAQTLGPIGAGRAFLRWLIVSASGLALAVGQLLMLLSPAFDASGR
FT                   RQGWHDKAVRSVVLRHRGSQTTAPADATFGAPARGAAPQAAPAPPSTPTTPSTPTTPST
FT                   PTTQYPPPQAAPAPSAPAPSPAVPDPWAFPSPAPTAPAASSGLITGVPGRTDGPPAPAL
FT                   APAPVPPTPVAATAVAPAPAPAPSSSSSVAPAPAPAATSTPPAPSDLAEIDGETRMAPA
FT                   RPQVLVLELATGERHPVTARTLVGRNPQAPAGEPWDVVPVPDPTRSVSKTHAELHPDLG
FT                   GLWVVDRGSTNGTVVSVPGRAPQVAAPGSRVRITAGATLHVGDARIVIHPESS"
FT   sig_peptide     576838..576891
FT                   /locus_tag="Xcel_0488"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.701) with cleavage site probability 0.388 at
FT                   residue 18"
FT   gene            578370..579227
FT                   /locus_tag="Xcel_0489"
FT   CDS_pept        578370..579227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0489"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Protein phosphatase 2C-like; SMART: protein
FT                   phosphatase 2C domain protein; KEGG: rme:Rmet_2562 protein
FT                   serine/threonine phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29528"
FT                   /db_xref="GOA:D1BW25"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW25"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /protein_id="ACZ29528.1"
FT                   /translation="MNTLNGLESVVLRWGSATHTGARRALNEDHFLADGFAFLVADGMG
FT                   GHEAGDVASSTAIDALLPLTAGIQDALEGDGAAGVERLLATAHGRVAAIVTEPGKEAGT
FT                   TVSGVVLAEQDGVPYWLVVNLGDSRTYLLTDGELEQVSVDHSEVQELFDAGVITARETR
FT                   THPRRHVVTRALGPGAPCAADFWYLPVGEHDRVLVCSDGLSGELDDERIAQVLLEVPDA
FT                   QSAADRLVHEALAAGGRDNITVVVVDVTAAGDDDGKRTAPRGVLVLTDEDTRPRADLVT
FT                   EGER"
FT   gene            579224..580960
FT                   /locus_tag="Xcel_0490"
FT   CDS_pept        579224..580960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0490"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   Hypothetical protein CBG02561"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29529"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW26"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACZ29529.1"
FT                   /translation="MTVTTTAVAWYAGTGAAADSTVVRRGRTTVLLADDPAGAARAVWA
FT                   GAGARSPVTAVLDALASLPGTTLTTLPPFAAVTVADDGGAHVLVRGRFRAVLGTGAGSV
FT                   VVEAADVSTWHERRVADVTTVVLGTQPRAAAEVLADEAAWPLAEGVVRAGEVALEVVPG
FT                   AAGAPDADDAPATAQPTPTARPTPPVKPTPTVKPTPAAVELPAVLSVPEVETMLPTAGQ
FT                   DDADGVPEPDPAAPEPTAVPADEEAPAPEATQAGPVDVADDGYAHLWGATVMRTVEDAA
FT                   VRPEDDEEAAEEEGSAQPAAASPVAAPAAPAPALSPAPAPDPSPVGAGLIAGIPRTWAG
FT                   AQAGAQAGVQGGALGASLGTIAPPPAAPAPAPLAAPASPAAPPPPPPGDDETDHDGHTV
FT                   MSSALAHLRTGAAPEPAPAPPAPPVGAGPQVLARSCPDGHANPPSRDACRTCGAPLTQE
FT                   AGLAVRPVLGRVRVAGGPQLDLDRPLVVGRRPRTPRSSAGEMPRLVTVVSPNQDVSRSH
FT                   VEVRLEGWHVLVTDLATTNGTVLHRGGQPPQRLHPSEATLVVDGDVVDLGDGATLTFEE
FT                   IW"
FT   gene            580957..582663
FT                   /locus_tag="Xcel_0491"
FT   CDS_pept        580957..582663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0491"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: mxa:MXAN_0871
FT                   putative serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29530"
FT                   /db_xref="GOA:D1BW27"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW27"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACZ29530.1"
FT                   /translation="MSSKRAPSVPPHIDGFEYVSIVGSGGFSDVFLYQQLRPRRRVAVK
FT                   VLLSERSASQAAAFEAEADLMATLSSHPSIVTMYQADIASDGRPYLAMEYCSRPNLGAR
FT                   YRTERFSVAEALRTTIQVAGAVETAHRAGIIHRDIKPANILVTEYGHPALTDFGISSTL
FT                   DDAERAEGMSIPWSPPEAFLDPPRSGVATDVWGLAATLYTLLAGRSPFEVPGGANSTAD
FT                   LVSRIERTPLVPVGRSDVPASLERILATAMAKSAASRYATVLAFARALQHVQNELQLGV
FT                   TPVDLLDDTGHVQADVQPADRPDDDGDDDEPGTRLRSVVAIDAQGPAAQASGAQVLAAP
FT                   RGPSAFAPGAPGSGAPGSGAPGSGAAAVPAALAPASSAPSRPAASSYVPTLTPAASGWD
FT                   SRLDETVHKAAEPVVEEAPAPAAPEPRRWPAVVGIAALAVVGVVVAVALSRGGTAPDDA
FT                   TGTPGADVPTAQSVPQDNLTSLVPPVVNLTAGEPDGRTITFTWEPPSKALEGDTYAWRQ
FT                   LSLTGEEPLRPVEEPSVTVTATAPGEVCVEVVVLRNGKQSYQPQQECGVVE"
FT   gene            582660..583379
FT                   /locus_tag="Xcel_0492"
FT   CDS_pept        582660..583379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29531"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW28"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29531.1"
FT                   /translation="MTETGADTVPRLAVEFCGEWFHPDPEAPFDIGREADLDVDDNPYL
FT                   HRRFLRFTFEYGMWWLSNVGTMLSATVSQASGGVQSWLSPGHRLPLVVPTTSIVFTAGP
FT                   TTYELRVELEGAPYQTVGRDDSPVGETTIGAAVFTLSQKQLILSLAEPMLRREGTSLAE
FT                   IPSSAAAAGRLGWSPTRFNRKLDNVCDKLDRLGVKGLRGGPGALATNRRARLVEYAVAS
FT                   RIVTVEDLPLLDVAEDG"
FT   gene            583435..587871
FT                   /locus_tag="Xcel_0493"
FT   CDS_pept        583435..587871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0493"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; SMART:
FT                   Forkhead-associated protein; AAA ATPase; KEGG:
FT                   bcb:BCB4264_A2089 FtsK/SpoIIIE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29532"
FT                   /db_xref="GOA:D1BW29"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW29"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ACZ29532.1"
FT                   /translation="MRIKLTLNRPDASVADVAVTADATASVQDVAVALFGGDPVRAGSP
FT                   VPDRLTLQVEPTADGGQPRVLPPSSDLVTAGLRSGTAVSIVRVSEQFEAPGQARGTAVA
FT                   VLRVLAGPDAGSEFPLPAGTSYLGRDRGMDVRLTDPLVSKRHARITVGDSIEVSDLNSA
FT                   NGLVMGGERMSRAVVTSADLVVAGDTTFSIVALHRSTSIAPTSPVVEFNRSPRVVARFP
FT                   HDTLKAPKPPQPKQPFHLPWLAMVAPLILGGVMFAITRSVTMVVFLALSPLLMLAMYLD
FT                   NLIQERRRFRSESEAFHLSADALRETIARTHAVERAVRLAETPSVGESLDAVRRLGGLM
FT                   WTHRPEHEAFLTVRMGLGAAPSRTSVDGPSENDTLPEFWTRIDELQSLCATITDVPIVA
FT                   RLRVAGGFGVAGPDAVADAVGRAALLQLVALHSPAELVVAAITSPRSRTSWEWLEWTPH
FT                   TGSPHSPLGASHHLADNPGTALALLSRLEDLIESRGASLDTRAVLRGPLEEGKQGEVPA
FT                   PVLPSVVVLVEDDAPVDRARLIRLAERGADAGVHVMWVAPTVEQLPACCRTFVVVQDPA
FT                   GGTTGEVREGRLSYPVVCETVELPTAHEASRFLAPVVDVGAPVDDDSDLPRAVSYLALA
FT                   GTALRDDASSVVERWKENGSLTPRDGTPPQRRKKDTDLRALVGHNGVEPFHLDLRTQGP
FT                   HALVGGTTGAGKSEFLQSWVLGMAAAHSPDRVTFLFVDYKGGAAFADCVHLPHTVGLVT
FT                   DLSPHLVRRALTSLRAELHHREHLLNRKKAKDLASLERTGDPEAPPSLIIVVDEFAALV
FT                   GEVPEFVDGVVDVAQRGRSLGLHLILATQRPAGVIKDNLRANTNLRVALRMADESDSAD
FT                   VLGLPMAAHFDPSIPGRGAAKTGPGRITQFQTGYAGGWTRDQPDRPRIDVEEMSFGTNA
FT                   RWDVPAAEVEEVSDPGPNDIARVVTTISQAARAAGVPAPRKPWLDELALTYDLALLPNP
FT                   RTDDQLLLGVRDDPRAQTQPTYFYEPDRDGNLAVFGTGGSGKSTTLRTIAVSAAITARG
FT                   GPVHVYALDFGANGLRILEELPHVGAVVTGDDEEMVGRVLRMLTDVVEERSARYAAVRA
FT                   DSIGAYRRLADAPDEARILLLVDGVGPFREAYEWGPAWNQFTQVATDGRQVGVHIVVAG
FT                   DRANAVPASLGSTIQKRVVHRLANVDEYATIGEPGDVLGVTSPPGRAVVEGDELQVAVL
FT                   GGNANVALQARAAASLRQTMERMGVRPAPRLHRLPDLFALERLPVTAGGGAAFALDDLD
FT                   VAPVGLPVRGTLMVAGPPASGKTTALATIARALRRAGQGTLVHLALRRTALAGLDVWDR
FT                   GAYGEEDVADLLRELRSEVEDGAHAPGSLTVVLEGLTDFTDSDAEGAIDRYVRAAVRAD
FT                   LLVVGESETSTWGQSWTLAQPFKAGRAGLLLTPGDMDGDSLLNTSLGRIRAVDFPPGRG
FT                   FLVVGGKPRKLHVAMPE"
FT   gene            588008..588277
FT                   /locus_tag="Xcel_0494"
FT   CDS_pept        588008..588277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29533"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW30"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29533.1"
FT                   /translation="MAAGYLGLKPEDMQELIGVLNTKAGKINDIISRLSKEVRGTTWDG
FT                   PDAERFKNDWDSNLSVKLRNVQRSLEEIAKSAKSELNQQTTTSR"
FT   gene            588363..588629
FT                   /locus_tag="Xcel_0495"
FT   CDS_pept        588363..588629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29534"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW31"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29534.1"
FT                   /translation="MSGKLGMNVGDVRKLGKSLKADADELDRVVRDITRTLNKTYWEGK
FT                   DAQRFRNEWQGAHTKALKQVASALDTAGETARTNAEQQDQASN"
FT   gene            588749..589966
FT                   /locus_tag="Xcel_0496"
FT   CDS_pept        588749..589966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29535"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW32"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29535.1"
FT                   /translation="MSKLGADPAALRRLAATFERAGEGLEDDARSLARKIRSTGWDGAD
FT                   ARRYMAAWDQEHKPSLISVASVFAGAAKSLRDEAAAQEQASGLGGGSGGGSGGGGHAGG
FT                   GGGGGGGGGVGIKDPGTDAPHKYKPNSLLDGSDEKRYVYERGWEHTDTNGDGVVDGNDG
FT                   YTAIDHENHADDEKAARDEKTWRDKIGVDVKLAKVESSGFVGDQAGVGGAFGDESGVHG
FT                   QGAVNVHAGAGYDASAGVSLTDKGVQAKADVGVQIGVGANASGSVGYGEHVSASGNASA
FT                   HVGATAEASAGLTAGPGGLSAQVGANAMVGAEASASGKVEVGGVGVGGSVHAYAGAGIH
FT                   AEASAAFGPDKVGVKIDFGVALGVGAGASIDLSINPQEVVESIGDFASGAVDVAKDVGS
FT                   FLNPFD"
FT   gene            589997..590482
FT                   /locus_tag="Xcel_0497"
FT   CDS_pept        589997..590482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29536"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR019674"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW33"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29536.1"
FT                   /translation="MSAVTYPSPDFPAFAGISVDVPDGWEPRVLPAAQLVMVEPAGAGP
FT                   FRANVVVTVSRFAGEATLDAVAGQAVARMAGAPGFRELGRESAERGGFPTFRLSGSWTD
FT                   PQVGEVSQTVTLYEVAHHGVRDLVEVTTSSGGGEGAPAWPAVQAIQESVRVSTRATE"
FT   gene            590495..590974
