(data stored in ACNUC7421 zone)

EMBL: CP001825

ID   CP001825; SV 1; circular; genomic DNA; STD; PRO; 2026947 BP.
XX
AC   CP001825; ABUX01000000-ABUX01000010;
XX
PR   Project:PRJNA29523;
XX
DT   24-NOV-2009 (Rel. 102, Created)
DT   16-DEC-2013 (Rel. 119, Last updated, Version 5)
XX
DE   Thermobaculum terrenum ATCC BAA-798 chromosome 1, complete sequence.
XX
KW   .
XX
OS   Thermobaculum terrenum ATCC BAA-798
OC   Bacteria; Thermobaculum.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-2026947
RX   PUBMED; 21304745.
RA   Kiss H., Cleland D., Lapidus A., Lucas S., Del Rio T.G., Nolan M., Tice H.,
RA   Han C., Goodwin L., Pitluck S., Liolios K., Ivanova N., Mavromatis K.,
RA   Ovchinnikova G., Pati A., Chen A., Palaniappan K., Land M., Hauser L.,
RA   Chang Y.J., Jeffries C.D., Lu M., Brettin T., Detter J.C., Goker M.,
RA   Tindall B.J., Beck B., McDermott T.R., Woyke T., Bristow J., Eisen J.A.,
RA   Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.P., Cheng J.F.;
RT   "Complete genome sequence of 'Thermobaculum terrenum' type strain (YNP1)";
RL   Stand Genomic Sci 3(2):153-162(2010).
XX
RN   [2]
RP   1-2026947
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Kiss H., Lu M., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Eisen J.A.;
RT   "The complete chromosome1 of Thermobaculum terrenum ATCC BAA-798";
RL   Unpublished.
XX
RN   [3]
RP   1-2026947
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Kiss H., Lu M., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Eisen J.A.;
RT   ;
RL   Submitted (12-NOV-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; c993a9f6e52dc5d01a56e4aebf415dcb.
DR   BioSample; SAMN00017581.
DR   EnsemblGenomes-Gn; EBG00001020438.
DR   EnsemblGenomes-Gn; EBG00001020439.
DR   EnsemblGenomes-Gn; EBG00001020440.
DR   EnsemblGenomes-Gn; EBG00001020441.
DR   EnsemblGenomes-Gn; EBG00001020442.
DR   EnsemblGenomes-Gn; EBG00001020443.
DR   EnsemblGenomes-Gn; EBG00001020444.
DR   EnsemblGenomes-Gn; EBG00001020445.
DR   EnsemblGenomes-Gn; EBG00001020446.
DR   EnsemblGenomes-Gn; EBG00001020447.
DR   EnsemblGenomes-Gn; EBG00001020448.
DR   EnsemblGenomes-Gn; EBG00001020449.
DR   EnsemblGenomes-Gn; EBG00001020450.
DR   EnsemblGenomes-Gn; EBG00001020451.
DR   EnsemblGenomes-Gn; EBG00001020452.
DR   EnsemblGenomes-Gn; EBG00001020453.
DR   EnsemblGenomes-Gn; EBG00001020454.
DR   EnsemblGenomes-Gn; EBG00001020455.
DR   EnsemblGenomes-Gn; EBG00001020456.
DR   EnsemblGenomes-Gn; EBG00001020457.
DR   EnsemblGenomes-Gn; EBG00001020458.
DR   EnsemblGenomes-Gn; EBG00001020459.
DR   EnsemblGenomes-Gn; EBG00001020460.
DR   EnsemblGenomes-Gn; EBG00001020461.
DR   EnsemblGenomes-Gn; EBG00001020462.
DR   EnsemblGenomes-Gn; EBG00001020463.
DR   EnsemblGenomes-Gn; EBG00001020464.
DR   EnsemblGenomes-Gn; EBG00001020465.
DR   EnsemblGenomes-Gn; EBG00001020466.
DR   EnsemblGenomes-Gn; EBG00001020467.
DR   EnsemblGenomes-Gn; EBG00001020468.
DR   EnsemblGenomes-Gn; EBG00001020469.
DR   EnsemblGenomes-Gn; EBG00001020470.
DR   EnsemblGenomes-Gn; EBG00001020471.
DR   EnsemblGenomes-Gn; EBG00001020472.
DR   EnsemblGenomes-Gn; EBG00001020473.
DR   EnsemblGenomes-Gn; EBG00001020474.
DR   EnsemblGenomes-Gn; EBG00001020475.
DR   EnsemblGenomes-Gn; EBG00001020476.
DR   EnsemblGenomes-Gn; EBG00001020477.
DR   EnsemblGenomes-Gn; EBG00001020478.
DR   EnsemblGenomes-Gn; EBG00001020479.
DR   EnsemblGenomes-Gn; EBG00001020480.
DR   EnsemblGenomes-Gn; EBG00001020481.
DR   EnsemblGenomes-Gn; EBG00001020482.
DR   EnsemblGenomes-Gn; EBG00001020483.
DR   EnsemblGenomes-Gn; EBG00001020484.
DR   EnsemblGenomes-Gn; EBG00001020485.
DR   EnsemblGenomes-Gn; EBG00001020486.
DR   EnsemblGenomes-Gn; EBG00001020487.
DR   EnsemblGenomes-Gn; EBG00001020488.
DR   EnsemblGenomes-Gn; EBG00001020489.
DR   EnsemblGenomes-Gn; EBG00001020490.
DR   EnsemblGenomes-Gn; EBG00001020491.
DR   EnsemblGenomes-Gn; EBG00001020492.
DR   EnsemblGenomes-Gn; EBG00001020493.
DR   EnsemblGenomes-Gn; EBG00001020494.
DR   EnsemblGenomes-Gn; EBG00001020495.
DR   EnsemblGenomes-Gn; EBG00001020496.
DR   EnsemblGenomes-Gn; EBG00001020497.
DR   EnsemblGenomes-Gn; EBG00001020498.
DR   EnsemblGenomes-Gn; EBG00001020499.
DR   EnsemblGenomes-Gn; EBG00001020500.
DR   EnsemblGenomes-Gn; EBG00001020501.
DR   EnsemblGenomes-Gn; Tter_R0001.
DR   EnsemblGenomes-Gn; Tter_R0002.
DR   EnsemblGenomes-Gn; Tter_R0003.
DR   EnsemblGenomes-Gn; Tter_R0004.
DR   EnsemblGenomes-Gn; Tter_R0005.
DR   EnsemblGenomes-Gn; Tter_R0006.
DR   EnsemblGenomes-Gn; Tter_R0007.
DR   EnsemblGenomes-Gn; Tter_R0008.
DR   EnsemblGenomes-Gn; Tter_R0009.
DR   EnsemblGenomes-Gn; Tter_R0010.
DR   EnsemblGenomes-Gn; Tter_R0011.
DR   EnsemblGenomes-Gn; Tter_R0012.
DR   EnsemblGenomes-Gn; Tter_R0013.
DR   EnsemblGenomes-Gn; Tter_R0014.
DR   EnsemblGenomes-Gn; Tter_R0015.
DR   EnsemblGenomes-Gn; Tter_R0016.
DR   EnsemblGenomes-Gn; Tter_R0017.
DR   EnsemblGenomes-Gn; Tter_R0018.
DR   EnsemblGenomes-Gn; Tter_R0019.
DR   EnsemblGenomes-Gn; Tter_R0020.
DR   EnsemblGenomes-Gn; Tter_R0021.
DR   EnsemblGenomes-Gn; Tter_R0022.
DR   EnsemblGenomes-Gn; Tter_R0023.
DR   EnsemblGenomes-Gn; Tter_R0024.
DR   EnsemblGenomes-Gn; Tter_R0025.
DR   EnsemblGenomes-Gn; Tter_R0026.
DR   EnsemblGenomes-Gn; Tter_R0027.
DR   EnsemblGenomes-Gn; Tter_R0028.
DR   EnsemblGenomes-Gn; Tter_R0029.
DR   EnsemblGenomes-Gn; Tter_R0030.
DR   EnsemblGenomes-Gn; Tter_R0031.
DR   EnsemblGenomes-Gn; Tter_R0032.
DR   EnsemblGenomes-Gn; Tter_R0033.
DR   EnsemblGenomes-Gn; Tter_R0034.
DR   EnsemblGenomes-Gn; Tter_R0035.
DR   EnsemblGenomes-Gn; Tter_R0036.
DR   EnsemblGenomes-Gn; Tter_R0037.
DR   EnsemblGenomes-Gn; Tter_R0038.
DR   EnsemblGenomes-Gn; Tter_R0039.
DR   EnsemblGenomes-Gn; Tter_R0040.
DR   EnsemblGenomes-Gn; Tter_R0041.
DR   EnsemblGenomes-Gn; Tter_R0042.
DR   EnsemblGenomes-Gn; Tter_R0043.
DR   EnsemblGenomes-Gn; Tter_R0044.
DR   EnsemblGenomes-Gn; Tter_R0045.
DR   EnsemblGenomes-Gn; Tter_R0046.
DR   EnsemblGenomes-Gn; Tter_R0047.
DR   EnsemblGenomes-Gn; Tter_R0048.
DR   EnsemblGenomes-Gn; Tter_R0049.
DR   EnsemblGenomes-Gn; Tter_R0050.
DR   EnsemblGenomes-Gn; Tter_R0051.
DR   EnsemblGenomes-Gn; Tter_R0052.
DR   EnsemblGenomes-Gn; Tter_R0053.
DR   EnsemblGenomes-Gn; Tter_R0054.
DR   EnsemblGenomes-Gn; Tter_R0055.
DR   EnsemblGenomes-Gn; Tter_R0056.
DR   EnsemblGenomes-Gn; Tter_R0057.
DR   EnsemblGenomes-Gn; Tter_R0058.
DR   EnsemblGenomes-Gn; Tter_R0059.
DR   EnsemblGenomes-Gn; Tter_R0060.
DR   EnsemblGenomes-Tr; EBT00001623364.
DR   EnsemblGenomes-Tr; EBT00001623365.
DR   EnsemblGenomes-Tr; EBT00001623366.
DR   EnsemblGenomes-Tr; EBT00001623367.
DR   EnsemblGenomes-Tr; EBT00001623368.
DR   EnsemblGenomes-Tr; EBT00001623369.
DR   EnsemblGenomes-Tr; EBT00001623370.
DR   EnsemblGenomes-Tr; EBT00001623371.
DR   EnsemblGenomes-Tr; EBT00001623372.
DR   EnsemblGenomes-Tr; EBT00001623373.
DR   EnsemblGenomes-Tr; EBT00001623374.
DR   EnsemblGenomes-Tr; EBT00001623375.
DR   EnsemblGenomes-Tr; EBT00001623376.
DR   EnsemblGenomes-Tr; EBT00001623377.
DR   EnsemblGenomes-Tr; EBT00001623378.
DR   EnsemblGenomes-Tr; EBT00001623379.
DR   EnsemblGenomes-Tr; EBT00001623380.
DR   EnsemblGenomes-Tr; EBT00001623381.
DR   EnsemblGenomes-Tr; EBT00001623382.
DR   EnsemblGenomes-Tr; EBT00001623383.
DR   EnsemblGenomes-Tr; EBT00001623384.
DR   EnsemblGenomes-Tr; EBT00001623385.
DR   EnsemblGenomes-Tr; EBT00001623386.
DR   EnsemblGenomes-Tr; EBT00001623387.
DR   EnsemblGenomes-Tr; EBT00001623388.
DR   EnsemblGenomes-Tr; EBT00001623389.
DR   EnsemblGenomes-Tr; EBT00001623390.
DR   EnsemblGenomes-Tr; EBT00001623391.
DR   EnsemblGenomes-Tr; EBT00001623392.
DR   EnsemblGenomes-Tr; EBT00001623393.
DR   EnsemblGenomes-Tr; EBT00001623394.
DR   EnsemblGenomes-Tr; EBT00001623395.
DR   EnsemblGenomes-Tr; EBT00001623396.
DR   EnsemblGenomes-Tr; EBT00001623397.
DR   EnsemblGenomes-Tr; EBT00001623398.
DR   EnsemblGenomes-Tr; EBT00001623399.
DR   EnsemblGenomes-Tr; EBT00001623400.
DR   EnsemblGenomes-Tr; EBT00001623401.
DR   EnsemblGenomes-Tr; EBT00001623402.
DR   EnsemblGenomes-Tr; EBT00001623403.
DR   EnsemblGenomes-Tr; EBT00001623404.
DR   EnsemblGenomes-Tr; EBT00001623405.
DR   EnsemblGenomes-Tr; EBT00001623406.
DR   EnsemblGenomes-Tr; EBT00001623407.
DR   EnsemblGenomes-Tr; EBT00001623408.
DR   EnsemblGenomes-Tr; EBT00001623409.
DR   EnsemblGenomes-Tr; EBT00001623410.
DR   EnsemblGenomes-Tr; EBT00001623411.
DR   EnsemblGenomes-Tr; EBT00001623412.
DR   EnsemblGenomes-Tr; EBT00001623413.
DR   EnsemblGenomes-Tr; EBT00001623414.
DR   EnsemblGenomes-Tr; EBT00001623415.
DR   EnsemblGenomes-Tr; EBT00001623416.
DR   EnsemblGenomes-Tr; EBT00001623417.
DR   EnsemblGenomes-Tr; EBT00001623418.
DR   EnsemblGenomes-Tr; EBT00001623419.
DR   EnsemblGenomes-Tr; EBT00001623420.
DR   EnsemblGenomes-Tr; EBT00001623421.
DR   EnsemblGenomes-Tr; EBT00001623422.
DR   EnsemblGenomes-Tr; EBT00001623423.
DR   EnsemblGenomes-Tr; EBT00001623424.
DR   EnsemblGenomes-Tr; EBT00001623425.
DR   EnsemblGenomes-Tr; EBT00001623426.
DR   EnsemblGenomes-Tr; EBT00001623427.
DR   EnsemblGenomes-Tr; Tter_R0001-1.
DR   EnsemblGenomes-Tr; Tter_R0002-1.
DR   EnsemblGenomes-Tr; Tter_R0003-1.
DR   EnsemblGenomes-Tr; Tter_R0004-1.
DR   EnsemblGenomes-Tr; Tter_R0005-1.
DR   EnsemblGenomes-Tr; Tter_R0006-1.
DR   EnsemblGenomes-Tr; Tter_R0007-1.
DR   EnsemblGenomes-Tr; Tter_R0008-1.
DR   EnsemblGenomes-Tr; Tter_R0009-1.
DR   EnsemblGenomes-Tr; Tter_R0010-1.
DR   EnsemblGenomes-Tr; Tter_R0011-1.
DR   EnsemblGenomes-Tr; Tter_R0012-1.
DR   EnsemblGenomes-Tr; Tter_R0013-1.
DR   EnsemblGenomes-Tr; Tter_R0014-1.
DR   EnsemblGenomes-Tr; Tter_R0015-1.
DR   EnsemblGenomes-Tr; Tter_R0016-1.
DR   EnsemblGenomes-Tr; Tter_R0017-1.
DR   EnsemblGenomes-Tr; Tter_R0018-1.
DR   EnsemblGenomes-Tr; Tter_R0019-1.
DR   EnsemblGenomes-Tr; Tter_R0020-1.
DR   EnsemblGenomes-Tr; Tter_R0021-1.
DR   EnsemblGenomes-Tr; Tter_R0022-1.
DR   EnsemblGenomes-Tr; Tter_R0023-1.
DR   EnsemblGenomes-Tr; Tter_R0024-1.
DR   EnsemblGenomes-Tr; Tter_R0025-1.
DR   EnsemblGenomes-Tr; Tter_R0026-1.
DR   EnsemblGenomes-Tr; Tter_R0027-1.
DR   EnsemblGenomes-Tr; Tter_R0028-1.
DR   EnsemblGenomes-Tr; Tter_R0029-1.
DR   EnsemblGenomes-Tr; Tter_R0030-1.
DR   EnsemblGenomes-Tr; Tter_R0031-1.
DR   EnsemblGenomes-Tr; Tter_R0032-1.
DR   EnsemblGenomes-Tr; Tter_R0033-1.
DR   EnsemblGenomes-Tr; Tter_R0034-1.
DR   EnsemblGenomes-Tr; Tter_R0035-1.
DR   EnsemblGenomes-Tr; Tter_R0036-1.
DR   EnsemblGenomes-Tr; Tter_R0037-1.
DR   EnsemblGenomes-Tr; Tter_R0038-1.
DR   EnsemblGenomes-Tr; Tter_R0039-1.
DR   EnsemblGenomes-Tr; Tter_R0040-1.
DR   EnsemblGenomes-Tr; Tter_R0041-1.
DR   EnsemblGenomes-Tr; Tter_R0042-1.
DR   EnsemblGenomes-Tr; Tter_R0043-1.
DR   EnsemblGenomes-Tr; Tter_R0044-1.
DR   EnsemblGenomes-Tr; Tter_R0045-1.
DR   EnsemblGenomes-Tr; Tter_R0046-1.
DR   EnsemblGenomes-Tr; Tter_R0047-1.
DR   EnsemblGenomes-Tr; Tter_R0048-1.
DR   EnsemblGenomes-Tr; Tter_R0049-1.
DR   EnsemblGenomes-Tr; Tter_R0050-1.
DR   EnsemblGenomes-Tr; Tter_R0051-1.
DR   EnsemblGenomes-Tr; Tter_R0052-1.
DR   EnsemblGenomes-Tr; Tter_R0053-1.
DR   EnsemblGenomes-Tr; Tter_R0054-1.
DR   EnsemblGenomes-Tr; Tter_R0055-1.
DR   EnsemblGenomes-Tr; Tter_R0056-1.
DR   EnsemblGenomes-Tr; Tter_R0057-1.
DR   EnsemblGenomes-Tr; Tter_R0058-1.
DR   EnsemblGenomes-Tr; Tter_R0059-1.
DR   EnsemblGenomes-Tr; Tter_R0060-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001825.
DR   SILVA-SSU; CP001825.
DR   StrainInfo; 494581; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4084073
CC   Source DNA and organism available from ATCC:ATCC BAA-798
CC   (www.atcc.org)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Thermobaculum terrenum YNP1, ATCC BAA-798
CC   Culture Collection ID :: ATCC BAA-798, CCMEE 7001
CC   GOLD Stamp ID         :: Gi02489
CC   Greengenes ID         :: 51584
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: Prodigal
CC   Isolation Site        :: "Soil in Yellowstone National Park,
CC                            Wyoming, USA"
CC   Isolation Country     :: USA
CC   Latitude              :: 44.393704
CC   Longitude             :: -110.567703
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Nonmotile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Thermophile
CC   Temperature Optimum   :: 65 - 92C
CC   pH                    :: 7
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Soil
CC   Energy Source         :: Heterotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2026947
FT                   /organism="Thermobaculum terrenum ATCC BAA-798"
FT                   /chromosome="1"
FT                   /strain="ATCC BAA-798"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:525904"
FT                   /culture_collection="ATCC:BAA-798"
FT   gene            85..1455
FT                   /locus_tag="Tter_0001"
FT   CDS_pept        85..1455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: bar:GBAA0001 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40925"
FT                   /db_xref="GOA:D1CDB9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDB9"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACZ40925.1"
FT                   /translation="MNPKQVWQAVLGELEVRLNPAQFETWIKNTSLVSLDEDEAVISVP
FT                   TSFAQMTIERKFEPEIRRSLSNILHRPVQVSFVVNGIISSNERSSRSNESSVEAPLLNA
FT                   AQNTSTQFGAPNTPLNPRYTFENFIVGSSNRMAHAACMAVAEHPAEAYNPLFLYGGVGL
FT                   GKTHLLHAIGNHALKLKPYLRVLYVSSEQFTNDLINAIREHRTEEFRARYRSIDILLID
FT                   DIQFIAGKESTQEEFFHTFNHLHGANKQIVMTSDRPPKAIATLQDRLRSRFEGGLMTEV
FT                   NLPDLETRIAILRIKAENKGVDLPDDVLELIARKVQSNIRELEGALNSIVALARLTGEP
FT                   ITLATAAEALNDTTMARKKRQITPERILQAVASYYGVDEKLLKGKTRAREVVIPRQVAM
FT                   YIMREDTDQSLSEIGAILGGRDHTTVLHGITKVEKDIEVDTKLRQDVMTVREMLYNN"
FT   gene            1468..2256
FT                   /locus_tag="Tter_0002"
FT   CDS_pept        1468..2256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0002"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /note="TIGRFAM: biotin/acetyl-CoA-carboxylase ligase; PFAM:
FT                   biotin/lipoate A/B protein ligase; biotin protein ligase
FT                   domain protein; KEGG: gme:Gmet_1987
FT                   biotin--acetyl-CoA-carboxylase ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40926"
FT                   /db_xref="GOA:D1CDC0"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDC0"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ACZ40926.1"
FT                   /translation="MDQIDLNKLQQILSHTKILREIAFFEEIDSTNSYLKRIINNVDEG
FT                   IVVIADYQSQGRGRRGRTWVSPRGSSISCSILLSPPLTPNRSYILTAACALSIRDSITP
FT                   LVDKPVSIKWPNDVLIGDLKVCGILAESQINSNQTTITTILGFGINVYEYPKSVNATCI
FT                   ADHATTQISRTDLLASILVSLDSRLQVIYSGNWLQVYEEWKDSISTIGQEVTVITDSSN
FT                   IQGIAIGVSKEGGLIIRTPDNELVTVQAGEASIRKPNPKS"
FT   gene            2349..3311
FT                   /locus_tag="Tter_0003"
FT   CDS_pept        2349..3311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0003"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   afr:AFE_2515 ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40927"
FT                   /db_xref="GOA:D1CDC1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDC1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACZ40927.1"
FT                   /translation="MRIRLAKLSDSKQLVDILASSFAEEISLSNLNRDSIKAQVSLGTI
FT                   ASYPWLRHLLRVMGVTLEFWVAEEDGQVLGCVMLHSTKRRLPLNISSLAVHPEHRHKGI
FT                   GRSLMSVMFQRTKQLGRNIITLEVMTDNTPAVNLYRSLGMEEYDRRLSYRYIVNPMTIG
FT                   TDLSGVSLSPVNRADIPLWREIINTSPNVPIKLEQIMRVYEEEYISRAQRNLWLPSILG
FT                   RLSTYQQYAIYNQGKTVGFVAARNMLRGNPTESLPPLCLPQAGLNMTSVFIRLQEMLLQ
FT                   YGSRAHRLYVSAFDGNQIEAAQMLGYRFEKSWSYMYKRL"
FT   gene            complement(3308..3796)
FT                   /locus_tag="Tter_0004"
FT   CDS_pept        complement(3308..3796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0004"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="KEGG: dal:Dalk_0924 pantetheine-phosphate
FT                   adenylyltransferase; TIGRFAM: pantetheine-phosphate
FT                   adenylyltransferase; cytidyltransferase-related domain
FT                   protein; PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40928"
FT                   /db_xref="GOA:D1CDC2"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDC2"
FT                   /inference="protein motif:TFAM:TIGR01510"
FT                   /protein_id="ACZ40928.1"
FT                   /translation="MEAIAVYAGSFDPVTNGHLDLIERASPLFKKLVVAVGVNPRKPAA
FT                   FSLEDRLDMLRRVTAHIPNVEVDSFDGLLVDYAKSIGAKAIIRGLRAVADFDYEMQQVL
FT                   MNRRLCPEIETVFLTTSTQYSFLSSSLVKEVSILGGSVEGLVPKEVEPYLEKLKRSQT"
FT   gene            3916..4698
FT                   /locus_tag="Tter_0005"
FT   CDS_pept        3916..4698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0005"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bha:BH3101 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40929"
FT                   /db_xref="GOA:D1CDC3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDC3"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACZ40929.1"
FT                   /translation="MEADTERFLQLQHMGNTLLITLNRPPVNAINLQVIEQLEEALTSY
FT                   EEDKNTKAVIITGNGRCFSAGADIKSFLEQDPDSPEIPLIRKANDVLNFIESYPKVVIA
FT                   AINGICLGGGNELALACDLRIASQNAIFGQPEIKLGLLPGWGGIQRLTRLLGKARALEM
FT                   CLTGESLNADRALQIGLVNEVVSPEGLIDRSLEISQKLSSLPTLAVNLIKQRIHKGAGA
FT                   SQGQAIREDEWAFRELLSSSYGQEGIKAFLEKREPRWD"
FT   gene            4723..6393
FT                   /locus_tag="Tter_0006"
FT   CDS_pept        4723..6393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0006"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: met:M446_3854 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40930"
FT                   /db_xref="GOA:D1CDC4"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDC4"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ACZ40930.1"
FT                   /translation="MSRDKDYDVIVIGAGHNGLVCANYLAKAGCKVVVLERRPVVGGAS
FT                   ATEEMFGGYKIDVGSAVHTLIHETGIIDDLKLEKFGLKYLQLDPFAFAPFPDGTYLRFY
FT                   RDLDKTCEEIEKVSPKDAEAYKKFVEDWTELNRILTATFTSKPSAPSMSYKALSKDIVS
FT                   LLKMTARRSLQDRIHQLLMDYGKLLSMTFESEYVKAPLAFLAAQAGVSPSTPGTANFAG
FT                   WHALSHSTGVTRPQGGSGKLSEALQESLINMGGEVRLDTEVTSILIRNDRAIGVETSSR
FT                   EKFSSDIVISSVAPVKTLLELIPSEALNDNLRRKISSIKISPISGVYIRGIATNLPEYK
FT                   AVGGSDNKDHYMGMQLLCPTLSGLEKGFQEATIGNKPSKPAVYLLTPSVVDPSLAPEKH
FT                   LVYIWAQPYPLQLAGGQSWDDATQDVVADIFNATSEYIEGLVDIITKHRVIRTPPQLAG
FT                   DLQLPYSNIMHGDMTIDQLFFMRPIPELSGYRTPIKGLYLTGAGTHPGGGVQGAAGKNT
FT                   AEVILADMTKAKRWIKPALVVAGSSIAFAVLRRSARASN"
FT   gene            complement(6390..7883)
FT                   /locus_tag="Tter_0007"
FT   CDS_pept        complement(6390..7883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0007"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); tRNA synthetase class II
FT                   (G H P and S); nucleic acid binding OB- fold
FT                   tRNA/helicase-type; KEGG: bsu:BSU00820 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40931"
FT                   /db_xref="GOA:D1CDC5"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDC5"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ACZ40931.1"
FT                   /translation="MDLAGSILQDLNDQQQIRLEKLRKLRDMGINPYPPRSYRTHTAHE
FT                   VYSSVDSLEGQEVTVAGRLTARRDMGKSVFADLEDASGKIQLLVRLNTAGPDTLSFFKE
FT                   LIDLGDIVEATGSPMRTRTGEPTVDVKSVRILAKVLNPLPDKWHGLEDVEKRYRQRYLD
FT                   LMVNPEVRDVFIKRAKIISSVRRYLDDLGFIEVETPVLQPLYGGASAKPFTTYYNALDQ
FT                   TFYLRIATELYLKRLLVGGIEKVYEIGKDFRNEGLSTKHNPEFTMMELYQAYADYNSIM
FT                   DLVEKLITFTASNVLQTLKITYRGHEIDLTPPWRRLPLRDVVLNATGIDFYALRDDADL
FT                   AEAIRKAGIELRPGATRAQMIDELLDNSEHELIQPTFVIDYPVELSPFAKRKEDNPELT
FT                   ERFEVFIGGMEIGNAFTELNDPIDQARRFQAQLTNRTPDGEENPYDEDFIQALMYGMPP
FT                   TGGLGIGIDRLVMLLTDRPSIRDVILFPHLRTRIGEEQP"
FT   gene            complement(7889..8368)
FT                   /locus_tag="Tter_0008"
FT   CDS_pept        complement(7889..8368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0008"
FT                   /product="transcription elongation factor GreA"
FT                   /note="TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: rcm:A1E_05510 transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40932"
FT                   /db_xref="GOA:D1CDC6"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDC6"
FT                   /inference="protein motif:TFAM:TIGR01462"
FT                   /protein_id="ACZ40932.1"
FT                   /translation="MSTNERVRLTEQGLKELREELERLRTVERAKISARIREAKEGGDI
FT                   SESGEYEDAKHSQAFLEGRIKELEKLLANAEVIDRSAQPAGTVGLGSKVTVEENGRTYT
FT                   YTIVDGAEAGRGRDGEVRISSKSAVGSALLGRRVGDSVEVEVPAGKLTFKILSVE"
FT   gene            complement(8527..10581)
FT                   /locus_tag="Tter_0009"
FT   CDS_pept        complement(8527..10581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0009"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   protein of unknown function DUF1058; SH3 type 3 domain
FT                   protein; SMART: Animal peptidoglycan recognition protein
FT                   PGRP; N-acetylmuramoyl-L-alanine amidase family 2; SH3
FT                   domain protein; KEGG: bcb:BCB4264_A1909 peptidase, M23/M37
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40933"
FT                   /db_xref="GOA:D1CDC7"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR006619"
FT                   /db_xref="InterPro:IPR015510"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDC7"
FT                   /inference="protein motif:PFAM:PF01510"
FT                   /protein_id="ACZ40933.1"
FT                   /translation="MLLRASMHLSIRLLPLLAMFMAIINPSILPATGAPNRATIVAKDW
FT                   FVRSPATKSSAAAYSWRERNGYRTETYDSAVRNAYVHFNAIAPSWNMELTEGSVVRIFV
FT                   RSRNHDGNWSQWTSLQPDDNDGMNSGTNYGALVVQRGDEAQLRVQLVGKVGGQMPKLNW
FT                   IRLTFIDSENGPNPANMSASRSGVAMAAEPRPRIITRAEWGADESLRFDSQGHEIWPRQ
FT                   YTTPRKVILHDTVTINNDPNPAATIRAIYYYHAVIRGWGDIGYNYLVDEQGNIYEGRAG
FT                   GENVVGGHARCYNWGTVGIAALGDHSLMPPSSKMVGALEDLIAWIFSKNHINPLGHGSL
FT                   GSYAPYDIPNIATHYDLMGSCGNTHRDPGYYLRRLLPQIRRDIAVRLGYIKGSTISNDT
FT                   GSSSNNSRGTPKAWGPGLTYEVVNTRGTGLNLRARPDDRSPILAILPDGTIVQEIPSPI
FT                   DGWVKTTYKGKTGYLWHGYLKVIPPVEPSNPSSTSVNKEPTYVVTAPAVNLRAGPGMKY
FT                   KVLRTVPKGAVIQEITSKIDGWVKTVYGGYTGYIWYENLRVIRRPDSAPASGGSGGSGS
FT                   NSSFAQTNPVQAYIRGTPGALNLRKGPGMQYQVVTKMWEGMPVQIIGKSVNGWVPVIYK
FT                   DGFGRSFQGWAWGEYISTDRSARATAGALGLAGAAILPALRFRKWRKRK"
FT   sig_peptide     complement(10480..10581)
FT                   /locus_tag="Tter_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.948 at
FT                   residue 34"
FT   gene            10710..11282
FT                   /locus_tag="Tter_0010"
FT   CDS_pept        10710..11282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0010"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   aba:Acid345_1412 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40934"
FT                   /db_xref="GOA:D1CDC8"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDC8"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ACZ40934.1"
FT                   /translation="MNRQEAWELLNEYVKSPNLIRHCLAVEAAVRGYARLYGEDEELWG
FT                   LAGLLHDFDYEIHPTLDQHPSMGKPILEARGVPQEVIYAIQSHSDFTGVPRVHLLDKVL
FT                   YASDEISGFIVAVALVKPSRSIHEVDVKSVKKKLKDKAFARNVNRDDIYRGAEELGVDL
FT                   DTHIANVIEFLKPISDELTPKEQNVSR"
FT   gene            11353..11622
FT                   /pseudo
FT                   /locus_tag="Tter_0011"
FT   gene            11705..12451
FT                   /locus_tag="Tter_0012"
FT   CDS_pept        11705..12451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0012"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) reductase;
FT                   PFAM: short-chain dehydrogenase/reductase SDR; KR domain
FT                   protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   bha:BH2491 3-oxoacyl-(acyl-carrier protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40935"
FT                   /db_xref="GOA:D1CDC9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDC9"
FT                   /inference="protein motif:TFAM:TIGR01830"
FT                   /protein_id="ACZ40935.1"
FT                   /translation="MDLEGKVALVTGGSRGIGRATAIKLASLGARVVVNYNRSKEAAEE
FT                   VVRAISEAGGEAVASPGDVSTKEGAENAVNTALNTWGKIDILVNNAGITRDTLLMRMSE
FT                   EDWEAVIDTNLKGAYLCSKLAVRSMLRNRWGRIINISSVVGLVGNVGQANYASAKAGLL
FT                   GLTKSIAREFGSKNITANAIAPGYIETDIVAVLSEDIKKAILSQIPAGRYGKPEEVAEL
FT                   VAFLASDKAAYINGQTINIDGGMVMI"
FT   gene            12514..13434
FT                   /locus_tag="Tter_0013"
FT   CDS_pept        12514..13434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0013"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /note="TIGRFAM: malonyl CoA-acyl carrier protein
FT                   transacylase; PFAM: Acyl transferase; KEGG: gur:Gura_1876
FT                   malonyl CoA-acyl carrier protein transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40936"
FT                   /db_xref="GOA:D1CDD0"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDD0"
FT                   /inference="protein motif:TFAM:TIGR00128"
FT                   /protein_id="ACZ40936.1"
FT                   /translation="MSSRRIALVFPGQGSQYVGMGKALHDASEAAREVFKRADEILGFR
FT                   LSHLCFSGPEEDLQDTINAQPAIFTVSLATLAAIKEKLHEAGVKLNPSFVAGHSLGEYT
FT                   ALVAANVIDFEDGLRLVRERGRLMKEEGEKIPGGMAAVIGLDEEVIQRACEEASSEGIV
FT                   GIANSNSPGQIVISGELKALHRAMELLQQQGAKKVIKLPISIASHSPVMQRAAAQFAEI
FT                   VSHMKLRDPQIPIVANVTGQILTNVEDIRRELSHHITGPVQWTKSIREMLSHGTNGFIE
FT                   LGPKRVLTGLIQRISPGVDTISTDS"
FT   gene            13450..14691
FT                   /locus_tag="Tter_0014"
FT   CDS_pept        13450..14691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0014"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase 2"
FT                   /note="TIGRFAM: 3-oxoacyl-[acyl-carrier-protein] synthase
FT                   2; PFAM: Beta-ketoacyl synthase; KEGG: bcy:Bcer98_0891
FT                   3-oxoacyl-(acyl carrier protein) synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40937"
FT                   /db_xref="GOA:D1CDD1"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDD1"
FT                   /inference="protein motif:TFAM:TIGR03150"
FT                   /protein_id="ACZ40937.1"
FT                   /translation="MFDRRVVVTGLGAITPVGNNLEDTWKALVEGRSGISYVTRYDLGD
FT                   IPVKIGGEVKGFDPASVVDPKEARYMSRATVFAIAAADEAIKQAGLQITPENAERVGIY
FT                   MGSGAGGIELLLEQQKVLEQKGPRRVSPYLMPNFIVDSASGHMAIRYGAQGPNMAPVSA
FT                   CATGGHSVGEAYETIRRGDADVMIAGGTEGGSHLPIMFAGFSVIKALANDDPPEKACKP
FT                   FDLNRSGFVLSEGAAVLVLEELEHALSRGAKPLAEIIGYGTGNDAFHMASQPEGGAGAA
FT                   RVMRMAIRKANIAPEEVDYINAHGTGTQINDKGETAAIKEVFGDHAYKLAISSIKSMIG
FT                   HTMGAAGAIEAVACVKTIIEGCIPPTINYETPDPECDLDYVPNTARSADVRVALSNSLG
FT                   LGGHNSCLIFRKFE"
FT   gene            complement(14871..16175)
FT                   /locus_tag="Tter_0015"
FT   CDS_pept        complement(14871..16175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0015"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   SMART: CBS domain containing protein; KEGG:
FT                   afw:Anae109_2181 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40938"
FT                   /db_xref="GOA:D1CDD2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDD2"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACZ40938.1"
FT                   /translation="MSGSLWLSGLVGVCLFCLLVFSSMADAALRALNQVRLRALIEQGF
FT                   GRAEAMDRLLEYPHRITATTLIINTFALAGLSALTAILALQLSNNGAQWWLITLTIIVL
FT                   ALFVLIFGQLVPRSLAIRRPERTALRITRMLSVAYFFISPIARVAEWVTNTFLGIFGVK
FT                   DMPRNPFITEDDLRMLVNAGEEEGVIEQEERDMIAGILRFGDIAAHEVMVPRPDIVAVD
FT                   VNTDLRTALDLALEKGHSRLPVYEESLDNVVGIVYLKDLARAIVSSSNVSLRDLARPAV
FT                   FIPESKRLGELLQEFQSSKVHMAIVVDEYGGTAGLITIEDILEEIVGEIQDEYDVELPD
FT                   IEKISEDEWIIRAKIDLDDVNELLGIHLPAEEYDTLGGFITAQLERLPVPGDEVEVEGV
FT                   LMKVLDIEKRRVGRVLVKRLPVPTTSENQEEADES"
FT   sig_peptide     complement(16098..16175)
FT                   /locus_tag="Tter_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.542 at
FT                   residue 26"
FT   gene            complement(16288..17238)
FT                   /locus_tag="Tter_0016"
FT   CDS_pept        complement(16288..17238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0016"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: bcy:Bcer98_0045 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40939"
FT                   /db_xref="GOA:D1CDD3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDD3"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ACZ40939.1"
FT                   /translation="MNRLRIFTGNANRKLACDIARNLDIEIGDALVTTFKNGETRVRLE
FT                   ENVRGCDVFIIQSTSMPVDHHIMELLLMIDAARRASASRITAVIPYYGYAKQEKKTTGR
FT                   EPISAKLVANIIMQAGADRVLAVDLHAPAIEGFFDIPVDHLRAAPLLVDYYKRNPLPDA
FT                   VVVSPDPGGVLRANDFRFRLGVPLAIIAKQRPRPDTAEVLDMVGDVQGKNAIIVDDLIG
FT                   TGGTLAKAADMLLSRGAKSVHAVATHAAFVGSPAAEEVKKILEGNTIEKIVVTDTIYIP
FT                   PEEVDSKIEIVSVASLLAEAIMRIHKDLSVSELFR"
FT   gene            complement(17239..18696)
FT                   /locus_tag="Tter_0017"
FT   CDS_pept        complement(17239..18696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0017"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: Nucleotidyl transferase; transferase hexapeptide
FT                   repeat containing protein; KEGG: sus:Acid_4364
FT                   UDP-N-acetylglucosamine pyrophosphorylase /
FT                   glucosamine-1-phosphate N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40940"
FT                   /db_xref="GOA:D1CDD4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDD4"
FT                   /inference="protein motif:TFAM:TIGR01173"
FT                   /protein_id="ACZ40940.1"
FT                   /translation="MPESLGIVILAAGQGTRMKGHIHKVLHTVAGIPMIEHVLRSALQL
FT                   EPSKLAVVLGHNADQVADVIKRKYQVDFVLQDPPRGTGDAVRVSRPAMDGVEHVMVLYG
FT                   DTPLIRPETLRRLIDHHIAESPRVTILIGETHDPGRVLMDERGRVIAVVEEKQATEEQL
FT                   KIRERNSGVAVFQADWMWEHLESLQPSPVSGEYQLTDLVNIAVREDIGGHWSAYTPETA
FT                   SQEISEPVDTKWPVQYVVVEDPSEAMGINNRLQLAIAEKIMRQRILESLMLSGVTVTDP
FT                   ESTYVDVDVRVDVDAVLLPGTHLTGKTKVSRGAVVGPYSFIRDSYLDEDCRVQMSVVEE
FT                   SYVGVKSDVGPFSHLRPGTRVEAGVHIGNFVETKNTVLHAGVKCGHVSYLGDAEVGEEA
FT                   NIGAGTITANYDGVNKNPTKIGRRAFIGVDTMLIAPVEVGEGAKTGAGAVVTKDVPAGK
FT                   LVVGVPARQVPQHARKDEASEELEDEK"
FT   gene            18876..19841
FT                   /locus_tag="Tter_0018"
FT   CDS_pept        18876..19841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0018"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: mlo:mlr7234 glucose
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40941"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDD5"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACZ40941.1"
FT                   /translation="MSNRYVIGVDLGGSRVRAVLANEKGEFLDRCEFPTLADKGLYFVL
FT                   ERILECVRSVSSNAPRIDAIGVGAPGPINSKEGVVSNPPNLPGWVNVPLAKLIEEKTGI
FT                   PTFLGNDANLAALGEFTYGSGKYVQHLIYITVSTGVGGGIIIDGQLLEGHNGAAGEVGH
FT                   MVVQPGGPKCSCGGYGHLEALSSGTAIAKRAREAASLNKDTIMIELAGSVDKINAKIVD
FT                   EAAKKGDPLALKLLEQAGQWLGYALINLIHIFNPQMISIGGGVSEAGELLLGPARKVVF
FT                   EGLMPVFKQDLQIVKASLGGDVGLAGAVALALQESAKSKV"
FT   gene            complement(19874..20545)
FT                   /locus_tag="Tter_0019"
FT   CDS_pept        complement(19874..20545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0019"
FT                   /product="ATP binding protein"
FT                   /note="TIGRFAM: ATP binding protein; PFAM: protein of
FT                   unknown function DUF71 ATP-binding region; KEGG:
FT                   pca:Pcar_2428 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40942"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR030662"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDD6"
FT                   /inference="protein motif:TFAM:TIGR00290"
FT                   /protein_id="ACZ40942.1"
FT                   /translation="MKSRVALSWSGGKDSCLALYKLLRDDRFSVERLICTVTEGYERVS
FT                   MHGVRVELIEAQAASLGIPLYRIYIPQNCSNQVYDDRMRYALSELMSLGINTVAFGDIF
FT                   LEDIRAYRESRLSEVGVRALFPLWGRSSKDITLSLCKYGFRSVVVCVDSTLLDPSFLGS
FT                   DIDLGFLSSLPERVDPAGENGEFHSFVYDGPIFSRSVSFKKGEVVVRDNRFYYCDLVPA
FT                   G"
FT   gene            complement(20558..21637)
FT                   /locus_tag="Tter_0020"
FT   CDS_pept        complement(20558..21637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0020"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; Methyltransferase type
FT                   11; methyltransferase small; KEGG: THUMPD3; THUMP domain
FT                   containing 3"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40943"
FT                   /db_xref="GOA:D1CDD7"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDD7"
FT                   /inference="protein motif:PFAM:PF01170"
FT                   /protein_id="ACZ40943.1"
FT                   /translation="MRLLLHTAPGLGGILQKQLQSSAGNIRFLSRRFVSDKNDLLVVDA
FT                   ESLQEVLTSRVVEDAFFLFLYRDNISPNMQGLRDLGRVLASAIKTDRWQEAIRYRFDQL
FT                   PASRRKHRVVTFRPVVRLQGSHVFTRSQLRATAEEILVSTLPRNWRLVKDNSLVEVWIT
FT                   VIDNEVWGGVRLTPDYSKRYAYKQYHVEASLRPSIAAAMVWLSCPRNDDVFLDPFCGAG
FT                   TILIERALAGRYRLIIGSDKSREAIEVASSNIGPRYKPIELHQWDATSIPLEHDSVDAI
FT                   VTNPPFGYRYGSKESNKELYPAFLQEAGRILKPDGRLVVVTTEDKLMRHLIGQDWRELV
FT                   TVKVWVLGMRATIFAMERR"
FT   gene            complement(21634..22881)
FT                   /locus_tag="Tter_0021"
FT   CDS_pept        complement(21634..22881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0021"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase 2"
FT                   /note="TIGRFAM: 3-oxoacyl-[acyl-carrier-protein] synthase
FT                   2; PFAM: Beta-ketoacyl synthase; KEGG: mxa:MXAN_4768
FT                   beta-ketoacyl-acyl carrier protein synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40944"
FT                   /db_xref="GOA:D1CDD8"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDD8"
FT                   /inference="protein motif:TFAM:TIGR03150"
FT                   /protein_id="ACZ40944.1"
FT                   /translation="MKTDRRVVITGIGAVTPIGTTRQGLWSGVCKEKSAVDRITRFDPS
FT                   QFRSQVAAEIKDFDPATYLPPKKLARLDRFSQFSIVAAMQAVDDAGLDIDALDKDRVGI
FT                   FIGSALGGVGYAEEQHSIFVEKGLRAVSASLALSVFGGASSSNISMHFGITGPQLSNAN
FT                   SCSSGTIAIGEAFMAIRSGRADVILAGGAEAPLYPLTFGAFSLIKVMSARNDDPETACR
FT                   PFDRDRDGFVMGEGAAVLVLESLEHALRRNAQILGEIIGYASTSDAYHMTAPLPTGEQA
FT                   SRCMALAIANAGCSTDEIDYINAHGSSTPLNDSTETLAIKKVFGERAYKIPVSATKSMH
FT                   GHALGASGAIEIAICCMALACDYIPATVNLISPSDDCDLDYVPNRGRKAKVDTILSNSF
FT                   GFGGINASIVIRRFET"
FT   gene            complement(22871..23338)
FT                   /locus_tag="Tter_0022"
FT   CDS_pept        complement(22871..23338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0022"
FT                   /product="cyclase/dehydrase"
FT                   /note="PFAM: cyclase/dehydrase; KEGG: sgl:SG1803
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40945"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDD9"
FT                   /inference="protein motif:PFAM:PF03364"
FT                   /protein_id="ACZ40945.1"
FT                   /translation="MQATNSIFIKAPPEKIMDLVGNVQRWQEYLPHYRYVRALGDDGSV
FT                   RTFEMGASRSGIPVSWVAEFQAFPESHKLRFTHVGGITKGMYVEWRLMPSKGGTNVEIY
FT                   HDLRLRWPPVFRQIGELVITKLFIEHIASRTLRRFKELAESSEERHSQNEN"
FT   gene            complement(23367..24563)
FT                   /locus_tag="Tter_0023"
FT   CDS_pept        complement(23367..24563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0023"
FT                   /product="geranylgeranyl reductase"
FT                   /note="TIGRFAM: geranylgeranyl reductase; PFAM:
FT                   monooxygenase FAD-binding; KEGG: psb:Psyr_0428
FT                   monooxygenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40946"
FT                   /db_xref="GOA:D1CDE0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDE0"
FT                   /inference="protein motif:TFAM:TIGR02032"
FT                   /protein_id="ACZ40946.1"
FT                   /translation="MIEEREVVIVGGGPAGSSVANVLASLGHDVLLLDKSRFPRPKPCS
FT                   EYMSPGILPLLSNLGIDADLSGMHMLKGMRIHTPAGSQITIEYVDEHNGRYYAPTMERH
FT                   VFDKMLLDHAAHKGVEVRYQAKVMSVVSQDNYSILRVQLPDRAQMDIRTKLVIGADGLR
FT                   SVVARNLSRRYPLIWPKRMGLVTHINLPGIDADYGDMYVHPWGYCGVAATGKSSASVGI
FT                   VLDLRRMALTRGREAIFEDSLKLFPKAHKQICGAASFDRIMGISPIGHGVKEVHGRNWA
FT                   LVGDAAGFFDPFTGEGIYKAVRGGILLGEVVSPYLKVGRIKEGLERYATERARVFRRKS
FT                   LLVSLIQIFISYPYMLEYVANKLQDREALRLSLSRGIGDLQDPLYNLNLRFLFGLLRP"
FT   gene            complement(24584..25477)
FT                   /locus_tag="Tter_0024"
FT   CDS_pept        complement(24584..25477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0024"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: dal:Dalk_1254 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40947"
FT                   /db_xref="GOA:D1CDE1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDE1"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACZ40947.1"
FT                   /translation="MVTVGLLIVTAIWGLTFVTVQSAVADYSAFSFLTLRFALAALALL
FT                   PFSANRIGKKELFVGVPVGATLGLGMLLQTVGLRSTTATNSGFITSLYVVFAPIISALC
FT                   FRSRFHPRIWVAVILSTIGLFLVSKAGLYGVNPGDALTLGCAVLFGIQIALLSRYSPGL
FT                   DSAALAFIQTVTSVFMYLPVVFLTRTPLITNDLDVWLALLITGLGASAFGFWMQTYAQQ
FT                   RMSAARAAVIMAMEPVFAAIGGYTFAGDRMTILQWFGAAFMMAGLFVAEILPYLKHRVS
FT                   MSQRLGETLSEKDLSA"
FT   sig_peptide     complement(25400..25477)
FT                   /locus_tag="Tter_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.421 at
FT                   residue 26"
FT   gene            complement(25480..26640)
FT                   /locus_tag="Tter_0025"
FT   CDS_pept        complement(25480..26640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0025"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   KEGG: bar:GBAA0004 recombination protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40948"
FT                   /db_xref="GOA:D1CDE2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDE2"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACZ40948.1"
FT                   /translation="MPNGPILVLGPNASGKTTLLEAIYLLATTKSHRAGSDRELINWNT
FT                   ESEEGVPAFARVAAEVRRRSPIQVEITILKESTAQGENVRKRIRVNGVNKRAIDLIGQV
FT                   NVVMFGPQDLDLIVGAPSLRRRYLNITISQLDHQYVRTLQTYERVVLQRNTLIKALSDR
FT                   AFKLRDESINDQFAYWDNELVNQGSYLLARRLEILSRMNELASMVHSKLTGSSQELSIA
FT                   YKSTLFDSLPLQLDNPREEEIRDLYIKKIHDLRREELRRGMTLVGPHRDDISFLVGGVD
FT                   VGVYGSRGQQRSVILAIKLAEVDLMKSITGDLPILLLDDVVSELDPERRRYLLQNVLQL
FT                   SQQALVTTTDLLTIGREFLAEASLFETTSTGLLQPMKRTWKIGGER"
FT   gene            complement(26737..27081)
FT                   /locus_tag="Tter_0026"
FT   CDS_pept        complement(26737..27081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40949"
FT                   /db_xref="GOA:D1CDE3"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDE3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ40949.1"
FT                   /translation="MQSNKGNESNLARYAFSSLLVGIFCAILLISGAITNEILVVPKGY
FT                   GRTFSTFGWIVLIILALSAVTGHVLGLIAFADEKVRSRKVKGVEKAFASIVVGWVLFVA
FT                   ILLLILFVGV"
FT   gene            complement(27108..29180)
FT                   /locus_tag="Tter_0027"
FT   CDS_pept        complement(27108..29180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0027"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="KEGG: Os02g0603800; hypothetical protein; K03526 4-
FT                   hydroxy-3-methylbut-2-en-1-yl diphosphate synthase;
FT                   TIGRFAM: 1-hydroxy-2-methyl-2-(E)-butenyl 4- diphosphate
FT                   synthase; PFAM: IspG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40950"
FT                   /db_xref="GOA:D1CDE4"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017178"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDE4"
FT                   /inference="protein motif:TFAM:TIGR00612"
FT                   /protein_id="ACZ40950.1"
FT                   /translation="MVKSQEVTSNRYCVDPYSYKRRCTHEVMVGNVGVGGNNPIRVQSM
FT                   TTTRTKDVESTVNQIVSLARVGCEIVRVTTPTPADARAIKDIKKELQSKNIHIPIVADV
FT                   HFSPHAAMEAALWADKVRINPGNFADTKLFHIKEYTDEEYAKHLEKIAEKLYPLVMRCK
FT                   ERGISMRIGTNHGSLSDRIMSRYGDTPLGMVESALEFVRMCEEWGYKDIILSMKASNPK
FT                   VMIAAYRLLAARMLEYGMTYPFHLGVTEAGNGEDGRIKSAIGIGTLLEDGIGDTVRVSL
FT                   TEDPENEIPFAYELVKRYAYGIVPDSDEATSIDPLPDLRSPFDYSPRPTRKIFLGEHVL
FT                   GANNPPLVLYKQSSPLSINGVVSINRPVGRDSLRADALSLEVVSEKDRDVFQTSASGLQ
FT                   FASNKPALIATLRFPVDVRDIEAAAYMCSIERGQEDRLSTVARLAVEHKRPLVLELIAN
FT                   IAHDQARDLEGKHDYSVVDELISYALKVEQFGVNDLILALRIPDRSYRIRAYRLLDSRL
FT                   RELGKDWNLLLTVTEDDLIDASIGLGSLLCDGIGSMVSIEGNKPYEEKISLVFNILQAS
FT                   GARISKAEFIACPSCGRTLFDLQTTTEKIKSKTGHLKGVKIAVMGCIVNGLGELADADF
FT                   GYMGSGEGKVNLFVGKTCVEKNVPEEIAADKLVDLIKAHGRWIDPPDNNSSMHDS"
FT   gene            29352..30197
FT                   /locus_tag="Tter_0028"
FT   CDS_pept        29352..30197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0028"
FT                   /product="thymidylate synthase, flavin-dependent"
FT                   /EC_number="2.1.1.148"
FT                   /note="KEGG: afw:Anae109_1187 thymidylate synthase, flavin-
FT                   dependent; TIGRFAM: thymidylate synthase, flavin-dependent;
FT                   PFAM: thymidylate synthase complementing protein ThyX"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40951"
FT                   /db_xref="GOA:D1CDE5"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDE5"
FT                   /inference="protein motif:TFAM:TIGR02170"
FT                   /protein_id="ACZ40951.1"
FT                   /translation="MAQQSTNNGIALTRGEKTNIKVKLLFPTKEIAEQYYLPIAYTAAR
FT                   TCYSEKYPEDIWEDALSGKIPQEKMQKLIESIIESGHGTVIEHLWFTFAISGVSRSLSH
FT                   QLVRHRMGVSFDQQSQRYVRYKHPQYTVPESIAEDSELLEKFVQAIEGNMELYSEMLSQ
FT                   GVPAEDARFLFPNGIQTNLVMTVNLRELIHMSGLRLCTMAQWEIRKLFALIKAEVRRTH
FT                   PFLAQFLVIKCVRMGYCDEARNADEHCKVRPHKNTVFKLIDEYRHSQRTNSTRAQNTNE
FT                   "
FT   gene            complement(30202..30405)
FT                   /locus_tag="Tter_0029"
FT   CDS_pept        complement(30202..30405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40952"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDE6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ40952.1"
FT                   /translation="MRGSIVLFVVGLMLLAAVAAWFVFGYFLSQPTVSNTPPVVSPAPG
FT                   KVIPIPTGTVVDPGVIYNSPVR"