FT                   /locus_tag="Xcel_0498"
FT   CDS_pept        590495..590974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29537"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR019674"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW34"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29537.1"
FT                   /translation="MPTVSYPSAQFPGFPSVEVPRPDGWSPLAAPQVLLAVARDGAPGE
FT                   FRANVVVTVTRLDADQTLGTVAKAAAAALESRRDYAERRRDGIGISGLPGYVVQGAWVS
FT                   ADAGTVAQDVRGVIVEHDGVRDLVEITATCGGGQVDPAWAELQTILDGIVIGVAR"
FT   gene            590971..591717
FT                   /locus_tag="Xcel_0499"
FT   CDS_pept        590971..591717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29538"
FT                   /db_xref="GOA:D1BW35"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW35"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29538.1"
FT                   /translation="MNKGVYRVLYRFAFVGLIGGVVVASVLRQPWGWWLFAAGCASVAA
FT                   LAVWAFTLVFRSTFAGQRKLLVPDAPVASPGSPSPLDVVLADLAALNSPDVPFEVTVTR
FT                   EGDGALVEARWLTEEMRWRTLFTRGSQVLAWRMEVRLDAGRATYKFVEYNASAAKEALL
FT                   TPAGTPGAHAAWNWKRGKTAFQFQLSGVITVGGEVETTRYDGPQSSWGGAIAIAPRDVK
FT                   IPVFRTLRNHGWRPPRDTAMARMFEG"
FT   gene            591756..592691
FT                   /locus_tag="Xcel_0500"
FT   CDS_pept        591756..592691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0500"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pub:SAR11_0932 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29539"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW36"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29539.1"
FT                   /translation="MRSRTFKAAVVGSALAGALLFGGCSVSVGNVTKVPEYVEVEAQGV
FT                   RLEVLDGMVESDVPVGFDAFWQNHDGGALVSVAVATFVDESTFVDDQVASLGEAMPDIT
FT                   TSDAGGGAVAFEGTGVDDSTYTGLIAVRDGIGVVVSAGEGVADAVVGHVVESVQATEGE
FT                   ATSEDEAASDDEAASGELADDGPVTTTVFTADDSVMVDVLEGMAEYPSDAYDGLWQTPA
FT                   GTSPQVTVSVSADVDPATYLQEQATAISSSMQNPVELDETEDRYVFSGTGVDGQEYTVV
FT                   VGVNGSVGVVASSGPGLDVEVLHDLVDSAW"
FT   sig_peptide     591756..591845
FT                   /locus_tag="Xcel_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.639 at
FT                   residue 30"
FT   gene            complement(592735..593343)
FT                   /locus_tag="Xcel_0501"
FT   CDS_pept        complement(592735..593343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0501"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /note="PFAM: peptidase A24A prepilin type IV; KEGG:
FT                   mpt:Mpe_B0304 prepilin peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29540"
FT                   /db_xref="GOA:D1BW37"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW37"
FT                   /inference="protein motif:PFAM:PF01478"
FT                   /protein_id="ACZ29540.1"
FT                   /translation="MSASGPTTARVLGRLATEVAPHRSAVLPLAVLALAWAGWASGPGW
FT                   ATPAYAVVGLAGAAHAVIDARTHRLPDAVTYPAVLLTAALLGLAAAATADGDRLVRALG
FT                   GAAALGGAYLALHLVNRRGLGLGDVKLAVLLGLPAGWAGWDTVWWTGVLPFLLGGVWAV
FT                   ALLVTGRANRRTALAFGPFMLAGAALTLAVVRAEASLGG"
FT   gene            593602..595020
FT                   /locus_tag="Xcel_0502"
FT   CDS_pept        593602..595020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0502"
FT                   /product="Ferredoxin--NADP(+) reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: ade:Adeh_3296 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29541"
FT                   /db_xref="GOA:D1BW38"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW38"
FT                   /inference="protein motif:PRIAM:1.18.1.2"
FT                   /protein_id="ACZ29541.1"
FT                   /translation="MTSTRPLRVAIVGAGPAGIYAADILSKTDLDVSIDLFERLPAPFG
FT                   LVRYGVAPDHPRIKQIIVALHKVLSRGDVRLLANVDYGVDLKLEDLRQFYDAVIFSTGS
FT                   IKDAPLPLPGVELDGSYGAADFVSWYDGHPDVPRTWPLEAKSVAVLGAGNVALDVARVL
FT                   AKHADDMLPTDIPANVYEGLKASPVTDVHVFARRGPAQVKFSPLELRELGHVRDVDIVV
FT                   YPEDYDFDEGSMAAIESSNQTKQVVKTLTDWTLVDPSTHTASRRLHLHFLHQPAAILDE
FT                   DGAGKVTALRTERTALQGDGSVKGTGEFHDWPVEAVYRAVGYFGSPLPEIPFDQDKGVI
FT                   SNREGRVVDMVGDHLHGVYTTGWIKRGPVGLIGHTKSDASETVRHLVEDVTGVGDGGDV
FT                   AAGDPAGGRTAPHGDPQAVLEFLTERGVDVVEWHDFALLDEHERSLGEPHGRERIKVVP
FT                   REEMIAVAKKRHSS"
FT   sig_peptide     593602..593667
FT                   /locus_tag="Xcel_0502"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.883) with cleavage site probability 0.838 at
FT                   residue 22"
FT   gene            595110..596009
FT                   /locus_tag="Xcel_0503"
FT   CDS_pept        595110..596009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0503"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: bxe:Bxe_A4413 heat
FT                   shock protein HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29542"
FT                   /db_xref="GOA:D1BW39"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW39"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACZ29542.1"
FT                   /translation="MGQRQHFNGVKTAALFGVMWAVVLGLGWLMGGGTPRFLWLFTAIG
FT                   LVMTFVGYWNSDKIAIRAMHAYPVTELEAPEMHRIVRELSTAARQPMPRLYISPTRAPN
FT                   AFATGRNPKNAAVCCTEGILSLLDERELRGVLGHELMHVYNRDILTASVASALAGVITS
FT                   LAQFFMFFGGGGRRDGGGNPLAGLAMVILAPIAATLIQLAISRTREYDADEDGAKLTGD
FT                   PLALASALRKLEQGTAAAPLPQTRELENVSHLMLANPFRGAGLAKLFATHPPMAERIRR
FT                   LEGMAGGTGFGEGGITRY"
FT   gene            596184..597521
FT                   /locus_tag="Xcel_0504"
FT   CDS_pept        596184..597521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0504"
FT                   /product="glycoside hydrolase family 5"
FT                   /note="PFAM: glycoside hydrolase family 5; cellulose-
FT                   binding family II; SMART: cellulose-binding family II;
FT                   KEGG: sde:Sde_0064 putative secreted beta- mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29543"
FT                   /db_xref="GOA:D1BW40"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="InterPro:IPR018366"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW40"
FT                   /inference="protein motif:PFAM:PF00150"
FT                   /protein_id="ACZ29543.1"
FT                   /translation="MAGVAATLASVAALLTAPVALAADGSGVGIHTEGTRLVEADGTEL
FT                   VLRGISHAHTWYASQTRAFADISDAGANAVRVVLSDGTRWTRNGADDVAAVIDRCWDEQ
FT                   LVCVLEDHDTTGYGEEGAASTLATAADYWVSLLPVLAGTEDHVIINLGNEPYGNDAATN
FT                   ERWADDTIAAIQRLRTAGFEHTILVDAPNWGQDWAGIMKRDAAQVAAADPQGDVVFSVH
FT                   MYGVYDTAAEVRDYLDAFIAAGLPLVVGEFGFDHSDGNPDEDTIMSYTRAQGIGWFAWS
FT                   WSGNGGGVEYLDMVTSFDPAQRTSWGTRVITGPDGLAQTSVRAAVFGGGDTGDGDGDDG
FT                   DGDGDGDGDDGGTEEPTGACTAVPRVSNTWQGGYQAEVVVTAAAAIGGWTVSLGVTPTQ
FT                   IWGAALTGQTASNESWNGSVGAGTSTTFGFLGSGTPPAAGTVPCAA"
FT   sig_peptide     596184..596252
FT                   /locus_tag="Xcel_0504"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            complement(597546..598457)
FT                   /locus_tag="Xcel_0505"
FT   CDS_pept        complement(597546..598457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0505"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; KEGG: mlo:mll1014
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29544"
FT                   /db_xref="GOA:D1BW41"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW41"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACZ29544.1"
FT                   /translation="MPAISSAATFPLPLPQSPPRLVATDLDGTLLRADGTISARTREAL
FT                   AAAEEAGVEVVFVTARPPRWLEPLAEIVGGHGRVVCLGGAAVWDLATGQALDVCGFDDD
FT                   DAAALVADLRAAVPGTAFVLERVDGPTFDHTYAGIETLETIQPSWLAPRVEDTLFAGAP
FT                   PVGKLLALAEEDLLAARVSGRQTAPRISTATQEKFFDVVRDVVGDRAQLAYSGGGGLAE
FT                   LLAPGVSKAAALARWSAREGIDAADVWAFGDMPNDLPMLRWAGVGHAVANAHPAVLAAA
FT                   DAVVASNDDDGVARALEAALTR"
FT   gene            complement(598633..599235)
FT                   /locus_tag="Xcel_0506"
FT   CDS_pept        complement(598633..599235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0506"
FT                   /product="ATP-binding membrane protein"
FT                   /note="KEGG: bsu:BSU03140 ATP-binding membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29545"
FT                   /db_xref="GOA:D1BW42"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW42"
FT                   /inference="similar to AA sequence:KEGG:BSU03140"
FT                   /protein_id="ACZ29545.1"
FT                   /translation="MLIWINGAFGAGKSHTAFELRRRLAEAHLADPELLGSALHRMLPQ
FT                   AMRGDFQDLPLWRSVVVETLHQAAASHAGPLLVPMTIVNDDYFDEIVGGLRERGVDVRH
FT                   YTLVASPATLRRRLGTRLGFIRSGGRRETWAMRQIPRCVEQLAQDRYGTHVRTDDRPLD
FT                   EIVEWIAADAGLDLVGPRLSPVRFQMRRLQVAAQLIR"
FT   gene            complement(599298..599984)
FT                   /locus_tag="Xcel_0507"
FT   CDS_pept        complement(599298..599984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29546"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW43"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29546.1"
FT                   /translation="MGIGRQVAPAANLDAFMDWALRDGARLSEHPAHGTVHKGAHNPRS
FT                   WHYDGLAVDVNWGPKGASAEEHQKATIATRVARRFGLGVIFAREGTVGSAKFHQDHLHA
FT                   DCGSTFNIGQGLVSFQSAPPLTTYRIQAALGAERDNSWGPLTDKRVVALRAASQFGGAT
FT                   FPFGVGFLQDVLQVEQTGEFDAASRQAHDRAVVAVQRALAVPPGGRWDAVTEEAYVAAR
FT                   RRFRHD"
FT   gene            complement(600044..600538)
FT                   /locus_tag="Xcel_0508"
FT   CDS_pept        complement(600044..600538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0508"
FT                   /product="protein of unknown function DUF520"
FT                   /note="PFAM: protein of unknown function DUF520; KEGG:
FT                   gsu:GSU3204 nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29547"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW44"
FT                   /inference="protein motif:PFAM:PF04461"
FT                   /protein_id="ACZ29547.1"
FT                   /translation="MADSSFDIVSKVDRQEVDNALNQAGKEVSQRYDFRNVGASIAWSG
FT                   ESILMTANSPERVLAILDVFETKLIKRGISLKSLDTGDKEPKPSGKEYRLAATIKEGLS
FT                   SENAKKITKIIRDEGPKAVKTQITGDEVRVTSKSRDDLQTVIALLKGADLDVALQFVNY
FT                   R"
FT   gene            600671..600754
FT                   /locus_tag="Xcel_R0012"
FT                   /note="tRNA-Tyr1"
FT   tRNA            600671..600754
FT                   /locus_tag="Xcel_R0012"
FT                   /product="tRNA-Tyr"
FT   gene            601024..601449
FT                   /locus_tag="Xcel_0509"
FT   CDS_pept        601024..601449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29548"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW45"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29548.1"
FT                   /translation="MVELVAVTRPLPDAPGFQFRNRWVDYALYTPGRYTTYSAMQSGQE
FT                   VARLEIDWKSGLYEGMDPVDGPLLEIEFLDVQEEWRRRGIGTLTVHEVARTHPGHRLMA
FT                   RSEDADDFWGSFGWARHDHADGPRWYRPIYLAPEGWR"
FT   gene            complement(601452..601730)
FT                   /locus_tag="Xcel_0510"
FT   CDS_pept        complement(601452..601730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29549"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW46"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29549.1"
FT                   /translation="MPEPETHPFGHLITRQVLTPRLQERLPAPVPTRCTARSYAGRVVA
FT                   VDGVVTHRAGRWLAFTADYADWGEWAAWVDRDCCEVLEDGDSGDTTR"
FT   gene            602281..603075
FT                   /locus_tag="Xcel_0511"
FT   CDS_pept        602281..603075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29550"
FT                   /db_xref="GOA:D1BW47"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW47"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29550.1"
FT                   /translation="MSISAREASLKRQATWVRRVRIAMIVVAAAIGIVEFLHGLHWWAA
FT                   PSPLLLSGRFLLVAGTAIEGGWGLRRGSAWDKYGEVKSKLEKQLVAAVAAISRETGIDV
FT                   EHLGVSAWAVEKSGGVETLVRQYTVRLSGYPPPTAVVWTKGKGVIGQCWETQSVASENF
FT                   GKLQERYPKDRPISNSAWAKVKQTGGFTQAEFPHRIHKYSQILAVPFGAVGTSAGGFVG
FT                   CLSLDISTERESGRSIDTTEVREILSRTGGLVREMLAEHGTV"
FT   gene            603081..603305
FT                   /locus_tag="Xcel_0512"
FT   CDS_pept        603081..603305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29551"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW48"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29551.1"
FT                   /translation="MEVVQLPSENQARRKIRAARAYIETLRRMHPDADVLRSLDRQERE
FT                   LDELEAMLDRADDIVRAPSARHLRETHPV"
FT   gene            complement(603369..606005)
FT                   /locus_tag="Xcel_0513"
FT   CDS_pept        complement(603369..606005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_03195 RTX toxins and related Ca2+-
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29552"
FT                   /db_xref="GOA:D1BW49"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR024361"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW49"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29552.1"
FT                   /translation="MLDIAPLAFVYNATVGSTPTHPQAFTVAAIDRAPRTWTAVSQAAW
FT                   LTVGTGAGTTDAQVDVTANTAALPVGVHTATITVTDTADSTSTTITVHAVVNPTVPVQV
FT                   TTWKNGHAGAFSLSTDDGYMSGVNRLDEDGNHGTYVMNAIIAPAEYADAFETGHEIGCH
FT                   LVHHVCELLSADAVHGEIVGNMPGAAAICGWDRLITLVWPCGFNPLWYGVKAWDYFLCA
FT                   RGYNINALEDPTPRDIMNIKSYNSHEHAPVPPADLKTIVDGAVAQGRWANLVLHAMTND
FT                   NGAINYAATQDVWVAPIGTVVKYIMQRDRTIIGGWTPGSGAATWTMRRLPMPATRLRDF
FT                   EQSMFDEDTLTVRVPVSSLGLGGTIDHVSAGATVVPHEIRTEGGTDYLYFDAQVPTVER
FT                   TIRVATTAFAGGVPDPAGPDPEPDELAWTDVPMSYPNRAAALADGWSFVGAAPNGTARN
FT                   TEDPSAVTYGESGVAVTVGPGDLWGTTNNSRNTLLRALPAGWQMVEATVAVDPTRNTEQ
FT                   AGVGLYVTDDNYVQLVKARNSGISRPDRPAVPGGWTDPLLVTVDENAGTIAESVLCSPA
FT                   DLLSVRIVRETTDTATVWFRTPHTDWLPAGVQTRIPAGARLMLFTGGSPDAGAITATFS
FT                   EVRIGATPPPPPSGNEARLGLWEVRMLVGTTPVTALALGEALIDIEDPDPLPPDPDPPL
FT                   VAPPGSHSVLESAEPPGAPAKYATGSVIRTASGFYTFGTEVGWKCIGAKVWVPAGAGMT
FT                   APITVGYWPKRSGQPGPDLGGDPLVSTQITTVVPGAWNVALWDDPIATVLEERFWIGYS
FT                   TAAGDHVYTGAAGSDWIQPVDGSEFVLMAATSTYGTRSYRALPGDTTYPEEDAGAYYAI
FT                   DALFTTE"
FT   gene            complement(606010..607323)
FT                   /locus_tag="Xcel_0514"
FT   CDS_pept        complement(606010..607323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0514"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29553"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW50"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29553.1"
FT                   /translation="MTQWTINTAIVLNQTSGQVALDLAGQTVQVVVRGTTTPYPIIETG
FT                   SLDPIPSSLLTVSPIGTLPPFIIDTDTPEDLYLDWRDSGSGAQGGIGFEEVMRTIAVQA
FT                   RDAAADAIVQAEAAQEAAVVAQTAAAGAVTAATTAIAGIPAQIGTQVVAAVTAQVAAAV
FT                   EPVATSAQAAATSAVASQLAAEVAASTAAGLASGVVRSVNGLPPNAAGNVTVATGGGGS
FT                   GGAVDAVNGHTGYVVLDADDVGARPAGVAIPVADIAATGTPSGSTYLRGDGTWSTPAGG
FT                   GGSGAVDSVNGQTGDVTLAAADVGALPSSTVYVASVAGKTGTVSLTKGDVGLSQVDNTS
FT                   DANKPLSTAAAAALAGKAEAGAVVFNTGNQTVGGTKTFTSAPVVPDNAFPIAKVSGLSA
FT                   TLASLVAGMGITAIVAITQSAYEALPVKSATTLYVITE"
FT   gene            complement(607333..607452)
FT                   /locus_tag="Xcel_0515"
FT   CDS_pept        complement(607333..607452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29554"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW51"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29554.1"
FT                   /translation="MPATEGAALHECVECGAEYRSSAAAEQCAVWDLETATFD"
FT   gene            complement(607455..607796)
FT                   /locus_tag="Xcel_0516"
FT   CDS_pept        complement(607455..607796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29555"
FT                   /db_xref="GOA:D1BW52"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW52"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29555.1"
FT                   /translation="MTAVIPADITAAAQRGFIRTACQSLSSAIPTAAVAVSLSGDWALG
FT                   VGLGVASAVVTAVLAGAASALSIVAKGIPEAYQAPPVDRPLTADERSIIRDLRLLEGRD
FT                   PDSGAVPEP"
FT   gene            complement(607793..608431)
FT                   /locus_tag="Xcel_0517"
FT   CDS_pept        complement(607793..608431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0517"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   pde:Pden_0267 peptidoglycan-binding domain 1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29556"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW53"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ACZ29556.1"
FT                   /translation="MSRLLTYLAAVHARGLRVAEHPAYGGVTKGAHTSSSYHYKGRAAD
FT                   LNFGAPGTPPEERPVLLWAARLADAAGLNVIYTPHRVHPIAKTAAAHRDHLHVDDGPIQ
FT                   AYKAPGRDDALYARILSERPTTTQEVTVNVTIGKVRKGDTGPDVRLLQGVLNVHGAGVA
FT                   AGVGVLALDDDFGDKTDKALRAHQTAHKIDVDGVAGADSWRTLLEDVPA"
FT   gene            complement(608507..608857)
FT                   /locus_tag="Xcel_0518"
FT   CDS_pept        complement(608507..608857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29557"
FT                   /db_xref="GOA:D1BW54"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW54"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29557.1"
FT                   /translation="MTGANGTPSQQWVTTDVSRLAESVQALAVQVAENNAILRTSMDNI
FT                   TRRVENTEEDVEELQKADIALREELAALALTVSSTADLLRTSIKVALWALGALVTIGGI
FT                   VLAWALPHIAWT"
FT   gene            complement(608854..610185)
FT                   /locus_tag="Xcel_0519"
FT   CDS_pept        complement(608854..610185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0519"
FT                   /product="Tail Collar domain protein"
FT                   /note="PFAM: Tail Collar domain protein; KEGG:
FT                   mrd:Mrad2831_5676 tail collar domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29558"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW55"
FT                   /inference="protein motif:PFAM:PF07484"
FT                   /protein_id="ACZ29558.1"
FT                   /translation="MASGIETSGPITGEPWTEEMLRIQIGAEAGIVADTNGSAYSLTLP
FT                   TGSDVAEVGSATLESTATVAGFAHRIPQGSTQSITIPASSNGTNGRTDVIALKYDPSLG
FT                   GESPGPIRLARIAGTEGSAALPTIDEGKPGVEYLPLWAVTRKSGQSLNQAAKKDLRRWT
FT                   GPNLFVPAGASLPTDVPLGTHAHRDPAEKYTRVMSGATPTWARLSVAAADLDPALKAAI
FT                   NAACPVGMEAGFHTVPPGWLEHNGAAVSRTTYPALFAHYGTTYGAGDGSTTFNLPNAKG
FT                   RTPVGLDTAQAEFNAVGKTGGAKTHTLSTAEMPSHTHTSAAHTHSINHDHAAVTSSSAG
FT                   SHTHGSSTSGITDRAYFARGSAPASSATVGTNGVTPGPWDYVVSSTLASAGAHTHTVDL
FT                   PSFSGTSGSTTPGATGSTGSGSAHNNLPPYLVRRWCVRALPVLA"
FT   gene            complement(610185..611354)
FT                   /locus_tag="Xcel_0520"
FT   CDS_pept        complement(610185..611354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0520"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cak:Caul_2110 filamentous haemagglutinin outer
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29559"
FT                   /db_xref="InterPro:IPR029432"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW56"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29559.1"
FT                   /translation="MSALWEIWPREPDLSRTADPVNGWSQLVLTERDSLPHTWTVTAPT
FT                   AVAATFLGGGGCILDRDGQQIVSGRLTGATGDLITATLTFEGDKARYWDRLAWPVPTHA
FT                   LAESPSTFGAAHDTRSGARETVLLAYLAANLGATALTARRMTDVTLPASAGRGGSTQIS