FT   sig_peptide     complement(30346..30405)
FT                   /locus_tag="Tter_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.714 at
FT                   residue 20"
FT   gene            complement(30432..30764)
FT                   /locus_tag="Tter_0030"
FT   CDS_pept        complement(30432..30764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40953"
FT                   /db_xref="GOA:D1CDE7"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDE7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ40953.1"
FT                   /translation="MIRLIVTLSIGIASVALCIVPQTRAQILFLSAGILKGIGINKPEL
FT                   IFLPAALIIGWVVLDILAVFLGFWVFDRREAKRNALRRKLLIEEGLLPEEEEDKGAINA
FT                   KKHPRN"
FT   sig_peptide     complement(30687..30764)
FT                   /locus_tag="Tter_0030"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.973 at
FT                   residue 26"
FT   gene            30921..32183
FT                   /locus_tag="Tter_0031"
FT   CDS_pept        30921..32183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0031"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: glycine hydroxymethyltransferase; Orn/Lys/Arg
FT                   decarboxylase major region; aminotransferase class I and
FT                   II; aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; KEGG: gsu:GSU1607 serine
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40954"
FT                   /db_xref="GOA:D1CDE8"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDE8"
FT                   /inference="protein motif:PRIAM:2.1.2.1"
FT                   /protein_id="ACZ40954.1"
FT                   /translation="MAISESKVRFPSLAEFDPEIYEAIQNEKHREMSTLELIASENFVS
FT                   KAVMEAQGSVLTNKYAEGLPGKRYYGGCKYVDVVESLAIERAKQLFGADHVNVQPHSGA
FT                   QANTAVYLATLKPGDTVLGMDLTHGGHLTHGHPINISGMYFTFFRYGVSRETGYIDYDQ
FT                   VRALAKQHNPKMIIAGASAYPREIRFDIFREIADEVGAYLFVDMAHIAGLVAAGLHQSP
FT                   IPYADFVSTTTHKTLRGPRGGLVFCKAEHAKALDKAVFPGVQGGPLMHVIAAKAVALKE
FT                   ALQPEFKEYQRQIVKNASTLAQSLTKHGFNLVSGGTDNHLMLVDLRNKNITGKEAESLL
FT                   DEVGITVNKNTVPYDTQSAFVTSGIRIGTPAVTTRGMKEPEMEEIADIISTVIDARQGE
FT                   ALDEARERVKTLTDRFPFYTD"
FT   gene            complement(32238..34319)
FT                   /locus_tag="Tter_0032"
FT   CDS_pept        complement(32238..34319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bsu:BSU04320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40955"
FT                   /db_xref="GOA:D1CDE9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDE9"
FT                   /inference="similar to AA sequence:KEGG:BSU04320"
FT                   /protein_id="ACZ40955.1"
FT                   /translation="MTNGHDPSSELDVKEVRRGRHPGDRYVRVQHTPGFQKVGRGYISV
FT                   TPRATEPKTFVGKALRSVRRFLIGSPIETAREVHERLTKIKALAILGSDNISSSSYATE
FT                   EIMRILLLGGISALSLTLPITLAVICVLIIVVISYQQTIRAYPHGASAYIVASNELGKL
FT                   PGLTAAASLLNDYVLTVSVSIAAGVAALGSAAPFFLGSSAGDFFYNHRVLVSIVLIMII
FT                   MIGNLRGVREAGTIFAAPTYIYIISILGLLAYGFYRFASGDLPEYNPPPGWVEEWQHRS
FT                   LGALSILLILRAFASGSVGLSGTEAISDGVPAFKPPEWKNARITLIFMAGTFGILFLGI
FT                   SFLSGQLHIIPAPEEQETVLSQLARTLVGTGPYYLLVQAATAVVLVLAANTAFSDFPRL
FT                   AYFLARDGYMPHQFLHRGDRLAFSVGIISLSVIASLLLIIFGGSVTALIPLYTVGVFVA
FT                   FTLSQSGMVAHWRRQRGKGWRVKAAVNGVGATITGIVAVIVAVTKFSSGVPLFNIGSFT
FT                   VHAGSWIVLVLVPLMILMLMSIRSHYERAQRELQPEIPINPSDIKHTIIVPVASLNKVA
FT                   LQSLAYAKSISPNVTAIHVVENQEEAEEFRKEWEKFGSPCSLVIMESPYRSLVGPILAY
FT                   IDAVDRKRPDDTITVVLPEFVPKHWWERLLHNQTALRLKAALLFRPGTVVINVPYHLK"
FT   gene            complement(34408..34968)
FT                   /locus_tag="Tter_0033"
FT   CDS_pept        complement(34408..34968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0033"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="KEGG: bcb:BCB4264_A0071 hypoxanthine
FT                   phosphoribosyltransferase; TIGRFAM: hypoxanthine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40956"
FT                   /db_xref="GOA:D1CDF0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDF0"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ACZ40956.1"
FT                   /translation="MNSDIEQILITESELQAKIKELGSRIAEDYKDKIPVLIGVLNGAV
FT                   MFVSDLIRACPIQLNIDFMAVSSYQDSTESSGVVKIIKDLDRNISGRHILIVEDIIDTG
FT                   LTLSYLLETLQARHPASIKVCALLDKASRRRVNVPIDYLGFQIPDKFVVGYGLDFRDLY
FT                   RNLPYIGVLKPYLYEGITGDNDI"
FT   gene            34982..35800
FT                   /locus_tag="Tter_0034"
FT   CDS_pept        34982..35800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0034"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40957"
FT                   /db_xref="InterPro:IPR017587"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDF1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ40957.1"
FT                   /translation="MESKYNFYHNKDTRTISKMPYKMISNNLSSYLEIGPSSFVSLVGA
FT                   GGKTTTMFRLAHELSDRGLRVITTTTTAIQMPSKNQTPLVLTREEIEQKADYLSEALEK
FT                   YRHVTIVGTIARKDKLLGVDFDFLQRVKDIADSVIAEADGARHKLIKAPAEHEPAVPPY
FT                   TTHFVAIASLKALGMPLSEACHRPEEGQKLACMDPSLPLTVEAFAKILGSPLGILKGKP
FT                   EVIRSYLLLTALSQDNKLEAEEIARRVVSTNRNGFDLIIGVDKEGGLVVL"
FT   gene            complement(35801..36391)
FT                   /locus_tag="Tter_0035"
FT   CDS_pept        complement(35801..36391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0035"
FT                   /product="SNO glutamine amidotransferase"
FT                   /note="PFAM: SNO glutamine amidotransferase; CobB/CobQ
FT                   domain protein glutamine amidotransferase; KEGG:
FT                   dds:Ddes_1897 SNO glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40958"
FT                   /db_xref="GOA:D1CDF2"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDF2"
FT                   /inference="protein motif:PFAM:PF01174"
FT                   /protein_id="ACZ40958.1"
FT                   /translation="MKIGVLALQGDFREHEQMLHRIGIVPVEVRKPEHLYGLDGIIIPG
FT                   GESTTIGKLAVNYGLMEPLKDFAAQGKPVWGTCAGMIFLSKDVGMEQPLLGLLDVKVRR
FT                   NAFGRQLDSFEADIEMPEVSERPVHAVFIRAPIVESVGPGVQVLGKLQDGTIVAVRQGN
FT                   ILATSFHPELTQDPTMHLYFISMAKEDLVTNRS"
FT   gene            complement(36451..37527)
FT                   /locus_tag="Tter_0036"
FT   CDS_pept        complement(36451..37527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0036"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="TIGRFAM: pyridoxine biosynthesis protein; PFAM:
FT                   Vitamin B6 biosynthesis protein; thiazole biosynthesis
FT                   family protein; KEGG: bha:BH0022 pyridoxine biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40959"
FT                   /db_xref="GOA:D1CDF3"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDF3"
FT                   /inference="protein motif:TFAM:TIGR00343"
FT                   /protein_id="ACZ40959.1"
FT                   /translation="MTIYRKHFTKYNLYVATKMVIVCVITFITSIRVSYKNFSATPVFV
FT                   CAKMIYWSNPNTPYIQEAIEVEKSTELTKRGLAEMLKGGVIMDVVNAEQARIAEAAGAV
FT                   AVMALERVPADIRAQGGVARMSDPALIEEIMNAVTIPVMAKVRIGHFVEAQILEALGVD
FT                   YIDESEVLTPADEMHHIDKKKFKVPFVCGARDLGEALRRVGEGASMLRLKGEAGTGNIV
FT                   EAVRHARLIYSEVRRLSTMPEDEWMAYAKQIQAPYELVAEVARTGKLPVVNFAAGGIAT
FT                   PADAALMMQLGVDGIFVGSGIFKSSDPYKRAKAIVEATTHYNDPEVLVRVSKGLGEAMH
FT                   GIDIRTLSQEELMAPRGW"
FT   gene            37541..38287
FT                   /locus_tag="Tter_0037"
FT   CDS_pept        37541..38287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0037"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /EC_number="1.8.4.8"
FT                   /note="KEGG: bha:BH1486 3'-phosphoadenosine 5'-
FT                   phosphosulfate reductase; TIGRFAM: phosphoadenosine
FT                   phosphosulfate reductase; PFAM: phosphoadenosine
FT                   phosphosulfate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40960"
FT                   /db_xref="GOA:D1CDF4"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDF4"
FT                   /inference="protein motif:TFAM:TIGR00434"
FT                   /protein_id="ACZ40960.1"
FT                   /translation="MSLVDKIVEEPAKEELDRINAELEDATPQEIIKWAVDRFGDGLIL
FT                   ACSFGGISGMAILDMAVKIKPDIDVFYIDTDFLFPETHQTKEEAIKRYGIKPIAFKTKL
FT                   TPEAQAEKYGDELWKRNPDLCCHIRKVEPTREALKGRSAWITGLRRDQSSTRRNVRPVE
FT                   WDYKFGLYKINPLAYWNEREVWRYIFKHNVPYNPLHDQGYPSIGCTHCTSPVYGSEDSR
FT                   AGRWAGTGKVECGLHIKLPQTESSSQ"
FT   gene            38399..38956
FT                   /locus_tag="Tter_0038"
FT   CDS_pept        38399..38956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0038"
FT                   /product="adenylylsulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /note="KEGG: sus:Acid_7933 adenylylsulfate kinase /
FT                   phosphoadenylylsulfate reductase (thioredoxin); TIGRFAM:
FT                   adenylylsulfate kinase; PFAM: adenylylsulfate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40961"
FT                   /db_xref="GOA:D1CDF5"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDF5"
FT                   /inference="protein motif:TFAM:TIGR00455"
FT                   /protein_id="ACZ40961.1"
FT                   /translation="MDQKGFTVWFTGLSGAGKTTLADRLEPILRERGLKVEKLDGDVVR
FT                   THLSKGLGFSKEDRDTNIRRIAFVAQLLTRNGVAVITSAISPYRETRQEAREMIGNFVE
FT                   VYVKCSIEELARRDVKGLYAKALRGEIPNFTGISDPYEEPLNPEIVVDSEKETVEESLN
FT                   KIVTRLEELGYLPKVDVAVGAK"
FT   gene            38994..40172
FT                   /locus_tag="Tter_0039"
FT   CDS_pept        38994..40172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0039"
FT                   /product="sulfate adenylyltransferase"
FT                   /EC_number="2.7.7.4"
FT                   /note="KEGG: bsu:BSU15590 sulfate adenylyltransferase;
FT                   TIGRFAM: sulfate adenylyltransferase; PFAM:
FT                   ATP-sulfurylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40962"
FT                   /db_xref="GOA:D1CDF6"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020792"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDF6"
FT                   /inference="protein motif:TFAM:TIGR00339"
FT                   /protein_id="ACZ40962.1"
FT                   /translation="MQQELIDPHGGKLINRMAPQELLEDLRAEAANLPKIPINAREQSD
FT                   LDLIAVGAFSPLEGFMSSDDYRSVVNNMRLSNGLPWSLPVTLSTTEDVARSLSIGSKAA
FT                   LTRDEKIVATIEVQDIFSYDKVSDAEKVFRTSEEAHPGVRAMYAQGEILIGGPVTVFER
FT                   APLQFPKYNRTPAETRKLIQEKGWKTVVGFQTRNPVHRAHEYIQKCALETVDGLLLHPL
FT                   VGETKSDDVPADVRMKCYEVLLENYYPRDRVILGVLPAAMRYAGPREAIFHALIRKNYG
FT                   CTHFIVGRDHAGVGNYYGTYDAQKLFDEFEPSELGITPMKFEHAFWCNQCEAMASTKTC
FT                   PHPESSRVVLSGTKVRNMLASGQMPPKEFSRPEVAQILIEAYRSRQSVADLA"
FT   gene            40192..41121
FT                   /locus_tag="Tter_0040"
FT   CDS_pept        40192..41121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0040"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   bcz:pE33L54_0031 permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40963"
FT                   /db_xref="GOA:D1CDF7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDF7"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACZ40963.1"
FT                   /translation="MKNLARRSEEWHLNRDWVVFLLSALFLIAIKLGLAIPWNELLPAW
FT                   AQGGAHFQIRIALAGLLVGILVGMTGMGSGALMAPLLILILKVKPSLAIGSDLVYATIT
FT                   KVFGAFQHYKHGSVHVRLTAWLAIGSVPGALLGAESVELIHRSYGDDAEHFITKVLAIT
FT                   FMLVSTSIILRTFLPIKSYSKANMENFSLTRKILTPILGFFVGFLVGLTSVGSGSLLMP
FT                   ILIMFYPMPTSTLVGTDIFHAVLLTGAAGASHFMAGNVDLILVSNLLIGSVPGIVLGSR
FT                   LVKVVPERLLRTILAIVLFLTGWKLWLN"
FT   gene            41118..42176
FT                   /locus_tag="Tter_0041"
FT   CDS_pept        41118..42176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   aba:Acid345_2376 conserved hypothetical protein 698"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40964"
FT                   /db_xref="GOA:D1CDF8"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDF8"
FT                   /inference="protein motif:PFAM:PF03601"
FT                   /protein_id="ACZ40964.1"
FT                   /translation="MTEIHPHIEAVSQEIKETPIHLFIWRRVQRYAPGILLLVAVGYFA
FT                   LVCSYFLTGLSYIPMSILLGAFISNSFGLHPALEKGISTYELWLKVGIVLLGAQVAFTQ
FT                   LGIYWLKVLPLAILIVLLGFFITLAIGKCFRLPRPLTILIAAGSGICGVSAIINTSKRI
FT                   GASEEETEYAVGTVLVFGALAIVLYPILGRLLGLSEQIYGTWTGLSVNNTAEVVATGYT
FT                   LGAVAGTIAIATKLCRILTLGAVISIIDRIDSGESTPRDITIQNIWKHTPKFILAFVVL
FT                   SIVSSLGFLSAEDKTSLYNLSSWFFLMAFAGIGFRLKWSDLSKVGYRPLLAGGISTLFI
FT                   ASISLVISMIIT"
FT   gene            complement(42389..44989)
FT                   /locus_tag="Tter_0042"
FT   CDS_pept        complement(42389..44989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0042"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mca:MCA1018 ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40965"
FT                   /db_xref="GOA:D1CDF9"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="InterPro:IPR038054"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDF9"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACZ40965.1"
FT                   /translation="METGQVRTLPSAFGLAKLSWNRNRLLLAGMLAFILLLLAASGIYA
FT                   IAYSGKIYPGVKVLGVDLSGKTKQEAARLLQSRADKLLESPVVLTADKHRFQVKSSDLG
FT                   VRFDIQAMVDSAYQFGRSDAFASRWLQRFMAPFSDHEVAPVVSLNNAKTRDTLESIAST
FT                   VDRPVRNAKIILGEDGPRFITSQVGVKLDIDSNLKSLSNSIPRAYEKSTTVSLKVIYTR
FT                   PSIEDSDLQPIYKGLVAAWNRPLTLKFGDKQWAMPVSEVRQLLRLDTSGKLPKPYLLEA
FT                   PIRNWLEDISQEIDSDPVDARIKVLSQSVELVPHKDGYTLLEDQTVERIQTEAFKSGII
FT                   DVVVQVTHPNLTTESLKPVVDKANAMVNQPFEVSYRNRSWTLEPQDLVQMLRWNKDDTP
FT                   PTPYISRNKLRTWLSGVAERIERSPVNARVIVDNGKVRIIPARIGVRLDIDANLKALIS
FT                   AISSGNTRQFALQVQRWEPKIRSSDLRPAVDLANQLISDPITVSYSSGNWNIDSTTLAS
FT                   WLRWEGNGKDITPVLDYDSVRSFVYQIAQQVNKDPSDAYLSVAGGYAHIVPETVGVTVD
FT                   IESTTQKIINAASTSTRNVTLDVTTSYPQVTSDDLKPALDKMLYWTGERFYMSLNGRTW
FT                   WLDPSDLVLALRWYGTGENTVVYLDENALEQQIRRWVPQDSVTDMDINYSATAQVAMKA
FT                   IVNGNRHIAIVAEPIKNDTSDQEHKGYESFWKGDFPDKWIDINLSSQSLAAYEGSKQVK
FT                   VSLITSGRPELPTPTGLFHVLSKISPKVFISPWPKDSEWYYPPSKANFALLFRSGGYYI
FT                   HDAPWRSVYGPGTNGSGPPGDARTGSHGCVNVPYSMMAWLYSWAEVGTPVLIHY"
FT   sig_peptide     complement(44846..44989)
FT                   /locus_tag="Tter_0042"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.389 at
FT                   residue 48"
FT   gene            complement(45176..46183)
FT                   /locus_tag="Tter_0043"
FT   CDS_pept        complement(45176..46183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0043"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: bcb:BCB4264_A0292 putative O-
FT                   sialoglycoprotein endopeptidase; TIGRFAM:
FT                   metalloendopeptidase, glycoprotease family; PFAM: peptidase
FT                   M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40966"
FT                   /db_xref="GOA:D1CDG0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDG0"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ACZ40966.1"
FT                   /translation="MNILAIETSCDETSAAVIADGYLVKSNIVASQIDIHRRFGGVFPE
FT                   VASRQHVLAILPTIEESLSKAQVGWEDIDAIAVTKGPGLVGSLLVGVNTAKGIAWARDL
FT                   PLIGSNHIEGHIYANWLQEDPNAPRHIPQFPLLALIVSGGHTELILMKDHGVYERLGRT
FT                   LDDAAGEAFDKAARILGLGFPGGPAIQKAAEKAEGREFVLPRAELPGTFNFSFSGLKTA
FT                   LLRAVESSENVDVYALANGFQESVVDILVRKTVAAAEQTAAKEVVIAGGVAANTRLRER
FT                   IKQELGEKVRVPKFEYCTDNAAMIGGLAYYRYIRGKTDQLDLDVDPNLDLVVDA"
FT   gene            complement(46206..46901)
FT                   /locus_tag="Tter_0044"
FT   CDS_pept        complement(46206..46901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0044"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: bcb:BCB4264_A0291 ribosomal-protein-alanine
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40967"
FT                   /db_xref="GOA:D1CDG1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDG1"
FT                   /inference="protein motif:TFAM:TIGR01575"
FT                   /protein_id="ACZ40967.1"
FT                   /translation="MPFKIERMKVEDIPEVAEIDRISFSTPWPPSAYRREIEHPDRNYY
FT                   IVLRRVGEGPLKDKDMSRHGVLANILPFLKDEKLEPNPNPIIGYAGLWIIGEEAHVTTI
FT                   AVLPQFRGKKLGELLLVSLIDYARKNGVHRMTLEARVSNHVAQTLYRKYTFKNAGYRRR
FT                   YYSDNGEDALVMWSDRIDTDEFANKFESLKRELFEKLNGQLLLEDDSMEDASHRHVGEH
FT                   IEHVDRESP"
FT   gene            complement(46948..47622)
FT                   /locus_tag="Tter_0045"
FT   CDS_pept        complement(46948..47622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0045"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   sfu:Sfum_1786 peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40968"
FT                   /db_xref="GOA:D1CDG2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDG2"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ACZ40968.1"
FT                   /translation="MAKDLILALDTSDRRCGLAINRNGENLLDLSWDSGRSHTVQLMPW
FT                   LDYAFKQLRLSKESISAVAVTTGPGSFTAMRVGMATAKGICKALGVPIIGVPTLLYAAW
FT                   PYRYFCKHIVACLVLGRGRLAAALYASEDGGNLSLQWCRSLSLQELANELDSLPYDRVL
FT                   LCGDIPVELKENLKDSTRYLLLSPAESSRRLAVLAEIAWQRFRLGSVDNPATLQAEYLD
FT                   RK"
FT   gene            complement(47623..48147)
FT                   /locus_tag="Tter_0046"
FT   CDS_pept        complement(47623..48147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0046"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   bsu:BSU05910 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40969"
FT                   /db_xref="GOA:D1CDG3"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDG3"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ACZ40969.1"
FT                   /translation="MLQQLDRLVLLTHNAEETKDLGRTLAQLVQPGDVIPLWGGFGVGK
FT                   TTFTQGLAEGLGVREAVVSPSFGLVNIYHSTKRPEITLYHLDLYRISSRQEAEGFGADE
FT                   LIMDEGVALVEWPEVIKDLLPPEKLDVNFEWIDENNRRITLAASGKRFLTLLTALEDKL
FT                   RQDKVAFDKES"
FT   gene            48272..48484
FT                   /locus_tag="Tter_0047"
FT   CDS_pept        48272..48484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40970"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDG4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ40970.1"
FT                   /translation="MNHSPEDRILEETLSKQKELIEFYKKAIKQSADQECKDLFKSLAK
FT                   SLDSDMTSVAEEIAKHRMERKLREQ"
FT   gene            48547..49023
FT                   /locus_tag="Tter_0048"
FT   CDS_pept        48547..49023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0048"
FT                   /product="ATP-cone domain protein"
FT                   /note="PFAM: ATP-cone domain protein; KEGG: sat:SYN_02369
FT                   transcriptional regulator NrdR"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40971"
FT                   /db_xref="GOA:D1CDG5"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDG5"
FT                   /inference="protein motif:PFAM:PF03477"
FT                   /protein_id="ACZ40971.1"
FT                   /translation="MRCPKCGSTRTRVTDSRETTNAIRRRRKCEDCGYRFTTYERIEQV
FT                   MPLVVKRDGTREEWDRNKLLTGIRLACNKRPVSYSTMQQIVDEIEEQFSGRQEVDSSEI
FT                   GQAVMKKLRVLDEVAYIRFASVYLRFHDVNGFIEAVEQVRRPQKPPEEQIPMNI"
FT   gene            49160..51595
FT                   /locus_tag="Tter_0049"
FT   CDS_pept        49160..51595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0049"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ribonucleotide reductase
FT                   large subunit; Ribonucleotide reductase large subunit
FT                   domain protein; KEGG: ribonucleoside-diphosphate reductase;
FT                   K00525 ribonucleoside-diphosphate reductase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40972"
FT                   /db_xref="GOA:D1CDG6"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDG6"
FT                   /inference="protein motif:TFAM:TIGR02504"
FT                   /protein_id="ACZ40972.1"
FT                   /translation="MSGTTYIDTSSIHTIEDLEREVQALIDSGRATKLEGYREKIFLDR
FT                   YARKDPNGTPLEHYPEEMWLRVAKAIAAVEPNPEAQRQWTLRFYDILQGFRFVPGGRIL
FT                   SGAGSGAEVTYYNCFVIPSPEDSVEGIFRNITTAAHIMRRSGGVGVNLSSLRPRGAYIK
FT                   TVNGTSSGPCSWAILYSDMTGKVIIQGGSRRGALMIMLDDDHPDIEEFVEYKRKNPGHI
FT                   DHANLSVAVSDAFMEAVKKDLPWDLKWQGKVWKTIRARDLWRKIAESAWAYAEPGLVFI
FT                   DRYNKRSNTWYFENIRCVNPCGEQGLPPWGVCNLGALNLLAFVKHIDGETYFDFEDLAN
FT                   TARVAIRFLDNVIDATVYPFPENEEAQKHGARRTGLGTMGLADVLIKLGVKYGSPEAEP
FT                   LVERIYRTIRDAAYDASADLAAEKGPFPKFDRDKYMQGEFIRELPEEIQAKIRRQGIRN
FT                   AVLLTQAPTGTTSSLAGVNSGIEPVFAFVTKRRDRLGEHLLYHPLAQEWMDAHPGKPLP
FT                   DYFVSSADLTPEEHIRIQAVVQKYTDSSISKTVNGPEDNTVEDVERLYMLAYDTGCKGI
FT                   TYYRQGSRDAVLEAVDTKPKEKAEKPEEAPKASHPEVHRSTLKKRPDVVSGYTRQIRAP
FT                   EGKVNITLNSDDEGLLEVFINLGKAGSDIAAMAEALGRLISFALQMPSPMSPNERAAEI
FT                   ADQLRGIGGSRSVGFGPGQVKSLPDAVGQALLKHLQSEGIALSNGNGNGHADVESKELV
FT                   AVVAQNGNHGEETPESIAQKLLEKTYQLTGNLCPSCGCNSLIAQEGCKKCYTCGYSEC"
FT   gene            complement(51642..52760)
FT                   /locus_tag="Tter_0050"
FT   CDS_pept        complement(51642..52760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0050"
FT                   /product="Ion transport 2 domain protein"
FT                   /note="PFAM: Ion transport 2 domain protein; KEGG:
FT                   sus:Acid_0874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40973"
FT                   /db_xref="GOA:D1CDG7"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDG7"
FT                   /inference="protein motif:PFAM:PF07885"
FT                   /protein_id="ACZ40973.1"
FT                   /translation="MLMEVFSIVLGVCIILLAITDIVLTVLHIQGRSLIEWLFTRSLWS
FT                   LLRAIASPLPGRARHHVLSWGFPLMIAGLIGIWVCLLVVGYSLIYWPFISNDAYFSQTQ
FT                   YHQGFGGALYFSGVTLATIGYGDIHPRSTLLGFVAVTEGFSGFVVITMSVTFLLSVYPS
FT                   LLKKSSLASALNREVDGDISAVPMIARYIDAGNLEALYTRIADINKDLLEVIEAHRVHS
FT                   ALYYAHPFEPDRSLVRVLLIIRGIITALRFGLYDQSRKVGQPWNDPRILVLEDSFTYAL
FT                   AMFAESVYVASRQSEYSEEEVREYLRKDYRSLRHRLHDLGLVLSADDGAEEEYVRFRLS
FT                   VDPYINAYREHSGYTTSEVESKLELAAHPLKK"
FT   gene            52894..54816
FT                   /locus_tag="Tter_0051"
FT   CDS_pept        52894..54816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0051"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: bha:BH0006 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA topoisomerase type IIA subunit
FT                   B region 2 domain protein; DNA gyrase subunit B domain
FT                   protein; TOPRIM domain protein; ATP-binding region ATPase
FT                   domain protein; SMART: DNA topoisomerase II; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40974"
FT                   /db_xref="GOA:D1CDG8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDG8"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACZ40974.1"
FT                   /translation="MAQLEEKVISNYNAESIQVLEGLEAVRKRPGMYIGSTDVRGLHHL
FT                   IYEIVDNSVDESMAGYCDFIEVHIHKDKSVTVRDNGRGIPVGIHPKLKKSALEVVMTVL
FT                   HAGGKFGSGGYKVSGGLHGVGASVVNALSEYLIAEVHREGKIWRQSYERGVPKTPVEAI
FT                   GDTDRTGTIITFKPDADLFSTLEYQFDTLAQRFREIAYLNKGLKITFIDDRDDKELTLY
FT                   FEGGIASFVRHLNKNRNVLTEKPIYIHKQLNGIDVEVAIQYTDGFNESLHTFTNNINTV
FT                   DGGTHLTGFRTALTRTLNDYAVKNGLLKDSDTKLTGEDVREGLTAVVSVKLPDPQFEGQ
FT                   TKSKLGSSEAERVVASVVRDGLLSYFDENPSDAKRIIEKAITAARAREAARKARDLVVR
FT                   KGALDGMTLPGKLADCSERDPRHSELYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNV
FT                   EKARLDKMLSSAEIKALITALGTGIGDSFDISKLRYHRIFLMTDADVDGAHIRTLLLTF
FT                   FFRHMPDIIKNGHLYIAMPPLYKIQVGKEKYFVYSDEERDRVLAGLNGNRSKAIIQRYK
FT                   GLGEMNPEQLWETTMDPSTRTIMQVTIEDAVKADELFDMLMGSNVAPRKKFIQSHAKSV
FT                   RNLDI"
FT   gene            54946..55962
FT                   /locus_tag="Tter_0052"
FT   CDS_pept        54946..55962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0052"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="TIGRFAM: fatty acid/phospholipid synthesis protein
FT                   PlsX; PFAM: fatty acid synthesis plsX protein; KEGG: fatty
FT                   acid/phospholipid synthesis protein PlsX; K03621 fatty
FT                   acid/phospholipid synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40975"
FT                   /db_xref="GOA:D1CDG9"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDG9"
FT                   /inference="protein motif:TFAM:TIGR00182"
FT                   /protein_id="ACZ40975.1"
FT                   /translation="MRVAVDAMGGDKAPDEIVEGALRASNELGIDITLVGKEDVIAPLL
FT                   SSKPSQRHIEIIHTPEIIAMDEHPATAVRKKKDSSIVRGLELLKEGKADAFVSAGNSGA
FT                   VMAASLFVLGRCTGIDRPAIGTIIPGKEGPVLLIDAGANVDPEPVHLLQFAFMGSIYAR
FT                   EVMRIGNPKVGLLSNGEEETKGNKLTLQAHKLLKGSNLNFQGNVEGRDVTKGTVHVIVT
FT                   DGFTGNVVLKTVEGVAEDLVSIIREEITSGILNKVGALILQGAFRKVAQKLDYAEYGGA
FT                   PLLGVRGNVFIAHGRSNAKAIKNAIRLAHEAASHRIPKLISDNNIIVTGKEMFQQDL"
FT   gene            55964..56734
FT                   /locus_tag="Tter_0053"
FT   CDS_pept        55964..56734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0053"
FT                   /product="peptidase C26"
FT                   /note="PFAM: peptidase C26; glutamine amidotransferase
FT                   class-I; KEGG: mxa:MXAN_5086 class I glutamine
FT                   amidotransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40976"
FT                   /db_xref="GOA:D1CDH0"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDH0"
FT                   /inference="protein motif:PFAM:PF07722"
FT                   /protein_id="ACZ40976.1"
FT                   /translation="MSAVIGIALSLDTGKNKIARFYGGLQYFRAIRSAGGVPVGLPLLD
FT                   EHTLRQAYDRMDGILLMGGGDVAPQRYGEKPIPELGDVEEYRDELELALIRWAREDNKP
FT                   LLAICRGIQILNVAYGGTLYQDIDAQNPTGLDHRLSTKTGKRSYIAHKMSIQEGTRLYR
FT                   SILEKEIPVNSMHHQAIKDVGKGLAVTGWSEDGIIEAVEDESNSWIVGIQCHPEELWEE
FT                   HLWAKRLFESFIREASFQANRRNPDRTIGALVKD"
FT   gene            complement(56739..57230)
FT                   /locus_tag="Tter_0054"
FT   CDS_pept        complement(56739..57230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0054"
FT                   /product="CinA domain protein"
FT                   /note="PFAM: CinA domain protein; KEGG: dps:DP2957
FT                   competence-damage inducible protein (CinA)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40977"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDH1"
FT                   /inference="protein motif:PFAM:PF02464"
FT                   /protein_id="ACZ40977.1"
FT                   /translation="MANSISLAFQVYRMIGNLTLSVAESCTGGSLASSIVSIPGSSRFF
FT                   LGGVVAYSNDIKIRILGVSERTISIHGAVSSACALEMANNVRKLMGADIALSTTGIAGP
FT                   EGGTEEKPVGLVYVAISTPEGSWYIRRIWRGTRAQNIASTNAAALSLLIEYLAQKINPD
FT                   "
FT   gene            57312..58607
FT                   /locus_tag="Tter_0055"
FT   CDS_pept        57312..58607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0055"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="KEGG: bha:BH3556 enolase (2-phosphoglycerate
FT                   dehydratase); TIGRFAM: enolase; PFAM: enolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40978"
FT                   /db_xref="GOA:D1CDH2"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDH2"
FT                   /inference="protein motif:TFAM:TIGR01060"
FT                   /protein_id="ACZ40978.1"
FT                   /translation="MAVIDDVYALEILDSRGNPTIQVTVVLDSGAYGTAAVPSGASTGA
FT                   HEAIELRDKDPIRFGGKGVLKAVSNVNEIIAETILGENVNSQRELDQILLELDGTPNKS
FT                   NLGANAILGVSLAFAHAMAADLNLPLYMYLGGAIARTLPVPMMNILNGGKHADNSTDMQ
FT                   EFMIMPIGASSFSEALRWGSEVYHALKKDLDNRGFNTNIGDEGGFAPSLDSNKTAIEAI
FT                   LRAIENAGYTPGEQIVIALDPAATELYQGGQYHLKKEGEVLTSSEMVDFWQEWIRQYPI
FT                   VSIEDGLAEDDWEGWTQLTEAIGNSVQLVGDDLFVTNTDRIREGIARRAANSVLIKPNQ
FT                   IGTLTETIEAVELAHKAGWTAIMSHRSGETEDTTIADLAVALGTGQIKTGAPARGERTA
FT                   KYNRLLRIEHELGDDAIYAGWSALRRKDLLSR"
FT   gene            complement(58801..59109)
FT                   /locus_tag="Tter_0056"
FT   CDS_pept        complement(58801..59109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40979"
FT                   /db_xref="GOA:D1CDH3"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDH3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ40979.1"
FT                   /translation="MTAVTTLLLVLAPLISLVGGIILIFCGVRYLLGYRKLIWDLEIAN
FT                   NNAALATCILGVSFAGLGLTYILTSGSVGHDLLYFLWLAMVLLAGILTFCIPGNSHQ"
FT   gene            complement(59114..59530)
FT                   /locus_tag="Tter_0057"
FT   CDS_pept        complement(59114..59530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0057"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG: afr:AFE_0850
FT                   septum formation initiator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40980"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDH4"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ACZ40980.1"
FT                   /translation="MLNLDLIRDRRSQIARLVLLLCAAYFALAFVAQAWKARNLNQVLV
FT                   QERAKLEQQEARNRELQEQLEMLSGKEYSVYVERVAREKLGMVKPGDIPVFVVPNPQAP
FT                   KRQQKVLTAGEEQTGTNRQSDIPVWRQWISVLLK"
FT   sig_peptide     complement(59426..59530)
FT                   /locus_tag="Tter_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.917 at
FT                   residue 35"
FT   gene            complement(59592..61076)
FT                   /locus_tag="Tter_0058"
FT   CDS_pept        complement(59592..61076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0058"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /EC_number="3.5.1.4"
FT                   /note="KEGG: gbm:Gbem_3644 glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40981"
FT                   /db_xref="GOA:D1CDH5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDH5"
FT                   /inference="protein motif:TFAM:TIGR00132"
FT                   /protein_id="ACZ40981.1"
FT                   /translation="MKHRDNRDLVDLSIRELRKLLDNKHVSSVELTEAYLRRIEQVDPQ
FT                   IRSYLTVTADLALQQAQEADKKLASGEKSPLLGIPMALKDIISTKGIKTTCGSKMLENY
FT                   IPPYDATVYEKLCAAGCVLLGKLNMDEFAMGSSTENSAYGPTKNPWDLTTVPGGSSGGS
FT                   ASAVAAGEAAFTLGSDTGGSVRQPAALCGVVGLKPTYGRVSRYGLVAFASSLDQIGPIT
FT                   RTVEDLADVLQVIAGYDPKDSTSVPIDVPQYGDALSEDIRGIRIGVPKEYFVEGMEPGV
FT                   ERAVREAIDKLGSLGAKIVDISLPSTDYALATYYIIAPAEASSNLSRYTGVEYGHRAPD
FT                   AEDIIDMYMKTREEGFGPEVKRRIMLGTYVLSAGYYDAYYLKAQKVRTIIKSEFDAAFK
FT                   ECDVIATPTSPTVAFKLGSKLQDPLSMYLSDLFTIPANMAGIPGLSIPCGFSDDLPVGL
FT                   QLLGKAFDESTLLKVGYAYQQSTEWHLKRPQILAYL"
FT   gene            complement(61066..61362)
FT                   /locus_tag="Tter_0059"
FT   CDS_pept        complement(61066..61362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0059"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; PFAM: Glu-tRNAGln amidotransferase C subunit;
FT                   KEGG: bha:BH0665 aspartyl/glutamyl-tRNA amidotransferase
FT                   subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40982"
FT                   /db_xref="GOA:D1CDH6"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDH6"
FT                   /inference="protein motif:TFAM:TIGR00135"
FT                   /protein_id="ACZ40982.1"
FT                   /translation="MGLSSEQVLHISRLARLGLTDAEVELFRDQLSSIIEHVNKLSELD
FT                   TEAIPPTAQVIELLDVFAKDEPSTSYSTDEMLANAPEKEENCFKVITVLGYET"
FT   gene            complement(61408..62529)
FT                   /locus_tag="Tter_0060"
FT   CDS_pept        complement(61408..62529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0060"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   cell cycle protein; KEGG: sat:SYN_00550 rod
FT                   shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40983"
FT                   /db_xref="GOA:D1CDH7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDH7"
FT                   /inference="protein motif:TFAM:TIGR02210"
FT                   /protein_id="ACZ40983.1"
FT                   /translation="MNSREEITTPWWRKFDWVLLLCTLALSSFGLVMIYSATSDPGPLT
FT                   LNPLVIRQFIYLIVGLLFMSIMATVDYRFLLNWKWVIYGLVLFLLTLVFVIGHTAYGST
FT                   RWIDLGPFPLQPSELAKLLMVLVLAGFLCEKKRGERDLKRLIISICIIAPPTALVFLQP
FT                   DLGTSMVLGAAWVSLVLFGGIPVKYLMRLFLLLIPFAVIGGRFLLKPYQIERIAIFLRP
FT                   EDNPFGSGYNIIQATISVGSGGFWGQGFMSGSQSQLHYLRVQHTDFIASVIGEEFGFIG
FT                   MMALLVVYGLLLWRIIRIASKARDKYGELIAVGVAAIILFQVFVNIGMNIQLMPVTGIP
FT                   LPFISYGGSSLVTLLTSEGILQSIILRHKKVNL"
FT   sig_peptide     complement(62410..62529)
FT                   /locus_tag="Tter_0060"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.895) with cleavage site probability 0.336 at
FT                   residue 40"
FT   gene            complement(62567..63580)
FT                   /locus_tag="Tter_0061"
FT   CDS_pept        complement(62567..63580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0061"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl; cell
FT                   division protein FtsA; KEGG: pca:Pcar_1049 rod
FT                   shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40984"
FT                   /db_xref="GOA:D1CDH8"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDH8"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ACZ40984.1"
FT                   /translation="MVFSKRIGIDLGTANVLVYVKGRGIVIKEPSVVAVSTKDGSIKAV
FT                   GAEARDMLGRTPETIEVVRPMKDGVIADYVITEEMLRHFIGKAAGRFSLGGPEVMVCVP
FT                   GGVTTVEMRAVRDAALNAGAKHAWLIREPLAAALGAGIPVSAPSGNMVIDIGGGTTEVA
FT                   VISLNGIVVGNSVRLGGNHIDEEIMNYMKRSYGLIIGDRTAEEIKIEIGSAVPLPEEEK
FT                   KTMNVKGRDQVTGLPRTVTVTSDEITEAIAEPLDSIVNAVLVVLEETPPELMSDIIDKG
FT                   MVLAGGGALLRGMDKLLAERTGIPCCIAENPLDCVAIGTGMALEHLDVLRDSLIED"
FT   gene            complement(63703..64125)
FT                   /locus_tag="Tter_0062"
FT   CDS_pept        complement(63703..64125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0062"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+transporting two-sector ATPase delta/epsilon subunit;
FT                   KEGG: dvm:DvMF_2832 ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40985"
FT                   /db_xref="GOA:D1CDH9"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDH9"
FT                   /inference="protein motif:TFAM:TIGR01216"
FT                   /protein_id="ACZ40985.1"
FT                   /translation="MPLHLEVVTAERVVFSDDVDMVVATGLEGALGILPKHAPLMAVLD
FT                   VGPLKYRKGNQEDEIAIGGGFMEVLNDRVTVLADTAERSEEIDIARAEEAQQRAQRLLA
FT                   ERPSAETRAAMDLALRRAQVRLKVARRRRRTGQPIP"
FT   gene            complement(64208..65623)
FT                   /locus_tag="Tter_0063"
FT   CDS_pept        complement(64208..65623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0063"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="KEGG: rce:RC1_2241 ATP synthase F1, beta subunit;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40986"
FT                   /db_xref="GOA:D1CDI0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI0"
FT                   /inference="protein motif:TFAM:TIGR01039"
FT                   /protein_id="ACZ40986.1"
FT                   /translation="MAVQAKAKGRIVQITGPVVDVEFPDGNLPEILNAVRVEREDGEPV
FT                   VLEVQAHLGNDWVRCVSMRSTDGLYRGMEAIDTGEPIAVPVGPATLGRIFDVLGQPVDE
FT                   KGPVNADERWPIHRPAPEFEEQSTEAEVFETGLKVIDLIAPFTRGGKTGVFGGAGVGKT
FT                   VIIMELINNVAKQHSGVSVFAGVGERTREGTQLYEEMTESGVLGSTVLVFGQMNEPPGA
FT                   RLRVGLTGLTMAEYFRDVEGRDVLLFMDNIFRFVQAGSEVSALLGRMPSAVGYQPTLAT
FT                   EMGQLQERITSTKRGAITSVQAVYVPADDYTDPAPATTFAHLDATIALERSIAERGIYP
FT                   AVDPLASTSRILDPRIVGEEHYEVARGVQRVLQRYKDLQDIIAILGVEELSDEDKLIVA
FT                   RARKIERFLSQPMFVAEQFTGRPGQYVRREDTVRGFKEILEGKYDDLPEQAFYMVGTIE
FT                   QAVEQAERMARES"
FT   gene            complement(65665..66540)
FT                   /locus_tag="Tter_0064"
FT   CDS_pept        complement(65665..66540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0064"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: sus:Acid_0464 ATP synthase F1, gamma subunit;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40987"
FT                   /db_xref="GOA:D1CDI1"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI1"
FT                   /inference="protein motif:TFAM:TIGR01146"
FT                   /protein_id="ACZ40987.1"
FT                   /translation="MPSTREIRRRIRSIRNTAQITRAMEMVAASRMRRAQQAVTASRPF
FT                   SEKIRHVLADLGASTGGGDSVMHPLLERRPENRVTLILMTSDRGLAGSFNTNIIRTAIN
FT                   FMLDRQDQQVSVIAVGRKGRDYMVRRRRDLKAEFSNIGDLPGLDAITPVAHMIIDEFTS
FT                   GQTDAVYLAYTEYITTLNQRPTLLKILPIEPPEVEEGRETKVPDYIFEPNPAMLLRALL
FT                   PRYVEVQLYQALLESKASEHSARMVAMRNATDNANELVEELTLTYNKLRQANITKEIIE
FT                   IASGAAALEG"
FT   gene            complement(66605..68131)
FT                   /locus_tag="Tter_0065"
FT   CDS_pept        complement(66605..68131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0065"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: gsu:GSU0111 F0F1 ATP synthase subunit alpha;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40988"
FT                   /db_xref="GOA:D1CDI2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI2"
FT                   /inference="protein motif:TFAM:TIGR00962"
FT                   /protein_id="ACZ40988.1"
FT                   /translation="MAIKTEEIAEIIKKQIESFGQPVVTAEVGTVVEVGDGIARAYGLS
FT                   GVKASELVQFENGVYGLALNLEEDNVGIVILGPYTDIEEGQQVRSTGRVVDVPVGDELI
FT                   GRVVNPLGEPIDGKGPINATKRRVIERIAPGVVARKSVDTPVQTGIKAIDSMIPIGRGQ
FT                   RELIIGDRQTGKSAIAIDTIINQKGKDLICIYVAIGQKTSKVAQVVATLEEYGAMEHTI
FT                   VVAANADDPASLQYIAPYAGCAMGEEFMEQGRDALVVYDDLSKHAAAYREISLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARLNDEYGGGSLTALPIIETQANDVSAYIPTNVISITDG
FT                   QIYLESDLFYAGIRPAINVGLSVSRVGGAAQTKAMRQVAGKLRLDLAQFRSLAAFAQFG
FT                   SDLDKATRAQLERGQRLTEVLKQPQYSPVPLERQVMIIFAATNGYLDDIPVDSVRDFEN
FT                   RFYEYMDSVHPEIGQEIADKKALSDELTEKLRAAIEEFKQGYTPQQSAPA"
FT   gene            complement(68158..68697)
FT                   /locus_tag="Tter_0066"
FT   CDS_pept        complement(68158..68697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0066"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+transporting two-sector ATPase delta (OSCP) subunit;
FT                   KEGG: bha:BH3757 F0F1 ATP synthase subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40989"
FT                   /db_xref="GOA:D1CDI3"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI3"
FT                   /inference="protein motif:TFAM:TIGR01145"
FT                   /protein_id="ACZ40989.1"
FT                   /translation="MPSVGSSARRYAEAIFELAQESGNLDAWHADLSLLASVFSDVSAL
FT                   RFFKNPRKSISEKQDMAKRLFEGKVQPQAMYLLQMLVDRDRVEIVPAILSRFEELLREA
FT                   RGIVVAEVTTAVPVDDNEKQQIVEQLSQITGKQIELHTKVDPSIIGGIVVRVGDKLVDG
FT                   SVATALTQLHRSLTLR"
FT   gene            complement(68690..69217)
FT                   /locus_tag="Tter_0067"
FT   CDS_pept        complement(68690..69217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0067"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+transporting two-sector ATPase B/B' subunit; KEGG:
FT                   afw:Anae109_4485 ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40990"
FT                   /db_xref="GOA:D1CDI4"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI4"
FT                   /inference="protein motif:TFAM:TIGR01144"
FT                   /protein_id="ACZ40990.1"
FT                   /translation="MSAVLENLGLQLWPFIWQLVAFLILVYVLKRFAFGPVTRILDERA
FT                   ARVRESIETAERIQREAAEQEQRTKQMLEDARRQAQAILQQAQQAAERIQSTAQDNARE
FT                   QANQIIQRAQEDIDRMKAEAIDELRRQVADLAIAAASRIIRKELDPATHRALINEVLAE
FT                   SVDQFRGGRPVA"
FT   gene            complement(69324..69635)
FT                   /locus_tag="Tter_0068"
FT   CDS_pept        complement(69324..69635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0068"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+transporting two-sector ATPase C subunit; KEGG:
FT                   sat:SYN_02965 ATP synthase C chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40991"
FT                   /db_xref="GOA:D1CDI5"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI5"
FT                   /inference="protein motif:TFAM:TIGR01260"
FT                   /protein_id="ACZ40991.1"
FT                   /translation="MDLGVLTDLSNTIVAAAQNAPALQEQAANLTQFKGFASAIAIGVG
FT                   ALGPGLGIGLAVRGAMEATGRNPEASGDIRTTLIIGAALAEAVAIYAFLTALLILFTT"
FT   gene            complement(69681..70535)
FT                   /locus_tag="Tter_0069"
FT   CDS_pept        complement(69681..70535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0069"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+transporting two-sector ATPase A subunit; KEGG:
FT                   rce:RC1_0365 ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40992"
FT                   /db_xref="GOA:D1CDI6"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI6"
FT                   /inference="protein motif:TFAM:TIGR01131"
FT                   /protein_id="ACZ40992.1"
FT                   /translation="MPLMLAEQRVGGLARILAQEEEHGKGLLGTPFHQPTLAPETLFHI
FT                   GPIPVTNSMLMTLIVVVALSIAAIWLSRGLSLVPSKRQNFLEAIVELLDNLVQTTAGRT
FT                   AGRAILPLIGTLFIYILVANWASLLPGVGTITWHTEHGDVPLLRAPNADLNMTLAMAIV
FT                   TIVVVQIAGVAAHGVGGHFKEYLNPMHLIDELARVISLSVRLFANVFGGEVLLTVMLAL
FT                   SFLGAIAIIPVVIPMAFMGLEMFIGLIQALVFSLLSLIYITLAVAGHGHPADAEDAESA
FT                   THH"
FT   gene            complement(70613..70756)
FT                   /pseudo
FT                   /locus_tag="Tter_0070"
FT   gene            complement(70892..72571)
FT                   /locus_tag="Tter_0071"
FT   CDS_pept        complement(70892..72571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0071"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="KEGG: bsu:BSU37150 CTP synthetase; TIGRFAM: CTP
FT                   synthase; PFAM: CTP synthase-like; glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40993"
FT                   /db_xref="GOA:D1CDI7"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI7"
FT                   /inference="protein motif:TFAM:TIGR00337"
FT                   /protein_id="ACZ40993.1"
FT                   /translation="MPKFIFVTGGVVSSVGKGIAVAAIGRILKSRGLSVSAQKLDPYIN
FT                   VDAGTMSPFQHGEVFVTDDGAETDLDLGHYERFIDVNLSRNSNVTTGQIYLEVLTAERR
FT                   GDYLGGTVQVIPHITNTIKNRIWSVAETSGADVVIVEVGGTVGDIEGLPFLEAIRQMRR
FT                   EAGRENVFYVHLTFLPYIAATGELKTKPTQHSVNELRRIGINPDVLICRSDHPVTPEIR
FT                   QKIALFGDVDVEAVIPLETAETIYEVPILLEESGLGTYVVDRLNLNAKEPDLTGWKDMV
FT                   AKLKAPKDHSVNIALVGKYTELRDAYISVAEALRHAGLAHNLQINIDWIDSESLENEDV
FT                   DQRLSHVSGIVVPGGFGPRGVEGKIAAAKYARENNIPYLGLCYGMHMLTIEFARNVCGL
FT                   TGANTTEVDPDTQYPVIDLMASQKSLSDKGGTMRLGAYPCSLVAGTKVSKAYGKSLIHE
FT                   RHRHRWEFNNSYREIMENHGLVLSGLSPDGNLVEIVELKDHPWYVGTQFHPEFLSRPMR
FT                   PHPLFLGFIEAASKVVLEGQQHELPLEEDALQSLEDEIQVGV"
FT   gene            complement(72591..73238)
FT                   /locus_tag="Tter_0072"
FT   CDS_pept        complement(72591..73238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0072"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase
FT                   fold-like protein"
FT                   /note="KEGG: sus:Acid_7033 Zn-dependent hydrolase of the
FT                   beta-lactamase fold-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40994"
FT                   /db_xref="GOA:D1CDI8"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI8"
FT                   /inference="similar to AA sequence:KEGG:Acid_7033"
FT                   /protein_id="ACZ40994.1"
FT                   /translation="MEITWLGHSCFRIKTKEATVIMDPYSKMEGLDLGRPKADIVTVSH
FT                   DHPGHNNVSSVKGGDDLKVITGPGEYEIKGLFITGVRTYHDKQLGKKLGKNTVYLIETE
FT                   GLVLAHLGDLGHVLDEEQADLMSEVDILLIPVGGGNSLGAEEAVEVISQIEPSIVIPMH
FT                   YKTAPGQANLEGIERFCKEMGLTNWQVEDKLVVRKSDFGEQTEVKILAVKAN"
FT   gene            complement(73308..74069)
FT                   /locus_tag="Tter_0073"
FT   CDS_pept        complement(73308..74069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0073"
FT                   /product="regulatory protein RecX"
FT                   /note="PFAM: regulatory protein RecX; KEGG: bsu:BSU08520
FT                   recombination regulator RecX"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40995"
FT                   /db_xref="GOA:D1CDI9"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI9"
FT                   /inference="protein motif:PFAM:PF02631"
FT                   /protein_id="ACZ40995.1"
FT                   /translation="MCSSGKTEFSGRGSSNIPDNNREGTPTSLNGEKKLVVTGIERQKG
FT                   NRNRFSIYLNGRYAFSLSESLAWEYRIEEGKTLTEAEIDELVHKDKFDKAFDAAVRLLA
FT                   VRPRSESELIQRLRRKGVDENVIDEAIDKLRTLGYVNDEDFARFWVQNREQFSPMGSRR
FT                   LKFELRQKGVESDTVDEVLEDEVGPDEYELAYRAARSKLRSYTGLEYQDFYRRMGGFLS
FT                   RRGFDYETSSKVIKQLWRELHADQDERSVEN"
FT   gene            complement(74062..75096)
FT                   /locus_tag="Tter_0074"
FT   CDS_pept        complement(74062..75096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0074"
FT                   /product="recA protein"
FT                   /EC_number="3.6.3.8"
FT                   /note="KEGG: rru:Rru_A2819 RecA protein; TIGRFAM: recA
FT                   protein; PFAM: RecA domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40996"
FT                   /db_xref="GOA:D1CDJ0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDJ0"
FT                   /inference="protein motif:TFAM:TIGR02012"
FT                   /protein_id="ACZ40996.1"
FT                   /translation="MSDRDKALESAIAQIERAFGTGSIMRMTGDRAKMQIEAIPTGSIA
FT                   LDIALGVGGVPRGRIVEIYGPESSGKTTLAQHIIAEAQKLGGTAAYIDAEHAFDPSYAE
FT                   KCGVQLSDLLISQPDTGEQALEIAETLVRSGAVDVVVIDSVAALVPRAEIEGEMGDSHV
FT                   GLQARLMSQALRKLAGAVNKSKTVLIFINQIRMKIGVMFGNPETTSGGNALKFYASVRL
FT                   EIRKVESIKQGQDVVGNRVRVKVIKNKVASPYRTAEFDIMFNEGISKEGNLIDVGLSVG
FT                   VLRKSGSFIYLDDERLGQGRENAKEYLRQNPDVAEEIESRIKAAGNLDKVLIGSNGGLS
FT                   DIDV"
FT   gene            75247..75729
FT                   /locus_tag="Tter_0075"
FT   CDS_pept        75247..75729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0075"
FT                   /product="protein of unknown function DUF456"
FT                   /note="PFAM: protein of unknown function DUF456; KEGG:
FT                   ppd:Ppro_1793 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40997"
FT                   /db_xref="GOA:D1CDJ1"
FT                   /db_xref="InterPro:IPR007403"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDJ1"
FT                   /inference="protein motif:PFAM:PF04306"
FT                   /protein_id="ACZ40997.1"
FT                   /translation="MNEIAFLLGLTLILVGLVGIMIPFIPGIPIMWLGALVYGAMTGFR
FT                   ELTWPWMLIITLIALISISLDFILSAIMARKFGGSRLASFGSLLGGILGTLYLGAFGAL
FT                   LGAFGGAALTDLPVSRSIRKALRSGTGAVVGFVLALIVDLTSGIAILAIYLLTAIS"
FT   gene            75746..77821
FT                   /locus_tag="Tter_0076"
FT   CDS_pept        75746..77821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40998"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDJ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ40998.1"
FT                   /translation="MPRSLLSLLLNLEVEKLRDIALWWCVDLPNGTRSEQATILAREIL
FT                   RSDTSLYMYWERIGPEPRDLLLRIAEHSELRLSQLPASKDDPALRDLIASGMVWKLSEA
FT                   DLRSERVYTHTTSSDPYLLIPRELIRMITRLKRKLQEGDTSDKPLEFYLEGMGTGELEA
FT                   VALNWGLADEPGSYTREEIIKSLLEELEKTPTSRVLKKLTTNALMVYRSLLEEGKAYGF
FT                   ELAKSLNLPLPAMREAVIELTENILVQEAIYNDRWLIFPTRGLIHTTKSKSYVSPPEVY
FT                   TPRKQVKNPDYAPAWDLLHLLRAYQLYDLPYPNNTEIEEALFNRLSSLIFTNSEDKASH
FT                   AKLLFHLSRDLGLVSENAGMITTTKAVESWIKLPIEVQAKRIFKAWIETKYDESHGLLK
FT                   QAPGYSDSQELLKKARLEIIEILSACHVDKWYSIEQVSEIIRQEHPYIIRTNNRLVREL
FT                   GLEGAQKALEEWPRYEGRWITLLFQGPLTWLHVVETSSDELNPAFSLTPDGAFLIGKSK
FT                   TKYESKLAKSLSIQGHNSGLQIRVPRPESSLIWTLSAFARPHKWHESGLGIYVADRRTV
FT                   ARARGVNLSPSGIVEFLEEHSKEKLPNSITSKLEEWGKEPYKVSFAQGLVLTLDSTEAV
FT                   RDLQKLSFIQHFHPMIIDETKVLLFLPKDNYEREVSNLLRRLNKTGLFVVENNYGG"
FT   gene            complement(77824..79302)
FT                   /locus_tag="Tter_0077"
FT   CDS_pept        complement(77824..79302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0077"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   glutamyl-tRNA synthetase class Ic; KEGG: gsu:GSU1219
FT                   glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40999"
FT                   /db_xref="GOA:D1CDJ3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR020752"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDJ3"
FT                   /inference="protein motif:TFAM:TIGR00464"
FT                   /protein_id="ACZ40999.1"
FT                   /translation="MNSEVRVRFPPSPTGYLHVGNLRTAVFNWLLARHHGGKFILRIED
FT                   TDRARVVPGAVEVIYETLRWIGIDWDEGPDIGGPHAPYVQSERKEIYREYAELLISQGK
FT                   AYRCFCSQERLEALREEQRKNNLPTRYDRKCRYLGPEEAKRLVDSGQPYVVRFATPLEG
FT                   TTTMVDLLRGPVTYQNDQIDDFVILKSDGYPPYHFAVVVDDHLMGITHVLRGDEYISSG
FT                   ARDILLHEALGWNPPLYAHTAIILGPDRSRLSKRHGALPALEYRDIGIIPEAMFNYLAL
FT                   LGASYSADREIFSREELIELFDIDKMSPSPAIFDANKLEWMNAYYINHVLSVDDLASRV
FT                   KPILENAGLVKTEDLDEGYLIEVIGLVKDRIKLLPDVVELTDFFFRDPDPSAEEIAGKK
FT                   LTLQEAQELLQKVKDRVSPIDNWSEEILETELRSMASELGVKTGTLFMLIRVAITGKTA
FT                   SPGLFETMAVLGKDRTISRIGRAIDKLDLVVHGG"
FT   gene            79436..80785
FT                   /locus_tag="Tter_0078"
FT   CDS_pept        79436..80785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0078"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; FAD dependent oxidoreductase; KEGG:
FT                   gsu:GSU0493 pyridine nucleotide-disulphide oxidoreductase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41000"
FT                   /db_xref="GOA:D1CDJ4"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDJ4"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACZ41000.1"
FT                   /translation="MTVGARIDLLSKGHRSQTEEEYRKASYKILILGAGFGGIQAAIEL
FT                   DKHLGKRQDVSILVVDRDNTQLFQPLLWTVASGKNCPDDTTVPIRKFQKGRSFHVMHSA
FT                   VKHIDLQNQVVYFDNGEDRPFDFLVIALGSVTAIPDLPGLRERALLFRSPADAIELRNK
FT                   VIDALEMAHKEQDPEARKSWLTFVVGGGGDTGIELAATLKEYIYAGLFAEYPWLENEPA
FT                   RIVLVSRSSRLVPQSRPHISKTVQEVLEHEGIEVMNNTSVEAVTEDEVKTSAGTIKART
FT                   LFWAAGITAPKVVKDLPVEHARNGSLIVDKFLRIPQYPNVFVVGDSAWAFDARTNDPIP
FT                   PTAQAAEHMGRYVGRTISSLIQNRSIKPFVFKPLGHLALLGQRTGVAEVGPLTFTGIPA
FT                   WFIWHSYYLIHIPSWQNRIYLFTHWLLSLILGRETGQLRLSPGVLKEGIQ"
FT   gene            80951..82498
FT                   /locus_tag="Tter_0079"
FT   CDS_pept        80951..82498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0079"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="TIGRFAM: protein-export membrane protein SecD;
FT                   protein-export membrane protein, SecD/SecF family; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG: bja:bll4735
FT                   preprotein translocase subunit SecD"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41001"
FT                   /db_xref="GOA:D1CDJ5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/Swiss-Prot:D1CDJ5"
FT                   /inference="protein motif:TFAM:TIGR01129"
FT                   /protein_id="ACZ41001.1"
FT                   /translation="MRRSTLYSLIFIIILTAFAVWVDLPGSRNVFGRQAEVVEGLDLQG
FT                   GLQVLLQARHVGGKAPTREQMEEVRQVVEQRVNSLGLTEPVVQLQGSDRIVVELPGVKD
FT                   PEQAIRTFQGTGLLEFIDAGDTPLQVGTLVNTTLGPAITNGNQNQNSTKNGTPTPGTTP
FT                   TPESTPQANQTPVAANVTPTPEDPQFQQALQATPPEQLQRTYTTVITGNDIANARPDFD
FT                   PTTGEPVVSFELKPEAAKKFADFTTQNVGKYLAIALDKKIISSPQIRDPITNGRGVITG
FT                   VTREEARTLAIQIRSGSLSVPLDIISSNTVGATLGNDSVQRSIRAGLIGIGAVALFMIL
FT                   YYRLPGFVSVVALAIYAAVVFALFKLIPVTLTLAGIAGFILSVGMAVDANVLIFARLKD
FT                   ELRRGRGLIQAIDVGFKNAWPSIRDSNISTLITCAILIWFGSRFGASVIKGFAITLAIG
FT                   VIVSMFTAIFVTRTLLQVVLSMVHTRNLWIWGIGKNQLPEPEGRTLQPAKSSRTTQA"
FT   sig_peptide     80951..81010
FT                   /locus_tag="Tter_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.837 at
FT                   residue 20"
FT   gene            82519..83472
FT                   /locus_tag="Tter_0080"
FT   CDS_pept        82519..83472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0080"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="TIGRFAM: protein-export membrane protein SecF;
FT                   protein-export membrane protein, SecD/SecF family; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG: bha:BH1237
FT                   preprotein translocase subunit SecF"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41002"
FT                   /db_xref="GOA:D1CDJ6"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/Swiss-Prot:D1CDJ6"
FT                   /inference="protein motif:TFAM:TIGR00966"
FT                   /protein_id="ACZ41002.1"
FT                   /translation="MIDIVRWRYAFYLLSLLIIIPGTIYLLLFGLRLGIDFEGGTFWQI
FT                   QFEKPVRIEDVRSALAQAGYNEAFVQSFGQQSNTAQGTVTRGVSMRLPEIKENSPEKAK
FT                   LEQILKSRFGNYEELVFTSVGPAVGREIRNRSIVAIALASLGILGYIAFAFRKVSHPFR
FT                   YGICAIIAMLHDVLVVVGIFAILGKHFGVEIDALFVTALLTVIGFSVHDTIVVFDRIRE
FT                   NQLRRYGESFEQIVNISLLQTLVRSVNTSMTVIFTLLALYFFGGTTIKHFVLALLIGIV
FT                   SGTYSSIFNASLLLVSWENKDFLRIFRRTEPEAAAT"
FT   gene            83548..85662
FT                   /locus_tag="Tter_0081"
FT   CDS_pept        83548..85662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0081"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: AVP2; AVP2 (ARABIDOPSIS VACUOLAR H+-
FT                   PYROPHOSPHATASE 2); TIGRFAM: V-type H(+)-translocating
FT                   pyrophosphatase; PFAM: Inorganic H pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41003"
FT                   /db_xref="GOA:D1CDJ7"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDJ7"
FT                   /inference="protein motif:TFAM:TIGR01104"
FT                   /protein_id="ACZ41003.1"
FT                   /translation="MSNEVLWAILIFGAGILAVIFALSMARYVLSRDTGTPEMKAVADT
FT                   IYEGAIAYLNRQYTTIASIAVITAIIIGAIIALVGSETMDLPGPQAAIMTAIAFLAGAL
FT                   ASGVSGYIAMLVAVKSNVRTAAAARRSLGDALLVSLRGGAAGAFFIIALSIMGVAAIFY
FT                   AYNGFNQPERAPFLIVGFGFGASFVALFAQLGGGIYTKAADVGADLVGKVEAGIPEDDP
FT                   RNPAVIADLVGDNVGDCAGRGADLFESTAAENIGAMILGVSIFLATGRDNPGFIFLSLV
FT                   LGAMGLIASMIGVLSVRPSANADPMGALNRGFAVTAVLSIIGLFIATLWVLDGNWWLFG
FT                   CGLVGIITSILFLLMTQYYTSEKYRPVRTIAEASKTGPATNIISGIAIGFENTALPAIV
FT                   ISLAIGTAYFFGTRTGFSDNSFVNGVYGTAVATMGMLMTVAYVLAMDIFGPITDNAGGV
FT                   VEMSNQPEEVRERTDALDAVGNTTKALTKGYAIGSAALAAFLLFSAYLSDARLEAVNLA
FT                   RVPVFIGGFLGGMLVFLFSSLAIRAVGRAAGDMIEEVRRQFRSEPGIMQGTVRPNYAKA
FT                   VDISTRAALREMVLPGILAVGMPVVVGLILRAEAVAALLMVGTMTGILVALVLNNGGGA
FT                   WDNAKKLIESGQLLDEEGKPIGKGTATHAAAVVGDTVGDPFKDTAGPSLHVLIKLLSTV
FT                   TLVLAPLFIR"
FT   sig_peptide     83548..83643
FT                   /locus_tag="Tter_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.916) with cleavage site probability 0.720 at
FT                   residue 32"
FT   gene            85759..87069
FT                   /locus_tag="Tter_0082"
FT   CDS_pept        85759..87069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0082"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: psp:PSPPH_0963
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41004"
FT                   /db_xref="GOA:D1CDJ8"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDJ8"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ACZ41004.1"
FT                   /translation="MRIAVIGGGIAGLSASYELLKAGQEVHLFERSNFLGGQVVTIPLY
FT                   GTPIELAYHHLFTSDVVMQELMAELGIIDKLEWYPSKVGWFKGGKIYPFVTPMDLLRFK
FT                   PLRLWNRLRLGLVVLFLQRYKNWKALEKTTATLWMRKWAGDNAYEQVWRPLLKGKFGTR
FT                   HEDISMAWLWGKIHLRTTSRSSINKEVLGYPTGSFKIIVDALEKAIRDMGGHIHLGASI
FT                   EKIEARTSPSGELTAVGIRTGEGLQEFEKIISTIPSNRFLDIAPPVGKAYEEKLRSGRY
FT                   QGALVMLMTLHNKLSDYYWLNIGEEGFPFVGLIEHTNLVPKEWYGGKHVLYISNYLSTE
FT                   DYYWQLGKEELLEAYIPFLQRVNPEFERSWIDSYQVFREAAAQPIVPPNYSQRIPEMQT
FT                   PVKNLILANTTQIYPQDRGTNYSVDLGRKAARLALES"
FT   gene            87188..93910
FT                   /locus_tag="Tter_0083"
FT   CDS_pept        87188..93910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0083"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; Tetratricopeptide TPR_4;
FT                   Tetratricopeptide TPR_3; Sel1 domain protein repeat-
FT                   containing protein; SMART: Tetratricopeptide domain
FT                   protein; Sel1 domain protein repeat-containing protein;
FT                   KEGG: SLEI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41005"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDJ9"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ACZ41005.1"
FT                   /translation="MTTYFSKQTEEKRSADNHYIRAYLEEVLTRFNAHGREIPLHLIKA
FT                   FTEEDKPGVSLEQAVESYGRLIILGKAGAGKTSLAKKAVLHIASRSLRSHFGAEPGKRS
FT                   LSIDDQRIPVLVQLQSLESVEIHDMLAGAFQQAGITLPDEEFPQRVVENFPLLLVLDGL
FT                   DEIRPDIKLEAAAEIASLVSKPGSANRFVITCKEDEFPLYRVWFERCEIRSIEPINESQ
FT                   IRLFLEDCADPKRRDRVLSHPRAFEVLSTIKVLNLAKQELDDTRSNVNSIGDLVLASSR
FT                   KLLMEAESKKRNREGFAGAQSRTLMKLLAALAFSLKTDSVKDLSRDQARGIVSASSGDS
FT                   ASSEQLLEVLLSSGIIESSDSRRRIKFRDELTLEVFAAYAISLHLESGGDLKDYISDSS
FT                   KREKWGGVVSLLYGIHSDKEKLLSDILGDGQSLPLVRLAVTCITQNEPEEKWSYITSKG
FT                   DLDAQAHYYLGRAFADLGFYAHASNELNRAIEKKLDSADVHYQLGKIHEAEGKYELACQ
FT                   QYELAVERDPSNVNYRRSFGLALALCNKYDLAAAKLREVVDILKSDCALTQHELGNIYK
FT                   IQGRLQQALEQFQDAATMSPSSAVYLTSLGSVLAACGDDQGAERELRRALDLDPNYAPA
FT                   ANELAAVLERQGKLDLALANYQKATEIQPEEPLYHRNAGAILRKLGRVEEAERELVTAI
FT                   ELDSKYADAYNELGSLYMDMGKHLAALENFQKAIQYSPEQPEYYLQMGLTYRALKQPAK
FT                   AITALQIALSMDPKDLNKRAILAETYCQSGRLTEAIEEYRWAIELSGGMPQYLLNAAIV
FT                   QRKAGMLEDAEESLKKVIQNNPGLAPAYFELGMVAEQKGDYILALERYRKALELSPDNE
FT                   HFIVAVSRSARLSGNLLQADELIRDAFSRMPESALIHDELGTIEFVRGNYQKASECFLK
FT                   ATKLSPETSDFWAHLGKAYRYLTRLDEAKEACEEALRLDANNPVAHHETAMLLIALNEE
FT                   EEALSHFRKAARLDARNAQYALDLGACASKLGRVNEGLTWLEKALSLDPNNGQAHAELG
FT                   MLMGSRGQWEEALAHFRASLLIDEQNVDYLHMYGIACLHTDATEDAIKTLERALALDPR
FT                   RADVYVTYAEALEIAGKRDEAIQNLQEAVRLDDTNVSYKVKLGSMLRRYGEYQDAEDLL
FT                   LKCTDDHPESAQAHSELGMLYMDLGLQEKALRHHEIACSLDDRSPEYKYRMALALIHLK
FT                   RYAEAIDTILTAIQANPEAAEYYHALGRAHMGLSQYEEAVQAFEKAVRIAPSVAQYHRD
FT                   LGIAYRSISEYGAACQEIEEAVRISPDVAAWYNDLGICYERRGWLHEAVQAFEKAIELQ
FT                   PGEPVYLSNAGNVLRQQRKHDLALQHLQKAIELDSNFAEPYHQMALVMQDMGRFDDAYD
FT                   LFQRSISLSPDNPRYHYNLGILMRSQGDLHDAINQVSKAIDIQPNNAEWHSTLADLYFQ
FT                   IGMLDKARKEAEEASRLDPDNYRYHRQLSVIARETQDLDQALASARQALKCAPDEPQAI
FT                   AELASVQEALGELTSALALYKQAAMLDPLNADYHRKIGSIYRQLGKTQESLQSLQKAID
FT                   LAPNAPDSLFEIGQLYLQTDRFDEACKVLQKATQLAPDNPTYRFHYGLAIMRLKEREDK
FT                   LRSARLLASSSQVSYAQAIEEIEAALRIEHNHADWHNTLGELYELVDDYESALHHFRWA
FT                   ADIDSDCALFQYNQGRIYKKLRDYDRAIRAFQMAVRLDPEFAQAYSELGATYNMVGNHS
FT                   EALINYERALQIRPDDGLTLRRLGSTYRQMKRFKDAISILQKAAEIDPQDPEIYNELGL
FT                   AYRAQGKHREALAEFEHALKLRPDNATYNRNAAIAHQDLKQTKLAIEKLQHAVMLEPYQ
FT                   PTWHFELGALLEASEQYEEALAEYNEAMQLNPDGAIYAFRAAEVCERMGKKEEAIECLK
FT                   YALKLEPRNYEWRFKLGCMYLDMEYFAPAAEELAKSLEIEPESAEAHLKLGIALINLEQ
FT                   YDQALERLMDAAKIEPNNFDVHEQLSLVMEKLGRPEEAISHIAQALLLDSSRADLYRRA
FT                   GKLYADMDRLEEAAQALEKALELDPDDAETHSELGLIYEAQEKLKLALGEQKEAIRLDP
FT                   KNPIYELRAASICRQLRWFEEAMAALERSLDLDPENAAAYNERGMLYEAMGNLDAAREQ
FT                   YEIAVRLQPDEALYHRNLGVVYKKLKRYDLAASELRQAVKLRPGYADAYKELTTVSTLS
FT                   FITRGFGKERAS"
FT   gene            93938..94540
FT                   /locus_tag="Tter_0084"
FT   CDS_pept        93938..94540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0084"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /note="TIGRFAM: deoxycytidine triphosphate deaminase; PFAM:
FT                   deoxyUTP pyrophosphatase; KEGG: tcx:Tcr_1043 deoxycytidine
FT                   triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41006"
FT                   /db_xref="GOA:D1CDK0"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDK0"
FT                   /inference="protein motif:TFAM:TIGR02274"
FT                   /protein_id="ACZ41006.1"
FT                   /translation="MILSDTMIIDAIKTGWVSFDPPVDIDIQVQPASVDLRLGNTFRVY
FT                   NYAQQAVIDPTEDIDLDSISQIVRLEDKPFILHPGAFVLGSTMEYVKIPPDLVGRLEGR
FT                   SSLGRLGVVVHSTAGFIDPGFEGNITLEISNIGKIPVALRAGIRICQLTLMHTGPVARP
FT                   YGPLRGSKYQGQREPTPSRIKNDVEFLRRGEIKVGES"
FT   gene            complement(94586..95077)
FT                   /locus_tag="Tter_0085"
FT   CDS_pept        complement(94586..95077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0085"
FT                   /product="dUTPase"
FT                   /note="KEGG: dUTPase; K01567"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41007"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDK1"
FT                   /inference="similar to AA sequence:KEGG:AFUA_3G14580"
FT                   /protein_id="ACZ41007.1"
FT                   /translation="MSEEVDTNAADFIRDYIDLEEQTQPNGVELTLAWVERFLEAGKLA
FT                   FDNSERVLPRTERLEFDSEGWIWLPQSSYKIGFNEFVTIPEDRFAIARPRSSLLRMGVS
FT                   VGTALWDSGFRGKGEAILCVHNPHGFWVRKNARVVQLVFFKLPTRAHKLYEGQYKDRTW
FT                   "
FT   gene            95189..95767
FT                   /locus_tag="Tter_0086"
FT   CDS_pept        95189..95767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0086"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="TIGRFAM: Holliday junction DNA helicase RuvA; PFAM:
FT                   DNA recombination protein RuvA domain I; RuvA domain
FT                   protein; KEGG: rfr:Rfer_0739 Holliday junction DNA helicase
FT                   motor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41008"
FT                   /db_xref="GOA:D1CDK2"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDK2"
FT                   /inference="protein motif:TFAM:TIGR00084"
FT                   /protein_id="ACZ41008.1"
FT                   /translation="MIASIKGHIEYKLNDGLIVQVGGVGLRVFTPSSMVREIGEIGDEV
FT                   YLHTHLMVREDALTLYGFSTREQLRLFELLISVTGVGPNHALNILSSASVEEIQTAIAQ
FT                   ENAQFFSLIPRIGKKLAARIILELKGKVEPSGEAVQIISHKDEELVSALLALGYTLGEA
FT                   QAAVRSLPTDKELPMEEKLRLALSYFSTP"
FT   gene            95778..96719
FT                   /locus_tag="Tter_0087"
FT   CDS_pept        95778..96719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0087"
FT                   /product="peptidase S58 DmpA"
FT                   /note="PFAM: peptidase S58 DmpA; KEGG: dac:Daci_2906
FT                   peptidase S58 DmpA"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41009"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDK3"
FT                   /inference="protein motif:PFAM:PF03576"
FT                   /protein_id="ACZ41009.1"
FT                   /translation="MQDSILDVAGIEVGSSEDQTIRTGCTVVLCKQGATVGVDVRGAAP
FT                   ATRETDLCRSGNLVSKVHAILLTGGSAFGLDSASGVMRFLWERGIGFDTPATRVPIVPA
FT                   AAIYDLNVGRVGWPHSEMAYQACREATSKTMSRGRVGAGTGATVGKILGPKNCTEGGLG
FT                   SASERVGSFRVGALVVVNALGDVVDPNSGKIIAGPKDPLTGNFISTEDVLLEGRPSTSN
FT                   EGQNTTLVVVATDAPLSKEQANRLASISHDGLARVIRPAHTLVDGDVVFALSTTADNQV
FT                   VTTDQMIALGVGAIRAVERAILDAVAVKVNHR"
FT   gene            complement(96716..97165)
FT                   /locus_tag="Tter_0088"
FT   CDS_pept        complement(96716..97165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0088"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: ank:AnaeK_2633
FT                   Holliday junction resolvase YqgF"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41010"
FT                   /db_xref="GOA:D1CDK4"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDK4"
FT                   /inference="protein motif:PFAM:PF03652"
FT                   /protein_id="ACZ41010.1"
FT                   /translation="MVVMGIDPGRKRIGIALSDPTGLLATAYKVIHRTTSDRDLEEIRR
FT                   IAEHENVEKIVVGLPLHMSGYEGEEAVRARELAKQIETATGLPVELVDERLTSVEAERR
FT                   LLESRRKLGKLGRKKLAIDAEAAAVLLQDYLDQERLRQRAIDSSL"
FT   gene            complement(97174..99813)
FT                   /locus_tag="Tter_0089"
FT   CDS_pept        complement(97174..99813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0089"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="KEGG: dal:Dalk_2944 alanyl-tRNA synthetase; TIGRFAM:
FT                   alanyl-tRNA synthetase; PFAM: alanyl-tRNA synthetase class
FT                   IIc; phosphoesterase DHHA1; Threonyl/alanyl tRNA synthetase
FT                   SAD"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41011"
FT                   /db_xref="GOA:D1CDK5"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDK5"
FT                   /inference="protein motif:TFAM:TIGR00344"
FT                   /protein_id="ACZ41011.1"
FT                   /translation="MKSSEIRSKFLEFFEARGHTVVPSSSLVPAKDPTLLFTNSGMVQF
FT                   KDVFLGRESRSYTRATTAQKCMRAGGKHNDLENVGPSARHLTFFEMLGNFSFGDYFKRE
FT                   AIGYAWEFVTQVLGLEPSRLWATVHYTDDEAASLWQEVAGLPESRIIRMGDEDNFWQMA
FT                   DVGPCGPNSEIFYDRGPEKGCGDPNCTPAHDCGRFWEFWNLVFMQYYQDESGNRTPLPK
FT                   KNIDTGLGLERTSAIMQGVDSIFETDLFVPIMDEVQRIAGHSDEDRRREIVAYRVIADH
FT                   SRSLAFLIADGVTPGNEGRSYVLRRIIRRAIRFGRRIGIEGHFLSDTARVVVDIMGHHY
FT                   TELEDQWSFIDKVTRAEEEHFSRTLARGVAQLDDLIDKLSASGQKEIPGEDAFRLYDTY
FT                   GFPLDLTLELARDRGFSVDTEGFKRAMERQRAQSRAASTFTAKMPAAYAALSGEPTQFT
FT                   GYTTLEDTGRVMAIIREGELVDKVEHGQEAEILLDRTPFYAEAGGQVGDTGVITGPEGD
FT                   FHVLDTQRPVNGYILHRGRVLHGSISVGQNVDLVVDARRRQDIMRNHTATHILHKTLRD
FT                   VLGPHARQAGSLVAPDRLRFDFTHPSQLSDEEFFEIERIINDVSQDDRKVYAQEKPYTE
FT                   AIASGAMALFGEKYGDIVRVVSIEDYGSELCGGTHVHHTGEIGPIYITSEGSIASGVRR
FT                   VEAVTGRGAIKYARERMELLERLGAKLKVPTSEIERQVALLQERLREQERQIEQLRRQL
FT                   AAGEIDQMLRNVRQVDGTKLLVAQTSLDSREAMSDLADRLRDRLRSGVVVVGSVLQGKP
FT                   SIVAVVTPDLVQKGVHAGKLVKEISALVGGGGGGRPDRAEAGGRFPEKLEEALGSVDEV
FT                   LARQLEGK"
FT   gene            100139..101128
FT                   /locus_tag="Tter_0090"
FT   CDS_pept        100139..101128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0090"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="KEGG: mxa:MXAN_2666 pyruvate dehydrogenase complex,
FT                   E1 component, pyruvate dehydrogenase, alpha subunit;
FT                   TIGRFAM: pyruvate dehydrogenase (acetyl- transferring) E1
FT                   component, alpha subunit; PFAM: dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41012"
FT                   /db_xref="GOA:D1CDK6"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDK6"
FT                   /inference="protein motif:TFAM:TIGR03182"
FT                   /protein_id="ACZ41012.1"
FT                   /translation="MAKMETRTENKEQLLELYRKMLLIRHFEERAAQLYTQAYIGGYCH
FT                   LNVGEEATVVGALTSIREDDYVFTYYREHGHALTLGSDPKAVMAELCGKVTGLSKGRGG
FT                   SMHLFDKKHRLYGGYGIVGGHLPLAVGAAMAIEYKGEDSIVMCLFGEGATNIGAFHEAL
FT                   NLAKVYHLPVLFFCVNNQYAMGARVDEDSAVPEMWMKACAYNMPAEKVDGMDLFAVREV
FT                   TQRMVEKVRETREPMFLEAITYRFRGHSMADAGRYRTQEEVKQWMQRDPIHLTARRLEE
FT                   MGVLDSELKAKIESEVEQEIEEATKFAIESPDPDVSDLYKYVYTEDGE"
FT   gene            101129..102103
FT                   /locus_tag="Tter_0091"
FT   CDS_pept        101129..102103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0091"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: mxa:MXAN_2667 pyruvate dehydrogenase
FT                   subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41013"
FT                   /db_xref="GOA:D1CDK7"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDK7"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACZ41013.1"
FT                   /translation="MAVKTYREALNEALREEMERDPNVFIIGEDVGKFEGAYRVTQGLL
FT                   AQFGPKRVRDAPISETGFLGAGIGAAMLGLRPVVEFMTINFILVAMDQVINHAAKIRYM
FT                   FGGEVSVPMVIRAPGGAGQQLTAQHSQSFEVWFAHTPGLKVMAPSSPSDAKGMLKTAIR
FT                   DPDPVFFLENLALYNTKGEVPEGEYTVPLGKADVKRQGTDVTLISHSRAVNWCLQAAQQ
FT                   LEKEGVSVEVVDLRSLRPLDMETVIESVKKTNRAVTVEEGWLSFGVGAEVASRLMEQAF
FT                   DYLDAPVLRVGGAEVPMPYAKPLERAAMPSVDKIVARVREVLE"
FT   gene            102136..103377
FT                   /locus_tag="Tter_0092"
FT   CDS_pept        102136..103377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0092"
FT                   /product="Dihydrolipoyllysine-residue succinyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="PFAM: catalytic domain of components of various
FT                   dehydrogenase complexes; biotin/lipoyl attachment domain-
FT                   containing protein; E3 binding domain protein; KEGG:
FT                   mxa:MXAN_2668 pyruvate dehydrogenase complex , E2
FT                   component, dihydrolipoamide acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41014"
FT                   /db_xref="GOA:D1CDK8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDK8"
FT                   /inference="protein motif:PRIAM:2.3.1.61"
FT                   /protein_id="ACZ41014.1"
FT                   /translation="MNLTMPRLSDTMEEGTVGKWLKKEGDSFKKGEAIAEIQTDKANME
FT                   LEAFQDGVIEKILVQEGQTVPVGEPIAIIRSPSEAPGPSETPTTEEPKHETKPQEPVQE
FT                   QTPQPAESPIPIAPREEAGTAGPQGRIKASPLARRIAQELGIDLATVKGTGPNGRIKRE
FT                   DVERAAASRTQAPKVEEIPAAEAAPPSRVEPFTRIQSIIAQRMVQSKTQVPHIYITIEL
FT                   DMSKAIALRQEINQLGEPPVSFNDMVIKACGLALRNYPLANASYVDGGIKYNEQVNVGF
FT                   AVATKGALYVPVIRDADKKNLRQIAAETRALINKARENKLSPQDLSGGTFTVSNLGMYG
FT                   VEEFQAVVNQPEAAILAVGAITQKPVVQDGQIVIGNRMRVTLSADHRVLYGADAAEFLN
FT                   ELRKFLENPLLLAF"
FT   gene            103429..104463
FT                   /locus_tag="Tter_0093"
FT   CDS_pept        103429..104463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0093"
FT                   /product="3-methyl-2-oxobutanoate dehydrogenase
FT                   (2-methylpropanoyl-transferring)"
FT                   /EC_number="1.2.4.4"
FT                   /note="PFAM: dehydrogenase E1 component; KEGG: bce:BC4159
FT                   2-oxoisovalerate dehydrogenase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41015"
FT                   /db_xref="GOA:D1CDK9"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDK9"
FT                   /inference="protein motif:PRIAM:1.2.4.4"
FT                   /protein_id="ACZ41015.1"
FT                   /translation="MATTQDEISATNSQDRHTELGLTAEDLKKMYRLMVLARTLDERMW
FT                   ILNRQGKVHFVISGQGQEGAQIGTAYALRPGVDFFVPYYRDLTVCLYAGVTPREIMLSL
FT                   FARADDPASGGRQMPGHYSYKPLKIVTGSSPIATQIPHAVGIALASKIKNEDVVTAVWF
FT                   GEAASSKGDFHEGLNFAGVIKAPVIFICENNHYAISVPQNKQMAVPNVADKACAYGFPG
FT                   VVTDGNDVLDVYKAMKAAVERARAGEGPTLIECKTYRIVPHSSDDDESRYRTKVEVEEW
FT                   KRKGPIERLRTYMQAQGIWSEEFENQVKSEALSIVDDATRFAEQASPPSPSSLLRHVFA
FT                   EEAK"
FT   gene            104464..105450
FT                   /locus_tag="Tter_0094"
FT   CDS_pept        104464..105450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0094"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: bha:BH2762 branched-chain alpha-keto
FT                   acid dehydrogenase E1"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41016"
FT                   /db_xref="GOA:D1CDL0"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDL0"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACZ41016.1"
FT                   /translation="MATKTVIQTIRDTLFEEMERDERIIILGEDVGLAGGVFGATKGLQ
FT                   ERFGEWRVIDTPLAESAIIGTAIGAALNGLLPIPEIQFADFIHPAFDQIVNEAARIRYR
FT                   SNGAWNVQMVIRCPWGGGIHGALYHSQSVEAFFTHVPGLKVVAPSTPYDVAGLLRSSID
FT                   DPDPVLFLEHKKTYRLIKGEVPEGSRFKVPIGKAKVVRQGSDVSVFAYGLMVHQSLEAA
FT                   NLLSNEGIEAEVIDLRTLSPLDKETILNSVAKTGKALIVHEDNITGGFGAEVAAIIASE
FT                   GFEYMDGPITRLAGPDVPAIPFASTLEEAFLPNTYKIAEAIRNLAKY"
FT   gene            105483..106745
FT                   /locus_tag="Tter_0095"
FT   CDS_pept        105483..106745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0095"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: catalytic domain of components of various
FT                   dehydrogenase complexes; biotin/lipoyl attachment domain-
FT                   containing protein; E3 binding domain protein; KEGG:
FT                   bha:BH2761 branched-chain alpha-keto acid dehydrogenase
FT                   subunit E2"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41017"
FT                   /db_xref="GOA:D1CDL1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDL1"
FT                   /inference="protein motif:PFAM:PF00198"
FT                   /protein_id="ACZ41017.1"
FT                   /translation="MRITMPQLGESVVEGTIGKWFKKEGETVQEYEPLLEVITDKVSAD
FT                   YPSPITGKIVKILVPEGQTVPVGTEIAEVEIISEKEPEATAASTRSEPDESAQQQDTLT
FT                   VHLTRDKGKPHRYSPAVRRLAEEYKLDLSKIKGSGLGGRVTKKDVESYINTLESIKRNE
FT                   PEGAKVAAYKPQEIAPKPLHMLPGDEIIPLTHMRRAIADHMVQSVYTAPHVTAVIEVDM
FT                   TSIVQYRESIKDAFQKHEGIPITYLPFVVSAVAQSLREHPILNSSWSDEGIVLHKQINI
FT                   GIAVALEDGLLVPVIKQADEKNIVGLARTIYELSNKARAGKLSPEDVQGGTFTVNNPGT
FT                   FGTIISTPIIVQPQAAILTMEAIIKRPVVINDAIAIRSMMYMCLSFDHRILDGLQAARF
FT                   LQSVKKKLETFDPDKLGVGYR"
FT   gene            106758..107669
FT                   /locus_tag="Tter_0096"
FT   CDS_pept        106758..107669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0096"
FT                   /product="lipoic acid synthetase"
FT                   /note="KEGG: aba:Acid345_4487 lipoyl synthase; TIGRFAM:
FT                   lipoic acid synthetase; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41018"
FT                   /db_xref="GOA:D1CDL2"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDL2"
FT                   /inference="protein motif:TFAM:TIGR00510"
FT                   /protein_id="ACZ41018.1"
FT                   /translation="MKPDVEHMSDGRPAYELPKPSWIKARIPSGPNYQELKGLMRGLGL
FT                   HTVCEEAHCPNIGDCWERRTATFMILGRVCTRSCGFCAVETGRPPEYDLLEPGRVAMAV
FT                   SRLGLRHVVVTSVARDELPDGGAEIFARTIRAIHRRVPGCSVEVLIPDFRGQEDAIRKV
FT                   VEAGPEIINHNVETVPRLHRRVRPQAKYERSLRVLELAGELGGEVLTKSGLMVGLGESR
FT                   QELRDVMRDLRSVGVEILTVGQYLRPSREHLPVEKYYTPQEFEELKQEALELGFKHVES
FT                   GPLVRSSYHADQQVSSLLQKAV"
FT   gene            107750..108373
FT                   /locus_tag="Tter_0097"
FT   CDS_pept        107750..108373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0097"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: sus:Acid_0913
FT                   lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41019"
FT                   /db_xref="GOA:D1CDL3"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDL3"
FT                   /inference="protein motif:TFAM:TIGR00214"
FT                   /protein_id="ACZ41019.1"
FT                   /translation="MGIVPYMEAWELQKSLVASIASNEHPESLILLQHPHTYTIGRKGG
FT                   HDHLLASIEQLRAMNVEVIETDRGGDITYHGPEQIVGYPLINLRNIGSDVHKYLRMLEE
FT                   VLIRTLNDYGFSAHRDEQYTGVWIGKAKIAAIGVKISRGITMHGFAININTDLRYFDMI
FT                   IPCGITGRSVTSLQVLLGRTIPLEEVMDHIEHHFSEVFEVQITR"
FT   gene            108455..109741
FT                   /locus_tag="Tter_0098"
FT   CDS_pept        108455..109741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0098"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; protein
FT                   of unknown function DUF894 DitE; KEGG: rso:RS05067
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41020"
FT                   /db_xref="GOA:D1CDL4"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDL4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACZ41020.1"
FT                   /translation="MSTRFVALSHRDFRLLWIGQLISTIGSQMSFTAINWHIYRLLSNT
FT                   SYSIDILGRHFELGAEALGLGILGMIRVLPIIFFSMLGGMVADTHDRRQILLWTELGGA
FT                   LVSALLAITTLTGNISLGIIYLLTALSAAVSAFDTPARQAIVPQLVPKEHLTNAISLNT
FT                   LDWQIGTIIGPAIAGALIASLSIGWVYAINSLAYLMVLALILMMSFRGKPAAQETSINL
FT                   RAMFEGFRFVRNTPIIWSTMILDFWATFFSSARTMLPIVAGDLLQVGPVGYGVLSTAQS
FT                   VGSVIAGLILSLRREIHHQGIVLLVSVAIYGIATALFGVSKIFILSYILFALTGAGDTV
FT                   STVIRGTVRQILTPDHLRGRMVGVNMIFFMGGPQLGELEAGLVASVLGVPFAIVSGGVA
FT                   TVLITLWVAAKYPSLRQYKSSSEPELAIA"
FT   gene            complement(109849..111180)
FT                   /locus_tag="Tter_0099"
FT   CDS_pept        complement(109849..111180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0099"
FT                   /product="Hydroxypyruvate reductase"
FT                   /EC_number="1.1.1.81"
FT                   /note="PFAM: MOFRL domain protein; KEGG: dal:Dalk_0946
FT                   hydroxypyruvate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41021"
FT                   /db_xref="GOA:D1CDL5"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDL5"
FT                   /inference="protein motif:PRIAM:1.1.1.81"
FT                   /protein_id="ACZ41021.1"
FT                   /translation="MISIETLRNDAKDILMAGVKACNARDAVKRNLQLVDGELRCGNST
FT                   VLLDEYKRILVVAIGKAAADMALGAHDVLGDLVHIYFVITKYGHGKDIDRLGMRLFESG
FT                   HPVPDVAGVTAATEMIHLLEETSDKDLVIFLISGGASALCTLPEDDITLEDLQETTKRL
FT                   LLAGADIRELNTVRKHISRSGGGKLAGIVYPSRVVALVVSDVIGNDLDVIASGPLTPDP
FT                   TTYQDALEVVDRLRVELPVSVKNYLLMGIAGDVPETPKPGSPEFENVSIRVIADVFLAL
FT                   REAASRAEALGYESLILTSRLEGESRELGKTVGNIAVNVVKENVPYSPPVALLLGGETT
FT                   VTVRGNGVGGRNQELALSAALAMQGCENVVVASMGTDGTDGPTDAAGGIVDGLTVARGK
FT                   VAGLDAKRYLARNDAYNYLKATGDLIFTGPTGTNVNDLVLVLAR"
FT   gene            111270..113369
FT                   /locus_tag="Tter_0100"
FT   CDS_pept        111270..113369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0100"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   mes:Meso_1097 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41022"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDL6"
FT                   /inference="protein motif:PFAM:PF03747"
FT                   /protein_id="ACZ41022.1"
FT                   /translation="MSLPEDYLERVYAGVLGKIIGVYLGRPFEGWPYDKIKSELGYIWY
FT                   YVNNKLKQPLIVTDDDISGTFTFIRALEDYGCSKDLSPEQIGNTWLNYIIENRTILWWG
FT                   GLGNSTEHTAYLRLKQGLKPPQSGSIETNSKVVAEQIGAQIFIDGWGMVSPGDPEMAAD
FT                   LARRAACVSHDGEAIYAAQVIAAIEAQAFVEDNIEKLIDCGISFIPQDSTIYRLITDIR
FT                   NWYTAYDDWEQTRELIEQKYGYDKYGGGCHVVPNHALIINALLYGKGDFQKSLMIVNTS
FT                   GWDTDCNSGNVGCILGIKNGLEGIDLGPDWRSPLADRMYIASADGGRVVTDAVRESYRI
FT                   ANIGRRLVGMEAVSPKGGARFHFEAPGALQGFYVDKSDGCCQTVSIRNSAIEQLHGNRA
FT                   LELEFAHICPGQSARALTPTFIPPDDLDMPGYRLMASPQLYPGQTIRASFLASDISGEA
FT                   NLSLIVKTYRSDGSTELFKSRSIPLMPRQQATIDWRVPNINNQTIYAVGVEISSDRYSS
FT                   GRVYLDYLTWEGVPSANLIFPDEQNSRLPWIDAVDHVLYPPSGGIALIQDKDTGLFLQG
FT                   CDDWRGYTLRASISIHMAEAAGLAFRARGINRYYALLLKPRSGRVELISRFDDHISVLH
FT                   SFEKKLELDRYYDITISIKDDTVYVTLENEAFEYRLSNTFLRSGFIGLVCTEGRVDCKA
FT                   LSITT"
FT   gene            complement(113393..113686)
FT                   /locus_tag="Tter_0101"
FT   CDS_pept        complement(113393..113686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0101"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_4897 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41023"
FT                   /db_xref="InterPro:IPR015359"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDL7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41023.1"
FT                   /translation="MIADNGNAVTGTRDVVYDLISVIYHALKGAETYSSYVEDADFMGD
FT                   QELVQFFRRVQEEDRRRAEEAKRLLRKHLAREAAEDWNPVEAHVKGISLDVV"
FT   gene            113952..114188
FT                   /locus_tag="Tter_0102"
FT   CDS_pept        113952..114188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41024"
FT                   /db_xref="GOA:D1CDL8"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDL8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41024.1"
FT                   /translation="MEMIPREKYYHEVRTQLTRAILAAQLLKRGGLQNLDARQVRLLHT
FT                   LEDSLMRASWLIMTHKINNIGSHRPASSKYRHN"
FT   gene            complement(114191..115288)
FT                   /locus_tag="Tter_0103"
FT   CDS_pept        complement(114191..115288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0103"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: gur:Gura_3690 DNA protecting protein
FT                   DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41025"
FT                   /db_xref="GOA:D1CDL9"
FT                   /db_xref="InterPro:IPR001711"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDL9"
FT                   /inference="protein motif:TFAM:TIGR00732"
FT                   /protein_id="ACZ41025.1"
FT                   /translation="MSSCEDFPDLPYWIAFSRIPSIGPARIRKLLAHFGGLQRAWEANA
FT                   LELKAAEMDDKSIGIILKARKSINPHLELEKLESRGIKPYAYDSPGYPRLLSYVPNPPV
FT                   VIYVQGDIVQEDECSVAVVGTRKATAYGREVVSRIVTGLVMNGVTVVSGLARGIDSYAH
FT                   RAALEAGGRTIAVLGSGLDQVYPWENKKLADDIVRSGALVSEYPLGTRPEARNFPPRNR
FT                   IITGLSLAVVVIEADMKSGALISAGFAAQQGREVMAVPGSILSPTSAGTNYLIQQGAKL
FT                   VSRVEDILEELDIDRVSLESNSRSIVTDDPTEQALLDVLGTEPKHIDDIAFESNMPIAV
FT                   VSATLTMMEIKGIVRSNGMFYSLAT"
FT   gene            115384..116151
FT                   /locus_tag="Tter_0104"
FT   CDS_pept        115384..116151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0104"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ppd:Ppro_2693 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41026"
FT                   /db_xref="GOA:D1CDM0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR035518"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM0"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACZ41026.1"
FT                   /translation="MTEGRPFISVIIPAYNEAKRLPVTIPRIVSFLSSQGWQYELIVVD
FT                   DGSTDETQQIACQLSKEYPSIRLLKLPHRGKGPAVREGVLASTGDLVLFTDADLSTPIS
FT                   QLSKLLARIEQGYDIAIGSREGVGARRYKEPFYRHLMGRVFNLFVRLLTLAHFNDTQCG
FT                   FKLFRKHAAKDIFSNLVLYGSTAPAIKGPMVTSLDVEVLQIAARRGYKVAEVPVEWHYS
FT                   SGSKVRPALDSYRMLKDIIRIKLNDLRGMYDKK"
FT   gene            116161..116487
FT                   /locus_tag="Tter_0105"
FT   CDS_pept        116161..116487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41027"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41027.1"
FT                   /translation="MGIFRRFFSGKQADKDGLYLYVKCNYCQEPIRIRVNPSTDLNPLY
FT                   EGPGDDPSGYELNKEIIGNRCFRLIRGTWYFDKSKRIIESNIEGGTEISAEEYNRLQGE
FT                   SSGE"
FT   gene            116484..117356
FT                   /locus_tag="Tter_0106"
FT   CDS_pept        116484..117356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0106"
FT                   /product="Prephenate dehydrogenase"
FT                   /note="PFAM: Prephenate dehydrogenase; 3-hydroxyacyl-CoA
FT                   dehydrogenase NAD-binding; KEGG: bur:Bcep18194_A4157
FT                   prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41028"
FT                   /db_xref="GOA:D1CDM2"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM2"
FT                   /inference="protein motif:PFAM:PF02153"
FT                   /protein_id="ACZ41028.1"
FT                   /translation="MKKEPSFGKVLIVGLGLIGGSIGLALTDNRVEVRGVTRSVSTLEE
FT                   ALRRGAITGGSTRLEDEAPHADLIILAAPTRTSINLITDLAQLAKEGTVITDVCSSKVD
FT                   VVRAMNQLPRHLRAVGGHPMAGKETPGISAAEKDLFLNSRWVLTETKRSDQESKSICEE
FT                   LAKLCGANVLWLDAEEHDLAVAYISHLPLLTSAALVLAAEEADTELTHKLAATGFRDST
FT                   RLAAGDHQMGVDLILTNSRNILQAINMFAHELQRMADAIEAGDEGKLRSLLEEAANIRR
FT                   NRYYKDNTH"
FT   sig_peptide     116484..116561
FT                   /locus_tag="Tter_0106"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.748) with cleavage site probability 0.406 at
FT                   residue 26"
FT   gene            117416..118735
FT                   /locus_tag="Tter_0107"
FT   CDS_pept        117416..118735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0107"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: 3-phosphoshikimate 1-
FT                   carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1- carboxyvinyltransferase); KEGG:
FT                   bha:BH1667 3-phosphoshikimate 1- carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41029"
FT                   /db_xref="GOA:D1CDM3"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM3"
FT                   /inference="protein motif:TFAM:TIGR01356"
FT                   /protein_id="ACZ41029.1"
FT                   /translation="MDITISPARSVHGNIMPPGDKSISHRAAIFGALAQGTTDIYNYSP