FT                   ARMDILGDLVTRLAENGGLILDLIHDESTGTPRLLATVTARTDRSDDVVFGAPQAARAT
FT                   SFVSNLTWSIQRPEYTDAVLFAAGDQSARTAALFQDVDAISDWAMHREGLVDYSISSNT
FT                   AEMTERATTALGDASAPVAVSFDVAQGGDLTYRTDYLLGDALGFELPAGLEALILDNRL
FT                   REVTTTVRAGQAEQVQLTIGTPGAQSTGTQASRILRAAMRRIANLERTR"
FT   gene            complement(611351..612295)
FT                   /locus_tag="Xcel_0521"
FT   CDS_pept        complement(611351..612295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29560"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW57"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29560.1"
FT                   /translation="MTYFVLASVLSAPVAPPSPASDQRKFWLESWDGKVTVPITTSPMW
FT                   RGPLDGSTGLDVAPTQVLTAVQPGVAGSMVTDVLTVERPVVLALDLRTTSKADQDEQLG
FT                   VLRDLVAPTTGMTRDGSFRLVCSGPAGVRQLGLVYQSGLEGDGKETPTFRRVVLNCVAP
FT                   QPFAEDRTDQQVPFRIAPTALTGIGGIWGEAGVSTSSVLSQDTPVEMWSAVPVYPTLTL
FT                   TGPAASILIEGDNGMRVDVPTGLSSGDTLVIVTDPRRKSIRLNGAPAAGKLARGSRTPA
FT                   FNLGTTLISVNALSATNATILTLGWRGLHRSLS"
FT   gene            complement(612292..617178)
FT                   /locus_tag="Xcel_0522"
FT   CDS_pept        complement(612292..617178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0522"
FT                   /product="phage tail tape measure protein, TP901 family"
FT                   /note="TIGRFAM: phage tail tape measure protein, TP901
FT                   family; KEGG: dno:DNO_0755 phage tail tape measure family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29561"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW58"
FT                   /inference="protein motif:TFAM:TIGR01760"
FT                   /protein_id="ACZ29561.1"
FT                   /translation="MTTRSYAVRLDAEYQALVRGFDEGAKAADKMADTVEKAGQRVERA
FT                   QKAQADAAGRARVAEQQLAQAREKGAADSAQVVGAEERAAKARRDLDKATKDVTQAEAA
FT                   HRSAQAAHTQATARQTTAVGKLTSTLDNNREAFNRAGTALAAFGAVTTATVGATVAAAV
FT                   QWESAWTGVTKTLPDDADLKATEDGLRSLAKTLPATHQEIAAVAEAAGQLGVSAQALLP
FT                   FTKTMIDLGETTNLTADEAATSIAQLANVMGVDLANEVDNLGASLVALGNNGASTERDI
FT                   VQMAQRIAGAGAIVGLSTGEVMGLANALASVGIEVEAGGSAISNVLTDIAKDVASGSED
FT                   VANWARVAGMSAQDFAAAWNADPTDALASFIEGLGRMNEAGEDVFTTLSDLGQSDVRVS
FT                   RALLSMATSGDMLRKSIQMGNDAWADNTALLEEAGKRYDTTEAKIQIARNSINDAAITV
FT                   GSAFLPVLAQGAEAVAGLANAFSELPEPVQQAIGGLGGIVGAAALVAGGFLLVVPRVVD
FT                   TVRAFRQLREISPGVATGLGKVGKAATAAGVALVALEVLDTIGSMSERAAAGIEQTTAA
FT                   LLDNAASVDALFAAVDAGRNEGAWDWGRLFSSRTDQATEINTLADAIDRLVNPSVTQKM
FT                   GDWAETVPLLGKIVSVNDGKNASAQITALGESLAYLVQSGHADLAADRFADISAQWTDA
FT                   GGSLDDLNALMPAYGDALTAVDSEQKLAAESAEDMSEATSQVAEMTEEAAAALQKWREM
FT                   VAGAHVSFRDLGGAWQAAIDQQREYAEQTAKATKSSKDSWEDYYDGVSVSADQWIEQLQ
FT                   KQAEAQARWRDNVLKASEQVREELPANMTAAADAMIDDLIARGPEGAEMLEAFVTAKPE
FT                   QRARIVETWTSMGEDIVHDLENIRTPQITVEANTRLAVEQTNDLLGVIDSARGTVTLLG
FT                   NGAPVVAELGAVTATVDAASGTVTIYGEDGEALTTLSDYTATIDATDGTVQITGNDENG
FT                   RNVVVGLTDWVTQQGASITVDASTTEATLAVNAWREAMAARSVTIQVRANMPDLNGTAS
FT                   GNGRMGSYSSGGHTGAGGKWEPAGVVHKGEFVIRQESTRAIDAAYPGLLDAMNSGGLTA
FT                   FGLGGFASGGYTFGAPSTKGKDAAYWRDAFMDFPERYRLLEQIWKMQTDLADKTGLARQ
FT                   AAEQEISRAETKLSEAEYAATVANGDPRYWDGVVAAQAEAKKKDEAAQAEAKKKDEAAQ
FT                   ESAARRADTARDIGTSMRRGEYVSQATSGLSGAYGLVDTLYAQSRNTDLSASSQKSLAG
FT                   AAAAAEGQFTSLYAQLDKVNAAVDEQSDLVGDLQRAYDQVKNAISGAFDLQGVARQQDQ
FT                   LVSAAQSAREKADALKNDVVYEAHTNEQGETYYTSRLSDEAVQAEKDAQAAEKAAAGAG
FT                   TGASYLKAAQEYAGKVQTLAGKIQALVKRGVPTRIIQEILAFGVDGGAIDAATAIGSLS
FT                   DADLGKLSTAYQQIDAYSGQIGQYTTATMAAGGLAGQSSVLTGLQGQASGLEAQIAGVG
FT                   KAVEDAIATAFGLPKRAAGGPTVPGQTYWVGERGPELWTSAAAGFVLDAATSRNLAMAT
FT                   PAGGYGAGRYGQAAPQVTKTYSATVNTLQATPAQVLAAVKQAELQDVMP"
FT   gene            617306..617557
FT                   /locus_tag="Xcel_0523"
FT   CDS_pept        617306..617557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29562"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW59"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29562.1"
FT                   /translation="MLVLLVAVGVEVHRHGQDREAAGRACVEQAAYKYLPGMTLFRTYV
FT                   GEPNPGRFEYRIVDIEANRPLTCLVEKRDGAWVASYLG"
FT   gene            complement(617631..618410)
FT                   /locus_tag="Xcel_0524"
FT   CDS_pept        complement(617631..618410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0524"
FT                   /product="prophage antirepressor"
FT                   /note="PFAM: BRO domain protein; phage antirepressor
FT                   protein; KEGG: mca:MCA2642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29563"
FT                   /db_xref="GOA:D1BW60"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW60"
FT                   /inference="protein motif:PFAM:PF02498"
FT                   /protein_id="ACZ29563.1"
FT                   /translation="MTTDLQQFDFHGAGVRIITDEHGDPWFVAADVAAALSLGNIHSSL
FT                   SLLDDDEKGLHTVETLGGAQTTSTVNEPGLYSLVLRSRKPEAKAFKRWVTHDVLPAIRK
FT                   TGSYGVPALTGPELMARALIEADATIKAAHAELAVARPKVEAFDAFLSTDGDYSVRDAA
FT                   HVLSRHHAILTGEKRLRDWMLTAGWLYRDPTGAPRAYQRRIDAGHLVEKAQWHYRPDNG
FT                   EKVTDPPQVRVTPRGIEALAKALTKVTAQGELTITAS"
FT   gene            complement(618407..618727)
FT                   /locus_tag="Xcel_0525"
FT   CDS_pept        complement(618407..618727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29564"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW61"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29564.1"
FT                   /translation="MNTIVPSPTPRTIFSDGFTSDGITFTAQRGFITDLYPAEQTHDGN
FT                   WEPATVETHGATEADGTARVRVLISETPTLELTQTQAVLLATHLLATLAEQGIAIQHGG
FT                   AL"
FT   gene            618877..619068
FT                   /locus_tag="Xcel_0526"
FT   CDS_pept        618877..619068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0526"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /note="PFAM: Prophage CP4-57 regulatory; KEGG:
FT                   dac:Daci_2613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29565"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW62"
FT                   /inference="protein motif:PFAM:PF05930"
FT                   /protein_id="ACZ29565.1"
FT                   /translation="MDEPLMGNAEVAALLGVSRQRVHQLTSRPDFPAPIAVLAMGKVWR
FT                   TADVLAWAEATGRELRHG"
FT   gene            complement(619065..619433)
FT                   /locus_tag="Xcel_0527"
FT   CDS_pept        complement(619065..619433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29566"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW63"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29566.1"
FT                   /translation="MYLGVAEPGGAWSDRDRALAEVLLLHERSACPGCAMPKHTAWDPR
FT                   SEGEWTVDKHTCQACAERDRVSQAAKDTPGQYLTVHPYRVGDAAAAQTSAAQAIAADEQ
FT                   HTAARAAAQRAAAAEKSI"
FT   gene            complement(619478..620206)
FT                   /locus_tag="Xcel_0528"
FT   CDS_pept        complement(619478..620206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29567"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW64"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29567.1"
FT                   /translation="MRSEKSITDDVQPTEQDTTAVSEPALDLDSWISGIAPTERSVPIY
FT                   GNTQVFGEAEHLKRELATLEAEHAAEFDESIVAGTRVQEILERLAELWEVQQASKTTWY
FT                   VTALDAQTVKAINKSHPVPDPLPEPEAPSKGAPVSVRGQYETAHAAWERKNPKHEEKRA
FT                   AALNERNIAHVAAAVVRVEDRHGNVIATGATVAQLKAMEAKPQGPLQVGRLLQATAEAK
FT                   FGEPVIDAPFSYRTSRGGQG"
FT   gene            complement(620304..620816)
FT                   /locus_tag="Xcel_0529"
FT   CDS_pept        complement(620304..620816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29568"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW65"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29568.1"
FT                   /translation="MARIVDLGVTQYTWVPGVAGLTTPSAPLLADLSGAPAKNISQYVV
FT                   TTTDVNPDPSDTVNERAVTDTSNAVVPTVGNYHGNLVLFRDFTAGAPTANDPITVFGSG
FT                   DYGWLVRRLGKPASTALAADDIVDVFLFLVDNVTKTGGTGDGYLKANITLLQQGQFYTD
FT                   VAVVAGT"
FT   gene            complement(620818..621006)
FT                   /locus_tag="Xcel_0530"
FT   CDS_pept        complement(620818..621006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0530"
FT                   /product="TolA protein"
FT                   /note="KEGG: ccs:CCNA_03339 TolA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29569"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW66"
FT                   /inference="similar to AA sequence:KEGG:CCNA_03339"
FT                   /protein_id="ACZ29569.1"
FT                   /translation="MAKHTPTPEAGFQPIEVTPVTHDGFKPIEVTPVPAPAEPKPAAPA
FT                   PVPTPPKPAKPAENKEA"
FT   gene            complement(621078..621482)
FT                   /locus_tag="Xcel_0531"
FT   CDS_pept        complement(621078..621482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29570"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW67"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29570.1"
FT                   /translation="MTAPDVLHTALMTRLRAITSLQVFEFQVPDKPPADGQGRVYPYAV
FT                   VWPGAGTPGPESTVTGASGDMWAASVNVAAGDPAWVLPAVTLVRQALSLLTLAPGITLT
FT                   EVPLGGVVTKDPDVAPARWFLPTSWAALTP"
FT   gene            complement(621479..621832)
FT                   /locus_tag="Xcel_0532"
FT   CDS_pept        complement(621479..621832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0532"
FT                   /product="phage protein, HK97 gp10 family"
FT                   /note="TIGRFAM: phage protein, HK97 gp10 family; PFAM:
FT                   TP901-1 ORF40 family protein; KEGG: nar:Saro_2728 phage