FT                   ARDCQSTLECLLSLGTGIRRDGNYIRVEGVGDTGFKEPESILDCGNSGTTMRLLIGALA
FT                   PMDLYAVLIGDKSLTKRPMDRVLKPLGDMGLRYYARNKDRYPPVSIRGGKIQGIHYQTP
FT                   VASAQVKSAILLAGLRAEGETVVTEPAKSRDHTERMLKAMGAQIQSDGTTVRLVASRLS
FT                   ATTFHVPADPSSAAFILAAALIVPESKVTTSNICLNPTRIGFLNVLERMGANIEIHNER
FT                   ESSGEPIGDIEASTSELNGIEIGGTEIPTLIDEIPILAVLATQAKGRTVIRDAEELRIK
FT                   ETDRISVLCRALQQMGADIREMRDGFEIHGPCKLKGAKVDPDHDHRIAMALAVASLIAE
FT                   DKTTILGAECASISYPNFWDHLSSLGVELSGTQSDSKTNV"
FT   gene            118745..119614
FT                   /locus_tag="Tter_0108"
FT   CDS_pept        118745..119614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0108"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="KEGG: pca:Pcar_2150 shikimate 5-dehydrogenase-like
FT                   oxidoreductase; TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate dehydrogenase substrate binding domain protein;
FT                   Shikimate/quinate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41030"
FT                   /db_xref="GOA:D1CDM4"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM4"
FT                   /inference="protein motif:TFAM:TIGR00507"
FT                   /protein_id="ACZ41030.1"
FT                   /translation="MKQVGVIGYPIKHSISPVFQQAAFDALGIEAIYKAYEVPPEDLRS
FT                   FFFNLRNGNWLGVNVTIPHKSAAAKLADERSQEVSFTGAANTIISMNGRLKAHNTDISG
FT                   FILALEENGFQIKSKRAVVLGSGGTTRAVVYALAICEAQSIAVIGRSQDKVHSLISELK
FT                   PFFEHKQVTVTGHSWEKDSIRRQIQNSDILINTTPIGMKGTDQEHLSPVSKEDLSSDLI
FT                   VFDVVYNPIMTPLLTYAKDVGASTISGIEMLIYQGAESFRLWTGQEPPVDIMRKAAIKA
FT                   MEEKSRDV"
FT   gene            119607..120761
FT                   /locus_tag="Tter_0109"
FT   CDS_pept        119607..120761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0109"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="KEGG: sus:Acid_2745 chorismate synthase; TIGRFAM:
FT                   chorismate synthase; PFAM: chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41031"
FT                   /db_xref="GOA:D1CDM5"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM5"
FT                   /inference="protein motif:TFAM:TIGR00033"
FT                   /protein_id="ACZ41031.1"
FT                   /translation="MFRWLTAGESHGQALVALIDGMPAGFKINIDEINKELRRRQGGYG
FT                   RGGRQKIERDTAHVLSGIRNGTTLGSPISIMIRNLDWENWQNVMRVEPGEEPKKVTRLR
FT                   PGHADMAGSLKYGHDDVRNVLERASARETAARVAVGAIAKQCLQEFGISIHSLTRSIGP
FT                   IRSDATPPYDWQQIEESPVRAPSHSEEMVKAIDEARENGDTLGGIFEVIAEGVPVGLGS
FT                   HTQWDRKLDGRIAQAFMSIQAVKGVGIGAAWEAASLPGSQVHDVIIPDEEGNLKHATNR
FT                   AGGVEGGISNGEPIVVQAALKPISTLLKPLDSADLITREPMKARYERSDICVVPAAGVV
FT                   GEAMLAIVLWDAFLEKFGGDSLREIRRNYEGYIESLKLGNFAQS"
FT   gene            complement(120758..121084)
FT                   /locus_tag="Tter_0110"
FT   CDS_pept        complement(120758..121084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0110"
FT                   /product="protein of unknown function DUF971"
FT                   /note="PFAM: protein of unknown function DUF971; KEGG:
FT                   sus:Acid_1286 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41032"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM6"
FT                   /inference="protein motif:PFAM:PF06155"
FT                   /protein_id="ACZ41032.1"
FT                   /translation="MEVIEPVDIRLSNDGKSLEIEWTDGHVTTTDLRTLRWNCPCAICS
FT                   GEMGSKGLLSQVKELPDDEYILEGVQPVGRYALQLVWKSGHDSGIYTYELLRDLCQCPE
FT                   HATS"
FT   gene            121195..121530
FT                   /locus_tag="Tter_0111"
FT   CDS_pept        121195..121530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0111"
FT                   /product="2',3'-cyclic nucleotide
FT                   2'-phosphodiesterase/3'-nucleotidase bifunctional
FT                   periplasmic precursor protein"
FT                   /note="KEGG: bca:BCE_4194 2',3'-cyclic nucleotide 2'-
FT                   phosphodiesterase/3'-nucleotidase bifunctional periplasmic
FT                   precursor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41033"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM7"
FT                   /inference="similar to AA sequence:KEGG:BCE_4194"
FT                   /protein_id="ACZ41033.1"
FT                   /translation="MENTNKQEDRKVTRLPDAEAEGAGNFGAEPDNDPTAGNTPNAISA
FT                   LSETAQLPEAENPQEPTPLAEEGNRTGGEPSEDIVARHADSERDEQAADQQMEERGLPK
FT                   DMTIEEE"
FT   gene            121535..121894
FT                   /locus_tag="Tter_0112"
FT   CDS_pept        121535..121894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0112"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aav:Aave_3522 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41034"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41034.1"
FT                   /translation="MPRNQWSKEREKEYQELKEEFEEEGRYKGREEEVAARIVNKQRRE
FT                   YGETKEAKAEDKEGSSPDRGLPIKNYDNLTVDEILSKSKGLSASVLKEIESYEKKHKNR
FT                   KTLLEQLDRMIGSKS"
FT   gene            121891..122511
FT                   /locus_tag="Tter_0113"
FT   CDS_pept        121891..122511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0113"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   aba:Acid345_3354 phage SPO1 DNA polymerase- related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41035"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM9"
FT                   /inference="protein motif:TFAM:TIGR00758"
FT                   /protein_id="ACZ41035.1"
FT                   /translation="MKGSAVSDQYELDRVREEALFCQRCTLWQTRTQVVFGAGKAGSKI
FT                   MFVGEAPGEDEDRTGTPFVGRAGILLDQLLEEAGIGRESTYITNIIRCRPTAVTQGKIT
FT                   NRAPRAGEVSACEPWMWLEIHLVKPSVIVCVGAPAAKTLIDKNFRLSDQRGDVYEKEDG
FT                   IRYIATLHPAYLLRLLSTDTEAYQRAKGLVLQDLKKAKMLASR"
FT   gene            122578..122653
FT                   /locus_tag="Tter_R0001"
FT                   /note="tRNA-Ala1"
FT   tRNA            122578..122653
FT                   /locus_tag="Tter_R0001"
FT                   /product="tRNA-Ala"
FT   gene            122660..122746
FT                   /locus_tag="Tter_R0002"
FT                   /note="tRNA-Leu1"
FT   tRNA            122660..122746
FT                   /locus_tag="Tter_R0002"
FT                   /product="tRNA-Leu"
FT   gene            122933..123967
FT                   /locus_tag="Tter_0114"
FT   CDS_pept        122933..123967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0114"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 3 domain protein; sigma-70
FT                   region 2 domain protein; sigma-70 region 1.2; sigma-70
FT                   region 4 domain protein; KEGG: bsu:BSU25200 RNA polymerase
FT                   sigma factor RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41036"
FT                   /db_xref="GOA:D1CDN0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDN0"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACZ41036.1"
FT                   /translation="MEELGKDFDILDNLDEIILDSELEDLEADLSPASLLEEEMDRELI
FT                   GDSLGIYLREIGRAQLLTAEEEVALAQAIERGQEAEQRLQSDDISPEELDDLKKAVEEG
FT                   KAARHKLIEHNLRLVVSIARRYVGHGMPLADLIEEGNLGLMRAAEKFDWRRGFRFSTYA
FT                   TWWIRQAVTRGLAEGGRTIRLPVHVGEALTKIGRETQRLSLELGREPTNQELAEATGLS
FT                   PERIDEYKNASRLPLSLEAPLGEDGETNLGEVLEDTEAANPEHIADHTMLGEDIKRALE
FT                   RLNERQRAIIIMRYGLYGGQPMTLEAAGRKLGVTRERARQIEQEALNRLRQSDAKQFLA
FT                   SHVA"
FT   gene            124030..124833
FT                   /locus_tag="Tter_0115"
FT   CDS_pept        124030..124833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0115"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: lpf:lpl0291
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41037"
FT                   /db_xref="GOA:D1CDN1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDN1"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACZ41037.1"
FT                   /translation="MPFASNGDLKIYYEEVGKGDPVVWIQGLGASNTAWNVQKFHFSQR
FT                   FRCIFIDNRDVGQSSRANADYTTKDMAEDVLCVLESANVDSAHIIGLSMGGAIAQELAL
FT                   NSPKKVKSLVLVSTFATPDARIRAVNAAWGELYGKVNRELFYKQVEPWLFSPSYLEKPS
FT                   NIRAFRRYIQHEPNPQETDAYQRQVRAVLSHNTADRLEKISNPTLIIAGEQDILVSPLH
FT                   SKLLAELIPNAELEIIPGAAHSVNLENQKEFNNRVRSFLESYLET"
FT   gene            124912..126336
FT                   /locus_tag="Tter_0116"
FT   CDS_pept        124912..126336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0116"
FT                   /product="Hyaluronidase"
FT                   /note="PFAM: Hyaluronidase; KEGG: Hyaluronidase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41038"
FT                   /db_xref="InterPro:IPR011496"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="PDB:5DIY"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDN2"
FT                   /inference="protein motif:PFAM:PF07555"
FT                   /protein_id="ACZ41038.1"
FT                   /translation="MEYFRYRGIIEGFYGKPWEHQERLDMFEFMQANNLNAYIYAPKQD
FT                   LYHRELWREPYKEEQLQLFKELIEKAGSCGINFTFAISPGLSLVYSSEEELETLIRKIT
FT                   PFLEMGVHSIGIFFDDVPFDLIHEEDRNSYSNLAEAQADFLTRVLQRLESTISTPQIIM
FT                   CPTFYCNDPNLEYLRILGQRLPKNIDVFWTGPNVCSHEITTSHMQEVQKSLQRPATLWD
FT                   NYPVNDGGMMPELHIGPYDHRDPELHTHVVGIYANPMALPEASKLPLYTFAQYLNSPSQ
FT                   YNPQDSWRQAVSTLLGEDNLSAMEKFYQSNTISCLEPEEPAYLTNLFKKVQEDFASFRF
FT                   EQGLRTLREEIISMQTTYSRLSTQDSKFFWEIRPWLEEYKLWTDYLDQAMITFSNLFTG
FT                   FFTADEEQARESLQKALQGRTYLREVLKDAVDFRTRVCGDVVRNFLQQVLRSTVSIELQ
FT                   AEGKEWTALPPGIVRD"
FT   gene            complement(126345..129320)
FT                   /locus_tag="Tter_0117"
FT   CDS_pept        complement(126345..129320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0117"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; KEGG: tbd:Tbd_2206 translocation protein TolB"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41039"
FT                   /db_xref="GOA:D1CDN3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDN3"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACZ41039.1"
FT                   /translation="MSDDSHASLTVADFTLADHLGLEALQVLVNPILPQLYDFIARRTI
FT                   DGQEAEDVLQQTLWLAFKTCYKSDQELGLLDWLLSIATRVLLNRVNSDPLCECGLGFLV
FT                   QDDSGRTNDKVSRLYGRLLASEISHFAKTQRFILGLFVHERWSIHRISTVLGISPHKVE
FT                   SSISTTVLQILIDLWPEEPESRLNRNDVYLITREILLGNISGSYPRIRSLIDTLSVKHT
FT                   TFSMPPNLEARLWKSCSADFPQQYVPPLAVGNDNIRVYLWAVAACIVLLFAAVLGANFF
FT                   GIDSSAKPSQVKTAERLVSDQNVSNRSDDSTSNIAARINGFVRDRYLSGRLVLLHYGPD
FT                   GNSVGVVDFDTGNIARDVFTDLSPNVVFAISPSGRYLAYGKQDAVMLSDIIDRSPPRWL
FT                   ITLQSPNTDRWRYEMDRTPHRFRVAALAWHPNEQILAVASEPIYYRGLEHSRVQLVRVR
FT                   NSGGETISTIVTLQSFEDVVSLDWSADGTQLLIGTDRRILLASFSRFGFWDLKQLPGRG
FT                   TATWSPDDKLVLWVSPSDSASGSSLFGVTNPSTGKSSTLGTCDYARWEDDPNYVVFLQG
FT                   VSNHSDRIVLSRMNLSSGEVDQVLQVAFKGNFESNALLSPDGRYLLYNDEDGLHLYDAK
FT                   FQESVWRLDYPPKEVISPLVWMSGWQSYDREFETLSGTIIYPKKSGSKVSLVSLDLRTG
FT                   STRQIAAASKLSYTVGDQALMVRTSKSNALLYTQEGIIKLYIPPKMQDITAVELTSSGS
FT                   TIAYATREGRGVAIWEITPQRSRVNLARSKPIAHLRTIPLSLDFSPSGRWILIKDRNNV
FT                   WHLFNNKFKRIKILPRADRYSWMVLDGKDVLVQLKNLNISIYTPRGKTVYEINGYVNAY
FT                   APLDDGYIAVWTMDDDLRVYDLRKKDFVTWGSMLGMDYSELDDSSLVQIVPISDGGSWI
FT                   ALRLRDSVYMLDLSNGYQYPLQIKATSAGELTWLSGDPNPQFRRYVDWDSCHEVPPDKC
FT                   PA"
FT   gene            complement(129404..130315)
FT                   /locus_tag="Tter_0118"
FT   CDS_pept        complement(129404..130315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0118"
FT                   /product="homoserine kinase"
FT                   /note="TIGRFAM: homoserine kinase; PFAM: GHMP kinase; GHMP
FT                   kinase domain protein; KEGG: predicted protein; K00872
FT                   homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41040"
FT                   /db_xref="GOA:D1CDN4"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDN4"
FT                   /inference="protein motif:TFAM:TIGR00191"
FT                   /protein_id="ACZ41040.1"
FT                   /translation="MRIHVRVPAASGNLGSGFDCAGMALALYNEAILDTDAKGVVIEGE
FT                   GADFLPREESNACLKAMMELASRLDCQLPSFGLRLINRIPIGRGLASSGAAALAGLLLA
FT                   NELLGCPKDREQIMELATELEGHPDNVAAALLGGITISAWDGSKVHTVRIDPDPSMKAV
FT                   LWVPDSQVYTKHARSILPKQVSMQDAVFNLSRAALMAASFARGEYNLLQVATQDRLHQP
FT                   YRASLVKGLQESMLSALEAGALATWISGAGPSVLALCIDNVQAVELALWHIASKYNDGK
FT                   VMTLEIDTCGAQVTKMAEEVEV"
FT   gene            complement(130312..131610)
FT                   /locus_tag="Tter_0119"
FT   CDS_pept        complement(130312..131610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0119"
FT                   /product="threonine synthase"
FT                   /note="TIGRFAM: threonine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: sus:Acid_1559 L-threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41041"
FT                   /db_xref="GOA:D1CDN5"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDN5"
FT                   /inference="protein motif:TFAM:TIGR00260"
FT                   /protein_id="ACZ41041.1"
FT                   /translation="MSSSMAIDRDLKVKPKVRCIQCSAEKNLWTTVSSCECGGLLEIVW
FT                   PLGEYEASWLKDTWASRMGSLLAIDRSGVWRFRELVSPVDGEAIITRGEGNTGLYNVPK
FT                   LADWVGVDTLYLKHEGENPTGSFKDRGMTVGVSVARHCGAAIVACASTGNTSASLASYA
FT                   AIADMRCVVLLPAGKVSAAKLSQSIAYGAKTIAIRGDFDKALSLLQSTAPQLGLYILNS
FT                   VNPWRLEGQKTVMYELLESLRWEVPDWIFLPGGNLGNTSAFGKALLEMRSLGLIDSLPR
FT                   IGVVQAEGAAPFAHAYKSGWQSYSPVKAETVATAIRIGDPVNYQKARRVVQELDGLVTS
FT                   VSDREILDAKAMVDGAGVGCEPASAASVAGIRKLMSERIISPDSKVVAVLTGHILKDPD
FT                   ATFMYHTSDNRFSNKIIEVDADPKSIISVVESL"
FT   gene            complement(131613..132158)
FT                   /locus_tag="Tter_0120"
FT   CDS_pept        complement(131613..132158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0120"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   vch:VCA0417 acetyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41042"
FT                   /db_xref="GOA:D1CDN6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDN6"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACZ41042.1"
FT                   /translation="MLGPIIVGDRVRLVPPTEDMIPIFCSWFADTEVTKFLNIRFPPSL
FT                   SAEKEWFDRVSRSNEDVLWAVTLEDKLIGTTGIHQIDWRNRHAITGNLIGDKSEWGKGY
FT                   ASEVVALRTRFAFESLGLEKLKSQVFSGNLASRKVLEKAGYRLCGTFRREAFIDGHWYD
FT                   SWLFEILREEWLQIQSME"
FT   gene            complement(132185..133975)
FT                   /locus_tag="Tter_0121"
FT   CDS_pept        complement(132185..133975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0121"
FT                   /product="threonyl-tRNA synthetase"
FT                   /note="TIGRFAM: threonyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein; Threonyl/alanyl tRNA synthetase SAD; KEGG:
FT                   bsu:BSU28950 threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41043"
FT                   /db_xref="GOA:D1CDN7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDN7"
FT                   /inference="protein motif:TFAM:TIGR00418"
FT                   /protein_id="ACZ41043.1"
FT                   /translation="MSTKAKDAEQLAYHGAEMESGSLLSTMRHSAAHVMAAAVLQMFPD
FT                   AKFGIGPAIENGFYYDFELPRPITPEDFPEIEERMRQLIEEDHPFIREEISRQQAKEMF
FT                   RDQPYKLEIIDDLPEDAVISIYKMAHFTDLCRGPHVESTGKIGPFKLLSVASAYWRGDE
FT                   KRPQLQRIYGTAFPTQEELDDYLWRLEEAKRRDHRKIGRDLELFMISDEVGPGLVLWLP
FT                   NGSIIRRELENFIVKAEAREGYQHVYTPHIAKLGLYKTSGHWQHYRDAMFPPMVLEDGE
FT                   EYELRPMTCPHHIMIYKHSLRSYRDLPLRIAELGTVYRYEKSGELTGMSRVRGFTINDA
FT                   HIFCRPDQLKEEFIRVIQLMHEVYRAVGFHDYVYRLSLRDPSDKEKYVEGDEMWNNAEN
FT                   AIRQALDELGADYVEAEGEAAFYGPKLDVMVRDVLGREFAASTNQLDFYLPERFDLEYI
FT                   DADGERRRPVMIHRAPIGSMERFFAFLTEQHAGAFPVWLSPVQVVVIPIADRHIPYAEE
FT                   VASAFSRHNVRVNVDARNERMNAKIRDAQMQKIPYMLIVGDREAQAGTVAVRKRSGEDL
FT                   KGQPVQDVVQMVLDDIREYK"
FT   gene            complement(134310..134750)
FT                   /locus_tag="Tter_0122"
FT   CDS_pept        complement(134310..134750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0122"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: mes:Meso_3240
FT                   OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41044"
FT                   /db_xref="GOA:D1CDN8"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDN8"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACZ41044.1"
FT                   /translation="MATAQSKAHVDWSGDLLQGNGQVSVGSGSFGPLPISWRTRTERGG
FT                   GGTSPEELIAAAHAGCYAMALSNTLAKHGSPPENLSVDATCNFEFGEGGARITSIDLNV
FT                   TGRVPGLSEEEFKSIAEEAEKGCPVSNALRNNVDIRLNAQLA"
FT   gene            134913..135194
FT                   /locus_tag="Tter_0123"
FT   CDS_pept        134913..135194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0123"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_4897 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41045"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41045.1"
FT                   /translation="MSYGRKITGTRDEVYDLISVLYHTLQAAETYVIYSEDADFSQDKE
FT                   LVSFFQELQEEDKRRAERAKELLRKRLLAEAEHEDTSTGEQEGPTVGI"
FT   gene            complement(135224..136057)
FT                   /locus_tag="Tter_0124"
FT   CDS_pept        complement(135224..136057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0124"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sme:SM_b20969 putative
FT                   sugar uptake ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41046"
FT                   /db_xref="GOA:D1CDP0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41046.1"
FT                   /translation="MVGRILHSTSVYIMLIALSLFILMPIGWMLTAALKPSTAPVFTYP
FT                   PEWFPTKYWEWKTFRDALFEENFFIYTRNTVILVLLNVVGALFSCSMIAYAFARLKFRG
FT                   KNLLFTILVATMLLPGPVLLIPQFLLFYRIGWYNTYFPLFVPAFTGNAFFIFLLRQYMK
FT                   TLPIELDEAARIDGASYWGIYWRIILPLSIPALTVVAVFQFLATWNDFFGPLIYLDDPD
FT                   KFTLALGLATMVRRVGTEWNEVMAANLVAVIPVLIVYFLAQNKLIGGIASVGLKG"
FT   sig_peptide     complement(135959..136057)
FT                   /locus_tag="Tter_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.649) with cleavage site probability 0.388 at
FT                   residue 33"
FT   gene            complement(136099..137007)
FT                   /locus_tag="Tter_0125"
FT   CDS_pept        complement(136099..137007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0125"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: togM; ABC transporter
FT                   membrane spanning protein (galacturonic acid); K02025
FT                   multiple sugar transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41047"
FT                   /db_xref="GOA:D1CDP1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41047.1"
FT                   /translation="MSKHSPLSAREEKAAYLFLTPWFIGLIFFLAVPLVWSLYISMTDK
FT                   RLISAGGEHFIGLQNYMYMFTQDGYFYHSLYVTLKWLVLTTPLYLLAGLFISLLLNQKL
FT                   PGIHLFRTILYIPAVLSGVAVAVLWLQLFNPELGAINYLLYRIGIDNPPYWLQDPRWAM
FT                   PAVIIMGLWGVGGTAIIYLAGLQNIPPHLYEAASIDGAGSIAKFFYITLPMLSPTIFFL
FT                   LVNAIIDSLLIFGPVFVLGGDGGPEDSLLFYMLYLYRRAFIQGLMGYATALAWVLTILG
FT                   VILVFLMFRFERRFVFYEAAE"
FT   gene            complement(137074..138507)
FT                   /locus_tag="Tter_0126"
FT   CDS_pept        complement(137074..138507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0126"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bha:BH1864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41048"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP2"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACZ41048.1"
FT                   /translation="MSRINKMKIFSIIILLMLSISCGPGRESSGPPGVEQPTPTANVPA
FT                   QEQTPVGFDISKVTPETKPTPIVRGAWKDYDGPTVTISVWMYPQDEDSLKAYKDAFEEK
FT                   HPNIKIKYVVYPEDNYQTKINTALQAHKPPDVAVMENKAWMKAGKVVDLTPYYKQWGIF
FT                   VNDFAQGGVARFTLEKGPSQGIFGVGDFLGGNIIVYNKDMFDEARVSYPPADKSLTWPQ
FT                   YAEICKKVAKPDPNPTKRIYGCSVPPWGFGIWQKWLFGPNGKRALGNMNSPEMIEAWNV
FT                   GTELVREKYAPSGNVLQTLPNGEPDLFTQKRIAMTWTDFTFVKDYKAAGIDFGIAPWPV
FT                   IRGSESFVDTWTAPWGTFTESEHQHAALTFLKFMATDAQRIRGTVSADPPLSFKVAEQM
FT                   KWGQGDPLKEQYLQVLKVAAKAQPFVPPLPEGGYNPDDIYNKMTVQGVKDAKPLLDDAA
FT                   KRTQPLLDKAWQEWEKIGR"
FT   sig_peptide     complement(138424..138507)
FT                   /locus_tag="Tter_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.534 at
FT                   residue 28"
FT   gene            138635..139672
FT                   /locus_tag="Tter_0127"
FT   CDS_pept        138635..139672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0127"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   sus:Acid_2859 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41049"
FT                   /db_xref="GOA:D1CDP3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP3"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACZ41049.1"
FT                   /translation="MRGVVLPGNRTVDLREFPTPQPGYGQVLVRMKASGICGSDIRAIY
FT                   REWLGTGPEAYKGCIAGHEPCGIVEEVGPGVEHFSPGDRVVVYHIVGCGVCKDCRAGWM
FT                   INCKAPYPYRAAYGWQRDGGHADFLLAEQRTLIKLPDNLTFVDGALAACGLGTGYQAIL
FT                   RAGVSGRDRVAVVGLGPVGLGILMLARASGAEVIGIDVIPERLEMAQKIGAEHTFLSGD
FT                   NTAERIMDLTKGEGVEVVIDASGNPLGRHLCLEIAGEWGRVVFVGEGNTVSFEPSPLLI
FT                   HKQLTLMGSWVCGLVQMEELLGFLSRKELHPEQIVTHKFPLEDADEAYRLFDSGKSGKV
FT                   VITWD"
FT   gene            139745..140383
FT                   /locus_tag="Tter_0128"
FT   CDS_pept        139745..140383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0128"
FT                   /product="protein of unknown function DUF47"
FT                   /note="PFAM: protein of unknown function DUF47; KEGG:
FT                   aba:Acid345_3130 protein of unknown function DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41050"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP4"
FT                   /inference="protein motif:PFAM:PF01865"
FT                   /protein_id="ACZ41050.1"
FT                   /translation="MVLARFLPNDERFFEYFRDAATNARDSAALLRDIVETNADIERKV
FT                   RKLRDLEHIGDEITHQVFNALNSTFVTPIDREDIQRLTSELDEFVDYIEEAARRMYLYK
FT                   VGAPTEISKLLVRVIDEQAEILANSIPLLESAKKRDTLLRNTVEIHRLENEGDDILNQA
FT                   MAHIYDDVPDIPSLIKAIRWSELYQLLEDATDRAEDIANALEGIVLKNA"
FT   gene            140376..141392
FT                   /locus_tag="Tter_0129"
FT   CDS_pept        140376..141392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0129"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: scl:sce3330
FT                   low-affinity inorganic phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41051"
FT                   /db_xref="GOA:D1CDP5"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP5"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ACZ41051.1"
FT                   /translation="MPDINSALILLGVIVLLGLAFDFINGFHDTANAIATSVATRVLSP
FT                   RQAVIMAGVLNFVGALTGTAVAQTVGKGIIKPEHSTQLLVISALISAIIWDLITWWYGI
FT                   PSSSSHALVFSIVGAGVASRGWQEIQFDGVNKVLTGLVASPALGFAVAFMVMAILLWLF
FT                   ARAKPQAISRIFGRLQVLSAAYMAYSHGSNDAQKTMGVITMAVASYYGWSGSEWAVPLW
FT                   VILAAATAMALGTAAGGWRIIRTMGLKVVELRPIHGFAAETTAATVIEVASRLGIPVST
FT                   THVISSSILGVGATRRLSAVKWGIAGRIVTAWIVTIPACIAIGWAVYEVLHLLTGAS"
FT   gene            141554..142675
FT                   /locus_tag="Tter_0130"
FT   CDS_pept        141554..142675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bsu:BSU06570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41052"
FT                   /db_xref="InterPro:IPR021416"
FT                   /db_xref="InterPro:IPR023158"
FT                   /db_xref="InterPro:IPR035328"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP6"
FT                   /inference="similar to AA sequence:KEGG:BSU06570"
FT                   /protein_id="ACZ41052.1"
FT                   /translation="MMKTHNLIYTTLVLLLIAFITACGSGSSANENSPTPTTPESSTLQ
FT                   SPSPEPTPTQVASTPPTQMPSPQPTSTPEHKEKRTDKNLLSPRKRPIAIMVENHPDARP
FT                   QSGLINADVIYEAPAEFGIPRFMAIFVNKESKIVGPIRSARTYYVSWASEYNPVYVHAG
FT                   GSPQGIRLIDQLGLQHIDALRYYAPQAFWRSTDRDAPHNLYGSTTEIRKLIAKDKNLQG
FT                   KKGTWGPIHWSNNPTIGSESGKEVSVTYAEGYQASFKYDPQTGLYNRYMVGKPHLDRET
FT                   KRQIAASAVIVQTVDMWQIKGDAYGRREVDLTNASGPILVFQNGKVLKGKWEKEDVDTI
FT                   TKYETNDGKPIELKPGQVWIEIVPKEGSKIDYR"
FT   sig_peptide     141554..141643
FT                   /locus_tag="Tter_0130"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.771 at
FT                   residue 30"
FT   gene            complement(142760..143176)
FT                   /locus_tag="Tter_0131"
FT   CDS_pept        complement(142760..143176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0131"
FT                   /product="molybdopterin biosynthesis MoaE protein"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE protein; KEGG:
FT                   scl:sce2941 molybdopterin-converting factor chain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41053"
FT                   /db_xref="GOA:D1CDP7"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP7"
FT                   /inference="protein motif:PFAM:PF02391"
FT                   /protein_id="ACZ41053.1"
FT                   /translation="MIAVTQDPISIDELISSVSHPGAGAIVIFLGVVRDNNEGRKVRYL
FT                   EYESYEPAAKASMQKICGFAKDKWPGVRISAVHRVGKLNIGDISVAVVASAPHRQEAFA
FT                   AARFVIDSIKEESPIWKKEIFEGGEVWIGDPSPS"
FT   gene            complement(143142..143444)
FT                   /locus_tag="Tter_0132"
FT   CDS_pept        complement(143142..143444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0132"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein; KEGG: CNX7/SIR5; CNX7/SIR5;
FT                   catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41054"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP8"
FT                   /inference="protein motif:PFAM:PF02597"
FT                   /protein_id="ACZ41054.1"
FT                   /translation="MNIAGGSFEIKLLLFAQFREVIGQKELLYKVTIGSTPASVLRSLI
FT                   GEYPDLARLESVTKFIVNEEFVPGDYKLSPGDTLAFIPPVAGGRDDSSDSRSHIH"
FT   gene            complement(143445..144812)
FT                   /locus_tag="Tter_0133"
FT   CDS_pept        complement(143445..144812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0133"
FT                   /product="Glycine dehydrogenase (decarboxylating)"
FT                   /EC_number="1.4.4.2"
FT                   /note="PFAM: glycine cleavage system P-protein; KEGG:
FT                   glo:Glov_2672 glycine dehydrogenase (decarboxylating)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41055"
FT                   /db_xref="GOA:D1CDP9"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP9"
FT                   /inference="protein motif:PRIAM:1.4.4.2"
FT                   /protein_id="ACZ41055.1"
FT                   /translation="MPYIPHTDKERQEMLSRIGVNSIDELLTAIPERYKYPQLRIGPGL
FT                   SEAEVAKKVNALSERNLDVDHVACFAGGGAYNHFIPAAVKSVTSRNEFYTSYTPYQAEV
FT                   SQGTLQSIYEFQTMIAALMGMDVANASMYDGATAAAEGALMAVHYTRRPKIVIVPTFHP
FT                   EWVEVIRTFTSGVELEIVVAGELPDNFKSTPRDIATYVDERTACVLVQYPNFFGSIEDI
FT                   KGYADLAHSVGALLVVAAYPIALGLLKPPGELGADIAVGEGQSLGNELNFGGPYLGLFA
FT                   TRKDFIRYMPGRLVGATKDVDGKRGYVLTLQTREQHIRREKATSNICTNEALNALASTV
FT                   YLSLMGKQGLAKVAQLCVNNAHYLAGVLSAVPGWEVVSAEPFFNEFVLKCPVPASQVVS
FT                   ALIDEGILAGIDLGRFDSKLSEYLLVCATEMNTKEEMDRYASLISNVKAVKELERV"
FT   gene            144937..145479
FT                   /locus_tag="Tter_0134"
FT   CDS_pept        144937..145479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41056"
FT                   /db_xref="GOA:D1CDQ0"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDQ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41056.1"
FT                   /translation="MYNIIKNFIFILIGIVLGAIITLVFIVTRPQPEITPSASNSGQSP
FT                   DMRLSISQEIFVQQANSEAKDILSKYGLSNPKWYLQPDNQVTMDAQTRIPIIDLPVQVR
FT                   IRGSLYTNSGRVHATIESVDYGGLRLPVELFDNLSRELNRELESSQDTSKYWIESVDTN
FT                   QGRLNLDIDLRGNWLSR"
FT   gene            complement(145483..146241)
FT                   /locus_tag="Tter_0135"
FT   CDS_pept        complement(145483..146241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0135"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   sus:Acid_1840 beta-lactamase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41057"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDQ1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACZ41057.1"
FT                   /translation="MSVKLTFLGTGASFGVPMLGCKCRVCRSNNPRNKRTRTSALISFD
FT                   GHNILIDASPDFRCQALINNVDSLDAVLFTHSHADHTFGIDDLRAFSLREPITCYGDES
FT                   TVEAIRRRFDYIFSPTPHLGSRPKLRLHSIKNNFRVSGLEFVPLPIRHGLDCITAYMFE
FT                   GIAYITDASEIPEVTLQRIKSVDVLVLNALRFEPHAMHLGLWQAVDLAKTVGAERTYLV
FT                   HLGHDLDYDEVSSMLPDGVQLAYDGLQIEV"
FT   gene            complement(146251..147510)
FT                   /locus_tag="Tter_0136"
FT   CDS_pept        complement(146251..147510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0136"
FT                   /product="WD40 domain protein beta Propeller"
FT                   /note="PFAM: WD40 domain protein beta Propeller; KEGG:
FT                   gme:Gmet_3540 WD-40-like beta propeller repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41058"
FT                   /db_xref="GOA:D1CDQ2"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDQ2"
FT                   /inference="protein motif:PFAM:PF07676"
FT                   /protein_id="ACZ41058.1"
FT                   /translation="MIYCGECGALNDEHSERCRVCNAKLTLPAEESISADVEYGRTAGS
FT                   GVARRYLGRYILTVFLLVLLASIAWAVSHIDNQSIANVSGPTPTIPSEPAASATVPATA
FT                   VPTSVLPVPTAEPTFTPPVPTPTLVPTPEPTMPASDDVIVAPSGRIAFSSDRPVPGRNN
FT                   IRKNRDIYSIRADGTGLVRLTGESSFDGMPSWAPTGEQIAFVSDRTGSLQIWIMNSDGS
FT                   NPYQLTYGKIIAQDPDWSPDGKYIAYTLGRDTGIAKIPAKGGKPIVLTDLSYPQSAPAW
FT                   SPDGSKITFMGKPGKYWQVFVMNADGSGLRQITHDPTDHRFPRWMPDGKRIVYNTRKSE
FT                   HVIGQIFIMNADGTNVKQITMSTEGENGRPFPSPDGRYIVFNSNRLDNNWEIYIMRPDG
FT                   SEVKRLTNTIGDDFEPCWSP"
FT   gene            147834..149153
FT                   /locus_tag="Tter_0137"
FT   CDS_pept        147834..149153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0137"
FT                   /product="glycoside hydrolase family 4"
FT                   /note="PFAM: glycoside hydrolase family 4; KEGG:
FT                   pla:Plav_1937 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41059"
FT                   /db_xref="GOA:D1CDQ3"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDQ3"
FT                   /inference="protein motif:PFAM:PF02056"
FT                   /protein_id="ACZ41059.1"
FT                   /translation="MPKITFIGAGSTVFAKNLIGDILSFPELQDSTICLFDIDPDRLST
FT                   SEIVANKIKQALNAPAKIEATTDRRKALYGADYALCMIQVAGYKPGTVIDFEIPKKYGL
FT                   RQTIADTLGIGGIMRALRTIPVLLDMCKDMEELCPDVYFLNYVNPMAMNCWAISRASKI
FT                   KTVGLCHSVQGTAWELSKDIGVPLEEINFVCAGINHMAFYLKFERNGEDLYPLIRKVIE
FT                   EGRVPEHNRVRYDVFKRFGYFVTESSEHFSEYVPWYIKRDRPDLIEKYNIPLDEYIRRC
FT                   EAQIAGWEELRKRYESDEPIQVERTHEFASYIIHSIETGIPKLDEKGNTRVIYGNVPNN
FT                   GLIDNLPQGCCVEVPCLVDRNGIQPIKIGSLPIQLAALMQTNINVQALTVEAALTRKKE
FT                   YIYQAAMLDPHTAAELDPDQIYSLVDELIAAHGDWLPEYH"
FT   gene            149220..150176
FT                   /locus_tag="Tter_0138"
FT   CDS_pept        149220..150176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0138"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.144"
FT                   /note="KEGG: bcz:BCZK1642 tagatose-6-phosphate kinase,
FT                   phosphofructokinase I; TIGRFAM: 1-phosphofructokinase;
FT                   PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41060"
FT                   /db_xref="GOA:D1CDQ4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDQ4"
FT                   /inference="protein motif:TFAM:TIGR03168"
FT                   /protein_id="ACZ41060.1"
FT                   /translation="MKALTVTLNAAIDITYALPYLQPGESLRVHEKIYSPGGKGNNVAK
FT                   ILNILGDDVIATGFVGGYTGQFIEESLQSIGIVPKFVKTRDASRLCIAVIEEANGRVSE
FT                   LLEPGANITRDESDKLLELVKQLATEVDTVVFSGSLPKGVPDDYYRILLSQLKGLNVQT
FT                   VLDTSGESLRLGIRGKPNIIKPNRKEIQDLMGRDAPVKEIIAFCRQELLAKYLSTDAIV
FT                   LLTLGKDGAILLTKELVLQAIPPDIKVVNPVGAGDALLAGFLHAQSVWKDPDLMLKYAV
FT                   AVGTASALQKTAGSVNPQDIDLIMSQVNVRTLLLGAE"
FT   gene            150177..151241
FT                   /locus_tag="Tter_0139"
FT   CDS_pept        150177..151241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0139"
FT                   /product="Glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: rlt:Rleg2_4761
FT                   sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41061"
FT                   /db_xref="GOA:D1CDQ5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDQ5"
FT                   /inference="protein motif:PRIAM:2.6.1.16"
FT                   /protein_id="ACZ41061.1"
FT                   /translation="MLETSTAHSHTYNEITNQPVSWKTTVDAISSQWAELQPQLTITPD
FT                   THYVFVGCGTSLYIAQSAAQCFQEITGYTSLAVPGSEVFLSAKSTVPSRYPVIAFIISR
FT                   SGTTTEALLAADYLAANRSNVTTIGITCNSDTELTKRTRFSIQLPHAHEESVVMTQSFT
FT                   SMLIALQYVAASLAGDQMVIDQISSLSTYLQRDIRSFESKAQELGENLNLDHFVYLGLG
FT                   PNYGLAQEGNLKLKEMTQVHCEAYNPLEFRHGPISTVREGSAIILLAGNRERDYVPSLV
FT                   TDLKEVGAFVASCSPYPIDGSDMHLLVGKELTDVPRCALYMPFLQYLAYYRAVSLGLNP
FT                   DQPRNLSQVVKLDE"
FT   gene            151234..152214
FT                   /locus_tag="Tter_0140"
FT   CDS_pept        151234..152214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0140"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: smd:Smed_4553 PfkB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41062"
FT                   /db_xref="GOA:D1CDQ6"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDQ6"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACZ41062.1"
FT                   /translation="MNSKLSRPLAIVGNLNVDLWVRTVSRFPRWDEELVVDSAQMVLAG
FT                   TAGYIMLAAKGLGIPTFTISTIGNDAFGRFLLEEMKNHGLSCEGVIVMEGEETSLGIIF
FT                   VGDKGQRGILSTLGAHSKMDLTLVRSRDSLISSCEEIFLCGNYLLPLMSPSHIQDFAKE
FT                   LQERGQIVFFDPSWDPSGWTDVTRKSTYSLLQHVDVYLPNQEELLHLTAKNSLDEALQE
FT                   IRPRIAGEAVIKMGERGALYINKSEEIYFEGFRVEAVNTVGAGDVFDLGYLYARRCGWP
FT                   PYQRLQFACALAAMVISQHRDRQYPKLSEVLNFLQKKTHDNFWDF"
FT   gene            complement(152221..152655)
FT                   /locus_tag="Tter_0141"
FT   CDS_pept        complement(152221..152655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0141"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   sus:Acid_2826 histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41063"
FT                   /db_xref="GOA:D1CDQ7"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDQ7"
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /protein_id="ACZ41063.1"
FT                   /translation="MGTETKCKFCLISSGESNAKIVYANDFCLGFLDIRPVFPGHVLVI
FT                   PRKHYVTLPDLPNDLVLPLFKAVRTLSEAIPKAMEAEGTFVGINNKISQSVPHLHVHVV
FT                   PRRRGDGLRGFFWPRQKYPNEAAMEEVARKIREAVDAIVN"
FT   gene            complement(152658..152885)
FT                   /locus_tag="Tter_0142"
FT   CDS_pept        complement(152658..152885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41064"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDQ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41064.1"
FT                   /translation="MAEELIASVERSHDLLMEAFRILESVFLKLEEGQRREMSFTDLDA
FT                   LQERLHDAEEYAEDCKETARKAIETIENWK"
FT   gene            153037..154203
FT                   /locus_tag="Tter_0143"
FT   CDS_pept        153037..154203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0143"
FT                   /product="transcriptional regulator, CdaR"
FT                   /note="KEGG: eca:ECA3300 carbohydrate diacid
FT                   transcriptional activator CdaR"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41065"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDQ9"
FT                   /inference="protein motif:COG:COG3835"
FT                   /protein_id="ACZ41065.1"
FT                   /translation="MGMEQDYFREVANTVVKKIGSLLDQQVIVADDRGWVIASTDRRFM
FT                   GKNLDTSPSRRMLHQLRVPIKIRDKCGQLMIIESNKPSVPPRMAEALVEMVINQIMLVE
FT                   SLPNQSDLKNKLIYDLLHGNSSDETSIIRQAQILGMDLNLPRAVLLIDASKYILGGDDR
FT                   QLQQKVNTIIRSIVDFFMLPSDTICGYIGEGEVVVLKASSSRDLANWLRPKEKLDTSPS
FT                   SWANLAALKRAANALLSKLRSETKQPITIGIGRYHPGILGLTASYQDARAALSLGLKFY
FT                   GPNKVHCLDSLGIPAFVGISDERTKNDLATHLLKPLEKYPELMQTLEVFFDENCCPTSA
FT                   SKKLCIHRNTLTYRLDKIASLTGLDPRDFDSAVQLRLALTLKASSRNE"
FT   gene            154317..154913
FT                   /locus_tag="Tter_0144"
FT   CDS_pept        154317..154913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0144"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: hpp:HPP12_0857
FT                   phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41066"
FT                   /db_xref="GOA:D1CDR0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR0"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="ACZ41066.1"
FT                   /translation="MTISINNLLQKRQEKLNVAINQLIRDSELLESVANTLIQSLCSNK
FT                   KILICGNGGSAAQAQHMAGELIGRFKKNRAPIAALALGTDMATTTAIANDFGYEEVFLR
FT                   QVDALGNDGDVLLILSTSGNSPNVLAAVNTARRKGLKTVAFTGKKPSKVEDLADIVVRF
FT                   PAEETDVIQELHLLAIHILCEVVEEHLSKEVVDGQ"
FT   gene            154903..155517
FT                   /locus_tag="Tter_0145"
FT   CDS_pept        154903..155517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0145"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /note="TIGRFAM: D,D-heptose 1,7-bisphosphate phosphatase;
FT                   histidinol-phosphate phosphatase family protein; hydrolase,
FT                   HAD-superfamily, subfamily IIIA; PFAM: Polynucleotide
FT                   kinase 3 phosphatase central region; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: D,D-heptose
FT                   1,7-bisphosphate phosphatase; K03273
FT                   D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41067"
FT                   /db_xref="GOA:D1CDR1"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR1"
FT                   /inference="protein motif:TFAM:TIGR00213"
FT                   /protein_id="ACZ41067.1"
FT                   /translation="MGNKAVFLDRDGTLVHPRHYPSRAEDLVLYRGLPEEMRILQQMGF
FT                   KLVVITNQGGIAHGYFTERDLELMHTSLQDQLSEFGVRIDAFYYCPHHPEGNLAHLACE
FT                   CECRKPKPGMILQAAKDMNLDLSSSWMVGDILNDVEAGRKAGCKTILVDLGTESKPSSP
FT                   DRTPDYVARTTKHALQIIQSLEGQRKDVDLDYIPSSWKAAV"
FT   gene            155545..157032
FT                   /locus_tag="Tter_0146"
FT   CDS_pept        155545..157032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0146"
FT                   /product="cytidyltransferase-related domain protein"
FT                   /note="TIGRFAM: cytidyltransferase-related domain protein;
FT                   PFAM: PfkB domain protein; cytidylyltransferase; KEGG:
FT                   nmu:Nmul_A1792 bifunctional ADP-heptose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41068"
FT                   /db_xref="GOA:D1CDR2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR2"
FT                   /inference="protein motif:TFAM:TIGR00125"
FT                   /protein_id="ACZ41068.1"
FT                   /translation="MLKVDIVNNFHKVRALVIGDAMLDSYLEGTASRLCSEGPVPVVTK
FT                   SGEERVPGGAANTASNLRALGAQVMFLGFVGRDANAAYLRTALRRYDIDDGWLVEDPNI
FT                   STIHKMRILADEQYVVRFDEGDTTNYSKSSREELLYKLEQALTKCDVIVVSDYSYGAVS
FT                   EDVTSVIKDFRRTQDIPLLVDSKNIISYGKASATLITPNHHEARAAVGRPASIKPPDIE
FT                   EMMGIGKQLLDCMDCQFIAITMASEGVLLLGQKAEPLHIPAYPIPKASVAGAGDSFLAA
FT                   TALSLAVGADIAEATRIGVENARLAVLKRRTAVVEHRELLLRMSTLDRQSDQPYESLIA
FT                   ELEAARREGKVIVMVNGVFDLLHAGHVNLLRKAKELGDLLVVAINSDKSARRLKGPNRP
FT                   INDERHRLELVASLEPVDHVVLFDEDTPIQLIKTIRPHVLVKGADYEGQEIPEAPILQD
FT                   IGTKLVLVPLTENYSTSSLIERILSSAPNQQLTSEVM"
FT   gene            157035..158120
FT                   /locus_tag="Tter_0147"
FT   CDS_pept        157035..158120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0147"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   tbd:Tbd_0742 ADP-heptose--LPS heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41069"
FT                   /db_xref="GOA:D1CDR3"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR3"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ACZ41069.1"
FT                   /translation="MSIDWLQAKRILIVRLDNLGDVVLATPAIRAIKETLPECQITLLA
FT                   SPVGAQVAEVNPDIDSVIIYSAPWMDPWQRLPQDSAREMKIIEQIRNHKFDGAIIFTSY
FT                   HQSPLPAAYLCYLADVPLRLGSTSDGAGSLLTTRHKPPTTLIHEVERGLELVSAVGFSG
FT                   TQDDLVIEVPSAFRRAVRGWLEDMSIKSPESPLVVIHPGCSMPARTYPWQSYAQVADLI
FT                   KIEMGAEVVFTGAETELDLLTHIKSRMATEPKLFYGRSLPELCALIEHADLVITNNTGP
FT                   MHLAAALKTPVVALFALTNPPEQWRPWKVPHKLLFHEVDCRICYSRICPFEHECLAPVS
FT                   PQEVLQASIDLLQGSAQRRIA"
FT   gene            158117..159163
FT                   /locus_tag="Tter_0148"
FT   CDS_pept        158117..159163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0148"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   eba:ebA6912 ADP-heptose--LPS heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41070"
FT                   /db_xref="GOA:D1CDR4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR4"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ACZ41070.1"
FT                   /translation="MSKWLNVKNLLAVRLDNIGDVVMTGPALRAIKENLPETKITMLLS
FT                   PGGASAAPLLPWIDEVIAWKSLWQDLGDLPFDPARELELVEKLREHAFDGAIIFTSFSQ
FT                   DPHVPGYVCYLAGIPLRAGESKEFGGSVLTHELKSVPDNVHQVERNLRLIESLGFKVRD
FT                   RSLKIFIDEEASLSAHEKLGSMGIRVDEGYVVIHPGASASARRYPVDRFAVIAQELTRK
FT                   GIHVVVTGSDRERLLVEEIANAAPEVKTLVGVTSLSEYAAVLKMAKAVICNNTLPMHLS
FT                   DALRVPVVVLFSGTDEESAWGPRDTRALLMRKPTPCHPCYLFKCPIGQPCLDIPAHEVS
FT                   KAVLRIIS"
FT   gene            159182..160240
FT                   /locus_tag="Tter_0149"
FT   CDS_pept        159182..160240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0149"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   bam:Bamb_5648 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41071"
FT                   /db_xref="GOA:D1CDR5"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR5"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ACZ41071.1"
FT                   /translation="MNHPVALDNIEKIAIFRALFLGDLFFTLPAFRALRERFPNAEITL
FT                   IGLPWAKEFVSRFRHYLDRFLEFPGYPGIIEVDVNPTRTQEFLIQARDYGYDLAIQMQG
FT                   NGTTSNGFVAELGARISLGHAVNGDDRLTISIPFTERPIKNEILRWLDLVSLLGAHSTP
FT                   DLEFPIYPHERARAEELIRPALYNNGPIVGMHMGAKEDIRRWPAQRFGELAKILVKLFD
FT                   ATIVLTGTSQEIGLSKEVEAAVGSNVVNLIGKTDLGTFAAVVSSMDLLVTNDTGASHIA
FT                   AATSTPSVVLFGPTTPEQFGPINQDLHKAVKAYEHVQSYSGSPLWELPVEPVLDACIYM
FT                   LQNYYVKPSTAF"
FT   gene            160254..161198
FT                   /locus_tag="Tter_0150"
FT   CDS_pept        160254..161198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0150"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   tbd:Tbd_0743 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41072"
FT                   /db_xref="GOA:D1CDR6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR6"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACZ41072.1"
FT                   /translation="MRRYKILCWHIHGSYLDALAQIDQDWYLPVTPDRGEGYGGRRPGM
FT                   PPYVREVPAEEVRNLDLDIIICQTPKNFYEDIPAILSPEQQKLPKIYLEHNCPRQHPTD
FT                   TKHPIDDPNVLLVHVTHFNNLMWDSGRTPTMVIEHSVAIDPSIEYVGDRDKGITVINEM
FT                   KRRGRISGYDIFCKARESVPLDTCGIKSEEIGGLGDIKYRDLHRLMARYRFLFSPMRYT
FT                   SLPLAVIEAMTIGMPVIALATTELPTMIQNDYNGYVSCDVEFLIDRMLFLLNNPKEAKR
FT                   LGQNAKCTAQERFNLDRFRRDWNKAFDLVAGGL"
FT   gene            161198..162502
FT                   /locus_tag="Tter_0151"
FT   CDS_pept        161198..162502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0151"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   nmu:Nmul_A1795 phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41073"
FT                   /db_xref="GOA:D1CDR7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR7"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACZ41073.1"
FT                   /translation="MHLAERPKVAFISEHASPAALLGGVDAGGQNVYVDEISRNLGAMG
FT                   ISVDIFTRLDSPESPGVRNWSKGVRIINVPAGPKQHVFRDDLWTLMPEFTRNMLDFIKR
FT                   NNIRYDLIHSNFWMSGWAATKLKHRANIPMIHIFHAMGKTKRKHQGDMDTSPTERITIE
FT                   QLVASEADYLIAQCPSEKLELTEDYGVDPAKVVIIPSAVNIERFRPIGKEAARTLIGLD
FT                   WRGPVIGYVGRIIPRKDVRNIVLALHKVITNKPDLNPLLMLVGGETREPDPKATPEIGV
FT                   LQSMILELGLQDRVIFIGKRQPDELYAYYSAADLIVTTPWYEPFGLTPLEAMACGRPVI
FT                   GSNVGGIAFTVSDGETGYLVPPKSPETLAARIIELLDKDDLRERMGSNARHRVVKLFTW
FT                   ERAAELTAQLYVKALSKKLHIANTDYRKESDYEYR"
FT   gene            162489..163232
FT                   /locus_tag="Tter_0152"
FT   CDS_pept        162489..163232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0152"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: nmu:Nmul_A1794 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41074"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACZ41074.1"
FT                   /translation="MNTDRTHIRTVIITGAGSGLGEATACTFAQDGFNVACLDINEQAA
FT                   QNVANRLNENGAKAIAIRCDVSKEDDVFSAVQKTFDTFQRIDVVVNCAAVDHTLSVSDM
FT                   TIAQWDQVISVNLRGPFLIAKAVLPIMKSQKYGHIVNIASTAATRAWANAAAYHASKWG
FT                   LRGFSRALGVEGRPDNIRVTNVIPGGMKTHFFDRFVEQGIPMPDPANLQDPANVAKVIL
FT                   FAVNMPEESCMQEVIVTPLTETSWP"
FT   gene            163262..164305
FT                   /locus_tag="Tter_0153"
FT   CDS_pept        163262..164305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0153"
FT                   /product="GHMP kinase"
FT                   /note="PFAM: GHMP kinase; GHMP kinase domain protein; KEGG:
FT                   sus:Acid_0418 GHMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41075"
FT                   /db_xref="GOA:D1CDR9"
FT                   /db_xref="InterPro:IPR001174"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014606"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR9"
FT                   /inference="protein motif:PFAM:PF00288"
FT                   /protein_id="ACZ41075.1"
FT                   /translation="MQETIFSRAPFRISFAGGGTDLPEYYEKYEGVVLSTAIDKYCYTI
FT                   LRQSLDDSFHLKSAIDGIVWECFQGIPKIYTEDRLAIQKSAIATCYEGKQALDIFTTSE
FT                   IPSGTGLGSSSALAVSVLQALLTSSNVPYSKYDLAEAACRLEIDVLRSPIGKQDQYASA
FT                   FGGLNLIWFYRNETLVEPMQIAPERLRLLEDNLLLFYVGGTRKASEILREQKQATQSNM
FT                   QTLDHLHQLKQLALDMANSLRRGQMNEFGSMLHHAWELKKGLSDKISNPHIDEIYQLTL
FT                   KLGALGGKLAGAGGAGFLMLYVPQTSQPKIKDKLEAFGVREMPFSFDFEGACLLKSGWF
FT                   IVRSNQR"
FT   gene            164302..164919
FT                   /locus_tag="Tter_0154"
FT   CDS_pept        164302..164919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0154"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: sus:Acid_2237
FT                   sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41076"
FT                   /db_xref="GOA:D1CDS0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDS0"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="ACZ41076.1"
FT                   /translation="MIDTIKDYWNGITGSIRKVDLKAIEAAAWEIISCHNSGNNIYIVG
FT                   NGGSAATASHFACDLSKGARVPGQTPFRVLSLTDNMSLVTAWANDSSFEHVFAEQLRPM
FT                   IRQGDLLIVISASGNSPNVVFAAQVARDLGARVLGLTGKDGGKLRNIANLTITVPTEHI
FT                   EQVEDAHLVMAHCICFSIREYLTNKTIKIEDSALQQVFQANI"
FT   gene            165097..166095
FT                   /locus_tag="Tter_0155"
FT   CDS_pept        165097..166095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0155"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel; AP
FT                   endonuclease 2 domain protein; KEGG: vei:Veis_3268 xylose
FT                   isomerase domain protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41077"
FT                   /db_xref="GOA:D1CDS1"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDS1"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACZ41077.1"
FT                   /translation="MGRPVTLFTGQWADLPLEELAKKVSQWGYDGLELACWGDHFEVQR
FT                   ALKEPDYVQSRWEILNHYGLKCFAISNHLVGQAVCDPIDSRHKAILPPHVWGDGDPEGV
FT                   RQRAAQEMMDTARAAAKFGVTQVNGFTGSPIWHLLYSFPPNDFNEIEKGYQEFAERWGP
FT                   IIDVFEQEGVKFGLEVHPTEIAYDFVTTRKALDAIGNREGFGINFDPSHFAHQFLNPVD
FT                   FIEEFADRIYHVHIKDSKKFLDGRKSILGSHLNFGDRRRGWDFVSPGHGDVDFEAMIRA
FT                   LNRIGYNGPLSVEWEDSGMDREWGAQDALAFVRKVDFPASAVAFDAAFARE"
FT   gene            166131..167321
FT                   /locus_tag="Tter_0156"
FT   CDS_pept        166131..167321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0156"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: bha:BH0710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41078"
FT                   /db_xref="GOA:D1CDS2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDS2"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACZ41078.1"
FT                   /translation="MSEQVGFVTMAGQRATSKAPEVGVGMLGYAFMGKAHTNAFKKLPY
FT                   IVYPPPAIPRLVAIAGRNEEAVKEAASRYGYEGYYTDWRQMLDDDRIQLFDNGGPNYAH
FT                   AEPCIAAAQKGKHILCEKPLARNAQEAKAMLDAVNQAGVKAMVGFNYRFVPAVRLAYEM
FT                   IKNGELGEIYHFRAVYLQEWITDPEFPYIWRLDKELAGSGALGDLGAHIIDLGRHLIGE
FT                   VKSVMAMTRTFIPERNDPETGQRRKVEVDDAFEAVVEFENGAVGTLEASRFATGRKNHQ
FT                   VFEINGSKGSIRFNLERLNELEVYRTDAPKHTQGFTDVLVTESYHPFWSNWWPHGHIIG
FT                   WEHTFVHEIAHLLDCIVNDKDIAPYGATFEDGYRNAVICDAILQSAEEGKRVEVTF"
FT   gene            167357..168220
FT                   /locus_tag="Tter_0157"
FT   CDS_pept        167357..168220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0157"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: sus:Acid_2336 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41079"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDS3"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACZ41079.1"
FT                   /translation="MARSRHPLMVTRTLLWRAYMFDLSGKVALVTGASKGIGQELAIAL
FT                   GKAGAAVVANYHTDRRGAEIAVEKVLEAGGNAVAVQGDISSVDQCRMLVSKTVETFGRI
FT                   DIACCHAGITSWGKFLDYTEEAFDAVVNTNLKGTYFTAQAAAREMIKQGGGGRIIITSS
FT                   VTGNQAVHYLSAYAMTKGGLQMLTRNLVLELSPYGITINAVAPGPIVNERNLHDDPEYE
FT                   TKWAKVVPMGRAGYPKDVASAVLFFASDEAEWITGTVLLVDGGWTCYSPTPDFEFVERE
FT                   GRIGTG"
FT   gene            168248..169600
FT                   /locus_tag="Tter_0158"
FT   CDS_pept        168248..169600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0158"
FT                   /product="Glucose/sorbosone dehydrogenase-like protein"
FT                   /note="KEGG: glucose/sorbosone dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41080"
FT                   /db_xref="GOA:D1CDS4"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDS4"
FT                   /inference="protein motif:COG:COG2133"
FT                   /protein_id="ACZ41080.1"
FT                   /translation="MVAQKITFTLALILVLLVTACGGEQQSPTSTQTVISPSPSVAPTS
FT                   PSANNPSSTPTPIAASQSPPTPVATEETTKPSQEPAKETTPNPIPSATQEREVNRNVRV
FT                   GIRQIASGFDQPLFVTYANDNSNRLFVVEKGGKIKFLDGRVFLDITNRVGSGGSEQGLL
FT                   GLAFHPNYRVNRRFFVNYTDLNGNTVVAEFRAIDNGRRADPNSEKVILRQEQPAANHNG
FT                   GMLAFGPDGYLYIALGDGGGANDTYGNGQNLNTLLAKILRIDVDRGNPYSIPKDNPFVG
FT                   RDNARPETWAWGLRNPWRFSFDRQTGDLYIADVGQNQWEEINYQRAGSKGGQNYGWPIM
FT                   EGRHCLSSSQCNQEGLTLPVAEYSHELGCSVTGGYVYRGKRFPALRGKYFFGDYCTGRI
FT                   WSLQRAENSNWVMKEETDTDLSISSFGEDKNGEIYITDLAGGGIYMLVASS"
FT   sig_peptide     168248..168316
FT                   /locus_tag="Tter_0158"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.535 at
FT                   residue 23"
FT   gene            complement(169653..169973)
FT                   /locus_tag="Tter_0159"
FT   CDS_pept        complement(169653..169973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aba:Acid345_1209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41081"
FT                   /db_xref="InterPro:IPR025306"
FT                   /db_xref="InterPro:IPR026363"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDS5"
FT                   /inference="similar to AA sequence:KEGG:Acid345_1209"
FT                   /protein_id="ACZ41081.1"
FT                   /translation="MVYADKTLTCKDCGATFVFTQGEQEFYASKGLMNEPSRCPDCRRA
FT                   RRAAQNGSSYSNSGPREMYEVTCDSCGRVARVPFQPKGNRPVYCSDCYRQQRESRSSGY
FT                   GY"
FT   gene            170251..171702
FT                   /locus_tag="Tter_0160"
FT   CDS_pept        170251..171702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0160"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   afw:Anae109_2921 D-lactate dehydrogenase (cytochrome)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41082"
FT                   /db_xref="GOA:D1CDS6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDS6"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ACZ41082.1"
FT                   /translation="MNREQLIKKLVTIVGPQGVVHDREQLRTYECDGLANYRAIPTAVV
FT                   LPETTEQVQAIVKLCHRHKIPFVARGSGTGLSGGAMPVEEGILISLSRMRRILEVDIPN
FT                   QRVVVEPGVINLWVTQAVSQYGYYYAPDPSSQLICSIGGNVAENSGGAHCLKYGFTTNH
FT                   VTGLEVVLPDGEIIHIGGKALDTPGYDLVGTVVGSEGTLGVVTKITLRIVRKPEMVSTL
FT                   LAAFATIEQAGAAVSQIIASGIVPAAVEMMDPLSIEAVEAAVHAGYPKAGAVLIVELDG
FT                   PLLEVEDQFNKVKDICLHNGSTEIRIARNEEERVLIWKGRKSAFAAVGRISPNFYVQDG
FT                   VIPRTALPDVLREIEEISAQSGIRVANVFHAGDGNLHPLVLYDASIPGQEEKAEQVAGE
FT                   ILSICLRYGGSITGEHGVGVDKKKYMPKMFSEEDMNAMHMLRCAFDPEGICNPGKVFPT
FT                   PRLCGERPGPGKIHPLQEAGLAEIF"
FT   gene            171702..172967
FT                   /locus_tag="Tter_0161"
FT   CDS_pept        171702..172967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0161"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   ade:Adeh_2866 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41083"
FT                   /db_xref="GOA:D1CDS7"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDS7"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ACZ41083.1"
FT                   /translation="MAILDITDKLPNIEIENTPTNIDGVQPEYIAKPESPTDTVEILKY
FT                   AHQKGIGVIPFGSGTKLGWGNPPQRCDLLINTAKLDKIIEYSPDDLIVKVQAGIKLEEL
FT                   QQELRKHNQMLALDPPEKSATIGGIIAANASGPRRLRYGTTRDLLIGITVALTNGDLVH
FT                   GGGKVVKNVAGYDLCKLFTGSLGTLGVIVEAVFRLHPLPTKSFILKVNLKDLDQAEQCI
FT                   QQVLNSYLVISALEAHCSSTGEVSLWCMVEGSSENIARSAAGALRQILSNYGDCQVFDL
FT                   EEDPAVYNNLRQYPWEADDLGIKFSSTISRLKPIAMLARSTSQRHGCEFELRSHAGSGI
FT                   TYLAVKGGKNLPVDAQVSLIQSIREALTSEDSAMVLEASLPLKQRIDVWGYAGDALPLM
FT                   KRIKDQFDPAKILSPGRFVGGI"
FT   gene            172968..174311
FT                   /locus_tag="Tter_0162"
FT   CDS_pept        172968..174311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0162"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224 cysteine-
FT                   rich region domain protein; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; KEGG: acp:A2cp1_3045 protein of
FT                   unknown function DUF224 cysteine-rich region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41084"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDS8"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ACZ41084.1"
FT                   /translation="MIRITDRSKGNLGNTTIKPAFDSHEPPSRELIDDCIHCGFCLPTC
FT                   PTYLLWGEEMDSPRGRIYLMKAALNGDPLTDSMVLHWDLCLGCMACVTACPSGVKYDRL
FT                   IEDTRYQVERRYPRALADRAFRKLIFEIFPHPNRLRAILPLLLFYRHSPLSKVLESRLL
FT                   SKLIPSRLRNLLELAPEVDPSQFSYKYPEKIPAKGKRRAKVGLITGCVQRIFFSHVNRA
FT                   TINVLSAEGCEVYIPRSQGCCGALALHSGNKDAARDFARSLINAFEGLDLDYIVINAAG
FT                   CGSTLKEYALLLQKDAIYRDRAKEFAGKIVDVSELLVKLGPVAKRHPLRIRVAYHDACH
FT                   LRHAQGIRKEPRELLTSIPELELVEPPEADICCGSAGIYNLLNPEAARELGERKLKNIS
FT                   STGAKYVASANPGCTLQISSIAQLHNQSFHIAHPVEYLEASILGKGIP"
FT   gene            174340..175530
FT                   /locus_tag="Tter_0163"
FT   CDS_pept        174340..175530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0163"
FT                   /product="Alanine--glyoxylate transaminase"
FT                   /EC_number="2.6.1.44"
FT                   /note="PFAM: aminotransferase class V; KEGG: ade:Adeh_2994
FT                   alanine-glyoxylate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41085"
FT                   /db_xref="GOA:D1CDS9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDS9"
FT                   /inference="protein motif:PRIAM:2.6.1.44"
FT                   /protein_id="ACZ41085.1"
FT                   /translation="MTVGIQPRTITVPKRLLLGPGPSELDPEVARALSLPSLGHLDPAM
FT                   VEIMQDIKRLLQYTFVTRNEATLAVSGTGTSAMETALANVIEPGDKVLVGIMGYFGDRL
FT                   AQITAKLGGQVIRVEAEWGKAIDPDMIIARIKEVTPQVVCLVHAETSTGVVQPEIEHIS
FT                   SAAHEVGAVLVVDTVTSLGGQPVKVDDWGIDVCYSAGQKCIGAPSGLSPITFGELALDK
FT                   INKRTTPVSSFYLDLNLLRNYWDSQQYHHTISAPLVYALHTALDKIQQEGLENRWKRHE
FT                   INQRAFLAGVEALSLDLLAEKDHRLNTLITIKTTEDIAERTIRQELLNDYSIEVGGGIG
FT                   PFQGKLLRIGLMGYGSRREFIIQLLAALESILRKHGRPVPEGCSVAAAMKVYETAL"
FT   gene            175546..176451
FT                   /locus_tag="Tter_0164"
FT   CDS_pept        175546..176451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0164"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: sde:Sde_2639
FT                   fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41086"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDT0"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACZ41086.1"
FT                   /translation="MSSNNQVYGGIEAGGTKFVCAVGTGPDDIRSSITFPTTYPEETLE
FT                   KAVSFFRQATKGLTLVAIGIASFGPVDPNPLSPTYGYITSTPKPGWANTNFAGYIRESL
FT                   GVPVGFDTDTNVAALGEHRWGAAVGLETFIYLTVGTGIGGGGLVNGKLIHGMLHPEMGH
FT                   LAIPHDKEEDPFEGWCKFHKDCLEGLASGPAIESRWGVRGENLPADHPAWQLEAKYLAF
FT                   GLVNYIYTLSPQRIIMGGGVMQQSHLFPLIRQRVQHLLNGYIQADDVLQRIDQYIVPPK
FT                   LGTRAGVLGAIALAQDTVGD"
FT   gene            complement(176457..176533)
FT                   /locus_tag="Tter_R0003"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(176457..176533)
FT                   /locus_tag="Tter_R0003"
FT                   /product="tRNA-Leu"
FT   gene            176576..177094
FT                   /locus_tag="Tter_0165"
FT   CDS_pept        176576..177094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0165"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: sil:SPO1634 shikimate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41087"
FT                   /db_xref="GOA:D1CDT1"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDT1"
FT                   /inference="protein motif:PRIAM:2.7.1.71"
FT                   /protein_id="ACZ41087.1"
FT                   /translation="MQNVNSKHIVLIGLSGSGKSTVGCLLASKMGLPYIDTDREIEKHT
FT                   GMPIEEIFSKFGEGKFRQLESDQINRALKGKRAVVSLGGGAVLLEENRKLIWDLSTVIW
FT                   LQASIETIANRLKHTKEIRPLLAGDDLMRRLENMLQNRERYYSQAHLCIVTDNKSPYTI
FT                   VEEILSFVR"
FT   gene            177168..177686
FT                   /locus_tag="Tter_0166"
FT   CDS_pept        177168..177686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0166"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rru:Rru_A0455 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41088"
FT                   /db_xref="GOA:D1CDT2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDT2"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACZ41088.1"
FT                   /translation="MPEIVASDVVDVYPFCISENRAYYLTLLRTPGLELGNTWQAVHGR
FT                   IKKKESAVQAATRELQEQTGLNPTAVWNIDFVNTFYSPEEDTIYLVPCFGVHVSESAQI
FT                   ELTPMHVNWEWVPPEVAVRRFVWIGQRLALQTLHDEIAGPIAAGLDPNPYLQIPPSLYL
FT                   HGKKRGLIK"
FT   gene            177683..178183
FT                   /locus_tag="Tter_0167"
FT   CDS_pept        177683..178183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0167"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_4809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41089"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDT3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41089.1"
FT                   /translation="MNFGDLVERRIREAQVEGKFKNIKGEGAPIDLQENPFEDPEMRLA
FT                   YKMLKNAGFCPEWIELMKQIDEEISQAERVWENYRFNRQRQIKSAQNVKVVKFAETIRE
FT                   IDRSRNTTLQRLETRWREINSKITYFNAIVPVDSLKKPLISIDKMRESFSREFPLLSRY
FT                   LER"
FT   gene            complement(178190..178354)
FT                   /locus_tag="Tter_0168"
FT   CDS_pept        complement(178190..178354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41090"
FT                   /db_xref="GOA:D1CDT4"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDT4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41090.1"
FT                   /translation="MIADLLYWIGTLLIIGFVFLCVPILFMLIVTAHYYLAEGELRRSF
FT                   RKASEVRRL"
FT   gene            178387..179346
FT                   /locus_tag="Tter_0169"
FT   CDS_pept        178387..179346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0169"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG:
FT                   bcb:BCB4264_A5061 UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41091"
FT                   /db_xref="GOA:D1CDT5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDT5"
FT                   /inference="protein motif:PFAM:PF01040"
FT                   /protein_id="ACZ41091.1"
FT                   /translation="MPYQWHNNFVMKQSKIQTTNRYINSALFKHLYTIIVELRPKQWTK
FT                   NLLVFAGLVFSHNMLSLPALLRSSAAFVIFCAVSSAAYIINDLADVERDRLHPVKRLRP
FT                   IASGLISEPTAISIASLLLICSLIASFLLSWSFALVTVLYFLIVVLYSFYLKNVVLLDV
FT                   FSVASGFVLRAVAGTLVINVTLSSWLILCTLLLSLFLALAKRRHELLLLEEKASVHRQI
FT                   LNEYSRVFLDQLMAVVTSSTIIAYSLYTFSAASLPNDRSMMLTIPFVIYAIFRYLYLIY
FT                   QQNEGGNPETLLLQDKPLLISIVLWGIAVVLILYRPWA"
FT   gene            179343..180560
FT                   /locus_tag="Tter_0170"
FT   CDS_pept        179343..180560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0170"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmA family; PFAM:
FT                   (Uracil-5)-methyltransferase; deoxyribonuclease/rho
FT                   motif-related TRAM; KEGG: bha:BH0687 RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41092"
FT                   /db_xref="GOA:D1CDT6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDT6"
FT                   /inference="protein motif:TFAM:TIGR00479"
FT                   /protein_id="ACZ41092.1"
FT                   /translation="MTRNSVGKMMGINDSPATSIDQTVDLELHDMAHGGRALGRHEGMV
FT                   VFVPFGIPGERVLARIYHKHKRYAEAEIIDIITPSQDRVIPKCPYFGVCGGCHYQHIRY
FT                   DRQLEIKRHIVESLLSRIGGFRDIKVLPTIPSPREYYYRNSARFLCGQQGDLGFTDWRS
FT                   NSFIKVDTCPIMDEKINEVLQHIQGHGLPGENVRVRYSRQKDELVIWPKLSVDLETGQQ
FT                   FHTQVLLGREFRVSATSFFQVNTLQAENLIRIALDELEPLEGKTVVDAYCGVGTFTRFI
FT                   AERAELTIGIEESPSATADFRYNMQGLKAKLIEGRAEKELGRLPNNIDRLLLDPPRTGC
FT                   EPEALETILELAPEKIVYVSCDPATLARDLKVLCSTGAYRLKKVQPVDMFPQTFHIETI
FT                   ASLELL"
FT   gene            complement(180577..180650)
FT                   /locus_tag="Tter_R0004"
FT                   /note="tRNA-Glu2"
FT   tRNA            complement(180577..180650)
FT                   /locus_tag="Tter_R0004"
FT                   /product="tRNA-Glu"
FT   gene            complement(180693..180769)
FT                   /locus_tag="Tter_R0005"
FT                   /note="tRNA-Glu1"
FT   tRNA            complement(180693..180769)
FT                   /locus_tag="Tter_R0005"
FT                   /product="tRNA-Glu"
FT   gene            complement(180826..181626)
FT                   /locus_tag="Tter_0171"
FT   CDS_pept        complement(180826..181626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41093"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDT7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41093.1"
FT                   /translation="MTKAGIGVESNLTYYSRVSAMHVNTYYDLLTAFRLEGCPICRLVR
FT                   LAVDSYLDSLDYEFINDAKVRKDLVVSFGFCKDHAEQWFERPRLLATCILYRDVVAYLG
FT                   YHLHLKRRELFEKRSSRGWNRRLRSSLENIRRLIKSKPVCPVCDFQQEEEHKYLSALLQ
FT                   GFEDESFEEAYMKSHGLCLLHLFLGLDIAAEDSSVSILLIDKALMEQRKHMDLVVQCLQ
FT                   SQSYNSVAAYTPKSSEIYSIVQHLCGDPRLDRKPQIHCEKNTLA"
FT   gene            181692..183632
FT                   /locus_tag="Tter_0172"
FT   CDS_pept        181692..183632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0172"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="KEGG: sat:SYN_03643 cell division protein; TIGRFAM:
FT                   ATP-dependent metalloprotease FtsH; PFAM: peptidase M41;
FT                   peptidase M41 FtsH extracellular; AAA ATPase central domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41094"
FT                   /db_xref="GOA:D1CDT8"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:D1CDT8"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ACZ41094.1"
FT                   /translation="MTNNQTDRPRPPGPESRRFDNNDKNNRNRWGPIPSWAWIVLIVAL
FT                   LLNWLVAPILFPEGKGAVSIPYTSFKQQLENNNVAEVTTQADKITGEFKQAVKVPGVDQ
FT                   PVKRFVTHIPAFGDDQLMSQLDQKGVIVNVQPESSTRSLLLSILISFGPTILFFLLFLW
FT                   LISKAQSSQQGLFGLGKSRAKRYNATESTRVTFDDVAGIEEAKQELAEIVDFLKNPQKY
FT                   QRLGGTIPKGVLLIGPPGTGKTLLARAVAGEAGVPFFSMSGSEFVEMIVGVGAARVREL
FT                   FQQAKKEAPCIIFVDELDAIGRRRGSSINVGGHDEREQTLNQLLVEMDGFDSRQGVIVL
FT                   AATNRPDVLDPALLRPGRFDRRVVVQRPDKVGRLKILQVHTRNVPLDPNLDLSEIAAAT
FT                   PGLVGADLRNLVNEAALLAARRGKNYVDREDFFDALEKITLGAERKLLISEEDRRRVAY
FT                   HESGHALLGLLLPEADPVHKVTIIPRGQALGVTYQTPEDDRYNYTERYLRSRITAALGG
FT                   RAAEELVFGTVTTGAENDLKQVTEIARQMVTRWGMSKEVGLVYLSPDGQEDFLGPNPIT
FT                   SREYSESLATVIDRETRRIIDECYAEALSLLNRERQRLDNLAEALLREESLDEQQIREI
FT                   VGLGEKQPEPA"
FT   gene            complement(183644..184003)
FT                   /locus_tag="Tter_0173"
FT   CDS_pept        complement(183644..184003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0173"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: aav:Aave_2238 response regulator
FT                   receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41095"
FT                   /db_xref="GOA:D1CDT9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDT9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACZ41095.1"
FT                   /translation="MLMKKVLIVDDEAEIVELIVMVLDDGQVQLLTAYDGEQAMRIIKE
FT                   QRPDVVLTDVMMPRLDGRELCKMVKSDPSISDTKVILMSAIHRLDKGDCPADGLIHKPF
FT                   DIVAIVEAVHKFLDQ"
FT   gene            complement(184034..185419)
FT                   /locus_tag="Tter_0174"
FT   CDS_pept        complement(184034..185419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0174"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="PFAM: KaiA binding; KEGG: bxe:Bxe_B0484 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41096"
FT                   /db_xref="GOA:D1CDU0"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU0"
FT                   /inference="protein motif:PRIAM:2.7.11.1"
FT                   /protein_id="ACZ41096.1"
FT                   /translation="MDKISTGIPGFDVLLGGGIPKGSFVLVGGPPGVGKTILVTQMAFH
FT                   HASQGKKVVMLTALTETNAKLIAHLSTLAFFDDALLGNTLQILNIQKLLQEEGLDKTLA
FT                   EIRSTVIEQGVELLVIDSFRSLFTLTGDAAAVQNFIFNLSSALFMLGCTTLMVEDQYRM
FT                   DGFIHPEQAISDTIIHLSLSSLNSSATRKIEVLKMRGGDPIPGKHYFEITPSGIAIYPR
FT                   IESLASKVWPCDTNKRVSWGVAGLDEITGGVPVCSSNLVLGPLGVGKSLLSLQFLAAGI
FT                   REGQRVLFATFYDTLEDLSRRLSSVGVDLEDALNKGNVIAIQFPFSDISADKLVHQIIS
FT                   QLPESSSSRLVIDGFEVVREELDRDGRFMPFVGALAQIMRSRNVTTLITCGDKSMSLWA
FT                   ASPEWAPMDNVLTMDRINLSGELRRVLTIVKMRGIEHDNTVYEFTITPTGIEIKDKVEE
FT                   IGR"
FT   gene            complement(185572..186165)
FT                   /locus_tag="Tter_0175"
FT   CDS_pept        complement(185572..186165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0175"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="TIGRFAM: intracellular protease, PfpI family; PFAM:
FT                   ThiJ/PfpI domain protein; KEGG: pzu:PHZ_c2654 putative
FT                   intracellular protease/amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41097"
FT                   /db_xref="GOA:D1CDU1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU1"
FT                   /inference="protein motif:TFAM:TIGR01382"
FT                   /protein_id="ACZ41097.1"
FT                   /translation="MAGKLEGKKIAFLATDGVEQVELTEPWKAVTQEGAEAHLISIKSG
FT                   EIQGVNGMDKADTFKVDKTVDQVSASEYDALVLPGGVANPDKLRMNQDAVRLVREFVES
FT                   GKPVAAICHGPWTLVEADVVRGRTLTSYPSLKTDIKNAGGNWVDQEVVVDQGIITSRNP
FT                   NDLPAFCAKLIEEVQEGIHEARAQSAGEFTTPQM"
FT   gene            complement(186231..187817)
FT                   /locus_tag="Tter_0176"
FT   CDS_pept        complement(186231..187817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0176"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class I (M); KEGG: metS; methionyl-tRNA
FT                   synthetase protein; K01874 methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41098"
FT                   /db_xref="GOA:D1CDU2"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU2"
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /protein_id="ACZ41098.1"
FT                   /translation="MSGSRYYITTAIPYVNAKPHIGFALELVQTDVLARYHRLIGDDTR
FT                   FLTGTDDNALKNVQAAEAEGISTKELVDRNAELFKALREPLAVSFDDFIRTSGEKRHID
FT                   GVQKLWRACQRSGDIYKRVYKGLYCVGCEQFYSEEELVNGLCPEHLTRPELVEEENYFF
FT                   RLSKYTDRLISIIESGELRILPETRRNEVLSFIRRGLEDFSISRASSRARGWGIPVPDD
FT                   PDQVMYVWFDALGNYITALDYAYDGELYRRYWLENPHRTHVIGKGILRFHAVYWPAMLL
FT                   SAGEPLPTTIYVHEYLTINGQKISKSLGNVIDPISIVERFGTDALRYWFVREVSRTEDT
FT                   DFTWDRLVTRYNADLANDLGNLLNRTVSMIRRYREGKVPSPSDSTDLEQDLRQIAEGIP
FT                   EKIYKYLDEFDLRAAITAIWDLVTRANRYVEESAPWLLARQEKNGDGAASSRLDTVLYS
FT                   LAESLRVIAVHLSPFLPLTSSKILEQLGIGADSQTKWPDVAAWGGLQPGTLVGEPKPIF
FT                   PRVELTTSEIS"
FT   gene            complement(188243..189499)
FT                   /locus_tag="Tter_0177"
FT   CDS_pept        complement(188243..189499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0177"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   pla:Plav_0678 peptidase M16 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41099"
FT                   /db_xref="GOA:D1CDU3"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU3"
FT                   /inference="protein motif:PFAM:PF00675"
FT                   /protein_id="ACZ41099.1"
FT                   /translation="MSVRSNELLGVEKLPNGLTVVGQRMPGVESVAICFHVRTGSRDEP
FT                   QDIAGVSHFLEHMMFKGTTRRSAVDISREFEEMGAEFNAFTWVESTVYYARVLGDQLPR
FT                   AVDLLADMMRPALDEKEFETEKGVIIEEIARSEDQPAHELIHQLFANFFESHPLGNSVL
FT                   GTQDTIRNMPVHRMREYHQRRYGANNIIFGIAGNFDWDKLLPMLEEVTRGWEPSEEGHQ
FT                   KVEFKPTPKVRVDLKPQFQQEHIAIASSAPKQDEDDTWAAELVASVLGDSTGSRLFWEV
FT                   TQKGLVDSIETEYYGFDDAGLYLTYFSTSPDRAEEVLRVVRQEMQKLQQDGVDQDELDR
FT                   AKVKAVADIVIGGEASHRRMFELASLYVAKSKAMSVDEIVDSIESVSQEDIRRVLERYP
FT                   FTETFTVQAAGPLSDLNVS"
FT   gene            complement(189483..190748)
FT                   /locus_tag="Tter_0178"
FT   CDS_pept        complement(189483..190748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0178"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   sus:Acid_7201 peptidase M16 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41100"
FT                   /db_xref="GOA:D1CDU4"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU4"
FT                   /inference="protein motif:PFAM:PF00675"
FT                   /protein_id="ACZ41100.1"
FT                   /translation="MPEQYKDVLPNGLTVLGERLEGVRSLALGFIVGAGSSYDPDDKSG
FT                   LAHFTETMLLEGTTNRTSRQISDSLDSLGVSYGTSLDAETIGLSGVMVSSRLEPALEIF
FT                   ADILQNPSFPEDEMEQTRSSILQELRREEDEPMVKVRDLLRRVYYEGHPYSKRPTGEPD
FT                   VISSLSSADLREYHASYFNPANTVCAAAGDLDWDLFRSLVEKFLGGWKPGTKAPEIGPP
FT                   HPRPQLYVENQQTQQEHIAGAAPSVPFGHDDYYAAIIAAEILGGGMSSRLFVEVREKRG
FT                   LVYSVGASYSPGRYQGSWRIYAGTTPERASQTYSVLMEELHKLDSEGVSEEEFRRFQAL
FT                   TRSHVLMAGESTSARLRSLLTSWWYEGRIKPLSYIRERIDAVTVDQVNKVVREWPLSSN
FT                   LVLCALGPSTKESLVGENVSKV"
FT   gene            complement(190870..191874)
FT                   /locus_tag="Tter_0179"
FT   CDS_pept        complement(190870..191874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0179"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   lpp:lpp1448 spectinomycin phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41101"
FT                   /db_xref="GOA:D1CDU5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU5"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACZ41101.1"
FT                   /translation="MKFRPKDLDHEDLTLFISLIYGLSVVNIEFLPKGEDSWCYKVVTA
FT                   TESFLLQLRRIAEDTALCKFVEHVRMLHDSGFKSAVVPVETLDGCPLAQYGSYCVLLYP
FT                   FIGNGNSLYDKMQPSTLLEEIPLDKVVEIIAELHSTKLLIPTRDIFENPFESRIGNNLR
FT                   AINSSSEGGRIRSMLQELIRENIDDILDTARYTSLLGRILAKDQDDFVLTHGDPNLANF
FT                   IPGDDDRIYLVDWSSISMGAPERDLSSYIDLDWPMFWNVYKSLTGRNRCLLQRFKFYSY
FT                   LWILQEIADYTSRILGTDEILEQEYALDELRPYLPIPHDQINARLDFLARYAV"
FT   gene            complement(191896..192375)
FT                   /locus_tag="Tter_0180"
FT   CDS_pept        complement(191896..192375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0180"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bce:BC2074 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41102"
FT                   /db_xref="GOA:D1CDU6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU6"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACZ41102.1"
FT                   /translation="MKIRRMMQEDIPSVRHVAEVTWHHTYKNIIPEHIRTEFLATAYSD
FT                   KSLNYRMRNNVLLVVEDAGHLVGFAEFTPLQDSSEVELSAIYILPSHQGKGIGTQLLQE
FT                   GIKNFPDAKVIKLRVESRNAPAKSFYLAKGFLPTREYTILIHGYSCEITEMEKHL"
FT   gene            192521..194788
FT                   /locus_tag="Tter_0181"
FT   CDS_pept        192521..194788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0181"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: mmw:Mmwyl1_0214 glycoside hydrolase family 3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41103"
FT                   /db_xref="GOA:D1CDU7"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU7"
FT                   /inference="protein motif:PFAM:PF01915"
FT                   /protein_id="ACZ41103.1"
FT                   /translation="MTRDIKSLIAQMTLEEKASLCSGLGFWDTKPIERLGIPSIVMTDG
FT                   PHGLRKQVPGSQNFFDSVPATCFPTAATIACSWDRSLVREIGIALGEECQAEGVSVILG
FT                   PGVNIKRSPLCGRNFEYFSEDPFLSTELAASYIEGVQSQGVGTSIKHFAANNQEHRRMS
FT                   VNAIVDERTLREIYLASFEGAVKKSKPWTVMCAYNRLNGDYCSENHYLLTKVLREDWGY
FT                   EGLVVSDWGAVNERVKGLEAGLDLEMPGNGGVGDRKIIEAVCSGELSEEVLDRAVERIL
FT                   KLIFQAVDNRKENFRYDADAHHQLARKAARESMVLLKNDNSILPLRKEGTIAVIGAFAK
FT                   HPRFQGGGSSHVNPTRIDIPYDEIQKAVGDSARLLYSDGYQLGSDEVNQSLIEEARQIA
FT                   SQANVALIFAGLPENYESEGYDRVHMSMPRSHLELIQAVSESQPNTVVLLCNGAPVEMP
FT                   WLHDVPAVLECYLGGQAVGSAIADLLFGEASPCGKLAETFPQKLSDNPSYLNFPGEDDK
FT                   VEYREGIFVGYRYYDTKEIEPLFPFGHGLSYTTFEYSDLSVDKKSIKDNEVVNVQVTVK
FT                   NTGKFAGKEIVQLYVSDLASSVRRPEKELKGFEKVELQPGEEKTVNFTLDKRAFAYYNV
FT                   DLSDWYVETGEFEICVGRSSRDIVLTEIIHVDSTQVIPKRYHRNSLIGDLQEDPKAAAL
FT                   FNQMMQQGLANTPFASSGEFNSEMIMALLRYMPLRALVNFSGGAFSEDDLNNLLDQLNS
FT                   AS"
FT   gene            194812..195408
FT                   /locus_tag="Tter_0182"
FT   CDS_pept        194812..195408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0182"
FT                   /product="O-methyltransferase family 3"
FT                   /note="PFAM: O-methyltransferase family 3; KEGG:
FT                   scl:sce1553 O-methyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41104"
FT                   /db_xref="GOA:D1CDU8"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU8"
FT                   /inference="protein motif:PFAM:PF01596"
FT                   /protein_id="ACZ41104.1"
FT                   /translation="MDIKDYFASEPNTPEVLSKILVETDQLGFTMGSDVVTGSLLRALV
FT                   ASKPGGRFLEIGTGTGIATSWLLQGMDQDSILITLEKEDKFASIARKYLGNDPRVTFHL
FT                   VDAGTWLEQNQHEEFDLIFADSWPGKYSHLNEALSILKLGGIYVIDDMLPQPNWPEGHE
FT                   ASVRWLLNELASRSDLVIAKLACSTGLVLATKVTQ"
FT   gene            195622..196911
FT                   /locus_tag="Tter_0183"
FT   CDS_pept        195622..196911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0183"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bha:BH1864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41105"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACZ41105.1"
FT                   /translation="MLCRFKLHLFLVLALVVTACGGGGTASTPQQGSSGNQGKVTIRLS
FT                   TWAGVDESKELQAIIDKLNSKSNTYKIVHEPQPADYYTKLQTTISGGKGPDLMWLSQEY
FT                   VPGYAERGALMDLTQCVQEHSDKPAAKLDDYFESILDVGKFEGKLYALPWISQPVVLYY
FT                   NPKLFKEAGVEEPNENWTWDDFKAAAAKLTNPKKGIYGTAFNGWPPIQMFIWQAGGDVI
FT                   SEDLKHSPIDSPEAIQAEKFYQEIVYNPKYAAPENIIAEQGFADLAKNGKVAMFFGGAA
FT                   DDLDYAHAKDPKFAEMKAALVPKGPKSRTTFAWTGLMAINAKTANPEAACQALLDLTDG
FT                   IHHWKVLAPRKSLANKETIIQAVPEKAKSADVIIKAAQDMRTFRVVPQQSEWDTTFSEK
FT                   FLDPLFHRKGTPEELAKKVRPELEAILQGP"
FT   sig_peptide     195622..195702
FT                   /locus_tag="Tter_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.711 at
FT                   residue 27"
FT   gene            196956..197948
FT                   /locus_tag="Tter_0184"
FT   CDS_pept        196956..197948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0184"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rlt:Rleg2_4016
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41106"
FT                   /db_xref="GOA:D1CDV0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDV0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41106.1"
FT                   /translation="MLSDYARTLADYLIAAALIGSAMYLTYNILRKFGVKPETASGYTL
FT                   IVPWLLGFIIWTAYPILASLYYSFTDFNGLQPPRWVGLENYKNLLERGSYFWPSLRMTL
FT                   LYGAISLPIGLTLALLIAMVLAREDVRFIGFWRTMFYLPAVIPTVATLVLWIWLLSTNG
FT                   LVNQILSPIYNLIGMEKPSWFTDPTYALPGLIIMSLWGVFGANTVILLAGIKNIPRELY
FT                   EAVAIDGGGAWAKFWHVTLPMVSPTLFYTLVLGIIGAVKTFEPGVFINLPRATGTFLQV
FT                   LVYQYAFGTRALMGYASALSWLMLLIILILTALVFRSSALWVYYEGERR"
FT   gene            197953..198858
FT                   /locus_tag="Tter_0185"
FT   CDS_pept        197953..198858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0185"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH1866 sugar transport
FT                   system (permease) (binding protein dependent transporter)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41107"
FT                   /db_xref="GOA:D1CDV1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDV1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41107.1"
FT                   /translation="MATTTTARTSAAEKPTYLYKVQSLAVKVLVYMVLLLGLSIVIIPI
FT                   YWMIATSLKTDTALFLIPPQWFPDPIQWSNYIEVWQLVPLARYFANSVFVTLLAILGEI
FT                   ITSALVAYGFARFRFPGRGVLFSIMLATMMLPSIITLIPSFIIWARWLGRYDTYSPLTV
FT                   GSLFAWGPAYIFLLRQFFLTIPRDIEEAAIIDGGNLLQIFGYVMLPLVRPALLAITILS
FT                   FTGNWNNFLSPLIYLSTPEKFTLPLGLYQFNKSLAGGSEAPKWNMMMAMAVLMTIPIIV
FT                   LYFRAQRYFIEGITVGAVKG"
FT   gene            199425..201155
FT                   /locus_tag="Tter_0186"
FT   CDS_pept        199425..201155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0186"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein TPP
FT                   binding domain protein; thiamine pyrophosphate protein
FT                   domain protein TPP-binding; thiamine pyrophosphate protein
FT                   central region; KEGG: scl:sce3730 acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41108"
FT                   /db_xref="GOA:D1CDV2"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDV2"
FT                   /inference="protein motif:TFAM:TIGR00118"
FT                   /protein_id="ACZ41108.1"
FT                   /translation="MAITIDKPKIEETKKKETKKLSGARIMCEALVNEGVEIIWGYPGG
FT                   AIMPFYDVLPEYPSIHHVLVRHEQGAAHAADGYARVTGKVGVCVATSGPGATNLVTGLA
FT                   TAYMDSVPIVAITGQVARPFIGHDSFQETDIVGITLPITKHNFLVTSADSLGEVIHEAF
FT                   RIAREGRPGPVLIDVPKDVQFEEGEYTPPEKTWEERNSDNGSAYTDEYIRAARIIDSAQ
FT                   RPLIMAGHGIIISKAYDELRAFAEKTGIPVITTLLGLSAFPENHPLALGMPGMHGPAHV
FT                   NLAIDEADLIVGVGLRFDDRVTGNLKEFAPNARFIHIDIDPAEIGKNIKPEVGIVADAK
FT                   EALAKLTELVSKKEHSGWLEEIKRREKPERSVMKTTKISPYDVLKAIKKATNGEARIVT
FT                   DVGQHQMWAARFYGWEKPNSHISSGGLGTMGYALPAAMGVKAGCPEDPVWVVAGDGGIQ
FT                   MNIQELGTIVQENLDIKVAIINNGYLGMVRQWQEFFHNRNYSETRISSPDYSLIATAYG
FT                   AKGRRVTRKEDVEAAVEWAMSQPGCVILDFEIEQEANVYPMVPSGGSVKTMILDPEANE
FT                   "
FT   gene            201152..201676
FT                   /locus_tag="Tter_0187"
FT   CDS_pept        201152..201676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0187"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="TIGRFAM: acetolactate synthase, small subunit; PFAM:
FT                   amino acid-binding ACT domain protein; KEGG: sfu:Sfum_3022
FT                   acetolactate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41109"
FT                   /db_xref="GOA:D1CDV3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDV3"
FT                   /inference="protein motif:TFAM:TIGR00119"
FT                   /protein_id="ACZ41109.1"
FT                   /translation="MSTQGRTLVALVQDHPGVLTRISGLFRRRNFNIESLAVGHSEKPG
FT                   VSRMTIVVNGDASEVDQVVKQLSKLIEVIEVKDISEGAPLLRELALIRVAVDGTKRTEV
FT                   TELAKLFGAKVIDISHHSITLEMTGSESKVDSLVRLLEPFGITEMVRTGRVAMARDMAD
FT                   TSSAERSAISA"
FT   gene            201699..202706
FT                   /locus_tag="Tter_0188"
FT   CDS_pept        201699..202706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0188"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="KEGG: scl:sce3732 ketol-acid reductoisomerase;
FT                   TIGRFAM: ketol-acid reductoisomerase; PFAM: Acetohydroxy
FT                   acid isomeroreductase catalytic domain protein;
FT                   acetohydroxy acid isomeroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41110"
FT                   /db_xref="GOA:D1CDV4"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDV4"
FT                   /inference="protein motif:TFAM:TIGR00465"
FT                   /protein_id="ACZ41110.1"
FT                   /translation="MAQVYYDADADINVIKDKLIAIIGYGSQGHAHALNLHDSGCNVIV
FT                   GLHEGSKSAEKARNDGLEVRSVAEAAEAADIIMMLIPDTIHKKVYEESIAPAMRAGKTL
FT                   MFAHGFSIHYGQVKPPAEVDVVMVAPKSPGHIMRNLFTQGIGVPALLAVYQDASGQAEQ
FT                   TGLAYAKGLGCTRAGVLKTTFKEETETDLFGEQTVLCGGVSALIKAGFETLVEAGYQPE
FT                   IAYFECLNEMKLIVDLIYQGGLSYMRYSISDTAEYGDYVAGPRIIDEHVRENMKQILKE
FT                   IQDGSFARRWIEENEKGRPEFEKMREQDRNHLIEQVGQKLRAMMSWTQPQPANR"
FT   gene            202742..202885
FT                   /locus_tag="Tter_0189"
FT   CDS_pept        202742..202885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41111"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDV5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41111.1"
FT                   /translation="MTQYSYMWQDAQEFASMIWASLTETQQQEEDQDQEAECTQAIAWC
FT                   YE"
FT   gene            202895..204076
FT                   /locus_tag="Tter_0190"
FT   CDS_pept        202895..204076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0190"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   dol:Dole_2041 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41112"
FT                   /db_xref="GOA:D1CDV6"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDV6"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ACZ41112.1"
FT                   /translation="MSEIVRIFDTTLRDGEQSPGVNLSAHEKVLIAEQLVRLGVDIIEA
FT                   GFPISSPGDLEAVRQVANTVKGVVVAALARANKADIDAAWEAVKGAEQPMIHTFISTSD
FT                   LHIHYKLRKTRDEVLEAAEQAVRYAKQFTEEVEFSAEDASRTDPDYLCKVYEVAINAGA
FT                   TVINVPDTVGYAEPNEFSALIRTLYERVPNIHKAVVSVHCHDDLGLATANTLAAIREGV
FT                   GQVEVTINGIGERAGNTSLEEVVMALATKPAAFNNRKTRINTRELVPTSKLVSQLTGMV
FT                   VQPNKAIVGANAFAHEAGIHQDGVLKNPLTYEIMTPESVGWQNSKIVLGKHSGRHGFAS
FT                   RLSEMGIQLSPEELDIAYNQFKRLTDERKHITDDDLVNLIKSVRASRQEVSIT"
FT   gene            204102..205070
FT                   /locus_tag="Tter_0191"
FT   CDS_pept        204102..205070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0191"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase class IV; KEGG: plu:plu3042
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41113"
FT                   /db_xref="GOA:D1CDV7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDV7"
FT                   /inference="protein motif:TFAM:TIGR01122"
FT                   /protein_id="ACZ41113.1"
FT                   /translation="MTVKAEQKPKPIPTDLETNWCYFKGEIMPLADAKVSVATHALNYG
FT                   TACFEGIRAYWNDNQQQMYVLKMREHYQRFLRNCGLIKIKLNQTVEDLCNITLEVLRKN
FT                   QYKQDVYIRPLAFKATPTIKLMLSGLEDEVTIYTFPMGNYVDISSGLNVSISSWQRIND