FT                   protein, HK97, GP10"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29571"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW68"
FT                   /inference="protein motif:TFAM:TIGR01725"
FT                   /protein_id="ACZ29571.1"
FT                   /translation="MGFDVHGLRRLAADLRDVAAQAGPVVDLVVRKTAFDIERDAKILA
FT                   PVDTGNLRTSISTDVAATNSTVSAEIGPTANYGLFLEVGTSRMAPRPYMGPALDRNTPA
FT                   FDAAMAQIVDRFS"
FT   gene            complement(621832..622272)
FT                   /locus_tag="Xcel_0533"
FT   CDS_pept        complement(621832..622272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29572"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW69"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29572.1"
FT                   /translation="MPLDTTHPVHPDWAAHYQPVSQRTMNATVTVTDGTTGGGWDPVTG
FT                   PIPDAPVVVYTGKARVAYKPVRAEDRDAAGQRVTVRDVTVAVDRDACPELATTARVKVT
FT                   AVDANGPAALAGRTLAVQSTAWPSHALEQVITCTDDQTNQGA"
FT   gene            complement(622278..622661)
FT                   /locus_tag="Xcel_0534"
FT   CDS_pept        complement(622278..622661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29573"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW70"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29573.1"
FT                   /translation="MDYTTAVAQVRLLIADVATDETKRVLTDAHVGGFLTLQGAAPEDG
FT                   AQSWQVRRAAADALTTIAASETLIGKYVRTADGLTTDGTKVGAELRAQADRQLAIADRE
FT                   EADHDAADGAFGVLEFQPYPRGR"
FT   gene            complement(622749..623897)
FT                   /locus_tag="Xcel_0535"
FT   CDS_pept        complement(622749..623897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_2821 peptidase U35, phage
FT                   prohead HK97"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29574"
FT                   /db_xref="InterPro:IPR018774"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW71"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29574.1"
FT                   /translation="MDNIQILDGQAAVAEGEKTGGEGGFRAPARGDQYRARLVEAANLW
FT                   HDVMYSSGLNAMRARVKLVESLSTSDFPYLLGGVFDRVLMAQYEQIPSVWAKFAGRTTV
FT                   RDFRPKSLVDLLGGRAILDPVGEGAEYKARKLTEAKYELKVAKRGARIPLTWEMIVNDD
FT                   LDAFRDLPQRLAQAAVDTEDYLAAALLVKSSGINADFFKAGNGNAADNKPLNVANLDAA
FT                   VTAIGQRKDSEGRPIVASKLSLVVGPGLETTAAKILEAVEIQFTDDAGTVKTGNYLRGK
FT                   VQTVVNPWLPVIDKSATAGTSWFLVPTPGQSREALTMGFLRGHETPDLRVKADTGNRVG
FT                   GGAIAPEDGSFDDDTIQFRGRHVVGAAHVDPKATYASTPPAS"
FT   gene            complement(623911..624240)
FT                   /locus_tag="Xcel_0536"
FT   CDS_pept        complement(623911..624240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_3336 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29575"
FT                   /db_xref="InterPro:IPR011231"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW72"
FT                   /inference="similar to AA sequence:KEGG:Nham_3336"
FT                   /protein_id="ACZ29575.1"
FT                   /translation="MATNEVFRDADHLTLPVAEGVKSGAPVTVGSLVGVAITDRADDGT
FT                   ATVRLKGASLLPVTGGGITQVGTPVYITSAGALNITATDNTLFGYALATKSSGSAEIPV
FT                   RIAQV"
FT   gene            complement(624242..625639)
FT                   /locus_tag="Xcel_0537"
FT   CDS_pept        complement(624242..625639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_1429 response regulator receiver
FT                   domain/DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29576"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW73"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29576.1"
FT                   /translation="MSRTLVHESTSLVEASKPHAAETTGPGRFKVRIISAGVGSSGVYP
FT                   AEALKAAAEAKVFPAGTQMFLDHPSASEAWDRPERSVRDIAARLSSDAVYVNEDGGALD
FT                   AEIEVFTPWRTTIAEMADTIGLSIRALAEVNENDEQGRPIVARIVEAQSVDFVTKAGRG
FT                   GKILALVESARANVRAVQRGLSEASAEQRGGELRALVRAAYATGAREHAWIVDYDETAR
FT                   TVTFTHETEDGSRILRQAYELTDDVATALTGDPVEVRRVVAYVPVDEAATPQTADADQA
FT                   PVSEAAPAAEPNPPAVEAGTTPPHKKEDPMGTIQVDEARYAGLEEKAALVPALDAKVEA
FT                   AEARAVAAEQRALQAEAASKARDFARKLAAEANRDLVVASLNAIVDESTRNALPLDADG
FT                   RLDTEKFGAVVNEARKAHETLLAAVAEASGVGTVRGVGQTTTTTTSVSEADADAAALAA
FT                   FGIKKGA"
FT   gene            625669..625803
FT                   /locus_tag="Xcel_0538"
FT   CDS_pept        625669..625803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29577"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW74"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29577.1"
FT                   /translation="MGQDDDADCGGHAWKLVGVVLRAGETVVEYECLRCGGVMVEPLR"
FT   gene            complement(625903..625976)
FT                   /locus_tag="Xcel_R0013"
FT                   /note="tRNA-Gln3"
FT   tRNA            complement(625903..625976)
FT                   /locus_tag="Xcel_R0013"
FT                   /product="tRNA-Gln"
FT   gene            complement(625988..626248)
FT                   /locus_tag="Xcel_0539"
FT   CDS_pept        complement(625988..626248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29578"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW75"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29578.1"
FT                   /translation="MTTMARYYDDEASSDVFRSVLPTLASLITAEYAADMAESGEWQEA
FT                   VEFYLVVAARENIAVPADVIDQVRTVGADLIPAGLTVAQAA"
FT   gene            complement(626245..627768)
FT                   /locus_tag="Xcel_0540"
FT   CDS_pept        complement(626245..627768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0540"
FT                   /product="phage head morphogenesis protein, SPP1 gp7
FT                   family"
FT                   /note="TIGRFAM: phage head morphogenesis protein, SPP1 gp7
FT                   family; PFAM: putative head morphogenesis protein SPP1 gp7;
FT                   KEGG: sit:TM1040_0803 phage putative head morphogenesis
FT                   protein, SPP1 gp7"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29579"
FT                   /db_xref="InterPro:IPR006528"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW76"
FT                   /inference="protein motif:TFAM:TIGR01641"
FT                   /protein_id="ACZ29579.1"
FT                   /translation="MPVTDRTVRLSRQARKALDGIVDQATRDLVIAWATAWDEIAVTWQ
FT                   AAVDDLIGYQAANGTWPPAWRIARAERAQQALQAAAKALVDVSDTAGARITQDLPALTG
FT                   QAADWEARLIASQMPPAPVAGDMSVAATFNRVDPDALTAIVQRTTGQVTALAYPLAAEA
FT                   VTAMNRELIRGIAVGDNPRIAAARMLARVEGRFNGGLARAMTIARTEMLDAHREASRVQ
FT                   RIANADVLAGWQWQATLDTRTCPSCLAQHGSMHAVDETGPTDHQNGRCTALPVTKSWRD
FT                   LGFDIDEPASPLPDARAWFDGLPQAEQRAILGPTRLEMLHTGRIGWADLSTRKSAPGWR
FT                   DSHHVRSVRDLEGLAGAADGSGGGSGSWVTRAGSPDDLPDRYRDPGVPFTRSTRPRAAW
FT                   GAAQHALERHAHEAGPQGGVSYFPRGWFGEDDNDVQAMRDLADWVTHQAEPHWQDAGAL
FT                   RFEAWVGGVLVRVPIRPEPGTDDWRVRTVIPVRGNGVRKWVNGRYFDVP"
FT   gene            complement(627770..629413)
FT                   /locus_tag="Xcel_0541"
FT   CDS_pept        complement(627770..629413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29580"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW77"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29580.1"
FT                   /translation="MGRVRQILGLRESTVVTSAVECARVAEGNLELLTESLAELELTLE
FT                   DRGWQTMSAQAEQQFSRAGLGNASRVARVMAVANPLIKRGLGVRQAYVWGQGVQVQARA
FT                   TGRDGEEDVNTLVQAFLDAPGNRAAFTGDQAHERHERALGTDGNVFVACFTNPRTGAVQ
FT                   VRTLPFDEIDQVICNPDDRDDPWYYLRVWTSQVMKADGSGFEIRQEKAYYPALSYRPAT
FT                   RPRTIGRVEVRWDAPVYHVKVNALDGWDFGIGDAFAALPFARMYQDFLIDWATLVKSLS
FT                   QFVWKASAKNGSRAAGLRQALQRRPAGTAPDANPNNAGATALLPEGMNLEAIPKSGATI
FT                   DSESGRPMAAMVAAALGVPVTMLLADPGQVGSRATAETLDVPTINEMNHRRAVWAEAYR
FT                   TILAYVIREAVRAPQGPVKGQVTRDPYTGRETVILAGDTDATIEIDWPPLEKTPLDAIV
FT                   KAIVDADGTAKLPPLVIVKLLLQALGVKDADEILDDVTDDDGNWLDPYREVGDQVGQAA
FT                   VNAFRRGKDPAAVTRRSEPADDVQDEGPEA"
FT   gene            complement(629430..630917)
FT                   /locus_tag="Xcel_0542"
FT   CDS_pept        complement(629430..630917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0542"
FT                   /product="phage uncharacterized protein"
FT                   /note="TIGRFAM: phage uncharacterized protein; PFAM:
FT                   protein of unknown function DUF264; KEGG: mes:Meso_0224
FT                   phage uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29581"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR006517"
FT                   /db_xref="InterPro:IPR035421"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW78"
FT                   /inference="protein motif:TFAM:TIGR01630"
FT                   /protein_id="ACZ29581.1"
FT                   /translation="MSLDFLLHAAAAFEPPPPPRWDSPAQMGADLDARFVRTPALDLID
FT                   RELLWAFNTPDSRLILSMPPQEGKSTLATKWAPTWLLNQRPDTRIVIASYAATVARRMG
FT                   RLIRSEITTHADSLDIRLKDDVAAQNEFEIKGHIGGVYAVGVGGALTSRPADVLIIDDP
FT                   LKDREQADSDTYRERASDWWTSTASSRLAPGAPVILILTRWHHDDLAGRLMAAEDGKQW
FT                   RYVNIPAQADYDPDAGETDPLGRQPGEYMISARGRTHTQWEQRRMQAGPRDWNALYQGR
FT                   PTAGSGDLFPKEWARYSQPMHIVRDDGSCWVPGTGFELVQSWDFTFKDKPTSDFVVGQV
FT                   WLRQGVTMFLLDQVRARMNFTASLAAIKAMTAKWPQAVAKLVEDKANGTAIITSLSATV
FT                   PGIIAVEPIGSKYARASAISPFAHAHNIVLPDAALLPNVEELVEEAKSFPAGAHDDTID
FT                   ALSQAANQLLLHPLLEQDTFTTDDFTDDDPFAYLRGY"
FT   gene            complement(630939..631070)
FT                   /locus_tag="Xcel_0543"
FT   CDS_pept        complement(630939..631070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29582"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW79"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29582.1"
FT                   /translation="MDCPRCGEPCTRKHCTGPACPWWRCTTCNIEIDAAGRTIPQHV"