FT                   NAIPARGKICGAYVNSALAVDDALQAGFDEAIFLTKDGNVSEGSSCNLFIIRGKELITP
FT                   AVTEDILEGITRAAIIELVSAEEDLGLRVIERPIDRSELYQADEVFFCGTGVQVSPVTR
FT                   IDDRAIGNGTPGKFTLEIQKRYFAAARGDNDKYMHWVTPVY"
FT   gene            205133..206254
FT                   /locus_tag="Tter_0192"
FT   CDS_pept        205133..206254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0192"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="KEGG: acp:A2cp1_1886 3-isopropylmalate
FT                   dehydrogenase; TIGRFAM: 3-isopropylmalate dehydrogenase;
FT                   PFAM: isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41114"
FT                   /db_xref="GOA:D1CDV8"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDV8"
FT                   /inference="protein motif:TFAM:TIGR00169"
FT                   /protein_id="ACZ41114.1"
FT                   /translation="MSKAYNIAVLPGDGIGQEVVPEAVRVLKAIADIYGHSFQFEEMLV
FT                   GGAAIDAYGTPLRDEDLEKCKQADAVLFGANGGPKWDNPKAEVRPEQALLWLRKGLELF
FT                   ANLRPVKVTDSMLDASPLKPELVKGVDLVVVRELTGGIYFGQPSKRWEENGQRHAVDTL
FT                   YYSEEEIRRVVRTACDIAMSRRKKVTSVDKANVLSSSRLWREVATEVAQEYPEIEMEHI
FT                   LVDAMTMHIMRAPKSFDVIVTENMFGDILTDEAAMLTGSIGLLPSASLGARVKENGIRP
FT                   GLYEPIHGSAPDIAGKGIANPTATILSAALMLRYSFGLENEASSIEQAVSKALSEGKAT
FT                   ADIVRDGKALSTREMTDVIINYIYENSKSTTGV"
FT   gene            206278..207876
FT                   /locus_tag="Tter_0193"
FT   CDS_pept        206278..207876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0193"
FT                   /product="2-isopropylmalate synthase/homocitrate synthase
FT                   family protein"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase/homocitrate
FT                   synthase family protein; PFAM: LeuA allosteric
FT                   (dimerisation) domain; pyruvate carboxyltransferase; KEGG:
FT                   afw:Anae109_1753 putative alpha-
FT                   isopropylmalate/homocitrate synthase family transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41115"
FT                   /db_xref="GOA:D1CDV9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDV9"
FT                   /inference="protein motif:TFAM:TIGR00977"
FT                   /protein_id="ACZ41115.1"
FT                   /translation="MRQIKIYDTTLRDGSQMEGISFSVEDKLKLTRRLDELGVHYIEGG
FT                   WPGSNPKDAEYFERMKNIPLKNAKLAAFGSTRRAYASVEEDLNLRMLIEAGTPVITLVG
FT                   KSWDMQVHVVLGCSLEENLAMIKDSIAFCKSYGKEVFFDAEHFFDGYKNNPDYAMRCIH
FT                   AAIEAGADAVVLCDTNGGRMPEEIAQAVEKVVEETRAIAATRPFDVGIHTHNDSELAVA
FT                   NTLIAVQKGATQVQGTINGYGERIGNANLCSIIANLELKYGYHTIGREKVKELTSVSRY
FT                   FAEVANMAHDERLPYVGAKAFTHKAGLHVNAVAKSAETYEHLPPELVGNTRRVTISELG
FT                   GRSNVLMKMAQFGLEAHTSSEQVRQVLEEVKRLEKEGFQFEDAEASFELLVLRAQPDYE
FT                   PPFRLLDFMVVSESRNGGEFLSEATVKIKVGNEVMHTAADGDGPVNALDRAMRKALAPF
FT                   YPELDPVHLTDYKVRVLDNESGTAATVRVWIQSTDGKSTWNTVGSSTNIIEASWLALAD
FT                   SLEYPLRSISKRRLR"
FT   gene            207908..209317
FT                   /locus_tag="Tter_0194"
FT   CDS_pept        207908..209317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0194"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: bha:BH3056 isopropylmalate isomerase large
FT                   subunit; TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41116"
FT                   /db_xref="GOA:D1CDW0"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW0"
FT                   /inference="protein motif:TFAM:TIGR00170"
FT                   /protein_id="ACZ41116.1"
FT                   /translation="MAPRTLAEKVWEDHVVRRSPGEPDLLYIDLHLVHEVTSPQAFEGL
FT                   RLAGRKVRRPDLTLATMDHNVPTTGLQFGITDPISRAQVEALKKNCADFGIRLFGMGDP
FT                   RQGIVHVIGPEQGLTQPGMTIVCGDSHTSTHGAFGALAFGIGTSEVEHVLATQCLWQRK
FT                   PKMMAIEVNGELPIGVTAKDIILGIIEKIGVDGGNGHIIEYRGDTIRSLSMEQRMTICN
FT                   MSIEAGARAGMIAPDDTTFKYIEGRPHAPKGKAWEKALEYWQSLPTDEGAQFDKVVKLD
FT                   ASQLEPYVTWGTNPGQSVKITGRVPDPSEAKTPAEREAMERALKYMGLEPGTPMTEIKI
FT                   DTVFIGSCTNARIEDLRAAAKILNGRKVAKGVRAMVVPGSMQVKAQAEREGLDKIFKEA
FT                   GFEWRDSGCSMCLGMNPDILEPGKRSASTSNRNFEGRQGPGGRTHLMSPIMAAAAAVAG
FT                   HLVDVREWEVK"
FT   gene            209321..209914
FT                   /locus_tag="Tter_0195"
FT   CDS_pept        209321..209914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0195"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: kpn:KPN_00077 isopropylmalate isomerase small
FT                   subunit; TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41117"
FT                   /db_xref="GOA:D1CDW1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW1"
FT                   /inference="protein motif:TFAM:TIGR00171"
FT                   /protein_id="ACZ41117.1"
FT                   /translation="MKAINKVEGIVAPLDRPNIDTDQIMPKQFLKRIERTGFGPFTFYD
FT                   WRKEPDFILNRPEYQNAKILATGPNFGCGSSREHAPWGLQDMGFDVIIAPSFADIFRNN
FT                   CTKIGLLCVELPEDQVREIIKLALDNPGITGKVDMEAQTVEVGTLRANFNIDPFVKHRL
FT                   LNGLDDIGLTLQHVADIDAYEARRPEFKPVTILS"
FT   gene            complement(209992..211692)
FT                   /locus_tag="Tter_0196"
FT   CDS_pept        complement(209992..211692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0196"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: sus:Acid_0606 dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41118"
FT                   /db_xref="GOA:D1CDW2"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW2"
FT                   /inference="protein motif:TFAM:TIGR00110"
FT                   /protein_id="ACZ41118.1"
FT                   /translation="MSDASTGFDPRHKSRTIVEGRERAGARSMLRAIGWTDEDFHKPVI
FT                   GVAHCWIETMPCNYGHRELAEHVKRGIRDAGAVPVEVNTVAISDGITMGTEGMKASLIS
FT                   REVIADSIELVGRGHMFDAMVILVACDKTIPAGAMALARLDIPGFLIYTGTIYPGKYKG
FT                   RDVNIQDVYEAIGAAAAGKITDEELTELEKVACPGIGACGGQYTANTMATVIEALGIAP
FT                   VGSGSTPQPHPDKKRICYEAGKLVVDQLKRGLKPSDILTRQAFLNGIAAATGTGGSTNA
FT                   VLHLLAIAREAGVELTIDDFNEISENTPVITDLRPSGKYTAVDVYEAGGIELILKRLIE
FT                   GGKIDGSQLTPTGRTLAEEVANVQERKPGQQVILSLDNPKSPVGGLVILKGNLAPEGAV
FT                   VKIAASGRTYHKGPARVFDCEEDAMDAVINKQINPGDVVVIRYEGPKGGPGMREMLGVT
FT                   SAIVGEGLGDSVALLTDGRFSGATRGLMVGHVSPEAAVGGPIAALREGDIVTIDLDNKK
FT                   LEVDLPQEVITARMQEWKAPAPRYTSGVFAKYAALVSSASEGAVTKAFL"
FT   gene            211854..212372
FT                   /locus_tag="Tter_0197"
FT   CDS_pept        211854..212372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41119"
FT                   /db_xref="GOA:D1CDW3"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41119.1"
FT                   /translation="MSSPPDGIELSHWEERRSIHSRANPTPLIILSLIIIVSLSGILGP
FT                   MRHRATSQNNTSVLEIEGPRFIRTGEIFEMRIHITPRTELKNTVLSVSADLWKDMTINT
FT                   MSPAPQEESSENGNFRFLFGNLSSNKEFLVKVDLQINPSLRGQNHGTIRLLSNGAEINR
FT                   VDYSIMVWP"
FT   gene            212374..212868
FT                   /locus_tag="Tter_0198"
FT   CDS_pept        212374..212868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0198"
FT                   /product="protein of unknown function DUF421"
FT                   /note="PFAM: protein of unknown function DUF421; KEGG:
FT                   psb:Psyr_0769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41120"
FT                   /db_xref="GOA:D1CDW4"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW4"
FT                   /inference="protein motif:PFAM:PF04239"
FT                   /protein_id="ACZ41120.1"
FT                   /translation="MDIVIRATVIFWGLYILIRLLGKRELAQMTPFELIVLVVMGDLIQ
FT                   QGITHNDFSLTGALIAITTFGFWAASISWATYLSRRFEQFFDGKPIVIVRDGRYIEPNM
FT                   RNARVTRSEVESEMRLAGIANISNVAWAIIEPKGRISFIQSQGDQQSQQSQSEEDMAGT
FT                   M"
FT   gene            212889..213224
FT                   /locus_tag="Tter_0199"
FT   CDS_pept        212889..213224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0199"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41121"
FT                   /db_xref="GOA:D1CDW5"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41121.1"
FT                   /translation="MNSNPKVTRWPGDTPPTDEQIQQIMRRENLPFYTWSNSPGDVYAP
FT                   HSHSYHKVLYVAKGSITFGFPETQTKIEMHPGDRLDLPPGIVHDAIVGSEGVVCIEGHR
FT                   YDTGKES"
FT   gene            213227..213412
FT                   /locus_tag="Tter_0200"
FT   CDS_pept        213227..213412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0200"
FT                   /product="zinc finger C2H2-type domain protein"
FT                   /note="PFAM: zinc finger C2H2-type domain protein; SMART:
FT                   Zinc finger, C2H2-like; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41122"
FT                   /db_xref="GOA:D1CDW6"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW6"
FT                   /inference="protein motif:PFAM:PF00096"
FT                   /protein_id="ACZ41122.1"
FT                   /translation="MQQDHKYKCDVCHSMFRTLEELEEHGRQAHEVSSPDYPCPTCNKK
FT                   FATLEELEKHRKNYHP"
FT   gene            213495..214469
FT                   /locus_tag="Tter_0201"
FT   CDS_pept        213495..214469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0201"
FT                   /product="Acetyl xylan esterase"
FT                   /note="PFAM: Acetyl xylan esterase; KEGG: mlo:mlr6993
FT                   acetyl xylan esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41123"
FT                   /db_xref="GOA:D1CDW7"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039069"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW7"
FT                   /inference="protein motif:PFAM:PF05448"
FT                   /protein_id="ACZ41123.1"
FT                   /translation="MPFFDLSLDELQKYLPPRQEPSDFDNFWNNTLQEARAIPINARFE
FT                   PIDFGLRNVETYDVTFKGYGGQDIKGWLLKPKGQNGKIPCVVEFIGYGGGRGFPIDWLT
FT                   WSSAGYIHLVMDTRGQGSSFLKGDTPDDPDAAIDPQFPGFMTRGILSPTTYYYRRVFTD
FT                   AVRAVEVAKQYPDVDSDKIIVTGGSQGGGITLAVAGLVPDVFAAMPDVPFLCHYRRATE
FT                   ITDSAPYIEISKYCAVHRDKVDQVFSTLSYFDGVNFAARAKCPALFSVGLMDEVCPPST
FT                   VFAAYNHYAGPKEIRVYTYNHHEGGGNYQTLEKIKFLHNLLDE"
FT   gene            214487..215431
FT                   /locus_tag="Tter_0202"
FT   CDS_pept        214487..215431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0202"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   swi:Swit_0704 luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41124"
FT                   /db_xref="GOA:D1CDW8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW8"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACZ41124.1"
FT                   /translation="MNVIGFGWRFPDFPTDGSSFSDFTQQIRENLDVLVSYNYDSAWVA
FT                   DHFIPWPDWQEEDTPTIECLTTISYYSALYPQIKWGSTVFCQSYRNPAALAKAFAQLCA
FT                   LNPGKYIFGIGAGWKEKEYIEYNFPFPKPSVRITQMAEAIQIAKLLWTQSNATFEGKHY
FT                   RIHEATVNPKPDPLPPIMVGGAGEKLSMRVAAQYADWWNLSGGSIETFRHKLEVLRRHC
FT                   EDVGRSYDSIVKSWSSSCVAVADSSSQAERIARSSPFYSEDSAIFGTPDEVARQVEARI
FT                   SSGVQHFQLRFADFPSTRSMELFGREVIPRFLP"
FT   gene            215582..217738
FT                   /locus_tag="Tter_0203"
FT   CDS_pept        215582..217738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0203"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: ppd:Ppro_0502 response regulator receiver
FT                   modulated diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s); TIGRFAM: diguanylate cyclase; PAS sensor
FT                   protein; PFAM: EAL domain protein; PAS fold-3 domain
FT                   protein; GGDEF domain containing protein; PAS fold domain
FT                   protein; SMART: EAL domain protein; GGDEF domain containing
FT                   protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41125"
FT                   /db_xref="GOA:D1CDW9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW9"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACZ41125.1"
FT                   /translation="MLQNEVLIIILLAVLGTATILGISASKRTRTSDKESSKLVSATAL
FT                   THLEACLDAANIPMLIIDQNLSISYASKSLQNLINFVPKALIGASLLELIHREDQETAK
FT                   ELILQQNQAHEVSQADVKLRRAGDGWIRVRAYSGRLPSNLILMLIQDVSLTESLRVQLE
FT                   IEHAKIEIAERVANLGLWERDTSTGQEVWSDQTFKIYGLKPGSLEPSYEYLLRIVHPDD
FT                   RDRVDSAYRDSIKALSAYDVSYRILLPDSSIRVVHSKAQIVKGADSHLLLTGTVQDVTE
FT                   QKVNEESLLRQALHDPLTGLPNRVMLGQQLEKLLASNRSRSIAVLFLDLDNFKAVNDNL
FT                   GHQAGDSLLVAVARRLSANLRPTDFAARFGGDEFTVVVTKVKSIDYVVSIAKRIIESIS
FT                   QPFDIAGERVYTSTSIGIALCSSSEDSASSLLRKADIALYKSKSLGRGTYVIFDQSMEQ
FT                   EASEILELERNLRTAIQNDQFIVHYQPIVDAATGKVEMIEALLRWNSPNGILSPDKFIP
FT                   IAEEVGLINTLGELVLNKACEQTAYLKATTGAKFITSINVSAKQLRQPHFTNNLESMLH
FT                   KYDLQPKDVQLEITENALVEEVECITNALKEIKTLGIRIAIDDFGTGYSSLSYLRKLPI
FT                   DLIKIDQSFVKMLPNDEEHRAIIYTIISLACSLDLEIIAEGVEEKSQREILLSMGCKFI
FT                   QGNLISHPVDLESIKLILGHTSPK"
FT   gene            217848..218909
FT                   /locus_tag="Tter_0204"
FT   CDS_pept        217848..218909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0204"
FT                   /product="glycosidase PH1107-related protein"
FT                   /note="PFAM: glycosidase PH1107-related; KEGG:
FT                   nha:Nham_4368 glycosidase, PH1107-related"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41126"
FT                   /db_xref="GOA:D1CDX0"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDX0"
FT                   /inference="protein motif:PFAM:PF04041"
FT                   /protein_id="ACZ41126.1"
FT                   /translation="MLEEETLFKVERLGIIMSPDPNIPEEVEGVLNPAAVRGRDGELYL
FT                   FPRVVGRGNYSRVGIARVIFDDDGLPTSVERLGYALEPKEWYELRPEENTGGCEDPRVT
FT                   YIQAIDMFVMAYTAWGPGGPRIAIAVSEDLFHWERLGLLNFEPDPDPVYLVDFDDYHNK
FT                   DAAYFPLPVLDPDGKESLAVLHRPVYDEEDVPKTILDPRPSIWVSFCSLEEVRKDLKAL
FT                   QVVRKHKVVIDPEYEWESLRIGGGTVPVMTQFGWMHVYHGVSESGDSTTGRKYCAGLLF
FT                   LDKEHPEKTIFRTDRPILEPQMDEEKSGVVPHVVFPTGIDDRGNGQYDIYYGMADTRIG
FT                   VARLTLPERLPAN"
FT   gene            218948..220381
FT                   /locus_tag="Tter_0205"
FT   CDS_pept        218948..220381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0205"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mno:Mnod_3288 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41127"
FT                   /db_xref="GOA:D1CDX1"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDX1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41127.1"
FT                   /translation="MFVDTSRELLRESRFPRISSRFGGDSVTTLLSRTLLPTYFFLLLL
FT                   YSNTPSGHPAAQISEMYRAVLHTPYIPMTTMLFRISHILIMLCLWSSYIAKIRTLSYEN
FT                   SRENWILAIAVTLLAVLTPPVTSRDVFYYSISGEVTSIYKMNPYSTPPSALPASPLYGY
FT                   ADWKFLTFPYGPIWTVICGAVVFISGTGPFASTFTFKILCGSTVLLSAFLIQKISSKIS
FT                   LQPSHKAAMLYAMNPIVLVEAAVNAHLDAFIALLLVLTVLLLISNRKLPGYLALCASAL
FT                   IKPTTVPLLGFFVAARMQEESKLLSKVFQLAKYLIVAAILAFITYYPFWHGAETFGFLS
FT                   SERFSPSGLIPLAVVAIMFFRKFALPWAATTSALASLALVYWSLRKGFELLLGKARGYR
FT                   KEVLIWGTFMFLLPVCFYTAYPWYLLPALALLSITQLYSQRYSRLLFLIAACWFTVWTV
FT                   GTLFFMSLPCCQGSPLQGT"
FT   gene            complement(220361..221206)
FT                   /locus_tag="Tter_0206"
FT   CDS_pept        complement(220361..221206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0206"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH3847 ABC transporter
FT                   (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41128"
FT                   /db_xref="GOA:D1CDX2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDX2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41128.1"
FT                   /translation="MSTKPMQLPRIRYSRIIIYLVMIAFAVFYLLPVYLMLITGMKSFE
FT                   EVSISRMWALPSSLSFDSFAAAWERLDVSFLNSIKLVIPATVISSVLGSMNGYVLSKWK
FT                   FKGADTIFTAILFGMFIPYQSILIPLVLTLQKIGLYGSIPGLILTHVVYGIPITTLIFR
FT                   NYYAGIPGELVEAGKVDGAGFFGIYRHIIFPLSVTGFVVVAIWQFTSIWNEFLFGLIIT
FT                   NSPEQRPVTVALQNIAGSQYTLWNVQMAGALLVAIPTLVVYVLLGRYFLRGLLSGALKG
FT                   "
FT   gene            complement(221203..222210)
FT                   /locus_tag="Tter_0207"
FT   CDS_pept        complement(221203..222210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0207"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH3846 ABC transporter
FT                   (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41129"
FT                   /db_xref="GOA:D1CDX3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDX3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41129.1"
FT                   /translation="MAEATTSVVEKSAERAAPKKSLQLNEKLIGILMISPSVIAIAVFV
FT                   YGFIAWTGWVSLSRWRGIVADLSYAGFENYINVFKSYRFQTDIRNTIVFTLFFLLGSLV
FT                   IGLLLAMLVDSRVKGESFFRTVYLFPMALSFVVTGTAWQWLFSPGTPQEPHGLNQLFHM
FT                   FGLHVYQNWSTTSYVWPGGGWRPDWLRIPVGIPVAMIPVIVAAIWQMSGFTMAMYLAGL
FT                   RGIPEDLKEAARVDGASEWQIFRKITLPLLQPITLSAVIVLGHISLKIFDLIITQTGGG
FT                   PGFATDVPGIYMYETTFKSNKYAEGAAVAIIMLLLVSVLIIPYLIYNMRSETER"
FT   gene            complement(222264..223628)
FT                   /locus_tag="Tter_0208"
FT   CDS_pept        complement(222264..223628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0208"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bha:BH3845 ABC transporter (substrate-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41130"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDX4"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACZ41130.1"
FT                   /translation="MRSKISILSIFLIFASILFIACGGQGGTPTASTGGTSQSPSPSPA
FT                   ASAQPTQPANQGSSAGENKLEIFSWWTNPGEADGLKALFEIFKKRRPGVEVINATVAGG
FT                   AGTNAKAVLVTRMRGGDPPDSFQVHAGQELIGTWVVAGKMEPITDLFKQEGWDKVMPKT
FT                   LLDQITYKGEIYSVPVNVHRSNMLWYNIEIFKKNNLQPPKTIDDFFKVAEKLKAKGITP
FT                   LSVGGKDKFEVPHLFESVLLATFGPEDYPKLFKDPSMWENDPRLDKAIDTLNKMLDYAN
FT                   EDRASLSWADAAQRVIDGEAAMTIMGDWAEGYFINKGAKPNKDFGWAPAPGTSGSFLWL
FT                   SDSFGLPKGAPHRENAIEWLKVCGSKEGQDAFNPKKGSIPARTDADKSKYDVYLRWSID
FT                   EFKRDKLVPSIVHGAAANEAYMTDYDNALNLFSANRDKEELKGMLLDAASELQSQ"
FT   sig_peptide     complement(223548..223628)
FT                   /locus_tag="Tter_0208"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.426 at
FT                   residue 27"
FT   gene            complement(223851..224792)
FT                   /locus_tag="Tter_0209"
FT   CDS_pept        complement(223851..224792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0209"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbd:CBUD_1719 hypothetical peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41131"
FT                   /db_xref="GOA:D1CDX5"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDX5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41131.1"
FT                   /translation="MSSIEDTRLFLRSLNLPPGDLYDLPTSTKRFPDGAQYRIEIPSTE
FT                   GPACLHAVIEEAERLGVTIHRVSQGSGVLMLTDDEIDEMASLASAKGMEVSLFARPNAS
FT                   WDTSAMSLASAGGVVSPRARGQDQLIYCLEDIRRAADHGIRSVLLADEGVLWVAAKMRS
FT                   GGELPADMQFKMSVMMASANPASIRLMQDLGADTYNIPTDLTLPQIASIRAAVDIPLDI
FT                   YVEVPDDVGGFVRLYEIPELIRIASPVYIKLGLRNAPNIYPVGKHLESVAVLMSRERVR
FT                   RAKIAVDIIQRYYPDAVQSAAGAKGLAVPRKP"
FT   gene            complement(224795..225640)
FT                   /locus_tag="Tter_0210"
FT   CDS_pept        complement(224795..225640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: smd:Smed_2467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41132"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDX6"
FT                   /inference="similar to AA sequence:KEGG:Smed_2467"
FT                   /protein_id="ACZ41132.1"
FT                   /translation="MGLSEEIREAIVPDGMVSIWWLGQASFVLRTNDQTIYIDPFLSEF
FT                   EGRLIPPPFSPEEAPPASAVLITHDHIDHLDPETIPGLIKNSPEAKFLVPNPISSQLLD
FT                   IGVPSEQIIGVQPEDNVSLGSIAVHVTPAMHGESFPPYAYTFGDPQEGYRFVGYVLEYG
FT                   DTRIYHAGDTIVFDGLADMLRKLNVDVGLLPINGRNYFREKNNLVGNMDEREAVELAAE
FT                   AHISTIIPMHYDMFEPNLGRPDALISYLQRFHPEITCVFLARFQRFNYFKSPQKLPEVQ
FT                   "
FT   gene            complement(225659..228094)
FT                   /locus_tag="Tter_0211"
FT   CDS_pept        complement(225659..228094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0211"
FT                   /product="protein of unknown function DUF608"
FT                   /note="PFAM: protein of unknown function DUF608; KEGG:
FT                   sus:Acid_5570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41133"
FT                   /db_xref="GOA:D1CDX7"
FT                   /db_xref="InterPro:IPR006775"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024462"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDX7"
FT                   /inference="protein motif:PFAM:PF04685"
FT                   /protein_id="ACZ41133.1"
FT                   /translation="MVYSEDELYGMHPQRVFPGSASAVAFPLGGIGTGNVSLGARGELR
FT                   DWEIFNRPAKGFSLPNTYFALWARPEGESPVTKVLQSLPPPPHTQSHGYHPTSGLGLPH
FT                   FTSTLFRGEYPIAWVYFEDSDLPIKVTLESFTPFVPLNAEDSGIPGAYLIYRVENISPK
FT                   RIDVAIAASITNPVGEVRRDRFGGFSVERGGNANDFRRQGRILGLFLRSNSYPLYDLRY
FT                   GDLSLVTMNSHVTFKRVWLPSRWACDSVEEFWRDFSTDGKLEDLGIEDPSEEGQTYTGS
FT                   IAAMETIAPGEVKDFVFILSWFFPNRIKSWDSDAEDLEDVEIVRNHYSRRFSSSWDVAM
FT                   HLARRYDELRSITLSFHDALFNSTLPTHVIDAVASNITVLRSPTCFWLEDGSFMAWEGC
FT                   FDDAGCCAGTCTHVWNYAQTVAFLFPDLERLMRRSELLVETNQEGKMNFRGLTSLGQIW
FT                   DHEAAADGQLGTVIRVYREWKFSGDDAFLKELWPKVKSAVNYSSLYWDKDQDFILEGRQ
FT                   HNTYDIEFYGPNPLTGILFLGALRAAEEMAKYLGSESASSYAQAFEASSKKLDQLLWNG
FT                   EYYIQKLDDPNEHRYQHASGCLSDQLFGQTLASLTGLGYLLPKEHISRALESIFAYNFK
FT                   PNFWNHTNTQRVYALGDDAGLVMCTWPFGDRPSFPFPYSDEVWSGTEYQVATLMIYEGL
FT                   LDEALTIIRATRDRYDGFKRNPWDEVECGHHYARSMASWGLLIALSGFYYDGHSNTMTF
FT                   DPKINKENFACFWSTSKAWGTFSQTTDPQTGNIIPRVEVLYGDAQGMKVLACGQEINL"
FT   gene            complement(228101..229555)
FT                   /locus_tag="Tter_0212"
FT   CDS_pept        complement(228101..229555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0212"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: bsu:BSU02470
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41134"
FT                   /db_xref="GOA:D1CDX8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDX8"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACZ41134.1"
FT                   /translation="MEILAHYIAGEWISSTSEEYKDDVNPSDFGQVLAKIPLGDESTVQ
FT                   RAVEAANNAFKGWKHTPGPGRAEFMHRVANLLAQHRQDVARVVALEVGKPIGEALAEVD
FT                   RGVVILRYYAEEAVHPMGSVIPSQVPGSLQFTVREPVGPLGVITPWNFPVAIPLWKISP
FT                   AIAFGNTVVWKPAETSSMVAVHLMKIFAEAGLPQGVINLVLGSGSKIGKALVASDGIRA
FT                   VTFTGSEGVGMGIAQQAAQRNIKYQLEMGGKNAAIVLPDADLRLAARLIASGAMRYAGQ
FT                   KCTATSRVVVVADVIDSFIDHLTEEVKALPVAPAIDANSAVGPLISEDALSKVSYYADE
FT                   GAKSGEVVLGGKRAQGSLLDRGYFFEPTVIRNVSPDAKVAQEEIFGPVLVVHEAKGLDD
FT                   AINIANNSRYGLSVSMFTRDINAILSYIPNIEAGMVRVNADTTGVDPHAPFGGMKSSSS
FT                   HSREQGPAAVEFFTDTKTVQINPVTG"
FT   gene            complement(229685..230224)
FT                   /locus_tag="Tter_0213"
FT   CDS_pept        complement(229685..230224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afw:Anae109_3322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41135"
FT                   /db_xref="GOA:D1CDX9"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDX9"
FT                   /inference="similar to AA sequence:KEGG:Anae109_3322"
FT                   /protein_id="ACZ41135.1"
FT                   /translation="MLILARNWWSLVLRGVIAILFGILAFIWPGITVLVFVALFAAYAI
FT                   IDGILAIISAFRDSRNWLALVIEGVLGLAAGIVAILWPGITALALLYLIAAWAVVTGIF
FT                   EIAAAIRLRREISNEWLLGLAGLLSIVFGIILFLFPGSGALAVVWIIASYAILFGILLI
FT                   ALGLRLRSLYNSLRAA"
FT   gene            complement(230294..231664)
FT                   /locus_tag="Tter_0214"
FT   CDS_pept        complement(230294..231664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0214"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: bha:BH3875 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41136"
FT                   /db_xref="GOA:D1CDY0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDY0"
FT                   /inference="protein motif:PFAM:PF01546"
FT                   /protein_id="ACZ41136.1"
FT                   /translation="MSDEVFSRIDASSHKYLEDLKEFLRIPSISALSDYKAEVARCAQW
FT                   LKEHMITIGLQKAEVIPTSGHPIVYGEWMGSDSGRTILVYGHYDVQPPDPLDLWQTPPF
FT                   EPSVREGRIYARGAVDDKGQVMMHLKAVQSLLEEYGKLPVNLKFIIEGEEEIGSPSLDE
FT                   FLVQNKDRLSSEAVVISDTGWIAPGVPSITYALRGLSYIQVDVYGPKSDLHSGSYGGAV
FT                   MNPAEAIACIIASLKDDKGRIKVDGFYDKVVELTSQEREEFSKLPFDEESFRQALGVDQ
FT                   LYGEEGYSTLERLWARPTLDVNGIWGGFTGEGSKTVIPAEAHAKISCRLVPDQDPEEIS
FT                   DLLETYIRKITPPGVRVEIQRMHGGKPAIVPIDHPINQAAARALEKAFGKKAVFIRAGG
FT                   TIPVVASLKEILGLPSILMGMGLPDENAHAPNEWFLLDNFYGGIKSVAALWLDLGAA"
FT   gene            complement(231685..232074)
FT                   /locus_tag="Tter_0215"
FT   CDS_pept        complement(231685..232074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41137"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDY1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41137.1"
FT                   /translation="MPGIEELRKNDMMAHLIDSLESGKDIGHYGRLVFVMVARYFLSED
FT                   EIVRLLKNDPDFSEEDARSLYKQVVSRGYNPPKRERVLEWQDQQDFPICPNPEDPGSCN
FT                   VYKDLNFPEEVYEQINEYYDQKTES"
FT   gene            complement(232141..233466)
FT                   /locus_tag="Tter_0216"
FT   CDS_pept        complement(232141..233466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0216"
FT                   /product="glycoside hydrolase family 4"
FT                   /note="PFAM: glycoside hydrolase family 4; KEGG:
FT                   lch:Lcho_3239 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41138"
FT                   /db_xref="GOA:D1CDY2"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDY2"
FT                   /inference="protein motif:PFAM:PF02056"
FT                   /protein_id="ACZ41138.1"
FT                   /translation="MPKIAFIGAGSAVFTRNLLGDLLTYPELDGSTISLMDIDANRLKA
FT                   VESLAKKMVEQEGSKMVIEATTDRSQALQNADYVVITIQVGGLKAYELDIEIPRKYGVE
FT                   QCVGDTIGPGGVFRGLRHLAVIEEICNDLEELSPDALILQYTNPMAILCWGISSMSSIR
FT                   FVGLCHSVQGTSEELAHIAGVPYEELSYWVAGINHMSWFLRLEHKGRDLYPLLFEKMSD
FT                   PDTYALDPIRFDLMKHFGYFVTESSGHASEYYPYFRKRQDVLEQTLAKFTHPRHGWFKF
FT                   GQTGGYLKHCFEVADHYYEDIEDQLKADKIEIRRSREYGAQIIHSIETNTPRRINGNVT
FT                   NYDLITNLPYGCCVEVPCLVDNTGINPCYVGDLPPQLAGLIRTNVNLQELAVLGHIHRD
FT                   KTLVKQAIKMDPLTAAVCSLEEIDNMVDELFDAQKEWLPQFD"
FT   sig_peptide     complement(233404..233466)
FT                   /locus_tag="Tter_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.828) with cleavage site probability 0.824 at
FT                   residue 21"
FT   gene            233613..234647
FT                   /locus_tag="Tter_0217"
FT   CDS_pept        233613..234647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0217"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; homoserine
FT                   dehydrogenase NAD-binding; Oxidoreductase domain; KEGG:
FT                   rle:RL0824 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41139"
FT                   /db_xref="GOA:D1CDY3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDY3"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACZ41139.1"
FT                   /translation="MPGRTLGFGIIGAGMIAEYHKKAIEANSDLGAKLIAIGHYDPSKF
FT                   SQISTKFGVPCISVQNLLAHPDVDVVTICTPSGQHASQALDAMRAGKHVLVEKPMALNL
FT                   EDADSMIDLARSQGVKLGVVLQRRMDPTFQAVKQAIDAGDLGRLTLGLVKIPYFRPQTY
FT                   YDQAAWRGTWVLDGGGVIMNQGIHLVDLLVWYMGDPQQVSAYADTLSRDIEVEDTLVGI
FT                   IRFSNGAMATITATTTTSPGFPHTVEIYGTHGGIQLEGEGIRRWELAEPSKARVKAPGV
FT                   AENASAGAAADPRGISTENHTRLFRDFILAIQENRDPSIDGSEGRRSLALTLELYKSAG
FT                   LLQK"
FT   gene            234790..235332
FT                   /locus_tag="Tter_0218"
FT   CDS_pept        234790..235332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0218"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: gsu:GSU2525
FT                   nitroreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41140"
FT                   /db_xref="GOA:D1CDY4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDY4"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACZ41140.1"
FT                   /translation="MTTASDKISFLKSLRAIREFTPQPIPDDVIDDVLEVARWSGSAVN
FT                   RQPWEFIVIRDKDTLKKLATVEGHAGHLAGAATGIVLVMAGESFEHETYDEGRLAERIM
FT                   LAAWAHGVGGCIGWFGENGRSEVKAALGIPDNKFVRTAISLGYPDYEVRKNRPRREQPR
FT                   KPLSEIVHWERYGQHNR"
FT   gene            complement(235372..237402)
FT                   /locus_tag="Tter_0219"
FT   CDS_pept        complement(235372..237402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0219"
FT                   /product="4-amino-4-deoxy-L-arabinose transferase-like
FT                   protein glycosyltransferase of PMT family"
FT                   /note="KEGG: nmu:Nmul_A0278 glycosyl transferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41141"
FT                   /db_xref="GOA:D1CDY5"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDY5"
FT                   /inference="protein motif:COG:COG1807"
FT                   /protein_id="ACZ41141.1"
FT                   /translation="MLWFAHSWRVPPDASWYLLHGLNIISGKGYVDIQGDPQVVRGPVF
FT                   PAFLGFIMLLLGKNIDQLAWAVRLFALLNPLLLYLLIKRLLGTREALVAALFLAYFGYT
FT                   STLSQAFNIDAFLLTEYLLTAYLVLTAVDRRSSWLSLLSGFMLGLMILTKETSIVVLPT
FT                   AVVAALLLGWTLKDVLLHYLGVLVICAPWWVWVWNVSQSVFLLGKVPVYFLYLVVAVSL
FT                   IAVMVFYLAYRLGVFHKLAIYLQANRERCAWVLVIGWTLVASLAMLSQVNDLRVDQSTA
FT                   KYLVNQVMRGTPLWYVLPLGGLFAIWKSIKGSRNWAYLLAMGILWVPVSLVALVMEISI
FT                   RQWMIQQALGYASLAGLYIAAPEFFSRLKDWDWKIVLKGIPSRSQVIAFVSSHYLLNYA
FT                   LTCVLILFLIWGTGVQTRILANGIASNTANDNPVATDINPAVLDMKNWIDQNIPKGETI
FT                   LATWQYSYQLAFQDDFKHKWKAFKMNCASGPESISASSCRLDIQVTPVWPPTQIPFWMH
FT                   MDNACRPTMVTFSDLIREMKKDEASYLLMTRQQDFTATNSWTPALVSSGAFELMYQTFV
FT                   RRGSPSNQISLSMLRITGREPRNLPTQMSAESVINLAQCERRRVGEDKYVQSIRSILPY
FT                   GIWLVSDPNDNTAYSAEREREAREIIESIYGYLPKMPSQNS"
FT   gene            237733..238794
FT                   /locus_tag="Tter_0220"
FT   CDS_pept        237733..238794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0220"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   dol:Dole_1971 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41142"
FT                   /db_xref="GOA:D1CDY6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDY6"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACZ41142.1"
FT                   /translation="MLYSVRIVGVLVAVLFAYYGISKYRNGQWTRFDLTLALLVSAGVA
FT                   TVSIFPPVGNILMSAFGLKNRLFAILVFTNLLLFGLFFYALNQIRSINMRNIDTIRALA
FT                   KQKYMEEFGFANRETGNAASGNQGKILVTIPAYNEEVAIQTVLPRIPSELLGYRLDTLV
FT                   IVDGATDRTEEVSRKAGVSVATHIINCGGGAAHKTGFDIAKMIGADIVVNMDADGQHRP
FT                   EEIERLVTPIINNQADFVWGSRFYGYYEERGSIRHAGVVFFSRMISILIGFKVTDCTNG
FT                   FRAIRVRDLEKLHLKEEQFHTTEMIIEAAKKGLRLMEVPISVLKRAEGESKKPKRLRYP
FT                   LGVLRVIVQTWLR"
FT   gene            238823..240118
FT                   /locus_tag="Tter_0221"
FT   CDS_pept        238823..240118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0221"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   bat:BAS4308 stage V sporulation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41143"
FT                   /db_xref="GOA:D1CDY7"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDY7"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ACZ41143.1"
FT                   /translation="MSIPIVEKIRGQKLISSRQGVGAGSIYLALSLGITGVFTYGFQIL
FT                   SAYFLRLEDYGVIATLWSATFLVAQILWIGITQTLAKYIPEREAKAESWLPVLRSVRHL
FT                   QYIVLAIFILVTLVTFPLLTERIFAHKPIITAVFIMAVAGYSFSYFKRGVLSGYKKFSH
FT                   VGLMFITESCSRLLLSVGLLLIGLGLTAPGIGIAIAPFLSVLLVRTKIDVPQAGSSEHF
FT                   SIGKAFRFATPVLICMACAQLLANGGPIMISALGGPNAQAQAGLLLAGLVLTRIPQYVL
FT                   SPVMSNLLPHLSEMIAKGDHRKFNNFVKIAALALGAMGGILVAGFWLMGTFAMSLMYKP
FT                   EYRLSRGLLTVLALGAACYLFNEFMNQVLFAKSRTRLASLSWILGIVVTLAATLMISAD
FT                   PLHRVAYALAIGTLSTSIFLILSHLVTRPSQM"
FT   gene            240175..241359
FT                   /locus_tag="Tter_0222"
FT   CDS_pept        240175..241359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0222"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; CBS domain containing protein;
FT                   SMART: CBS domain containing protein; KEGG: noc:Noc_1011
FT                   peptidase M50"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41144"
FT                   /db_xref="GOA:D1CDY8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDY8"
FT                   /inference="protein motif:PFAM:PF02163"
FT                   /protein_id="ACZ41144.1"
FT                   /translation="MLGPGIPIGRIFGIRIYIDPSWIFIFLLVTWNLAAGALAVVHPEW
FT                   GTTTIWLVAIAASLLFFGSVLAHELAHSLVARSQGVPVRRITLFMFGGVADIEREPPSP
FT                   RAEFLITVVGPLTSLVLGIVFLVIGTAIAGISNLSIYNPEGLLAQLNPLSTIFLWLGPI
FT                   NIVLAVFNLVPGFPLDGGRILRSIIWAISNNLRLATRIASFIGQAIGWLMILAGVAMIF
FT                   GAHIPFFGTGLVSGLWLIFIGWFLSSAASQSYRQLVIHHILEGVPVNRIMRTDIPTASP
FT                   YMTIEDLVRLLLINSDERSFPVVEEDRLVGLVCIEDLKKVAREEWPIVPVSRIMTPRDK
FT                   LITIGPNDDLAKAFEQLARIDVNQLPVVVGDTLVGLLRRRDLLRWLQIHSQIAR"
FT   gene            complement(241364..242695)
FT                   /locus_tag="Tter_0223"
FT   CDS_pept        complement(241364..242695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0223"
FT                   /product="UDP-N-acetylglucosamine1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine 1-
FT                   carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1- carboxyvinyltransferase); KEGG:
FT                   mgm:Mmc1_1221 UDP-N-acetylglucosamine 1-
FT                   carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41145"
FT                   /db_xref="GOA:D1CDY9"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDY9"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ACZ41145.1"
FT                   /translation="MHTLLIEGGVPLRGEVRIAGAKNAALKMMAAALLTEEEVHLSNVP
FT                   HISDVYVMSALLQTLGVEVNWNGPNTLRIRAKDIRPVRFGIDVAAKIRASFVVMAPLLA
FT                   RCGEASVPNPGGDRIGHRPVDRLVEGLRHFGVCIDYDGAYYNATCDRLRGCEYRFNKNS
FT                   HMGTEHQIMAAVLAEGRSVIYNAAQEPEVDDLIDMLNSMGARIKRVEPRTIVIDGVRKL
FT                   GGTHHTVMPDRIEAGTFAIMAAATDGDLYLSGANPDHMQALLDKMKEAGCRIEADPEGI
FT                   RVRRGESLRAVNVITRPHPGFMTDWQAPFVVLLTQASGVSLVHETIFPNRLGYTEQLNL
FT                   MGAHIELFNPPVPDCGYEWNEKDDSPDYFHAARIYGPTPLRAANLTIPDLRAGATLIIA
FT                   ALCAEGVSKVSGVQWVERGYEHFVERLRSLGARIEESLPAEATA"
FT   gene            complement(242889..243116)
FT                   /locus_tag="Tter_0224"
FT   CDS_pept        complement(242889..243116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41146"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDZ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41146.1"
FT                   /translation="MKLVAVGTFSDAILAEMYAELLRRQGVPVMVQPVGAHLGGWAVGV
FT                   ASMHRLLVPEDYFDRANRILLEYLAGDEES"
FT   gene            complement(243118..243513)
FT                   /locus_tag="Tter_0225"
FT   CDS_pept        complement(243118..243513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41147"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDZ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41147.1"
FT                   /translation="MSTRWSEKDLYLLGSSASVDIKLVSELSPDESRHVIRGLWDSRGF
FT                   IGLNLGGYPVTSLVVDSLDLAFWISEYIRAVVGRYIPPRNLKSGLIWVGVSGRKCLPWL
FT                   RYIYDQSNFVSADKFSKAKELISILEQ"
FT   gene            complement(243530..244498)
FT                   /locus_tag="Tter_0226"
FT   CDS_pept        complement(243530..244498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0226"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: TPR Domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41148"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDZ2"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACZ41148.1"
FT                   /translation="MPLENNMSDNYFDNTDSGEVTIFDLRDGESRAKRLIRAGRRHTDE
FT                   GRFEEAARAFEQAVEISPKKAEYRVELAAAYRNLIESGVVSEPEMVEALLERAYSHLME
FT                   AVRLDPEYAPSYRLLGYVYEAMDAPWRAKEMWNFYLEMDPNGPYSSEVRSALEELDRVQ
FT                   NLHYMFEEASYLVNHGDPERALEILSEILEEEPDWYEAWFWRGLACREMEMISDAIESF
FT                   ARAVELDPESTYAYHELASLLARKGEVEAAEGFWHKALDLDPEEPWIMTSLALLLWRDE
FT                   RRDEAEKLFLRVLDIDPANRKVRNYLRNLRAGMPPPHLVET"
FT   gene            244639..245700
FT                   /locus_tag="Tter_0227"
FT   CDS_pept        244639..245700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0227"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: gur:Gura_4035 threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41149"
FT                   /db_xref="GOA:D1CDZ3"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDZ3"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /protein_id="ACZ41149.1"
FT                   /translation="MYTASGSGKEVLCGDEDRMLTLNDILEARDRISPYIERTPLKESH
FT                   TLSNRLGAKVYLKLEMFQTTGAFKIRGAFNKMLSLSPEEKNRGVVAVSGGNHAQAVAYA
FT                   ASKLGIKATVFMARNTPENYIEATEHYGAQVVLTSDIAEAFKLAAERQAYGEVMIHPYA
FT                   DNQVMAGQGTIGLEILEDLPQVTDVIISIGGGGLISGVATAIKSQKPHVRIWGVETAGA
FT                   DSMSQALRAGHPIELPAITSIAKTLGAPSVSENTLAITRKLVESVTVVSDKEAFQALEF
FT                   LLERAKVLTEPAASCTLAAAERLRSAFTPQSTLVLLLCGGNVSLADLCHYRQMFSVEDK
FT                   KHRSQLEHHEISL"
FT   gene            complement(245642..246703)
FT                   /locus_tag="Tter_0228"
FT   CDS_pept        complement(245642..246703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0228"
FT                   /product="Threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /note="PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; aminotransferase class I and II;
FT                   KEGG: sfu:Sfum_0699 threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41150"
FT                   /db_xref="GOA:D1CDZ4"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDZ4"
FT                   /inference="protein motif:PRIAM:4.1.2.5"
FT                   /protein_id="ACZ41150.1"
FT                   /translation="MHVIDLRSDTVTLPTEEMRKAMAEAEVGDDQSREDPTVNKLEELA
FT                   AEIIGKEAALFVPSGVMGNLCAMLVHCERGQEVIMGDQSHILWYESGSGAALGGLVYRS
FT                   VHNGRFGELNPSEVEETIRPERLGFPRTGLVCLENTHNRCGGTVLNLQQIEGIVDVAHR
FT                   HNVPVHMDGARIFNAAIYLGVPAKELAKPVDSIEFCLSKGLSAPVGSIVAGSEGFVREA
FT                   RRVRKLLGGAMRQSGVIAAAGIVALEKMIDRLHEDHVNARKIAEGIVDLDGIRLDLETV
FT                   QTNIVAFDLVSPDWTPPKLISELESRGLRISSYGGRKMRIVTHYGISDDEYDQAIKIFR
FT                   DVLTGTYVSYPQH"
FT   gene            246864..248039
FT                   /locus_tag="Tter_0229"
FT   CDS_pept        246864..248039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0229"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; SMART:
FT                   extracellular solute-binding protein family 3; KEGG:
FT                   rpd:RPD_2108 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41151"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDZ5"
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /protein_id="ACZ41151.1"
FT                   /translation="MSDCCNRNIMERDICPCDGIDLLDDSQTAPEIQTHPITRRQVLKY
FT                   MGGFLLTGFIAACGQAGGPQAQKSPVPTSIVSSQPTAPSREGLTKLDLAFCSQVLCILP
FT                   FEVARQQGYFADEGYDVNLIYMKGGALAINALISKSVDFVGTPMDLIVRSVDQGQPVIM
FT                   VASTSRLPFFALVVSPGKSSEITKISDLQGKRVGVNNLGTTDDLLLKALLAKNNLDPNS
FT                   TDSVALGPNLYDALLRGEVDAGMVQEPALTLLSQKGARVLVNFMDRQQTNEVLGGDYQF
FT                   MGLNTRPDVLDSKPDVVEKLARALVKANQWILNHTGSEIVKAAPQELAPGDDIQIFAKA
FT                   LDKYKESLYPSDGVIEEHAVRRVVETQKISGLLKNENIDISTLYTNKYVEG"
FT   gene            248039..248866
FT                   /locus_tag="Tter_0230"
FT   CDS_pept        248039..248866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0230"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sml:Smlt2573 putative ATP-binding ABC transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41152"
FT                   /db_xref="GOA:D1CDZ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDZ6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ41152.1"
FT                   /translation="MRASTAATSTKLQPPRVVFKNITKNFRSKNGDIYTALGGVDLEVP
FT                   AGKFVAIVGPSGCGKSTLLRILSGLDRPSSGEVMINDQRVAGVMPQIVGFLQQQDTLLP
FT                   WKTVFENVALGLRFRKFPAEEIKSRVEDWLRKVNLYRFRNHYPAQLSGGMRRRVAIAQT
FT                   LILDPPLLLMDEPFSSLDAQTRYMMEMDLLSLAGSGERTIIFVTHDLEEAASMADTVVV
FT                   LAAGPHSRVKAIVDVDIERPRDLLAIRSDPRFGQITRFLWDQLYEEVNKSYGK"
FT   gene            248856..249671
FT                   /locus_tag="Tter_0231"
FT   CDS_pept        248856..249671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0231"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mlo:mlr7951 ABC
FT                   transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41153"
FT                   /db_xref="GOA:D1CDZ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDZ7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41153.1"
FT                   /translation="MASEQVSNISVAQKQESGESKYLSVYILRWGLLLVFLALWELGAR
FT                   TGFIDTYFYSSPSRIIETLIQQFSTGAIWKHLAATMQAAIFGLIYGFIAGAALGWLAAR
FT                   FKTLSQIVEPVMTLFNSVPRIVIAPMIIMWLGIGIASKIAVAFILVFVVLFFAVYTGIR
FT                   EVNKDLIDRIRLLGGNERDIILNVYVPSVAAWIFSSLRLTVGFAFTGAIVGEYMASSRG
FT                   LGYMLNFAQNSQNADLMLSTVVLIMAIIMLIFALLGRLEARALIWREDR"
FT   gene            249881..249983
FT                   /gene="ffs"
FT                   /locus_tag="Tter_R0006"
FT   ncRNA           249881..249983
FT                   /gene="ffs"
FT                   /locus_tag="Tter_R0006"
FT                   /product="SRP RNA; RNA component of signal recognitionparti
FT                   cle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            250059..252536
FT                   /locus_tag="Tter_0232"
FT   CDS_pept        250059..252536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0232"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: glo:Glov_2744 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41154"
FT                   /db_xref="GOA:D1CDZ8"
FT                   /db_xref="InterPro:IPR018580"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41154.1"
FT                   /translation="MLSYKFMKALRYVRAHQRTLPSFFSLELRKLDVLGALGAVSLTLL
FT                   AVAHMVIKGTAVGLDSAVFFYPMYHYLGSSLRSGEIPVWNPFLFSGFPFAASPQSGWMY
FT                   LPAMAFFTLLSLSEAAKTYILFHWVVSAIAVYVLARDLGLSVSGSVLASVAYSINGFSY
FT                   ERTVCCFAYSGVYTWVPVALLGCERAIKTRELLNKWIWIAISSFSLAQIFSAWPGQGFY
FT                   YGFLLIASYLTFRILVFPEHRSGIIARITQLLSTGIIMGILAFGLGAADILPKLSFLSQ
FT                   SNLASGYTLQQAGVHSGWTILESLSLLGPTTWYLGVTVFSLALAAPFLVRTRYMTPFWI
FT                   VWMFACLVLASRSQTLLHLILYEFLPMFRSLHPHDPERIMMTFYIAPSLLAGSTITYLL
FT                   QLDRKRIKRKVYWLILVPPILLAFITAYAASQITIYVSIILLVFSIGLGIYIVNPSAQN
FT                   KILLTLLVLACVFADLYIVNNHVQAQRLQTRMVYALRKVNLESYYSSTKAVKFLRSQGP
FT                   NYTFRFFGYDPRLRWFPGKADPSIPPPGILYRYLWMDYRTKILLVNNRALVTGIQDIQG
FT                   YNPLQLSSYDSFFGVINGQSQEYRSTYVLQRGLSSPLLDLLNARYVITLRSFGPNFPEY
FT                   ESLEKTSRLVYEDSTIRIWERQTALPRAWIVHSWQNAPYEEVLHILANNALDFRKIALV
FT                   EGLESHIQDINPSDDAVTIDHYSQSRITLTTKSHLPGMLILSEVYYPDWRAYLDGKPVN
FT                   IYRAYGLLRAVTIPAGEHKIEFRYESKSLEYGLIISISFYLLVASLLLSKLLTYAKSRT
FT                   MDNIRGRSIDIRN"
FT   sig_peptide     250059..250205
FT                   /locus_tag="Tter_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.860) with cleavage site probability 0.817 at
FT                   residue 49"
FT   gene            252520..253437
FT                   /locus_tag="Tter_0233"
FT   CDS_pept        252520..253437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0233"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; KEGG: dol:Dole_2627 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41155"
FT                   /db_xref="GOA:D1CDZ9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDZ9"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACZ41155.1"
FT                   /translation="MILETSDLEYIDCNLCGSKSHSLFLPANTDFSQISANALACTSIH
FT                   HSKHGPIVRCNNCGLIFANPRPSPQKIIEIYSQVEDHVYLAEEEGRVATFKNNLAEISR
FT                   YKRKGKLLDVGCHVGTFLDIAKDYGYEVYGLEPSKWAAEYCRNKRNIEVQECGLSEANL
FT                   EDSSFEVITMWDVIEHLTDPYKELRRANSLLRDDGILAITTMNVDSVFAKVLGKHYPWY
FT                   MLMHLYYFTPDTMEKILGKSGFRILEIKHHIRVVSLRYLFSKIKAYSPAAYRAAHTVAH
FT                   LLKIHDLKVPLNFGDIMTVIARKI"
FT   gene            253460..254419
FT                   /locus_tag="Tter_0234"
FT   CDS_pept        253460..254419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0234"
FT                   /product="ribonuclease BN"
FT                   /note="TIGRFAM: ribonuclease BN; PFAM: ribonuclease BN;
FT                   KEGG: pap:PSPA7_2488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41156"
FT                   /db_xref="GOA:D1CE00"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE00"
FT                   /inference="protein motif:TFAM:TIGR00765"
FT                   /protein_id="ACZ41156.1"
FT                   /translation="MSFLVPYLNKLEQLGNKIRVPLARHIGIADLLKQVWKEASEDHLG
FT                   DFAASLTYHGIFAIFPFLTFLISMLGIFDKVLGVFDTSQLIKDFLSRPQVRQAIPVEVI
FT                   DFVQQQIDRLIGNIRPGTFTTGAIVSVLLALWGVSGAFRSIMESLNVVYEIKDSRPIWK
FT                   KYLISIMLSVIAVLLLLSAGILAVFGPKIADWLARTTGLGTLFAWSWKIAQWPLLILIA
FT                   LLAFALIYHYGPDIKQPLRLVTPGSILALLGWLVFTLIFSLYVNNFGNYNKTYGTLAGA
FT                   ILLMLYMYYSSYILLMGGEVNHVVETYSKTSEEVKQSV"
FT   gene            254462..254902
FT                   /locus_tag="Tter_0235"
FT   CDS_pept        254462..254902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0235"
FT                   /product="CcmE/CycJ protein"
FT                   /note="PFAM: CcmE/CycJ protein; KEGG: dds:Ddes_2369
FT                   cytochrome c-type biogenesis protein CcmE"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41157"
FT                   /db_xref="GOA:D1CC97"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/TrEMBL:D1CC97"
FT                   /inference="protein motif:PFAM:PF03100"
FT                   /protein_id="ACZ41157.1"
FT                   /translation="MWYTAKGMAQAVAVDTTRRRNLGLLVVGLVAAAAILYLVVSNFSA
FT                   NTVYYLKVSELQSSYHGGQVRVSGKVLPGSISRQGDKLSFTAYDGSGRMRVEYQGVVPD
FT                   IFKDNADVVVEGTYDGQVFHAHTLLAKCPSKFQSKPSQGYAQ"
FT   gene            254940..255683
FT                   /locus_tag="Tter_0236"
FT   CDS_pept        254940..255683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0236"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sus:Acid_4236 heme exporter protein CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41158"
FT                   /db_xref="GOA:D1CE02"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE02"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ41158.1"
FT                   /translation="MFSNKPSQSMSDPVPVIEAQGIGKLYNRRWALRNVNIKVFAGERV
FT                   LLWGPNGSGKTSLLRILATLSRASRGELKLFGLEAIKYKRDLRNRIGYLGHNLTLYDDL
FT                   TARENLNLYSKLYSVKNPENLYMPLIYTFGLVSFLDSRVRNYSRGMQQKLAIVKALIHQ
FT                   PEILLLDEPSTGLDAESTHKLEEVLAQYDGTIVFSSHDLEFGLSVGNRVLVLSNGSIIA
FT                   DKSVQEIDSIDLQHPTQRHKLTIQP"
FT   gene            255680..256351
FT                   /locus_tag="Tter_0237"
FT   CDS_pept        255680..256351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0237"
FT                   /product="cytochrome c-type biogenesis protein CcmB"
FT                   /note="PFAM: cytochrome c-type biogenesis protein CcmB;
FT                   ABC-2 type transporter; KEGG: mgm:Mmc1_3499 cytochrome
FT                   c-type biogenesis protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41159"
FT                   /db_xref="GOA:D1CE03"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE03"
FT                   /inference="protein motif:PFAM:PF03379"
FT                   /protein_id="ACZ41159.1"
FT                   /translation="MKFWQQVLALVHKDLVLEIRRKEIIISMFVFALQILVIFNYAFDL
FT                   RVENVKSIGPGVIWVSIFFSCAVNVGRTIFLEKERGGWEGLITAPLELGALYVAKLIGN
FT                   ILFMLFAEVLILPMFVVLFNLQVITLPIITVLILGTIGFASISTMFAGLLASTRAREIM
FT                   LPVLIFPILLPVTIATVEATANHLTGTTAMNRAPWTGLLIAFDALFICAGYILFDQVLE
FT                   E"
FT   gene            256356..257075
FT                   /locus_tag="Tter_0238"
FT   CDS_pept        256356..257075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0238"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   aba:Acid345_2302 cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41160"
FT                   /db_xref="GOA:D1CE04"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE04"
FT                   /inference="protein motif:PFAM:PF01578"
FT                   /protein_id="ACZ41160.1"
FT                   /translation="MAQITAAVQSTRYYGWVDKLSQVLAFVTLPLMALTLYMTLIYAPT
FT                   DATQGDVQRIFYYHVPTAWNGFLAFFLVFVASVVYLFKSSRFWDALARASAEVGLVFTT
FT                   IMIITGSLWGKPVWGTWWSWDPRMTTTLILWFIYLGYLMLRAYAPSKQQGARYAAVLGI
FT                   VGFVDVPIVYMSTKWWRTLHPQQVVEPGQVSMPPEMLQAFMVSLLAFTLLFIWILIIRT
FT                   RIALIEDELEIRSIENG"
FT   gene            257068..257223
FT                   /locus_tag="Tter_0239"
FT   CDS_pept        257068..257223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41161"
FT                   /db_xref="GOA:D1CE05"
FT                   /db_xref="InterPro:IPR030888"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE05"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41161.1"
FT                   /translation="MDNFGFLFAALLVVWIGIFVYIYYIGQKLNDLRQQLSEVEIRENQ
FT                   NTKEDQ"
FT   gene            257246..257812
FT                   /locus_tag="Tter_0240"
FT   CDS_pept        257246..257812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0240"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen;
FT                   Thioredoxin domain; KEGG: mxa:MXAN_3252 thiol:disulfide
FT                   interchange protein DsbE"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41162"
FT                   /db_xref="GOA:D1CE06"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE06"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ACZ41162.1"
FT                   /translation="MNAARWLVAGILAGVLVLLILFGYGLAKQREGDTLEQGARIVSVG
FT                   GDVPIEPHPAPDFTLKGFDGKQVKLSDYKGKVVIVNFWASWCPPCAEEAPTLESGWQKF
FT                   KNEGVVFLGVNLWDDPQNAEQFIEDNDLTYINGTTKTGTATEYGLTGIPETYVIDKNGQ
FT                   VIRRWRGPLTDHELANLVEAGLSSK"
FT   sig_peptide     257246..257329
FT                   /locus_tag="Tter_0240"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.946 at
FT                   residue 28"
FT   gene            257834..258766
FT                   /locus_tag="Tter_0241"
FT   CDS_pept        257834..258766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0241"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   pzu:PHZ_c1916 probable periplasmic substrate- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41163"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE07"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACZ41163.1"
FT                   /translation="MRIVSLLPSATEIVCSLGLIDSLVGVTHECDYPPEVMGKPILTRS
FT                   LIDTTQDSYSIDRQVVESLHEHRTLYALDEELLRELSPDLILTQELCDVCAVSYTVVEK
FT                   AARILPAETPVVSLEPNTLYDILETILLVGRLTGTEARAQKLIDELITRIRAVESKASS
FT                   VAHKPKVYCMEWVNPPYKSGHWIPEMVRIAGGEEVFGLEGIPSSRASWEEIAQAAPEVV
FT                   VVMACGFDADRTERELMLINEREEWQSLPAVRNGNVWVSNGSAYFARPGPRIVDSLEML
FT                   AHAIHPELFPEPDRTQFRRFRPLAAASLV"
FT   gene            258814..259290
FT                   /locus_tag="Tter_0242"
FT   CDS_pept        258814..259290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0242"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41164"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE08"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41164.1"
FT                   /translation="MSRAYTALKWFTIGIVLSILFAPRSGRETRSILLSRLRMHGNASQ
FT                   VNDTPVVNNPRENTQQANTSEKRDHRNITRDPLAEIEDKAQSAQEQLDKQVRDNVSQAI
FT                   DQAIDETQGEVEATLEESRRIIKTEEDSIQEKQENIRSQLNQMPRLKDDHNEQS"
FT   gene            complement(259297..259707)
FT                   /locus_tag="Tter_0243"
FT   CDS_pept        complement(259297..259707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41165"
FT                   /db_xref="GOA:D1CE09"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE09"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41165.1"
FT                   /translation="MGCRSAKGHVWQRINVRGSVWRCLRCGATQISSQMPRLETNPKQI
FT                   SEENKQKVSRLLPIYKDKLKDTWVFALEMRYGLNEESREYSYEEIAQVLGLSKLTVQKI
FT                   IRGAIHSLEGLERKDRWRSSIKEDKYKNIMDA"
FT   gene            259790..261304
FT                   /locus_tag="Tter_0244"
FT   CDS_pept        259790..261304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0244"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="KEGG: gur:Gura_3250 4-alpha-glucanotransferase;
FT                   TIGRFAM: 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase family 77"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41166"
FT                   /db_xref="GOA:D1CE10"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE10"
FT                   /inference="protein motif:TFAM:TIGR00217"
FT                   /protein_id="ACZ41166.1"
FT                   /translation="MNDHRRSGVLLHLTSIPTKYSIGDMGPKAYEFLDFITSSGLSIWQ
FT                   MLPVGPVGKSNSPYQSYSAFAGNHLLISPDLLLEEGILATADLPKEPNTKHQRTDYALA
FT                   RRIKSLILQKAFSRFTPTKDFESFCEEYSYWLDDYAMFMTLLELNNGRPWNLWHTDISR
FT                   RDKTTLERLSREHKQRIMFHKFAQYLFFKQWFELKKACNSRGVKILGDLPIFVAHNSAD
FT                   VWAHPEIFKLKPDGNPRMIAGVPPDYFSSTGQLWGNPLYDWQMLEAQNYSWWIDRLKWS
FT                   LKLFDMVRIDHFRGFCACWEVPYGETTAVNGRWVKVPGAKFFRTAIKALGSLPVIAEDL
FT                   GVITPEVEALRDKFGFPGMKVLQFAFTNPQNQYLPHNYVTFNCVVYTGTHDNNTTLGWW
FT                   EELDSKHKSIVRSYVGRKTGKDLVWELIRMGISSTAKYAIFPLQDFLTLGSEARMNIPG
FT                   TEFGNWEWSYPESALSEEIAGRIKHLCKLYNRVPPEEKEQQITNPQ"
FT   gene            complement(261288..262001)
FT                   /locus_tag="Tter_0245"
FT   CDS_pept        complement(261288..262001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0245"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: aba:Acid345_0544 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41167"
FT                   /db_xref="GOA:D1CE11"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE11"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41167.1"
FT                   /translation="MNCEVVEDKIPALALGALDDSELEEIKAHILACNKCKSELLSYTP
FT                   VLDALNLSVDEFDLPTGFNRRLMKRINPQAVKNSRQGETVQVQQSNFTSKLVVAWGVAI
FT                   VLLFVAILLGARAWTLEKSLAEQHNYDEHMVALMTSDNVQTLDLRAQGTDVRAKLYLSQ
FT                   DGREGVLMVSNLTPDSTYEVWLVGSDGRVMAATFTPLSNGTARVYLDPEGGLSKYQRID
FT                   IVVQGSSRQVITGDL"
FT   gene            complement(261998..262624)
FT                   /locus_tag="Tter_0246"
FT   CDS_pept        complement(261998..262624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0246"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 4 domain protein; KEGG:
FT                   sus:Acid_7860 ECF subfamily RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41168"
FT                   /db_xref="GOA:D1CE12"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE12"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACZ41168.1"
FT                   /translation="MKRELRKLIDNEDSANQSNSYSDHDDEYLLYLIKERDHQALAEVV
FT                   NRYGRLAYSLALRILGDQGWAEEVLQDVLVKLWQKPDMYDPKRGDLRRWLLSVTHNAAI
FT                   DNLRGRHGSEQKYEVGFEKFDILPDGYEDPSEDVVRKLQAEEVRGALALIPSEQKEVIE
FT                   LAYYGGMTISQIAKLTGASTGTVKTRMRLGMMKLRQILTSSGASE"
FT   gene            262800..263273
FT                   /locus_tag="Tter_0247"
FT   CDS_pept        262800..263273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0247"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="PFAM: blue (type 1) copper domain protein; KEGG:
FT                   aba:Acid345_1788 plastocyanin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41169"
FT                   /db_xref="GOA:D1CE13"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE13"
FT                   /inference="protein motif:PFAM:PF00127"
FT                   /protein_id="ACZ41169.1"
FT                   /translation="MKTWIKPLIALLILLLVAMPSKVSATTNTTHKVEVDDNYFEPKTI
FT                   TIRVGDTVEWENEGQNPHTVTADDGSFDSGNLNSGDSFSHTFTKAGKYAYYCKYHGAAG
FT                   GVGMAGTVVVMSGPAQTGAGGMANHESLLPILLLVVGVVILYLGLRFKYNRIS"
FT   sig_peptide     262800..262877
FT                   /locus_tag="Tter_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            complement(263289..265184)
FT                   /locus_tag="Tter_0248"
FT   CDS_pept        complement(263289..265184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0248"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; dienelactone hydrolase; WD40 domain protein
FT                   beta Propeller; KEGG: aba:Acid345_2116 peptidase S9, prolyl
FT                   oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41170"
FT                   /db_xref="GOA:D1CE14"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE14"
FT                   /inference="protein motif:PFAM:PF00326"
FT                   /protein_id="ACZ41170.1"
FT                   /translation="MGQADWTIEDVLNLRHVEDAQISPDGKYVAYVIRDAYREELKVRS
FT                   SHIYVADITTGESKQFTSGPGADACPRWSPDSNKLAFISDREEEARFDLFTIDVHGGEA
FT                   IKLADLEGSVLDLRWSPDGRYIGLLLEVSRNPHEDSPMVFEEKDQATRIWKVASSGGDA
FT                   EPLSPEGLHVWEFEWLEDSSALVAVCSRYPYEWSWYEPFLALIDASSSEYKVLYSPDKQ
FT                   IANPAPSPDSKHIAFIKGSFSDRGSVGGEVCVVDLQGGMYRSLTEDYPGSFCSVRWLNS
FT                   SCVLAIGYENGNACLLALSLDGNRRRLWLEESMVSHRWCARFTLNRHKNFGVLIKESHS
FT                   SPPDVWSFALSDSDISEWKKITDVFPDLRSKYNGEPKTIVWKSSDGLDIQGIFLHPRNF
FT                   SGVKPPLVTIVHGGPSSMYHHSFLGSYFLAPVLVSNGYAVFLPNPRGSYGWGTAFAEAN
FT                   LGDMGGMDKEDIISGIEYLLELGYVDPSRLAIAGWSYGGFMTAWMITQTDIFKAAVMGA
FT                   GIANWRSFHGVTNIPTWDKLYYRDDPYKLGGRFDKFSPVNWVSSAKTPTLILHGEKDAC
FT                   VPVGQAYEMYRALREHQVTTKLVVYPGQGHGIDKKSYVRDMYERILDWFGEHLRE"
FT   gene            complement(265211..266122)
FT                   /locus_tag="Tter_0249"
FT   CDS_pept        complement(265211..266122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0249"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; polysaccharide biosynthesis protein CapD; short-
FT                   chain dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: bja:bll0593 putative oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41171"
FT                   /db_xref="GOA:D1CE15"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE15"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACZ41171.1"
FT                   /translation="MSKVLITGAAGTLGQALIPVIAGAGYHLELVDIQPIESEYEFHQI
FT                   DILDADALSPVMEGVDFVVHAAGLHGIHLSTRSPREFYSINLTGTFNVWEASAQAGIKG
FT                   FVFCSSVSVYGESRRPPREDAVVALSENMPLLPSDIYGLTKFLGEEMSRYYVRRYGVPA
FT                   VALRLGMFTPEPFFRHGIRLLYGGVDPRDVAQAVLKSIQAMEAGKIRWEVLNIASEVPF
FT                   TKEDGPQLRKNPLPVLDKYYKDAVNLLKERGVERLYPIHEFIPISKAEEKLGFRPEYNF
FT                   SWWLQELEQHPDYRTPKNPPWP"
FT   gene            266252..267427
FT                   /locus_tag="Tter_0250"
FT   CDS_pept        266252..267427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0003316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41172"
FT                   /db_xref="InterPro:IPR007362"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE16"
FT                   /inference="protein motif:COG:COG4328"
FT                   /protein_id="ACZ41172.1"
FT                   /translation="MRFIGIDLAWSLINADRPETGAAVIDESGNILSQANLSTDESILD
FT                   FVLSNIDQEGAIVAIDAPIVVPNLEGSRRCEIALQSMKIPVYPSNRSLLEKNLGGIRGE
FT                   ILTHKLEIHGFRIQDSISPGEPTKAIVEVYPRATISRLFGKVPSYKGSKAKRSVLAHGI
FT                   LHLNRLIQEALDPPIRWIRSPIEDPARLETLTPRQLKHIADILDAVLAAYVGYLAWKED
FT                   GRVEVIGDVHEGFILIPTTHERLPQQSQIRTPKWLVSEYKQQAIRFFKALVDADIATLE
FT                   RMLPQDYQGVELSNGRTLNIEDTYKTVSSLRGLGLHLDFEDIVGEDSKICVVYRISNRS
FT                   TGKDVRCMSLLQFRQDKIQKAYHSHELRHIVEVLLDNPAEEVTHERDSTKH"
FT   gene            267402..267722
FT                   /locus_tag="Tter_0251"
FT   CDS_pept        267402..267722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41173"
FT                   /db_xref="GOA:D1CE17"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE17"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41173.1"
FT                   /translation="MKEIVPSISNQSKALVPLKSALRTSSRGLLTRLISSRVGVPAALI
FT                   AGGAIGGALVSNTVRRLIINGKQPPAHEKRSFIIQMTRLRVITPGLGHETLTYRVVRAD
FT                   EE"
FT   gene            complement(267736..268269)
FT                   /locus_tag="Tter_0252"
FT   CDS_pept        complement(267736..268269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0252"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: rec:RHECIAT_PC0000391 probable nitrilotriacetate
FT                   monooxygenase component B protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41174"
FT                   /db_xref="GOA:D1CE18"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE18"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ACZ41174.1"
FT                   /translation="MPIDPFLFRRVMGQFVTGVTLVTTLLEDGKPWAMTANSFTSISLE
FT                   PPIVMVAITRGLTTNNAVRSSRVFGVNILRADQIWIARRFASSNRPPDQFADIDMKIAT
FT                   TGAPILEECLAWLDCRVTDFVEQGDHTVFFGEVQELSLGSVGDPLLYYNSAYARLIPEM
FT                   ANFDEFIPRPSNKE"
FT   gene            complement(268374..269456)
FT                   /locus_tag="Tter_0253"
FT   CDS_pept        complement(268374..269456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0253"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; Methyltransferase type
FT                   11; KEGG: THUMPD3; THUMP domain containing 3"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41175"
FT                   /db_xref="GOA:D1CE19"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE19"
FT                   /inference="protein motif:PFAM:PF01170"
FT                   /protein_id="ACZ41175.1"
FT                   /translation="MKRERSKPSKLKPAPIQNVFYEVEFVPGLEPFVLEELHEKLVNLE
FT                   EIYPYVKSGNFQFNFYGDPRQLLKLRSVGSAFVVKLFEVPRPLALLGHQNFSQLLTLIE
FT                   SVLSLHPEGSFKTFRISAAGSDSPVFRRIYKELELSTGLIPSQDGDLFLRVRKPIVRGD
FT                   GFEVSIRLTPRPLSVRPWRVCDFPGAINSTVAYVMARLSEPSAGDVIVNLGCGSGTILI
FT                   ERLEMLPAKAVVGVDIDPEALACARRNVYAAGLTGKVDLLRGDMRSTGLNSGFADVIYA
FT                   DLPFGHILGSHADNIHLYPDTLKESARIAREGARGIFITSEIRLMRKVIDLCKHLWRQE
FT                   GEVRLEMDKLRLMIFVLSRL"
FT   gene            complement(269580..270092)
FT                   /locus_tag="Tter_0254"
FT   CDS_pept        complement(269580..270092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0254"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; Ferritin Dps family protein;
FT                   KEGG: nis:NIS_1151 bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41176"
FT                   /db_xref="GOA:D1CE20"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE20"
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /protein_id="ACZ41176.1"
FT                   /translation="MAMHTTSSHSIYAEENAAKREKIIQLLTKAYWMEIESVMNYITNS
FT                   VNPDGVRAREITEALSQDIQEELGHAQMFASRIKELYGVVPGSMDFKPEQSYLQPPENQ
FT                   TDIVHVIKGVIEAEKGAIEFYTQILHETEEVDLVTQDMVIDILHDEQGHLRLFEGFLRE
FT                   YEAEGKA"
FT   gene            complement(270152..271360)
FT                   /locus_tag="Tter_0255"
FT   CDS_pept        complement(270152..271360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0255"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: dde:Dde_1267 peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41177"
FT                   /db_xref="GOA:D1CE21"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE21"
FT                   /inference="protein motif:PFAM:PF01546"
FT                   /protein_id="ACZ41177.1"
FT                   /translation="MTIDRLREVAASHRDRIADFCSRLIQTPSLPGQEMQAAELIMSEM
FT                   KALRYDDVWQDEVGNVIGLIKGDRSGKSVMLNTHMDHVDIGDRSSWDYDPYSGEIRDGY
FT                   VCGRGAVDIKGPTSSQVYAPFLAREAGLPIYGDVYVVGVVQEEVGGLGSIELGKSLRVD
FT                   CAIVGEPSSNTLRRGNRGRIEIIAIFRGRSCHASMPDKGINPHYSMANFVAALRHLDRV
FT                   EDPFLGSETFTPTLVYADQTSSNVVPSELRLHIDWRTVPQRSPDEIKEMLASLLEKSLV
FT                   DGAWGEIKVKDITLTTYTGATRNVPAHFPPFLIDEEHPLVRIAQEALSESFSRKVEVKR
FT                   WDFATDAGHLVAAGIPSIGFGPGDETLAHTNQERISIEEMVEASMAYAFLCHRLTNPAA
FT                   WAS"
FT   gene            271451..272611
FT                   /locus_tag="Tter_0256"
FT   CDS_pept        271451..272611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0256"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   mgm:Mmc1_0698 L-aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41178"
FT                   /db_xref="GOA:D1CE22"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE22"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACZ41178.1"
FT                   /translation="MRSFIAERLQQVKPSATISIADKAKQLKADGKDIIDLSGGDPHFP
FT                   TPQHIVQAAFEAINRGETHYSPSRGTPNLLRAIQKKFASENGLEYSLEEIIVTPGGKHA
FT                   IYATLVATVNDGDEVLLLSPAWVSYEPSVYLAGGRPVYIPLEPEDYRITPEILRSVEAP
FT                   RAKVLIFNTPNNPTGRVATKEEIEAVAEFAIERDLLVISDELYEKILFDGHEHISIATL
FT                   PGMRERTVTINGVSKSYAMTGWRLGYLAAPRQIASQVLKVHQHSVTAAATFTQEAAACA
FT                   LEGPQDVVEYMVKEYEKNRALVVEALNAIPGIECKAPEGAFYAFPKVDGDSIKFADAML
FT                   EKAGVALTPGIAFGPTGEGHVRISFATDYNLLEKAFDRMKRAVVGR"
FT   gene            272601..273221
FT                   /locus_tag="Tter_0257"
FT   CDS_pept        272601..273221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0257"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="KEGG: gbm:Gbem_1611 transferase hexapeptide repeat
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41179"
FT                   /db_xref="GOA:D1CE23"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE23"
FT                   /inference="similar to AA sequence:KEGG:Gbem_1611"
FT                   /protein_id="ACZ41179.1"
FT                   /translation="MGDKSRPISIFHPRINKPRFYPLLRIFTEIILLRYRLTMRGRLRI
FT                   GRGFICNQRLRISGPGKVVIGDWVNAWAHQEPTMLITADKEAKIIIGNNVRLNGPTLIA
FT                   SRQIEIGDLCILGSAVVFDTDFHSVHKDRSTNRDAPVRKSPIKIGKNVWLAGQCAVLPG
FT                   VHIGDDSVVGFRAVVTKDVPAGVIVAGNPARVVREISEESRHS"
FT   gene            complement(273224..274945)
FT                   /locus_tag="Tter_0258"
FT   CDS_pept        complement(273224..274945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0258"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; TrkA-N domain
FT                   protein; KEGG: mfa:Mfla_0658 potassium efflux system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41180"
FT                   /db_xref="GOA:D1CE24"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE24"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ACZ41180.1"
FT                   /translation="MHEADLLTNLVLALSVAAIGGLVSTALKQSPIIGYLLAGIIIGPF
FT                   TPGPVSNVEIISQLADIGVIFLMFAVGVHISIKEILSYGKLVLIGAPLQVLAVILIAMA
FT                   IGRLIRMDTGTSLVLGFVVAISSSVVISKVLEDSGEGSTDHGGIALAWGAIQDIVTIIM
FT                   VAVMPLFSSVGTDNNSVLLSMVKTFGFLVIAFGGGFFVLPWFMNRLALLRNREVLLLAT
FT                   AAVALIAAVGASMFGLSVALGAFVAGLIVSESEISHQILGDIVPIRDVFSALFFVSIGM
FT                   LLDPRMIISDWHLVVLGLVLILIVKSLISTGIMLAMGYAIKTSVLVGLLLAQCAEFSFL
FT                   LASIGRDLELLSENSFRLMLATTTISVIINPFIYRLRAPIVSFVNNLISANNIPQPTQY
FT                   ATPDIDLPDRRHAVLCGYGRVGAVVGAALRRRGFPFVVIEEDPRIIKELRRRGIPAIIG
FT                   NAANMSVLSAANVESARILIIAISDAVATRIAVENAKALNPNIDIVARAQSAKERDYLR
FT                   HRRVSHVVLGEMELALEITRFTLHRFGVSGGEVQAILQGLRERSEAELGSGSLYDL"
FT   sig_peptide     complement(274859..274945)
FT                   /locus_tag="Tter_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.709) with cleavage site probability 0.567 at
FT                   residue 29"
FT   gene            274979..276103
FT                   /locus_tag="Tter_0259"
FT   CDS_pept        274979..276103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0259"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; CBS domain containing protein;
FT                   SMART: CBS domain containing protein; KEGG: sfu:Sfum_2488
FT                   peptidase M50"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41181"
FT                   /db_xref="GOA:D1CE25"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE25"
FT                   /inference="protein motif:PFAM:PF02163"
FT                   /protein_id="ACZ41181.1"
FT                   /translation="MSMNPLSGFRLCKIFGIPIYVNPTWFLVFALIVYSLASDRLPEFI
FT                   PGSSNLFYWLAAIVGTLLFFLSLTAHELGHSLVSKSFGIPVRSITLHMFGGIAQLGSEV
FT                   RRAREEFWIAIAGPIVSFALFLTFWGLSDIITSSMPAIGSFLSLLALLNIGVALFNLFP
FT                   GFPLDGGRILRSIVWGISGNYIRATRISALGGQLFGYLLIAAGVLFAILDRYLGYLWMV
FT                   LLGAFIIILARQSYRQSLTYHKLSNIKLADVYIPLVHVEEDTLVSDLFTDYIRSSGRQF
FT                   FIVDFHGEPVGLLTPYEILRLPQPFWHITPVRSIMINLASVGRLPADLSLFDAMNLFER
FT                   TGHNLFLVIDDDRIEGIVTRDTVVHVLGRTTSRV"
FT   gene            276170..276298
FT                   /locus_tag="Tter_0260"
FT   CDS_pept        276170..276298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41182"
FT                   /db_xref="GOA:D1CE26"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE26"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41182.1"
FT                   /translation="MEEDVRRRLLKGLLGLVLGIVATWLAAYITDLILGPEGETKS"
FT   gene            276456..277622
FT                   /locus_tag="Tter_0261"
FT   CDS_pept        276456..277622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41183"
FT                   /db_xref="GOA:D1CE27"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE27"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41183.1"
FT                   /translation="MSGIRVTSYQGVDPRRFIAGFLAGISIVLFLLLIFALLVFTGGFW
FT                   ETLRDVSFQIRSGHSFWSLLLQSLKQTLLSFPSYLWSARNGFFVMGILGIILAFIDETG
FT                   NRLRLLWAENLGLVVLVAILSFSTTTGAFIWQEKAVERLANNPGLFYDLRSLLVSNTTW
FT                   LFMAILTSLAFSYLIWISWIWWQDFWCRVFGTHRPTGETNTATSFDTSTYSRGNSSSKI
FT                   GIAFVLLAAIATVALLKAYSYHSSKLITSELWITKDSPRGEVLFSFKQDPEFVVASNVA
FT                   GRGNVNFDVLTKNQNSIIQNNTMKLSESPNSYSSVKLPLQGNAPGDFLVKASLISGEGG
FT                   LIRFVAVDGSTSLALVLAVLIGFCVSLAMTSLLVTFLSYRARESKHAL"
FT   gene            277640..278863
FT                   /locus_tag="Tter_0262"
FT   CDS_pept        277640..278863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0262"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="PFAM: Pyrrolo-quinoline quinone; SMART:
FT                   Pyrrolo-quinoline quinone; KEGG: aba:Acid345_4167
FT                   pyrrolo-quinoline quinone"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41184"
FT                   /db_xref="GOA:D1CE28"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE28"
FT                   /inference="protein motif:PFAM:PF01011"
FT                   /protein_id="ACZ41184.1"
FT                   /translation="MISKFVRSAYSQTKLILFGIIAVVALLYAILRTGLSFTLPHALTD
FT                   EKSKITSSKSWPMEGFNPARTRSVNYELSPPLRQIKVISLRDDVGTGSPPAIANNTLFI
FT                   DSNKSLRAIDERKARELWALPLAGEYLSPALYKGLVIIRSESANQGQVLALDVQTGRIR
FT                   WAFQPRRISSASNDYWGGHITSPVIVDDEVFIGAGKELYALDAGTGTILWEYDMADYVS
FT                   SSAAVDKNKVVISDAQYLYAIDKNNGKLIWKTPIKFSVFFSPVIAEGYILATSDKSIVV
FT                   ADLQSGKQVWTKAIAGETLIPVGTDGKLAFAKSSWTLRAFDLKTGRELWAYKDGNFVSM
FT                   PVITKTNIFVVSGVSAQTHIRCLEKSTGKVLWSLSYPNLSNASPVLSDGKLYVRTSKGQ
FT                   VIIFSPQG"
FT   gene            278981..279934
FT                   /locus_tag="Tter_0263"
FT   CDS_pept        278981..279934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0263"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: scl:sce3058 sugar ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41185"
FT                   /db_xref="GOA:D1CE29"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE29"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41185.1"
FT                   /translation="MAMLGILPKGKLARREALWFWFFISPWVFGYLVFTLGPILASFYL
FT                   SLTRYNIASPPKFIGLANYQLLLQDPIFWKSLKVSAYYTFLSVPLGIFFSLMLAVLLNQ
FT                   KVPALGVFRTLFYLPAILPAVAATLLFVWLLNPDFGIVNYVIRSLFGTNGLIPLGWNGP
FT                   DWLGDPKWVIPSFTLISLWGFGGPMLIYLSALQGVPTQLYEAAIIDGAGRIKRFWHITI
FT                   PMISPVILFTFITGIIGSFQVFTQAWVVNGGTGAPDYWSMFYVLYLFLNAFRRYRMGTA
FT                   AAQAWLLFLVILALTILFLWASRRFVYYETSEGGRF"
FT   gene            279959..280882
FT                   /locus_tag="Tter_0264"
FT   CDS_pept        279959..280882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0264"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sme:SM_b20969 putative
FT                   sugar uptake ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41186"
FT                   /db_xref="GOA:D1CE30"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE30"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41186.1"
FT                   /translation="MAEITTRPTVARPQVNFWQNKKFQDRAITIGATILCIIGVIIILF
FT                   PVAWMLSTALKTRAEVARFPPTWIPADPQWINFRDALFSTENPFPTYFKNTMFYALMAM
FT                   IGETLSCAFIAYGFARLRAPGKDILFLLVLATMMLPWQVTLIPQYVMFVKLDRMHFLGL
FT                   DWINSYAPLIVPKFFGSSYLIFMLRQFYRGLPKDYEEAAIMDGANYLNIWARIILPLSK
FT                   PALGAVAILSFMYHYNDFMGPLLYINDNAKYPVSLGLQQFRAPFGGTAWHLLMAASLVT
FT                   VLPPVIVFFVAQRYFIQGIVISGVKG"
FT   gene            281011..282543
FT                   /locus_tag="Tter_0265"
FT   CDS_pept        281011..282543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0265"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bha:BH1864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41187"
FT                   /db_xref="GOA:D1CE31"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE31"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACZ41187.1"
FT                   /translation="MPKLTNWYTKYKFPVLFVYLMIVALIIAACGGGAGSNTPTASQPA
FT                   ASTGEMGASNTPVPTIVATPPAIARQATGVPDIQCKPDQKQLVWMVRNGPVENQWEANI
FT                   VRPEFQKAHPEICLKILSINQDDIAVKRQAMIAAGEPLHVWSPNWGGDGFASDRIRGLI
FT                   ADLTPLIQRDNFDLSVFDPNVLKIYQIDGKTWALPFLTTGSFVYYNKELFDKAGVPYPP
FT                   TSWDDTSWTWDKFIATAKKLTKNTNNLNKAQFGAANGLWPPVDAIGALWGYWIIPDEAQ
FT                   QTGFSDGVQVVNDRTIKAFQAMHDLVYKDKVAPNNAAVSALTQLGGVFESGRVAMFMTG
FT                   GWGHWSYHPLIDDPNGFCWGAAPLPMGTPDAKRRAVLFTDPWVITANLSPEEQDLAWTF
FT                   IKFLVSEDQARKYMEATGTPPTQTKLMQEYYKQFSKCMKPEDMKEVFEGAFSHGRESSN
FT                   HLLVKFDELNQIWDNGLATFWNNPNAKAEDVLKKIEPQFNSALKRIKAEEGQ"
FT   sig_peptide     281011..281136
FT                   /locus_tag="Tter_0265"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.386 at
FT                   residue 42"
FT   gene            282639..284888
FT                   /locus_tag="Tter_0266"
FT   CDS_pept        282639..284888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0266"
FT                   /product="Spermine synthase"
FT                   /note="PFAM: Spermine synthase; KEGG: ade:Adeh_3062
FT                   spermine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41188"
FT                   /db_xref="GOA:D1CE32"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE32"
FT                   /inference="protein motif:PFAM:PF01564"
FT                   /protein_id="ACZ41188.1"
FT                   /translation="MRIKVRGIILIMFFMSGVTSLIYEVSWFRQLSLTLGVSAYSAAAV
FT                   VSAFMGGLALGGWLGSKIIKRVDAIKFYACLQLLIACCAFLTPVVFKFMPSIYTSLYNE
FT                   YNPDFYLFNLLRFGLACMVLLWPTTLIGMTFPAVSQAYTIYNQRGKDLGSLYSVNAIGS
FT                   VLGALLSGLVLIRLLGTRDTILISGIIDLMLAALAFAISSRIVKQNKDLRTLQANPQNI
FT                   DLYPKRLVNIAFWGFALSGFVSLGYEVVWFRILSNFTLNSVYSFTVLLSIFILGLSIGS
FT                   FLASRLVDSAKSPISAFAIIQLGIGVSAVLSLYVFHRLPTILLRIGLPSSALQEITIEV
FT                   IAAALTIFVPTVLIGATFPLAARIYTNSNVYKIGNPAGKLYGANTVFSMIGSLVAGFLL
FT                   IPTMGLQKSVLMLALVNILIGIAALLQISDPPKIEAYALLGTAAIGALLLPQGVFLGFR
FT                   EGTNPYLVYYKEGVDANVSVFIVPNPPLKISFVNGRNEVPTDRYSMRAFYLMGHLPALL
FT                   KPDAKSALVLSFGNGIATGALSRHKIQHIDAVEIVAQQVEAARFYQPENRNVLSYPGLN
FT                   ITIEDARNYLLRSDKKYDIITADATHPTNSSSWAMFTQEFYKLARSHLSPDGVMVQWLP
FT                   IHDISKEDYISIIKTFQSVFPHTTLWYVGSTHTLLVATPHKLSTQEVLALDSLIDKRGI
FT                   RDDLIDSRTLVSNYLMNEDQVRKYSSSGSIVTDDKAFFLPAMDDGVILQSFQLAK"
FT   gene            complement(284958..286286)
FT                   /locus_tag="Tter_0267"
FT   CDS_pept        complement(284958..286286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0267"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bxe:Bxe_C1347 putative mandelate
FT                   racemase/muconate lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41189"
FT                   /db_xref="GOA:D1CE33"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034610"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE33"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ACZ41189.1"
FT                   /translation="MSVTITDIETYDIRFPTSRNLDGSDAMNPSPDYSAAYVILKTDSP
FT                   DGLEGHGLAFTIGRGNEIVVSAIQALSYLIRGLTLEYITSDMGTFWYRLVGDSQLRWIG
FT                   PEKGAIHLGLAALVNAVWDLYAKAEGKPLWKLLVDMTPEQIVSCVPFRYIRDVLTPQEA
FT                   LEILKSNEPTKHIREREMLERGFPAYTTSAGWLGYSDDKLAALCRRCVEEGWSHFKMKV
FT                   GANLEDDIRRASLIRDIIGYDCALMMDANQVWDVDQAISWMKELSKFNPVWIEEPTSPD
FT                   DILGHARIAREIAPVGVATGEHCHNRVMFKQFMQANAIDYCQVDACRLGGVNEVLAVLL
FT                   MAAKFGIPVCPHAGGVGLCEYVQHISIFDYIYVSASLENRVLEYVDHLHEHFVDPVVIR
FT                   NGNYMPPTSPGYSITMKKESLEQYQYPTGIVWSLSESQSRKTM"
FT   gene            complement(286336..287088)
FT                   /locus_tag="Tter_0268"
FT   CDS_pept        complement(286336..287088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0268"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bbr:BB1748 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41190"
FT                   /db_xref="GOA:D1CE34"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE34"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACZ41190.1"
FT                   /translation="MRLEGKRAIVTGAGSGIGKAIASRFAQEGARVVIADIDLEAAEIV
FT                   AKELGDNTKPYRVDVSKAEEVHKLINHVVDEWGGLDIMVNNAGVGVAATTTETSEEDFD
FT                   RIIAINLKGTFLGMKYAIPAIRNSGGGSIINIASVAGLVGVPERAAYCASKGGIVALTR
FT                   AAAIDHISEGVRINCICPGTVLTPWIERITANYPDPEAARAAMEARQPHGRFVMPEEIA
FT                   AMAAFLASDEAGSIVGAAMVVDGGMTAK"
FT   gene            complement(287095..287937)
FT                   /locus_tag="Tter_0269"
FT   CDS_pept        complement(287095..287937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0269"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   scl:sce8243 fumarylacetoacetase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41191"
FT                   /db_xref="GOA:D1CE35"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE35"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ACZ41191.1"
FT                   /translation="MILTRHWDDDGPRWALDGYYMPRAFKLEMLMQVPAANLQEVLYRL
FT                   STGQEADGHILAPIEPNQEVWASGVTYLRSREARKAESERGDIYDDVYDAERPELFFKA
FT                   IGWRVVGDEGTVGIRSDSAWNVPEPELVLLINNQMEIVGYTAGNDMSSRDIEGSNPLYL
FT                   PQAKVYERSCAIGRGIKISPEGEISSIDIRLTIYRAGSCVFDAETNTAQMKRTLKELVA
FT                   YLGKSMSFPYGVFLMTGTGIVPDEDFTLLEGDEVRVRVGEIQLTNRVITIPDKTRLTR"
FT   gene            complement(287954..288928)
FT                   /locus_tag="Tter_0270"
FT   CDS_pept        complement(287954..288928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0270"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: ypm:YP_1303 putative D-isomer
FT                   specific 2- hydroxyacid dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41192"
FT                   /db_xref="GOA:D1CE36"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE36"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACZ41192.1"
FT                   /translation="MSVYKVLITDAEYPDLSDEQRLLEEAGCQVSIAQCRLPEEVILAA
FT                   RDAFALMVQYAPITSDVIHALPNLKLISRAGVGVDSVDLDAAKEKGVWVANVPDYGVHE
FT                   VASHAAAMILSLLRHVCFLDRKVREGVWHYLSTGEIHRISSLTLGVVGLGRIGRTLASM
FT                   MLHVFGRVIGYDPYLPANAWPEGVDRVDLRDLFMKSNVVSLHLPLTKETSNMVNREFLA
FT                   LMPVGSYLVNTARGGLVNMEDLIYFLDSGHLAGAALDVLPKEPPVAGDPIIHHPKIIIT
FT                   PHVAWYSEESEKELRYKWAMNVVAFLKNGSPLYPVVMPVERSS"
FT   gene            complement(288931..290094)
FT                   /locus_tag="Tter_0271"
FT   CDS_pept        complement(288931..290094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0271"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41193"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE37"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACZ41193.1"
FT                   /translation="MQTLRVLFVGGPMYDPLYTRLREFEDAHNIKVEIVATLIHPELNR
FT                   TIAREFSEGTADYDLISTHTKYAPSQMQWLTPVDDVWSIDELSKFNPMTLELARINGEL
FT                   YGIPRNLDVKLLHYRSDMISTPPRTWEELYELAVALRKEDFYGFVFPGKESGLFGHFFE
FT                   LTAMAGGNLFPNPELPEPNATTEASKWAITLLKNLYTRAAPPQTPDWHYDEVAQCFREG
FT                   LAAMSTDWPGGFYTYEDPKLSKIVGKYDLSMYPQGVAGRKVYSSSHTFAIPVTVKDRAA
FT                   AVELLRFLTSRESQAFEARFGTLPARQDSLEDAESECEPGTLQSRRWSLLEETSKFALL
FT                   PPKHKNYPFVEDVIWQNVRQALIGNIDVDQALENINKEGSAAARGES"
FT   gene            290193..291161
FT                   /locus_tag="Tter_0272"
FT   CDS_pept        290193..291161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0272"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: ret:RHE_CH00494
FT                   L-fucose dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41194"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE38"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACZ41194.1"
FT                   /translation="MEKQQTLPLRPLGSTGLQVTPICVGCAELGNMPETFAYSVEEEIA
FT                   LQTIREAFKSPINFMDTAAAYGDGESERRIGIVIREMGGLPPNYVLATKADRNLQTGDF
FT                   SGEQIKRSIERSLNLLGLDKLQLVYLHDPEHSTFEYITSKGGAIDTLVAYKDQGVIEHI
FT                   GIAGGPIDMMIRYVELDVFEAVITHNRYTLINRSAEPLIDLAHKKGLAVVNAAPYGSGI
FT                   LAKGPDAYPRYAYQEAPDKILNRVRVIDEVCKRYGVPIAAVALHFSLRDPRITSTIVGM
FT                   SKPERIRQTIDLVNTHIPAGVWEELEPLDYDTEDPEANRWK"
FT   gene            291217..292053
FT                   /locus_tag="Tter_0273"
FT   CDS_pept        291217..292053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0273"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sus:Acid_1947 xylose isomerase domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41195"
FT                   /db_xref="GOA:D1CE39"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE39"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACZ41195.1"
FT                   /translation="MNNRISCHLITWGNDLLTGMKEASELGFQACETFTHQALEYENRV
FT                   EEFRELLGSYDLELSALYGGGRFSDPSKEAEVIAYNTRVAQFLSKLGVDRIVFGPGGPR
FT                   EGKTSLEGLKQMAKTINEAAKRTYDLGVLACVHPHLGTELQDEDELDAVMEMTDDRYVF
FT                   FCPDTAHLTAAGMNAAEIIRRYGNRMRYMHLKDLTPENPDPSVFTAFSGTEALPIFCEL
FT                   GLGTIDFVPIMQALQDVGYDGWLTVEIDQSTSTPYQSLKQCRDFVQDKLGISIRYR"
FT   gene            292059..293096
FT                   /locus_tag="Tter_0274"
FT   CDS_pept        292059..293096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0274"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: probable dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41196"
FT                   /db_xref="GOA:D1CE40"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE40"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACZ41196.1"
FT                   /translation="MSFKIGIIGCGRIVEEGHAPALSNMRHVAEVVALADPSPERRATI
FT                   ENVLNYKVSGQYSSWKDLLENTPNLDAVLIALPHHLHEPAITDAARFGVNVISEKPLAA
FT                   TLEEVDRIGAVIKEHNVKLAVIHNYTYSRPMRYALRAIQEGRVGEVFLVRSEGLAGSHY
FT                   KGKDPSNPDWRTQSTRGGGGVLLDNGYHNMYVAEAEAQSPVIKVYARVGRYVREQDVDD
FT                   LAVVMLTHENGATTVVEVAWAVNGGGAFVHEVHGKLGSIRFKIEAPFVEIYENKIGQWL
FT                   PLSYADDNFQEGFHGVLQDIFNAWAQGEDAPTNLAKARHNLAILRAAYLSAQQGTVVDL
FT                   KDVER"
FT   gene            293351..294496
FT                   /locus_tag="Tter_0275"
FT   CDS_pept        293351..294496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0275"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   aba:Acid345_3531 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41197"
FT                   /db_xref="GOA:D1CE41"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE41"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACZ41197.1"
FT                   /translation="MFKQAGKSLRVAIYFMVFSVFCFVLSGCSVPGVAQVPPTPTPLPP
FT                   QPEVEKPIYTVKRGDIVELLRLTGRVSAVNEKDLQFTKSGNVLKVNVEVGDKVRKGQLL
FT                   AELDQSDLVKQLEQAQLELDQANLALQQYQNQHQTDVALAELDLQEAQLKLEAATSELD
FT                   RKLAEIAVKRAQIKLDQIKKATNEELQKQVAQARLNYERIKDQIDAGRIYAPFNGVVEI
FT                   VNIKPGDPVQPFQSVMTIMDPGEKEIRVDNTTSAELSQLSPHQKVQIRFLRYSDKVVSG
FT                   EIRMLPTGDQGSGGAIRISYNPDGLDVDIGDIANITVILQQKRNVLWLPPQAIRTFQGR
FT                   QFVVVQEGDRQRRVDVELGIQSQDKVEITSGLKEGQKVVGQ"
FT   sig_peptide     293351..293455
FT                   /locus_tag="Tter_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.971 at
FT                   residue 35"
FT   gene            294524..297415
FT                   /locus_tag="Tter_0276"