FT   gene            631246..631725
FT                   /locus_tag="Xcel_0544"
FT   CDS_pept        631246..631725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29583"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW80"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29583.1"
FT                   /translation="MTTLEPVHGGQAERIAALADALAALSDARTPYMPSPGLCALIDAT
FT                   LGGEPVESVFGRISDIGIGEPDFRGAFIALTAHLAAWVSWYPPDIDEHVEIAALPRSGF
FT                   RSISIKEPMSKLEGKLSTRLTLTLSHDSLGRVEVPVRREEVADVVATLLGSREPA"
FT   gene            complement(631722..632060)
FT                   /locus_tag="Xcel_0545"
FT   CDS_pept        complement(631722..632060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29584"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW81"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29584.1"
FT                   /translation="MTVTDFMLARIAEDEAVARRAINSGADLVMTPTDLWNGPGQLPVI
FT                   KGRRLLAECEAKRQIVEEAARLAALHPDGLATAPEFTGARKALQHAVQLLALPYASHPH
FT                   YDETWRPR"
FT   gene            complement(632057..632362)
FT                   /locus_tag="Xcel_0546"
FT   CDS_pept        complement(632057..632362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29585"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW82"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29585.1"
FT                   /translation="MPVINVDSVHATRCRIIRTAEVLGINSPDTIRDISIDRFTREVEV
FT                   TFLGGRNAVHRLPKPSLMTLEAAIQPDHVTITEATICDTNLTVTCQVCGLTWKEPL"
FT   gene            complement(632378..633427)
FT                   /locus_tag="Xcel_0547"
FT   CDS_pept        complement(632378..633427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29586"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW83"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29586.1"
FT                   /translation="MNPSRSMQPCTVDGCDRDVEDTTYVCSPCGDRLIGLLAALGDTRE
FT                   PDPMVLTYPHKPHHEHCDDCDLPLEDRRTAGHPDLNPLRRTGPTRIRPGLLTDAEDRIA
FT                   HGQTVHVGERDGMTTDAGPVTLPYRYSPSEARWELLNTLTAAADDIARRRGLHRPYNTP
FT                   QALAAWLTGNVPWIRAQPDGGNLIAELLDAIDTMKRAIDVPATMRYAGPCNADIDVTTE
FT                   TVVAGVPTTTLTTRPCYGELYARPGAIDVTCPDCGATYPVTARRAWLLDQVTDVLLPAA
FT                   EMAVAVNGLLDTDVKAARLATNIRWWKSVGRLPEKGRTRDGRPKYRVGDVVDLVVQSAK
FT                   RRTPHSETA"
FT   gene            complement(633424..633621)
FT                   /locus_tag="Xcel_0548"
FT   CDS_pept        complement(633424..633621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29587"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW84"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29587.1"
FT                   /translation="MTPYVAQVIEATHQLDVLGGCAAVAEAEDLARTRNVPILDALRHV
FT                   RDRVTAAPPTTTTTMKGDSL"
FT   gene            complement(633618..633953)
FT                   /locus_tag="Xcel_0549"
FT   CDS_pept        complement(633618..633953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29588"
FT                   /db_xref="UniProtKB/TrEMBL:D1BW85"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29588.1"
FT                   /translation="MSDVCEACGRPSTRIRLDRECVPLCPECWLAADVWTPESTVTVIA
FT                   FEPATPPPPDPDWAYLVIGAPGSGTRGHQVGDRVTVIGLTPDDVTVTTAVVVDGKHTPA
FT                   TMEVRGQ"
FT   gene            complement(633950..634174)
FT                   /locus_tag="Xcel_0550"
FT   CDS_pept        complement(633950..634174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29589"
FT                   /db_xref="GOA:D1BWK7"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWK7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29589.1"
FT                   /translation="MSAALGLYTSVSVFWLILFGVLSWLAGATDPRDARRLARIALAAP
FT                   GWPVGVVWGVFCGLRALVRSAYGDRAGRS"
FT   gene            complement(634171..634788)
FT                   /locus_tag="Xcel_0551"
FT   CDS_pept        complement(634171..634788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29590"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWK8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29590.1"
FT                   /translation="MARCTAKAKGTGEQCKRASIVGGSTCKVHGSGTKAAREAAARRVE
FT                   EERARAAVVTLGLPADVSPTEALLEEVRWTAGHVQWLRTKVQELDEAPVDPLTDGTTSA
FT                   LVWGMTKRKIGGDDGGDTFEAKPSIWYALYESERKHLVAVCAAAIKAGVEERKVRLAEQ
FT                   QGDLVAMVIRRILDDLHLTVEQQQLVPDVVPRHLRAIAGGAA"
FT   gene            complement(634788..635243)
FT                   /locus_tag="Xcel_0552"
FT   CDS_pept        complement(634788..635243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0552"
FT                   /product="SMC family protein"
FT                   /note="KEGG: bmc:BAbS19_I04860 SMC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29591"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWK9"
FT                   /inference="similar to AA sequence:KEGG:BAbS19_I04860"
FT                   /protein_id="ACZ29591.1"
FT                   /translation="MSEEPTFTLAQALIALDALTAERDRLTAGLDRTAEAADRAEVRLR
FT                   DVEQEMNETRRQIEDAWEIAHEHPEESLLDAVKGLTAQRDMWRGMWRTAADRAVKAEAT
FT                   LRRVRALHTVAAWADEATRDETADETGNTLPALMDTAPARAPHGGDV"
FT   gene            complement(635240..635836)
FT                   /locus_tag="Xcel_0553"
FT   CDS_pept        complement(635240..635836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29592"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWL0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29592.1"
FT                   /translation="MSDLDLDAIRGRAEAATPGPWRHAPAIGNGGRYVSHCVETADRET
FT                   LIADRLYGPTAKSIAHARQDIPALLAELRRLSAWKAEAVEVLNAYQRLAERVVPNPTLG
FT                   RRWSDMLAEHVDRQAAALAEVTALADLIEDTLIPPRGEHAAPSWDSRYWAGADDASEYI
FT                   ARKLRAILARAALTAPLTEPVTETCTDDRTERTEP"
FT   gene            complement(635829..636194)
FT                   /locus_tag="Xcel_0554"
FT   CDS_pept        complement(635829..636194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29593"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWL1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29593.1"
FT                   /translation="MSGERVESAADLAAMPDGTVVRSDAGTIACRFDAQHGVVFGDDRP
FT                   FPWATLRLPVVVLYRPDRDLIAEAEARGAARAADRIAAALRVEMRRHDAEQIGFSAIGD
FT                   AYAEAARIAEQIGETDE"
FT   gene            complement(636191..636466)
FT                   /locus_tag="Xcel_0555"
FT   CDS_pept        complement(636191..636466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29594"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWL2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29594.1"
FT                   /translation="MSDEFTVLAPARVEALQRYPDNSGPDGDNGIAEQNRAAFVEGARW
FT                   GARVALLSAAHDSEYENQTDEDEDFLDNADFPVWLSARAEQIGGDR"
FT   gene            complement(636463..636858)
FT                   /locus_tag="Xcel_0556"
FT   CDS_pept        complement(636463..636858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29595"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWL3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29595.1"
FT                   /translation="MTEYTPTTGEVRDCFVDGAEGEFIPDDFDRWLFRVQERALAHFVT
FT                   DGVCLTCGDGVLLSGEHIDPERHAAYAYTAEDIAEAETRGAREFAAWVSSSRLGWFQSI
FT                   PEGDVREWLLGVAVEYGYRAEQAGADR"
FT   gene            complement(636851..637123)
FT                   /locus_tag="Xcel_0557"
FT   CDS_pept        complement(636851..637123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29596"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWL4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29596.1"
FT                   /translation="MSGERIETAGEYVPTTDEVRDSWVDDMFPTLTAEAFDRWFDTEWT
FT                   KAFDKGWAHAATQVRRVLAKRWGNPDIANDMAVQALTRLFGESDD"
FT   gene            complement(637120..637299)
FT                   /locus_tag="Xcel_0558"
FT   CDS_pept        complement(637120..637299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29597"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWL5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29597.1"
FT                   /translation="MSGDCLAPCPCGCGHYCQRGYGHQKNPLSTTHITGGAWYNGGCHE
FT                   WDDTLDPSPTGGAR"
FT   gene            complement(637296..637598)
FT                   /locus_tag="Xcel_0559"
FT   CDS_pept        complement(637296..637598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29598"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWL6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29598.1"
FT                   /translation="MTTTDPTTPTPVERAAEAIHADCGPDYIAEYDDLEPESQAQWRGY
FT                   AEHALTAALDVDEIARVLSRATWPDGSHDGFPTKRVADMLAAALIEHLTRTETAR"
FT   gene            complement(637595..638113)
FT                   /locus_tag="Xcel_0560"
FT   CDS_pept        complement(637595..638113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0560"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; SMART:
FT                   Appr-1-p processing domain protein; KEGG: stm:STM2587 phage
FT                   tail assembly-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29599"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWL7"
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /protein_id="ACZ29599.1"
FT                   /translation="MTAASLTLFDLNAALCKAWATAFAGVPAVTVTHTALEDLPAHDVL
FT                   VTAGNSHAIMDGGLDLAVRDLLGVRVQDAVQWQAATSLGGPIPVGSCVTVPTGHDRFPW
FT                   LVYAPTMLTPQPIPPSHVLLATLAVLTNRYDDGQTIAIPGLGAGTGGLAPDVVAQTMRT
FT                   AWDLTGGAA"
FT   gene            complement(638110..638481)
FT                   /locus_tag="Xcel_0561"
FT   CDS_pept        complement(638110..638481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0561"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spe:Spro_0046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29600"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWL8"
FT                   /inference="similar to AA sequence:KEGG:Spro_0046"
FT                   /protein_id="ACZ29600.1"
FT                   /translation="MNIQARPPAATTTTAITHIFGTSDDLIEVEGGLYDELYPVDGGDV
FT                   LSVTVTTDVGPREVLIGVDYGPDGIWHLTVQTRPDLVTITPARGETELDDVDGCPGYSD
FT                   KATIVGVTSVHLLSQEGDR"
FT   gene            complement(638485..638856)
FT                   /locus_tag="Xcel_0562"
FT   CDS_pept        complement(638485..638856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0562"
FT                   /product="VRR-NUC domain protein"
FT                   /note="PFAM: VRR-NUC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29601"
FT                   /db_xref="GOA:D1BWL9"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWL9"
FT                   /inference="protein motif:PFAM:PF08774"
FT                   /protein_id="ACZ29601.1"
FT                   /translation="MNRDQYVAAVAKDMTERALQSQVEALMRETGWMFFHPADNRPNAR
FT                   GRVQSITAGYPDLHGVRRDREIYIELKRQNGRVSDAQKTWLHALEALGHEVHVFRPDDL
FT                   LSGRILAALTGRITTETKD"
FT   gene            complement(638933..639166)
FT                   /locus_tag="Xcel_0563"
FT   CDS_pept        complement(638933..639166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29602"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWM0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29602.1"
FT                   /translation="MHQPFASLRGLAEHIAALEVELGAARTNRDRDIIAAHQAGTHPLD
FT                   ICAAARLSPAGVQKVLVKHSVITPAPRKPKAA"
FT   gene            complement(639447..639761)
FT                   /locus_tag="Xcel_0564"
FT   CDS_pept        complement(639447..639761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0564"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btr:Btr_0055 heat-inducible transcription
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29603"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWM1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29603.1"
FT                   /translation="MSHTSAMSRDVAHTTARSFVSRAYPSIRNDDHTWSSPEVVTYASV
FT                   EHRVNALRVHVSVGEAATLVLPADEAAALCDHIRAALDDLAAHATPTGSDRTRAATQAA
FT                   "
FT   gene            complement(640155..640343)
FT                   /locus_tag="Xcel_0565"
FT   CDS_pept        complement(640155..640343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29604"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWM2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29604.1"
FT                   /translation="MQQHSTVCAIRGTYQPLTIRDHQRREGLIAVALTGIDDAEQAREA
FT                   ALSILFGATAEDRVDIL"
FT   gene            complement(640828..641193)
FT                   /locus_tag="Xcel_0566"
FT   CDS_pept        complement(640828..641193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0566"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: transcription factor WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29605"
FT                   /db_xref="GOA:D1BWM3"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWM3"
FT                   /inference="protein motif:PFAM:PF02467"
FT                   /protein_id="ACZ29605.1"
FT                   /translation="MTRPVKKLPRMNVWPADFHPRRWLTDEEAGQAACAQADPDAWFPE
FT                   RGGSTQEPKRLCATCPIRLACLTVGLTRREPHGIYGGTTVKERTSMLKRASSDSIGLAS
FT                   DSIGLASERSSLVAGGC"
FT   gene            complement(641190..641822)
FT                   /locus_tag="Xcel_0567"
FT   CDS_pept        complement(641190..641822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0567"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSc3193 bacteriophage T7-like gene
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29606"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWM4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29606.1"
FT                   /translation="MNIGCLVDGCDRKHKGRGLCELHLQRHRRTGTTDSPVKTLEQRFW
FT                   SKVDRRDADECWPWSGATNDFGYGVIRPAGRRNGPNLKAHRVSAELAGMDVAGRVVRHR
FT                   CDNPPCVNPRHLVPGTQAQNAVDMAERDRSVHGSRNPNARLTEGDVAAIKALVAEGITH
FT                   RAIAVLYDVSRPTVTYIAQGKTWQRVEPAARDLIACVVEAITGELAA"
FT   gene            complement(641819..643480)
FT                   /locus_tag="Xcel_0568"
FT   CDS_pept        complement(641819..643480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0568"
FT                   /product="C-5 cytosine-specific DNA methylase"
FT                   /note="PFAM: C-5 cytosine-specific DNA methylase; KEGG:
FT                   hch:HCH_02855 site-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29607"
FT                   /db_xref="GOA:D1BWM5"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWM5"
FT                   /inference="protein motif:PFAM:PF00145"
FT                   /protein_id="ACZ29607.1"
FT                   /translation="MSADPIVTTGRDELGPYETWTLPGGELTRTAVPDSGANLTLTDLF
FT                   CGAGGSSTGAVSVPGVQVRLAANHWDKAIETHNTNHPDVDHLQADISQTDPRYVPRTDM
FT                   LWASPECTNHSRAKGRKAAAIQPDLFGDVLPDAAAERSRATMWDVVRFTEAHDYRAVLV
FT                   ENVVEVVDWASPTGIRGGLFQAWLTAMHSMGYRHRIISLNSMHAAAMRAPAPQSRDRVY
FT                   IAFTKEGERAPDFERMQRPKAWCPRCETVVEAMQWWKRGNGQTRPGRYRSQYLYRCPNT
FT                   ACRNEVVEPYWLPASSIIDWSNPGQRIGDRAKPLADKTMRRIQVGIERYWSPLLVEHGG
FT                   NPYDAADPKHPGYGDPGSYYRAWPIADPTQTMHTRESKALAWHPLAVPVEGRDGKVATS
FT                   TGRAMRAQTTRNETGLAFPPFLAELRGGGSTARLASDALATVTASGNHHALIHRNNHGG
FT                   AEMTTPASEPIRTITTAGHQSVLQADRPTIDVDDVRFRMLEPDEIKQAMAFPGEYVMVG
FT                   NRREQVRLAGNAVTPPAARDLISAVVAAITREDVAA"
FT   gene            complement(643477..643668)
FT                   /locus_tag="Xcel_0569"
FT   CDS_pept        complement(643477..643668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29608"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWM6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29608.1"
FT                   /translation="MSHTITVDVEKRLNPHGGFRWHARPRCLDCDWTGTPARHDKRTLA
FT                   VEHAHRIAAGHTRQQVAA"
FT   gene            complement(643665..644207)
FT                   /locus_tag="Xcel_0570"
FT   CDS_pept        complement(643665..644207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29609"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWM7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29609.1"
FT                   /translation="MTIPQYAKTTNPEVLAVIDRNDARYVAFGERAHAFSKAHGGDKSY
FT                   VMVNGWGGDRHLSAIVADDKPTTGRWKSGGRRGTWEPFKNNPVRAEFDAIEYRRERIPG
FT                   LAETYNGPRNRDGSQVIMTPGVFAHDGVAYMRLRDLPSSDQSGFGSDEFDHDIWTEILP
FT                   SEWHAASERHTGKAVPA"
FT   gene            complement(644204..644350)
FT                   /locus_tag="Xcel_0571"
FT   CDS_pept        complement(644204..644350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29610"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWM8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29610.1"
FT                   /translation="MAQRPSCPDERAVFLAALEEDVSPLVPGRPRPTPVPATTTEPRTG
FT                   GAA"
FT   gene            complement(644350..644649)
FT                   /locus_tag="Xcel_0572"
FT   CDS_pept        complement(644350..644649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29611"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWM9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29611.1"
FT                   /translation="MSATRIGDIVQFALNPGLTITGTVVAKDWHSLTVVTTPAAGEVPP
FT                   GLDHLTTTAPSRTRIAEQAADAALAFVEAFRTSGLDPVSITALVDAANAWEKAR"
FT   gene            complement(644646..645176)
FT                   /locus_tag="Xcel_0573"
FT   CDS_pept        complement(644646..645176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29612"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWN0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29612.1"
FT                   /translation="MTHLPETAFDGHRPEHVHHAGQVANGTRVVVLDPQGTPSGRGTIA
FT                   SFNPDDRRYRIALDNAYETHRHWDGLLPAPPDRAAWSHAETRSRPATDPASIPAIGRHE
FT                   TLFAVPNHRVAHRPSLVELDDHETAIAAILDAVGPVIADLREMDQVKAIDLDNWPTAAA
FT                   LIDAHQRLLAAQA"
FT   gene            complement(645173..645538)
FT                   /locus_tag="Xcel_0574"
FT   CDS_pept        complement(645173..645538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29613"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWN1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29613.1"
FT                   /translation="MSGHHLPWWLRPGVAHTVDGTEPTRGDGWADLGDQPAPGQAAVDT
FT                   TGDDTPTDITAGELGDAWTNVADRRAVGLTTDDPAQFWATFTTFRQGVSRALDEYAARQ
FT                   FEDWAWPQIQQWTGAAR"
FT   gene            complement(645535..645819)
FT                   /locus_tag="Xcel_0575"
FT   CDS_pept        complement(645535..645819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29614"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWN2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29614.1"
FT                   /translation="MDTTTQQRMRRVRPGPVNKAAEIAAYEDYLNGTGPSVVGKHHSAK
FT                   AFPHEVRAQTNGFEATVWGRPSAAERARRAESRTTRLTAMARGLAAVTR"
FT   gene            complement(645822..645983)
FT                   /locus_tag="Xcel_0576"
FT   CDS_pept        complement(645822..645983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29615"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWN3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29615.1"
FT                   /translation="MTSNTQPEDPTPYQAAILQGPSRKSSRVPAHVKARRRAATKAARR
FT                   SRAINRGR"
FT   gene            complement(646188..647453)
FT                   /locus_tag="Xcel_0577"
FT   CDS_pept        complement(646188..647453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0577"
FT                   /product="DnaB domain protein helicase domain protein"
FT                   /note="PFAM: DnaB domain protein helicase domain protein;
FT                   KEGG: mmw:Mmwyl1_3461 replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29616"
FT                   /db_xref="GOA:D1BWN4"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWN4"
FT                   /inference="protein motif:PFAM:PF00772"
FT                   /protein_id="ACZ29616.1"
FT                   /translation="MSAASVTAAFAAERAVVGAALLDPESIRQSAEHVSGDDFHDLRLG
FT                   AVFAVACEMHARRDAVDAITVDAECRSRGIRGVAAADLFALIEATPTTANAGHYAKEIA
FT                   EAATRRRLTATGIRMRQLGESDAPLSEVMTAARGEWEAIAHRGAGRLATRTLAQVLDGS
FT                   DEYDWLIPNLLERMDRLILTGGEGAGKSTFVRQLAVCAAAGVHPTTFKPIAPVKVVVVD
FT                   AENTERQWRRAVRGVVAKARQVGSADPAEAIDMLTVDGMPTGRLDVTTDRDLGAIHRLI
FT                   DEHEPDLLLIGPLYKLVPRAINNDDDAAPLINALDSLRARGVALVMEAHAGHATNATGV
FT                   RDLRPRGSAALMGWPEFGLGLTIDRDEQAKLGEQADPKYFTLVRWRGDRDERAWPKSLE
FT                   RGGHWPWTPMDPELARWSGPGW"
FT   gene            complement(647450..648262)
FT                   /locus_tag="Xcel_0578"
FT   CDS_pept        complement(647450..648262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0578"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aav:Aave_1758 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29617"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWN5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29617.1"
FT                   /translation="MPWAKVSDQLWGSPKWVQAPAVARGLWVTALSWSMDQLTDGRIPA
FT                   YMLPMLGGNLDDANALVDVGLWDKADDGGWEFHDWSDYQPDAASVKAKREAESTAGALG
FT                   NHRRWHARKGITVPDCEFCTTPASGTRSGTRSGEDRVTRIAPESSRPVPDPIQSSSNSV
FT                   VGAAAPVAAAAAPTTTRKPAASKGTRIPEPFTVTPEMVAWVQAECPGIDGRRATAAFID
FT                   YWRAKPGQNGVKVDWPATWRNWMRREATSGQPAKAAAPSNADQFMGRW"
FT   gene            complement(648262..648633)
FT                   /locus_tag="Xcel_0579"
FT   CDS_pept        complement(648262..648633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0579"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   hne:HNE_3394 HNH endonuclease domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29618"
FT                   /db_xref="GOA:D1BWN6"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWN6"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ACZ29618.1"
FT                   /translation="MAYQPFEFPEWNGVENIDNWKYRRRRALKIHEASQSPLLRLRGPD
FT                   GEPLYRMNDSGSIRRTRQASSTTIRRVKERDGYRCVWCGSADNLEVDHIVRYADGGSNT
FT                   PDNLRTLCHGCHGSRGGRP"
FT   gene            complement(648638..649093)
FT                   /locus_tag="Xcel_0580"
FT   CDS_pept        complement(648638..649093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29619"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWN7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29619.1"
FT                   /translation="MTTSIPQPQSDTEIALRGTQQQRADHLRKHGPAAVRADLEHLKRT
FT                   LQHQRTIKAGWVADGVWTTTQYNAWVGRQATVELHVDNWLHDLAAVYDPATAVLADAIH
FT                   RYLEDADASDDILEDALDESTIPLGDRPAITVRDAIAQGLLPHTQGR"
FT   gene            complement(649120..649371)
FT                   /locus_tag="Xcel_0581"
FT   CDS_pept        complement(649120..649371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29620"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWN8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29620.1"
FT                   /translation="MSAATDELVHVDVDLTTDVPCNVTGCDNPAEWACLLGTCHHTVTV
FT                   CDHCHSLLTTVIAFTPTPFLHHPPRCTVRNTTWTWRPL"
FT   gene            complement(649368..649733)
FT                   /locus_tag="Xcel_0582"
FT   CDS_pept        complement(649368..649733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29621"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29621.1"
FT                   /translation="MSTATGFTMIHGGRWYGYNQTGPKWRCNICGREGYGNDQGPYVWH
FT                   KSCLRGHSPCPWCGRQLALRIDGTPRVHSRCPERPDDAELLRLVAAEVRHEARYAVRGP
FT                   MTRQGSAILDRLTGEAS"
FT   gene            complement(649730..650023)
FT                   /locus_tag="Xcel_0583"
FT   CDS_pept        complement(649730..650023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29622"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWP0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29622.1"
FT                   /translation="MNLRIVPAADDQPIPYDEANEEFGAAWSAARKAYADLLVAAGLLA
FT                   TPLYVHRGPVKYHRVAAALHDAERVANHAQEIATALAACRDLWTRADRQGIS"
FT   gene            complement(650020..650265)
FT                   /locus_tag="Xcel_0584"
FT   CDS_pept        complement(650020..650265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29623"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWP1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29623.1"
FT                   /translation="MTALDVDLTLTIDCAADGCARPAVVAGVTICPGSHGPVTVCHLHH
FT                   AVVLAEHLDAQVGDGAVVCDEHQFILPMPPVEWRHL"
FT   gene            complement(650262..650660)
FT                   /locus_tag="Xcel_0585"
FT   CDS_pept        complement(650262..650660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29624"
FT                   /db_xref="GOA:D1BWP2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWP2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29624.1"
FT                   /translation="MTARPALDLAAISARYQAALDAKPSKGGYSEKGIAALQDSVCDVP
FT                   DLLAALAAATTVGPSHRETQSGPRRMSDTHLHLVATTYRQAWSQGEYPTRAVAQHFGVP
FT                   HSTAARWVMKARENGQLGPADGRRGGES"
FT   gene            complement(650657..650968)
FT                   /locus_tag="Xcel_0586"
FT   CDS_pept        complement(650657..650968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0586"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29625"
FT                   /db_xref="GOA:D1BWP3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWP3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29625.1"
FT                   /translation="MTGTVTPLSIGMRVRGARDCRGWNQTQLAEALTAAGWPMGQPTVA
FT                   KIEAGLRPLRLHESVVVAKVLGTTIVGLLDDSELREIGDAFHAGVLHAINVLQREANR"
FT   gene            complement(650965..651498)
FT                   /locus_tag="Xcel_0587"
FT   CDS_pept        complement(650965..651498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29626"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWP4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29626.1"
FT                   /translation="MGAPTITVEVDGQSYDTTDVTWISYAPCGCVEGASTVDGRSYGGE
FT                   LILAEAQVLAKFYDTKAERDKAKAQGFRFEIRPRDEVKTLMGDCPHTPKWGIEPRPTLE
FT                   GHAWGIKDSGRVAHLVPTYGKERGSFLLHGDKFSERYDLGHVESLCGSVRDMNWRVAGS
FT                   SVPECTRCTKRAVA"
FT   gene            complement(651498..651941)
FT                   /locus_tag="Xcel_0588"
FT   CDS_pept        complement(651498..651941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0588"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: gme:Gmet_0362 single-strand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29627"
FT                   /db_xref="GOA:D1BWP5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWP5"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ACZ29627.1"
FT                   /translation="MAHVNVSGFLGADAELRFTPGGKPVLNFSIADTPRRKNDSGEWED
FT                   AGPTNWWRVALWGADAEAEAERQRLVKGAKVTVVGTAYLGSFRNREGGDTPSLEFKHVD
FT                   ALGVAEPRGPQQVGRGGQRSGGRQQADPWATSGPDSFDQAPPF"
FT   gene            complement(651977..652138)
FT                   /locus_tag="Xcel_0589"
FT   CDS_pept        complement(651977..652138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29628"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWP6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29628.1"
FT                   /translation="MIAYPPAIRRFEAALAAVALPTPAQMQPLADLYALAHGDTPDKQA
FT                   QRRAGGTP"
FT   gene            complement(652135..653118)
FT                   /locus_tag="Xcel_0590"
FT   CDS_pept        complement(652135..653118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0590"
FT                   /product="phage recombination protein Bet"
FT                   /note="TIGRFAM: phage recombination protein Bet; PFAM: RecT
FT                   protein; KEGG: cjd:JJD26997_0851 putative prophage
FT                   LambdaCh01, recombination protein Bet"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29629"
FT                   /db_xref="GOA:D1BWP7"
FT                   /db_xref="InterPro:IPR010183"
FT                   /db_xref="InterPro:IPR018330"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWP7"
FT                   /inference="protein motif:TFAM:TIGR01913"
FT                   /protein_id="ACZ29629.1"
FT                   /translation="MSTEIVTRGPSSDLAITDGQSFFTDKQVAALRQLGVSNATNADLA
FT                   VFFHQSTRTGLDPFARQIYMIERQGKQTIQTGIDGFRLVARRATDRARGSFGYEDTLWC
FT                   GPDGSWTDVWLSREAPAAAKVTVIRDGARYPAIALYTEYVALKRDGNPNSMWASKPALM
FT                   LAKCAEALALRKAFPQDLSGLYTSDEMQQADNTPADGGFERVSPRSGSAKLAAAVQERS
FT                   RQVQAVPDAVPEEIHDAEVIEDAVPHITREQSARLRDLMREAGLNRASMLTLASEQAGR
FT                   PVTAATDLTEAEAAAVITLLEAVAPPAEPAIPEDVFGGREPQTAAS"
FT   gene            complement(653115..654047)
FT                   /locus_tag="Xcel_0591"
FT   CDS_pept        complement(653115..654047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xcel_0591"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pde:Pden_3739 putative phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xcel_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ29630"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniProtKB/TrEMBL:D1BWP8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ29630.1"
FT                   /translation="MESKGARMSATTTTRVPPAPGTPEWARVVSASKVAGIIGLSPWES
FT                   PRSIWHLLRGEIPSDDGKNQDVKSRGHYLENGILSWWQDRHPELKRVRRQWYAELGAWA
FT                   AATPDAAAWPVLRPKAGRAPAVVVDAKTSRDDDAWGTPGTDEVPAYYAAQTQWQMHVTG
FT                   ARVGYIALLTTRLDLREYRIDYDADTAQGLERIAYAFYLSTLDDAAAPPLDDHVATFDT
FT                   LKRLHPDIEADSQVEIDEAMARAFVDAQAAKRQAEAAERAAKSALLDAMGDTRLAVWNG
FT                   ITVARRQGNRSGVSLVGVAKTIEPKEQDL"
FT   gene            complement(654023..654307)
FT                   /locus_tag="Xcel_0592"
FT   CDS_