FT   CDS_pept        294524..297415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0276"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41198"
FT                   /db_xref="GOA:D1CE42"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE42"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACZ41198.1"
FT                   /translation="MYWLLNLLGIVKIAFLRQKSYLGLVLALLAGFIVAITLVVSIPLY
FT                   ADAVGYRILRTELLEEQEGNLRPPFSYMFMAVASNEQRVPISGFRSADEYFTKYGARDL
FT                   GLPPLVYVRYVTTDKIRLLAPEGTAYKEEKGEEQLEWVSVGFASGLEKKVRIVEGRWPK
FT                   IASNDSNSPVEVLVHEGLADKLGLHVGENYIVMEKGVGDNLLRLPIKISGIWEPIDPSD
FT                   SYWFIRPQSLQDVLMVPEQTFSQRILRTHPNDGIYMALWYYVLDGTSVRSRHAQELIGR
FT                   MQGVERHAATLLPAVELRVSPEDALTEQHTQVRFLTLSLIVFSIPILGLIAYFIIMITS
FT                   MAVQRQQNEIAVLRSRGISRSGILGIFLLESLGLGILALVLGLGLGQYTALAMGWTRSF
FT                   LDFIPRYDFPVELSPESIRAGTWVMVLTLIASVVPAVGAAGHTIISYKRERARSLGAPF
FT                   WQKIYLDILLLIPAWYGYQQLKQRGTISFLGEGLPSDDPFKNPLLILTPVLWLLALGLL
FT                   SMRILPIVLGFIAQLIGRLKGISSVMALRYLTRTPRAYSGPVMLIVLTLSLATFTASMA
FT                   KTLDRHTYDRVYYDIGADMRLADLGQSTEPSSAGPGGGSSQQQPEQQDEGTPKWLFLPV
FT                   TEYLKVPGVENAMRVTRSDTEAVVGNSRQRGTLLGIDRMEFPKIAYWRDDYATYPLGYL
FT                   MNALGTFEDGLLVSRDFMREQGLSIGSKITLNLWDVEESKPVPFTIVGELNYFPTLYPE
FT                   DGPFFVGNIDYIFQREGGEFPYEVWLKVKPGTTKEQIELSTTKLGFRSIVTDVAQPEIE
FT                   SDQGRPERQGLYGLLSVGFLASAILTGLGFLFYSIVSFRRRFVELGTLRAIGLSTGQMA
FT                   AMLACEQLIIIGLSVVIGTVLGVLVSDMFIPFLQVSTGEHPQTPPFLVLIAWDRLMLIY
FT                   LIFAVLLGLALVMLAMLLLRMKIFQAVKLGESV"
FT   sig_peptide     294524..294664
FT                   /locus_tag="Tter_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.822 at
FT                   residue 47"
FT   gene            297412..298416
FT                   /locus_tag="Tter_0277"
FT   CDS_pept        297412..298416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0277"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ccs:CCNA_02006 lipoprotein releasing system
FT                   ATP-binding protein LolD"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41199"
FT                   /db_xref="GOA:D1CE43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE43"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ41199.1"
FT                   /translation="MSEPIIICENLVKIYKLAQVEVLALQGLDLTVERGEVMALVGPSG
FT                   SGKTSLMNVIGGLDRPTAGRVVVAGQELLKLSDRQLNHYRRHVVGFVWQQVARNLVPYL
FT                   NAEQNVELPMLMAGIKPAERKAWANELLEVVGLGNRKKHKLAQLSGGEQQRVAIAVALA
FT                   NKPQLLLADEPTGELDSATAKTIFDIFHKLNEMYGITVVIVSHDPQISRHVSRTVAIRD
FT                   GKTSTETLRQVVETEKEDEAKEEQHHFIEYTVLDPAGRLQVPEEYRELYRIGRRVILET
FT                   LPDGIVIRPVPGEEVTTVQPLVDEDEPPPKKQNLVSRIRKFLPMGSKGESEQK"
FT   gene            298413..299171
FT                   /locus_tag="Tter_0278"
FT   CDS_pept        298413..299171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0278"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: azo:azo3286 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41200"
FT                   /db_xref="GOA:D1CE44"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE44"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ41200.1"
FT                   /translation="MRPESSSQTHPDSWLLDKDGFKQPAIQVVDVVRKYKVGSEEVQAL
FT                   RGINLTVPEGQFVALMGRSGSGKTTLLNIIGGLDRPTTGEVFISGQSLSNLSEGELTKL
FT                   RRSQFGFVFQSFALIPILSAAENVELPLRIAGKYSLRERKQRVMEALSLVGLAKWAEHR
FT                   PYEMSGGQQQRVAIARALVTRPKILIADEPTGELDSKTGQMVLNLLRKVVDESKVTLVM
FT                   ATHDPAVEEYADVLYRMQDGQIIDTLIKTM"
FT   gene            299249..299494
FT                   /locus_tag="Tter_0279"
FT   CDS_pept        299249..299494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41201"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE45"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41201.1"
FT                   /translation="MTQEFFSHGMSVEVLQIHNPLAEDEDDLIVQGYVVDHNEIGLLLD
FT                   GVEGEDGGQIFIPWSNIAQVITIEFEEESGEEEILP"
FT   gene            complement(299491..300057)
FT                   /locus_tag="Tter_0280"
FT   CDS_pept        complement(299491..300057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0280"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="PFAM: blue (type 1) copper domain protein; KEGG:
FT                   predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41202"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE46"
FT                   /inference="protein motif:PFAM:PF00127"
FT                   /protein_id="ACZ41202.1"
FT                   /translation="MKKRLLKIVLLSLTLISCGASSEATPTLPVSQGLPSIVPTTISMP
FT                   TPIPTEEHIASPTPVPSISPITTPTVTEISPSPAASTPPTGSEYSITVTAKGLAFDVKT
FT                   ITVQPGQLVVIKFKNEDSVPHNMAFYTDKTAKEKIFVGKIINGPSSTTYRFKAPNRPGN
FT                   YFFRCDVHPQIMTGTFIVQAKEPGY"
FT   sig_peptide     complement(299986..300057)
FT                   /locus_tag="Tter_0280"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.569 at
FT                   residue 24"
FT   gene            complement(300102..300905)
FT                   /locus_tag="Tter_0281"
FT   CDS_pept        complement(300102..300905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0281"
FT                   /product="protein of unknown function DUF82"
FT                   /note="PFAM: protein of unknown function DUF82; KEGG:
FT                   acp:A2cp1_3352 protein of unknown function DUF82"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41203"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE47"
FT                   /inference="protein motif:PFAM:PF01927"
FT                   /protein_id="ACZ41203.1"
FT                   /translation="MSNFPDTPDKNTPCQVTLRFYAELNDFLPADKRQQDWLIDLDRRT
FT                   SIKDLVESLGVPHTEVDLLVANGDIIDFSYVPKCGDRISVYPEFRSLSLGHHLKPDLDP
FT                   NPKFVLDAHLGKLAGYLRMLGFDTIYDPDSSDLDLAFASKADGRILLTRDIGLLKRKIV
FT                   FRGYYVRETEPKRQIIEVIKQFKLLDKINPFGRCAHCNDLLIDVPKREIIHLLLPKTIL
FT                   YYDEFRRCRGCGKIYWKGSHHEAILRLIESIQEEVSLEPKRLQTS"
FT   gene            complement(300929..302731)
FT                   /locus_tag="Tter_0282"
FT   CDS_pept        complement(300929..302731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0282"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   aba:Acid345_2371 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41204"
FT                   /db_xref="GOA:D1CE48"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE48"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ41204.1"
FT                   /translation="MSSKTYVQERERVGVRQLSQDTALLWLIITTMAPYWRLILVALLM
FT                   LGGVAVLAAVPPYLLQLVIDGPIRTGDTSDLLPLAILYAITVLVSFGFQFGQTYLLQSS
FT                   GQKALADLRKRMLDHMLKQNMDFFNRHSVGELVQRITGDVDALNSLLSTSVVMILIDSV
FT                   TLVTVVVAMFLVNWRLALLALAILPFLAVITVFFRRRIRRTSDVERSLNSMVSGYLNEQ
FT                   IQGMLLVQLFRNEKRSMAGYQDLNARYRRALLWQRKESAQFLSVQEIITAVALASLLYW
FT                   GGKGVLAGWASLGVLVAFVQYTERAFQPVLRLSEQYNNVQIALAAAERVARLLSVEPSI
FT                   KDPQKPVPLGEVRGEIEFRDVYFGYNPEEPVLKGINLHIKPGQSVAVVGPTGAGKSSLV
FT                   SLLARFYDPQKGQILLDGKDIRTLKLDELRHAITVVPQDPICIAGTITDNIRLYDSSIS
FT                   FEEVRRAAEQANAAEFIEQLPEKYDTLVEPGGENLSIGQRQLLSLARAIALSPKGVLVL
FT                   DEATSSIDTATEALIQDALQRILKNRTSIIIAHRLTTIRNADRIIVLERGRIVEDGTHE
FT                   ELLARGGHYANLYNHHMRILMGVA"
FT   gene            complement(302728..304542)
FT                   /locus_tag="Tter_0283"
FT   CDS_pept        complement(302728..304542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0283"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   sus:Acid_3848 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41205"
FT                   /db_xref="GOA:D1CE49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE49"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ41205.1"
FT                   /translation="MRGSSITFLWPYIARRRHWIIGCLFLAAVGGTASAFSPFVLGHAV
FT                   DELKKGVRLDVIIFYAIGLLALSVTVAVFRYLLRMLTGNMAATVTYELGQEFFQKLLVL
FT                   DQKNYAFFGRGDLLSRGTMDFIYIWRFFSAGFQMMLHSLVLLFVGVVLMASSSLPLAAL
FT                   VFISLALIMMVQIFNGPFLERSFDRVQHDVGRLSAFVQEHLGAVRMFKAYSQLREVVEA
FT                   FEDVNRAYARSYTMFALRSGLFSPLPGLVVRLSAAVVLGVGGFMVIRNLLTLGELVQFV
FT                   VYLNLLSNAAIQMSSAYERLQQGAAATARVAEVLRHEPHVKDLPEATEVDIKGSVAMRD
FT                   VGVRAGGRWVLKDVNFEVPAGSTVGIVGPTGSGKSTLLSLIARVQDPDSGCVLVDDRDI
FT                   RTIKLDSLRKAIALVPQQTFLFEMTIRENITIGLEKVTKEDLEYAVNTSRLVNDMPQFP
FT                   NGLDTMVSEGGSSLSGGQRQRTSIARALVRKPKILLLDDAFASVDAHTATQIIQGLTRK
FT                   DLTNGYRRTTFIVTQNLLAVRHADVILVLDNGRIVEQGTHEELVELGGLYANMYANQHR
FT                   ERSNRLDDAVSSAGVQIEDTRREVKTAR"
FT   sig_peptide     complement(304414..304542)
FT                   /locus_tag="Tter_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.542 at
FT                   residue 43"
FT   gene            complement(304707..305732)
FT                   /locus_tag="Tter_0284"
FT   CDS_pept        complement(304707..305732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0284"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG: rle:RL1175
FT                   putative transmembrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41206"
FT                   /db_xref="GOA:D1CE50"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE50"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ACZ41206.1"
FT                   /translation="MSTKGEDHSHEHSGIIHRLADLLHLHTHGDESENFDIEVISSQEG
FT                   IKALKISLLVLLLTSILQLAIYLPSGSVALLSDTIHNFSDALTSLPLWLALSLSRRPPN
FT                   RSYTYGYGRIEDVAGVFIVLVIAASALIAAYESILKFFRPHEVRYPLLVALAALVGFCG
FT                   NELAAWIRISTGKKLGSEALIADGKHAQADGLTSLAVLLGSLGVILGFPLIDPIVGLVI
FT                   AFFIIFILRDVGFKMWWRLMDAVDPSILDAIERSAGSVEGVQDVHDIRVRWLGHNLQAE
FT                   MHVTVDEDLPTYASHKILEDVRHKLFHDIPRLEVVNVHADPCGHSGVDHHEHTSHHVIN
FT                   R"
FT   gene            complement(305809..307101)
FT                   /locus_tag="Tter_0285"
FT   CDS_pept        complement(305809..307101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0285"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III; KEGG: dal:Dalk_2855
FT                   glutamate-1-semialdehyde-2,1- aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41207"
FT                   /db_xref="GOA:D1CE51"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE51"
FT                   /inference="protein motif:TFAM:TIGR00713"
FT                   /protein_id="ACZ41207.1"
FT                   /translation="MKILANNSSKLFQRAQKVMPGGVSSPVRAFRAVGGEPIFIDKAQG
FT                   SRLFDVDGKEYIDFVGSWGPMILGHAHPEVLRLIHEAVDKGTSFGAPNQYELQLAEMVT
FT                   SLVPSVDVVRFVNSGTEATMSAVRLARAVTSRDLVVKFDGCYHGHADFFLVAAGSGAMT
FT                   LGQPDSLGVPNQIASLTASLPYNDIEHVTTFFQERGNEIAAVIVEPVAGNMGVVLPKQD
FT                   FLAKLRELTSKYGALLIFDEVITGFRLSLGGAQQLFDIKPDITTLGKIIGGGLPVGAYG
FT                   GTAEIMNMLAPNGPVYQAGTLSGNPIAMAAGYKTIHILQQDEGVYERLDYMGSYLEKGL
FT                   QDAAKDAGVGVTINRAGSMLTIFFSSYPVSNYQDAKRSDTTMFAKFHSNMLAQGIYLPP
FT                   SQFEAWFLSTAHTREDLDRTIEAAYTALKKI"
FT   gene            complement(307082..308341)
FT                   /locus_tag="Tter_0286"
FT   CDS_pept        complement(307082..308341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0286"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="KEGG: pca:Pcar_3064 glutamyl-tRNA reductase;
FT                   TIGRFAM: glutamyl-tRNA reductase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Tetrapyrrole biosynthesis, glutamyl-tRNA
FT                   reductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41208"
FT                   /db_xref="GOA:D1CE52"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE52"
FT                   /inference="protein motif:TFAM:TIGR01035"
FT                   /protein_id="ACZ41208.1"
FT                   /translation="MSGIFLTGINHTTANADIRERLYLSDPDIATLLAKLNQRFEEAVV
FT                   LSTCNRLEIYIYDSSPDHRYVVSCISSLVNAPEEQITSHSYTKSDREAVYHLMSVAAGL
FT                   DSVVLGESQILGQVRQAWEKAASLDTTGPVLNTLFRYALQAGKDVRTKVPIGRGATSVA
FT                   HAAVELTRSRFGSLRDLCVVVLGAGEMGRLAARNLRSAGVKRITIINRTYERAKFLAED
FT                   IGGEAVPIEDMDLALASADVLITCSLSPRPLVLTSHLEHAVRYKQDRQLLVIDIAIPRN
FT                   VDPQVRSLPSVSLYDMDDIQEICNRNRHARKMAARLAHKELQYWVEEFFKWQHERLAVP
FT                   LIRDVRGKAEQIRKDRLEKTFGILKDLTDEQRYVIDAMSKSIVNAILHNPTIWIKQVED
FT                   EDLKRLFADMWGVNHENPGK"
FT   gene            complement(308422..309120)
FT                   /locus_tag="Tter_0287"
FT   CDS_pept        complement(308422..309120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0287"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="KEGG: pca:Pcar_0240 ribulose-phosphate 3-epimerase;
FT                   TIGRFAM: ribulose-phosphate 3-epimerase; PFAM:
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41209"
FT                   /db_xref="GOA:D1CE53"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE53"
FT                   /inference="protein motif:TFAM:TIGR01163"
FT                   /protein_id="ACZ41209.1"
FT                   /translation="MFHVKQGKLKIAPSILSADFTRLGEQVQEAEAAGADYIHYDVMDG
FT                   HFVPNISMGPYIAEAVKRSTSLPLDVHLMIEDPDRYIPDFVSAGADIITVHYEAVVHLH
FT                   RTVMRIRDLGAKAGVAINPSTPPFMLDEILPFVNLILVMSVNPGFGGQHFIPTSLQKLK
FT                   RLRMMIDDRRYDIELEVDGGIDPNTAEPVAASGARVLVAGSAIFGQGSIEENIRAIRES
FT                   AERGLARQAF"
FT   gene            complement(309192..310064)
FT                   /locus_tag="Tter_0288"
FT   CDS_pept        complement(309192..310064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0288"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: ATP-citrate lyase/succinyl-CoA ligase; CoA- binding
FT                   domain protein; KEGG: bsu:BSU16100 succinyl-CoA synthetase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41210"
FT                   /db_xref="GOA:D1CE54"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE54"
FT                   /inference="protein motif:TFAM:TIGR01019"
FT                   /protein_id="ACZ41210.1"
FT                   /translation="MSILVDKNTRLLVQGITGREGSFHTQQMVEYGTNVVAGVTPGAAG
FT                   REVCGVPVYNTVREAVEATGANTSIVYVPAPFAPDAVYEAASAGISLIVCITEHIPAVD
FT                   EVKMYHYVREKGSRLIGPNCPGLTTPGEAKVGIIPGNIHKRGPVGIVSRSGTLTYEAVA
FT                   ALTAADIGQSTVVGIGGDPIVGTSFREVLEMFEDDPETHAVVLIGEIGGNAEEEAAEYI
FT                   RQMTKPVVAFIAGRTAPPGRRMGHAGAIISGGSGTAESKIRALEGANAHIAETPSQIAE
FT                   LVEVALAGA"
FT   gene            complement(310095..311243)
FT                   /locus_tag="Tter_0289"
FT   CDS_pept        complement(310095..311243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0289"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="KEGG: nis:NIS_0838 succinyl-CoA synthase, beta
FT                   subunit; TIGRFAM: succinyl-CoA synthetase, beta subunit;
FT                   PFAM: ATP-grasp domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41211"
FT                   /db_xref="GOA:D1CE55"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE55"
FT                   /inference="protein motif:TFAM:TIGR01016"
FT                   /protein_id="ACZ41211.1"
FT                   /translation="MNLHEYQSREILAKHGIPIPPGILARSVEEAVEAASSLGYPVVIK
FT                   AQVHSGGRGKAGGIKLVNSQRELEYVAPTILSMNIGGRPVSALLVVPAADIQKEYYLSV
FT                   VLDRELKTFTLIASAEGGVDIEEVAREHPDSILRVPAHPWLGLQPYQARELAYKVGFEG
FT                   SLVRTFVEIAMSLYRCALDVEASLVEINPLAKVSSGDLIALDSKIVVDDNSLFRHPDIA
FT                   EMRDLSQEETAEVEASRVGISYIKLDGNIGCMVNGAGLAMATMDLVKLYGGSPANFLDI
FT                   GGGAHADQVEAAMNIILSDEKVSAVLINIFGGITRCDDVARGIVEGLRNIKRGVPIVVR
FT                   LVGTNEEEGHRILEDAGLRSLSSLEEAAKLAVELASKSTVSR"
FT   gene            complement(311364..312365)
FT                   /locus_tag="Tter_0290"
FT   CDS_pept        complement(311364..312365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0290"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: mxa:MXAN_0643 sensory box histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41212"
FT                   /db_xref="GOA:D1CE56"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE56"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACZ41212.1"
FT                   /translation="MKTSEKLWIYSLVEAMPVALLVFDRDANLLAASPKARAMLLPISK
FT                   GDNHNGSLENPALPASIRESLYRVLKGYSRSESGHATIANTRIEFTVADIGDVVSVAFS
FT                   DPSPGYDENIDYLSIAAHELKTPLTAIKGGTQLLERTLLRNGDLSDRESKLLGMIISQV
FT                   NRLSYMVDSLLDTSRLASGRIKLTKSDHDLRMIVQEAVEEVRSSIPGRNIDIKMPSHEL
FT                   RANIDPVRLSQVIENILRNAVENSDPDKAVLVEAYEDMDDIYLTVTDYGKGIQPKDSPH
FT                   IFEKFYRGAECSGGLGLGLYISSELVKLHGGRIWFESEPGYGTTFYIAIPAR"
FT   gene            312497..313933
FT                   /locus_tag="Tter_0291"
FT   CDS_pept        312497..313933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0291"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 DNA-binding domain protein; sigma-54 factor
FT                   core-binding region; KEGG: pau:PA14_57940 RNA polymerase
FT                   factor sigma-54"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41213"
FT                   /db_xref="GOA:D1CE57"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE57"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ACZ41213.1"
FT                   /translation="MDMQMSQEQNQAQEMTIKASPSLIEANYILSLSLPELRQTILNEL
FT                   SQNPALELVDHETCPFCGEVMVGGKCENCSREDSKTDHTDTVNEDLDSLYYESYSATSR
FT                   SLVSDDEDDFDPMSIVASEQDFHESLRSDLHSILPEEDYEIADYLIESLDENGYLRQPL
FT                   DAIARELGRDVQRVEWVLQRLQEIAPAGVGARNLQECLLLQLRYLEQEGEIIPEYVRAI
FT                   LENYIEELGSHKYGYIARKLKTSPEKVAEARQFIKQKLSPYPSLDPAVGRTWKSPSRST
FT                   YISPDVIIFEREGKLEVEVVEGRQFELRLSPAYQQIAKDLEAHPNSYSENERTHIKEYI
FT                   SRTKMFISNVNQRRKTIYKIASALVELQEDFIRYGVRHLKPLTRAMLADYIGVHESTVS
FT                   RATAGKYVMLPNRKVIPFSDFFTASLSIKDVIKEIIMSEDKALTDRQICDKLRERGIRV
FT                   ARRTVAKYRAELGILPSTLR"
FT   gene            complement(314039..314224)
FT                   /locus_tag="Tter_0292"
FT   CDS_pept        complement(314039..314224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41214"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE58"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41214.1"
FT                   /translation="MYERNPFSYNKAKFQANLIEDLLVSPEDLCRVLEAVNWTMVRLLI
FT                   CEHTSKGYIRVRCIYK"
FT   gene            314406..315608
FT                   /locus_tag="Tter_0293"
FT   CDS_pept        314406..315608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0293"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dal:Dalk_3146 WD40 domain protein beta
FT                   propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41215"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE59"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41215.1"
FT                   /translation="MVLFVFLTSCSWGTTGRNTSKQAVQPTQTSYQRGTKHPEPTNSSP
FT                   RGITPVPTVTPKAGQQQRVKRRDLVLFQSDKAIWKMDPSRGSAEVFLNLTCRELLLNPR
FT                   TQDLTCIQPSKSKSTGLLLINLETHKSKEIVSDNVIQAAWSQDGRYLAYTVTRDSNHDK
FT                   KLELYLDRSLIYIKDIVRGSTIRVGPGIDPAWDPRKPQLFFATLGSRQGNKIMSYSLAS
FT                   RAFKEVVAIKDLPKDLSQYGVPFATKLNLLRHPSISYDGSRLAISAYGSTALLITLDLH
FT                   KPDKNNIHVEDFAPESSFEHLVWGPNSHKLAYEVLTPSGLDQLAVLDVSTGNREIFGDI
FT                   RSGIGYTEPAWAPDGKHLIATRTYRNRAKGIYMITLGNQRIRTLKPGYYSKSLWIRVLT
FT                   R"
FT   gene            315681..316463
FT                   /locus_tag="Tter_0294"
FT   CDS_pept        315681..316463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0294"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC764825"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41216"
FT                   /db_xref="GOA:D1CE60"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE60"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41216.1"
FT                   /translation="MVRKFVPVLLLVTFISLLTLVQASMQAIAQDQATPQPTATVSLTP
FT                   QSGGNSIRGTIAAVSDTDVTINVGNRLVTIPVSEDIPIVRNGKPSTLSELQATENISVQ
FT                   RDKSGKVLSIIVWTSTPTQVAQPTVVASPTVSPTSVSATPTPTERIVTGTITSVGNNSI
FT                   NVSGDDGKTYNFSTSTGNLQITKNGQTVTVSQLNAGDSVVVTLDASGNPVRIEATSVNT
FT                   SGGGFNPRWVLFPILMLLPFVLLLLLLINKPASAEENE"
FT   sig_peptide     315681..315770
FT                   /locus_tag="Tter_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.955 at
FT                   residue 30"
FT   gene            complement(316528..316872)
FT                   /locus_tag="Tter_0295"
FT   CDS_pept        complement(316528..316872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0295"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /note="TIGRFAM: S-adenosylmethionine decarboxylase
FT                   proenzyme; PFAM: S-adenosylmethionine decarboxylase
FT                   related; KEGG: gdi:GDI2320 putaive S-adenosylmethionine
FT                   decarboxylase proenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41217"
FT                   /db_xref="GOA:D1CE61"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE61"
FT                   /inference="protein motif:TFAM:TIGR03330"
FT                   /protein_id="ACZ41217.1"
FT                   /translation="MSFRHILYDLWVEDPSILERTKPLEQIMLEAARCSGATILHSYFH
FT                   QFDPHGVSGVVLIAQSHLSIHTWSEEKYAAIDVFTYQGMNPELAISYIREKLRPTRERI
FT                   TDLSRGGTLL"
FT   gene            complement(316882..318042)
FT                   /locus_tag="Tter_0296"
FT   CDS_pept        complement(316882..318042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0296"
FT                   /product="protein of unknown function DUF43"
FT                   /note="PFAM: protein of unknown function DUF43; KEGG:
FT                   rpb:RPB_2044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41218"
FT                   /db_xref="GOA:D1CE62"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002723"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE62"
FT                   /inference="protein motif:PFAM:PF01861"
FT                   /protein_id="ACZ41218.1"
FT                   /translation="MINTSLSDLARAVSDAASLKEGPDAVIRLLQVVAARGPISAKELS
FT                   QSIGLPIPVLAAVRRELESRGILERKGGIVLTDNGKRLLEGQTYRFLGVCEACSGAGLL
FT                   IPDELSPLLDKLRLYRANRPQVDVSLDQSFILPEYNLRRCLFALNHGLLAGRRVLFIGD
FT                   DDAGSLCVGLLAAYLGFHVDLTVLDIDHRILSYVQTACDEEGIEVKLLDHDARDPLPTY
FT                   ISSTFDTVFIDPPYTLTGLELFLSRAVDALVKQEGSAVVLSFGRKPPSESVQIMEKICN
FT                   MHLYVSDVRPSFNRYEGASVLAGASDIYLLRATHISKPTIKGRYTREIYTGDVRPKVRT
FT                   YICTKCGSSYKIAPGEKWQTIEALKAEGCPRCGNRSFRRQSSTLSG"
FT   gene            complement(318054..318653)
FT                   /locus_tag="Tter_0297"
FT   CDS_pept        complement(318054..318653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0297"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: bha:BH0036 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41219"
FT                   /db_xref="GOA:D1CE63"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE63"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ACZ41219.1"
FT                   /translation="MYTTAEPVERLIEEFSKLPGIGPKTASRLTYWLLRSSKEQAESLA
FT                   DAIRELKEKTTLCSECFNITDVDPCRICSSESRDRSVICVVEEPLDVRAIENTNEYKGL
FT                   YHVLHGLLSPLDGITPDKLKLQELKDRVARGGVKEVIIATNPTLEGSNTAFYIARLLKN
FT                   LNVKITRLAYGLPVGGDLEYADEVTLSRALQGRQSI"
FT   gene            complement(318777..319460)
FT                   /locus_tag="Tter_0298"
FT   CDS_pept        complement(318777..319460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0298"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; BAAT/Acyl-CoA
FT                   thioester hydrolase; KEGG: scl:sce0062 putative
FT                   carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41220"
FT                   /db_xref="GOA:D1CE64"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE64"
FT                   /inference="protein motif:PRIAM:3.1.1.45"
FT                   /protein_id="ACZ41220.1"
FT                   /translation="MGEMVTFPSNGTTAEGYLAKPDTDKAPGVLVIQEWWGLNDNIKSI
FT                   CERFASEGFLALAPDLYHGRATTEPDEARKLAMSLQMETAAKDMSGAVDYLREHAGYTS
FT                   VGAVGYCMGGGLALFIAALRGDVVKAVVPFYGLVPPSAPPVDWSKLQASVLGHYAELDQ
FT                   GITVERVREFENQLKSLGKEVEIHIYQGAQHGFCNDTRPQVYNREACELAWQRTIAFLR
FT                   KKLVS"
FT   gene            complement(319483..320118)
FT                   /locus_tag="Tter_0299"
FT   CDS_pept        complement(319483..320118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0299"
FT                   /product="O-methyltransferase family 3"
FT                   /note="PFAM: O-methyltransferase family 3; KEGG:
FT                   aba:Acid345_3436 O-methyltransferase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41221"
FT                   /db_xref="GOA:D1CE65"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE65"
FT                   /inference="protein motif:PFAM:PF01596"
FT                   /protein_id="ACZ41221.1"
FT                   /translation="MEEIAPSIARYLDALVPERTGDMVIMEDYAKAHGFPIIGPSAGYF
FT                   CYLMTRVMGARKVFELGSGYGYSTAWFARGVHENGGGVVHHTVWDSNLSNMARLHLKNM
FT                   GYENIVVYHIGEAVETLRNTDDTFDIVFNDIDKSAYPDSLPVIKSKLKKGGMLIVDNIL
FT                   WHGRILDPSERSRDTEAIRVMIDMVRNDPEWIYSIVPLRDGLLLAYKQ"
FT   gene            320229..320903
FT                   /locus_tag="Tter_0300"
FT   CDS_pept        320229..320903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0300"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Bacterio-opsin activator HTH domain protein;
FT                   SMART: response regulator receiver; regulatory protein
FT                   LuxR; KEGG: bha:BH2213 two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41222"
FT                   /db_xref="GOA:D1CE66"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE66"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACZ41222.1"
FT                   /translation="MQEEQVSGTEAIRVVIAEDHALVREGTKELLEKRGIRVIGEASNG
FT                   EEAVELAQKLQPDLILMDVSMPKLNGIDATKIIKQKHPNIAVLVLSAYDDDQYVFALLQ
FT                   AGAAGYILKDAHADEVVNAVKAVANGESVLAPSIAKKVLSRFTSPSTQPEHPSPVLTDR
FT                   ELDVLRLAAKGESNKAIAQQLHLSPRTVQVHLSNIFNKFGVASRTEAVLHALKLGLIDL
FT                   SE"
FT   gene            320910..323156
FT                   /locus_tag="Tter_0301"
FT   CDS_pept        320910..323156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0301"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: bxe:Bxe_A3924 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: GAF domain protein; histidine kinase dimerisation and
FT                   phosphoacceptor region; PAS fold-3 domain protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; ATP-binding
FT                   region ATPase domain protein; SMART: GAF domain protein;
FT                   PAC repeat-containing protein; ATP-binding region ATPase
FT                   domain protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41223"
FT                   /db_xref="GOA:D1CE67"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE67"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACZ41223.1"
FT                   /translation="MDRRFARVRVQEPLEKPPPDFRTVDQTTQKIFTLNAIAAAISREA
FT                   DLDKVFYLALDWILEVTGADAGTVFLRDEETGDLVRVVSRGISNLFLTEQERHSYGIGL
FT                   ASRVIRAESPIVLDNVARSSMISPSSYGDVVKSCVGIPLRSDNKVVGVLNIFSKQVNKF
FT                   EPADIELLTSIGNQIGVAVAKAKLSSTVTQSREQLQEKMRQLQELLKISATFRANAPLE
FT                   KVLNAICNAISSALGFRLVELSLLDPTTGMMVPAAFAGFSEEEQQELRSFVRPPSFYER
FT                   IMHPRFQISNSYFISHKEDIEQTLGMQWAFLPNINDEERGPDEWHQKDALAVPIYDRDG
FT                   NLTGLVFVDDPIDRKVPSLEKIQVLEMFVQQAGLAVENARLLSDLQKSEAQYRLVTENA
FT                   SDLIFLLNPDGSISFASSSAKAILGYQPDELLGKMFADLISPQSKRITPECLINPSTAD
FT                   ELSIRCEIEAIRKDGNSVFLEISCTPVFENGVFRGEQGTARDITEKKRMEREIARRQRQ
FT                   LRRSQKREEQLSGYAAAVIAAQEEERRRIARDLHDDTAQALIALSRRIDSLREDLGDLP
FT                   EAAQRKIEDLKALTDQTLASVRRFSRDLRPSILDDLGLVPALEWLVSENAKRYKITTRL
FT                   KIQGEERRLQPEVELALFRIAQEALNNTAKHSQATGAAVELTFGDTWCRLTVSDNGIGF
FT                   QTPPNISELADRGRMGVMGMYERANLLGGNLYVRTAPGQGTRITVTVPLIESSL"
FT   gene            323589..324815
FT                   /locus_tag="Tter_0302"
FT   CDS_pept        323589..324815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0302"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   tgr:Tgr7_1190 protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41224"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE68"
FT                   /inference="protein motif:PFAM:PF01936"
FT                   /protein_id="ACZ41224.1"
FT                   /translation="MHNLDSRVRSGTQFLHQNDVALYIDWENIKYSLWNKDSRVPNATA
FT                   LKEAASKFGRVVVARAYANWQEHQHQLDPNDLYSAGIEPIYVPTRTYTSTDAVKTNNRR
FT                   KNSVDVKLTVDAVDFCLSNPNIHTFVLVTGDGDFIHLVNALRSRGREVVVIGCSWSTSW
FT                   QLTSMADYFIPYDIEVDPIYDKVGEDNTEDVDLEHAFKTLVEIMHDIRRRGEPNVFAQI
FT                   RLLMLSRMRNFDERHYGFSNFREFMKEAERRGLIKTYNVGLIDRAYLPDEQLEVDVHTH
FT                   MKGIPSNELSASGANTGYASSYPYKEDGRSMLIKLIRYISELERNSPYMSFNFMVENAA
FT                   NNGILPISVSEIATMLNIAIDDGIFKRETKTIYSKATNDYREISVFHLNRSHPLVIEAT
FT                   EEDMVSSES"
FT   gene            324891..325889
FT                   /locus_tag="Tter_0303"
FT   CDS_pept        324891..325889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0303"
FT                   /product="zinc-binding alcohol dehydrogenase family
FT                   protein"
FT                   /note="TIGRFAM: zinc-binding alcohol dehydrogenase family
FT                   protein; PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   sfu:Sfum_0829 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41225"
FT                   /db_xref="GOA:D1CE69"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE69"
FT                   /inference="protein motif:TFAM:TIGR02822"
FT                   /protein_id="ACZ41225.1"
FT                   /translation="MKAQMLSEQLSIDRRPLKLVEVDEPSIGQKDLLIKVKACGVCHTD
FT                   LHIVEGDIPLHKRPIVPGHQIVGVVEKVGEAVTRFSPGDRVGVPWLNWACGRCEYCQRG
FT                   YENLCVNGKFTGWDVDGGYAEYQVTSEDFTYHIPDGYSDLQAAPLLCAGVVGYRALKLA
FT                   KADNAERVGLYGFGASAHIAIQVLRYWGTRVFVFTRSREHQKLALELGAEWAGTANDDP
FT                   GVLMQSSIIYAPAGDIIPQALGVLDKGGVLSLAGIYMTPIPQLDYELLRGEKVIVNVTN
FT                   ATRQDAIELLDLAPRVPIRTEIEVYPLEEANDVLLRLKESKINGSAVLQIS"
FT   gene            325937..326512
FT                   /locus_tag="Tter_0304"
FT   CDS_pept        325937..326512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0304"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_1270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41226"
FT                   /db_xref="GOA:D1CE70"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE70"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41226.1"
FT                   /translation="MSQEDIYSETTQPIDTSRKPTGSSASKAPLNADRIGVSRGEPWVD
FT                   AVRWGAVWAGLLSAFGLFLLLFTLALALGFGSTSVLAAIVLLCTFFGGFVSARSSGTYS
FT                   RFIGFIQGFLAWILGVLVSVPLTYIAIAIYRGDVIKNGLSLEPFLERLRNDTTYFGTFT
FT                   FLGLLITALLSSLGGIVGTLSGEGSDVS"
FT   gene            326571..326645
FT                   /locus_tag="Tter_R0007"
FT                   /note="tRNA-Asn1"
FT   tRNA            326571..326645
FT                   /locus_tag="Tter_R0007"
FT                   /product="tRNA-Asn"
FT   gene            complement(326813..327670)
FT                   /locus_tag="Tter_0305"
FT   CDS_pept        complement(326813..327670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0305"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: hch:HCH_04507 rhodanese-related
FT                   sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41227"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE71"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACZ41227.1"
FT                   /translation="MSYETLISVQEAAKHLHDPNWVFIDCRYTLGDPEKGLRDYLQAHI
FT                   PGAVYAHLDKDLSGKVIPGKTGRHPLPDLIDFDKTMSRLGVSQESQVVAYDEQTGAMAA
FT                   ARLWWLLKWAGHNNVAVLDGGFRAWIANGLPVATGKESRASTEFHGKYNHKLVASADDL
FT                   RATIGSRSCKIVDSRTRDRYRGENETIDPKAGHIPTAISLPYTENLDTDGFFRPPQILR
FT                   ERFASIAEQYPPESIVFYCGSGVTAAHNVLAFAHAGMGMPKLYPGSWSEWITDESRPIA
FT                   TGDE"
FT   gene            complement(327682..328230)
FT                   /locus_tag="Tter_0306"
FT   CDS_pept        complement(327682..328230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0306"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A; KEGG: pnu:Pnuc_0662
FT                   peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41228"
FT                   /db_xref="GOA:D1CE72"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE72"
FT                   /inference="protein motif:TFAM:TIGR00401"
FT                   /protein_id="ACZ41228.1"
FT                   /translation="MSNISRIQEATLGGGCFWCMEPIFKDLKGVIEVIPGYSGGHVPNP
FT                   TYEQVCTDTTGHAEVVNIKFDPNQISFRDLLEVFFSVHDPTTLNRQGEDVGTQYRSIIL
FT                   YRDEEQRRIAQEVIEELTRNKVWQDPIVTQVVPFEAFYPAEEYHWDYFRRNPNQAYCRL
FT                   VIAPKYEKFRKRYTELIKQ"
FT   gene            complement(328305..329228)
FT                   /locus_tag="Tter_0307"
FT   CDS_pept        complement(328305..329228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0307"
FT                   /product="glutathione synthase/ribosomal protein S6
FT                   modification glutaminyl transferase-like protein"
FT                   /note="KEGG: sus:Acid_3927 glutathione synthase/ribosomal
FT                   protein S6 modification glutaminyl transferase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41229"
FT                   /db_xref="GOA:D1CE73"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE73"
FT                   /inference="similar to AA sequence:KEGG:Acid_3927"
FT                   /protein_id="ACZ41229.1"
FT                   /translation="MEKLRVGLLVGREKSLVSALLQEITSNYSHVDVGIARLGAVELGE
FT                   DCRYSVIVDRLSHVVPFYKAYLKHALVSGVYVINNPFVSSSDDKFHQVSLAHKLGLLTP
FT                   KTVLLPNHYFLENYSPSRELVSHPLPVDWYEVAEEVGLPCILKDAEKGEWSELHICHSV
FT                   DELMENYRHTSTRTVMVQELIDWDLFVRCLVIGEEVIPMYFDFQKKRYLPGSQGIPNEL
FT                   EESIMSDSSKIVKELGYDINLVEWAVYEDKAFLIDCFNPIPDIDPDAMEESDFKWAIKA
FT                   LAELLNQLTIKIANGEAIYRNPKLGS"
FT   gene            329369..332164
FT                   /locus_tag="Tter_0308"
FT   CDS_pept        329369..332164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0308"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="PFAM: phosphoenolpyruvate carboxylase; KEGG:
FT                   noc:Noc_0770 phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41230"
FT                   /db_xref="GOA:D1CE74"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE74"
FT                   /inference="protein motif:PRIAM:4.1.1.31"
FT                   /protein_id="ACZ41230.1"
FT                   /translation="MAIERAGTGDKLSEDVRLLGSIVGEVLIEQGGRRLFEIVEKLRTT
FT                   SIALRTRYSEELHRELVQITSELDPATAFDVIRAFNLFFLVVNLAEENHRVRVLRQREI
FT                   SSYPEPLEGSIREAVRDLRNEDISDEQLQELLNRLRARFVFTAHPTESRRRTTLMHLRH
FT                   ISNLIALLDDALLTPTQREMVIDRLREVVTALWQTDDFRETRPTPLDEVYNSLYFFQES
FT                   VFEILPSVYREFSDALKSVYKDWNFQIPPVIQFGTWMGGDRDGNPNVTPEVTIRTARLQ
FT                   KGVLLRHYISQLDRLRRHLSMSVRRAGVSDELMQSIEKERKILPEASERIEERNKNEMY
FT                   RLKIGLMIEKLKNTLSAMEARQRPQPDVAYESVEQFYTDIDMIVNSLKQNKGDRLALGA
FT                   AEDFRRLAEVFGFHLAKIDVRQHSSRHSQAIAEVLSSVGICDRYLELSSEEQAELLREL
FT                   LRDNRPIIGKVHHFSPSTEETIAVFDAIRTIQEEIGKEACDTYIISFAQSAADLLEIQL
FT                   LARETGLLSISEGWSRLQIVPLFESIHDLNECGNIMANLLDDPIYRCNVKAWGDHQEVM
FT                   IGYSDSNKDGGFFTSCWELYKAQRRLAAVCSERGVTLRLFHGRGGAIGRGGGPTHMAIL
FT                   GQPPDTIHGELKLTEQGEVIFARYGNPAIAKRYLEQVLNALLRVSLSPTVIENQSRIEP
FT                   EWQEAADTLSTYSYREYRNLVYETPEFVEYFREATPIGEISLLPIASRPVRRQSGFDIE
FT                   QLRAIPWVFSWMQSRHTLPGWYGLGTAIEKYIAGDDSKLKILQEMYQKWIFFRSTLDNA
FT                   QMILSKADIHVASMYAGLVSNPDVWNRVWPRIQQEYERTVYWVIKVTGLNRLLDNAPVL
FT                   QRSIMLRNPYVDPISYIQVALLRKLRTIPDTKDHKKERESILQAVFLSINGIAAGLQNT
FT                   G"
FT   gene            complement(332211..334508)
FT                   /locus_tag="Tter_0309"
FT   CDS_pept        complement(332211..334508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0309"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: smd:Smed_5555 extracellular solute-binding protein
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41231"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE75"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACZ41231.1"
FT                   /translation="MHQKHGISRRKFLRLSAMAAGGVVLAACGGSTATNTPSASQPAAS
FT                   PTMGASPQPSTPGASPTAAMSPQPSAPSASPTAAASPSASATPGTSSGVPNVPYIATPV
FT                   TYQGEYKEAPSLAELVKAGKLPPVEQRLPKNPYVVPHKWVQQGKYGGKIEMLNSSSDDW
FT                   GTTHFIQESMYGHSPLRYLNDGLTIGPGLAESWESNEDATVWTFHFREGLKWSDGHPWT
FT                   VDDILFWWEDMVLNDEIPEGPPDDMRSGKGTIGKMKKIDDYTLQLIFDAPAPVTPERLA
FT                   AWVNRGIGPTWMAPKHYAKQFHKKYNPNVKKNWTEDFAFPWGKAVDFTANPDCPTMTGW
FT                   KLKEYKKGQYSIWERNPYYWCIDKWGNQLPYIDNLIMRNILDPEVLKLKFTQGAADFVH
FT                   GGFEPISPADYALLKQSEQKGDYQMIFWDSGSGTGSIFFFNHDYPDAKMRELIRNPKFK
FT                   QALSHAYNREAVRKLVYLDTGEVTTGTLSPKGVNFNINDEGRKLYEQWRDSYLEYNPDK
FT                   AKQILDEIGVVDKDGDGWREMPDGSKLVVYLDYQADTPQGGEHMRKNEQLAADWKAVGI
FT                   NAKLNPIPPTGWDDRWNSGKLMSTTTWEVGDNSILIYPGWVVPVEPAHWAPLHGAFFQV
FT                   IGTPKQNQQKNINPWKRNPPRIGPFDKEFFEPVKTLWDLYNKARVEVDRMKRISLEWQI
FT                   MKLHIEQGPFFLGVVANWPRVELVKNGLKNVPRREDLTLHGWVNPWIHPTPAVYDPETW
FT                   YWENPEQHQMQS"
FT   sig_peptide     complement(334407..334508)
FT                   /locus_tag="Tter_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.884 at
FT                   residue 34"
FT   gene            334633..335244
FT                   /locus_tag="Tter_0310"
FT   CDS_pept        334633..335244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0310"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcr:BCAH187_A2132 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41232"
FT                   /db_xref="GOA:D1CE76"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE76"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACZ41232.1"
FT                   /translation="MKQEDKSHILLRIPERISTRRLVIRNYVPEDATSLWLAVEESRES
FT                   IEPWLRWPRDVRNVDTARIRIRYLQAEWILRDRLVWGLFSKEDQQLFGEIGLVHPDWSV
FT                   VSFQVSYWLRKSAQGHGYMREALRAITALVFETISASRVEVRVESDNLRSRKVPEALGY
FT                   RLEGVLRRDHVGLDGELTDMYVYALTSEDYEDIRLGSEDQ"
FT   gene            complement(335247..335774)
FT                   /locus_tag="Tter_0311"
FT   CDS_pept        complement(335247..335774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0311"
FT                   /product="methylated-DNA/protein-cysteinemethyltransferase"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S- methyltransferase DNA binding; KEGG: sat:SYN_02919
FT                   6-O-methylguanine DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41233"
FT                   /db_xref="GOA:D1CE77"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE77"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ACZ41233.1"
FT                   /translation="MENLDQYFSIDLPIGRLYVAYNPLGISATAIASDDSSFEDYFLRR
FT                   FQKSIRPELHACEDIRVKVRKYLDGYRGSLSDFDLRGTTAFQRKVLETTLSIPRGEVRT
FT                   YTWVANKIGNPKALRAVGTALASNPVPILIPCHRVVRSDGVIGKYLFGTACKQQLLHME
FT                   DVKATLESPISM"
FT   gene            complement(335861..336499)
FT                   /locus_tag="Tter_0312"
FT   CDS_pept        complement(335861..336499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0312"
FT                   /product="tRNA guanosine-2'-O-methyltransferase"
FT                   /EC_number="2.1.1.34"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   dds:Ddes_0597 tRNA guanosine-2'-O- methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41234"
FT                   /db_xref="GOA:D1CE78"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE78"
FT                   /inference="protein motif:PRIAM:2.1.1.34"
FT                   /protein_id="ACZ41234.1"
FT                   /translation="MNTTRKITERRLNRMIQVLKRRQPDLTVVLENVHDPHNVSAVLRS
FT                   CDAVGVLAVHLVYTIEEFPDLSKNVSGSALKWLEIIKHKDIQDCYDTLRSQGMTIYTTY
FT                   LADPQRSHDLYSLDLTKPTALVFGNEQRGVSEEASRLADGNFVIPMMGMVQSLNISVAC
FT                   AVTLYEALRQRRAAGHYDHPKLSREEISTRLHNWLQREKRSIEELQKLI"
FT   gene            336912..338165
FT                   /locus_tag="Tter_0313"
FT   CDS_pept        336912..338165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0313"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="KEGG: Os12g0235800; hypothetical protein; K01940
FT                   argininosuccinate synthase; TIGRFAM: argininosuccinate
FT                   synthase; PFAM: argininosuccinate synthase; ExsB family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41235"
FT                   /db_xref="GOA:D1CE79"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE79"
FT                   /inference="protein motif:TFAM:TIGR00032"
FT                   /protein_id="ACZ41235.1"
FT                   /translation="MALSPLEKIQAVEVPKYRKVALAYSGGLDSALCLVLLREKYGAEE
FT                   IIPITVDVGQGQDEVEQSFKKAEVLGVEPLLIDAKSEFTNEWLTKAIRANSSYNGYPVS
FT                   TSMTRQLIAAKVAQKAVELGCDALAEGSSGKGNDQYRMHKVFKYFAPQLGIIVPVRDFD
FT                   LTRTEEMELCEHYGVPVTEIIVGGDDKTMWCRSIASGGITLETELPDNIWLWYTPPQKA
FT                   PDDPYTFTIEFEAGIPVALNGQKMPLEDIIDQLNVIGGKHGIGKIDMFEDGIMDLKSRE
FT                   IYEAPAATIILTIHRDLEQFTLTKDEIQFKKIVDAQWAYKVYHGEWFHPLKKALDAFIA
FT                   ETQSVVNGEYTVQLYKGNIDILKRKSDTGLFFPDVRSISSASFNQQLCGPTAQIWGLPF
FT                   ELLARREKESKKVGAASE"
FT   gene            338158..339504
FT                   /locus_tag="Tter_0314"
FT   CDS_pept        338158..339504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0314"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="KEGG: fph:Fphi_0553 argininosuccinate lyase;
FT                   TIGRFAM: argininosuccinate lyase; PFAM: fumarate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41236"
FT                   /db_xref="GOA:D1CE80"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE80"
FT                   /inference="protein motif:TFAM:TIGR00838"
FT                   /protein_id="ACZ41236.1"
FT                   /translation="MSKLWDKGYKLDETIERFEIGHDLAFDNELVEVDVYGSIAHAEML
FT                   NRIGILTDDELQTLKQGLGRILDLYRQGQFFMTPADEDIHTKIENFLVREYGDVGKKIH
FT                   TARSRNDQVLVDLRLYAKAKILELESALLQCAESLVEFASKHEHVPMPGYTHMQRAMLS
FT                   SVGTWAGAFAEALLDDLKLLETAYELNDQSPLGSAASYGVPLPIDRQYVADKLGFAKVQ
FT                   NNVLYAQNARGKFEALVVQAISQIMLDLSKLAQDILLFTTAEYGFFTISDSFVTGSSIM
FT                   PQKKNLSMMELIRAKANMALGYQQQMMSVLSGLPSGYNKDYQETKKPFMEAIQLALDSL
FT                   KVAELTISNLSPNKDKLLAACTPELFATDKAYELVQQGMPFRDAYRYVGTNLDKLEGAD
FT                   PEESLKKRTHIGASGNLGLSKLKESISASKVNVDKKYSHLMETWQNLLS"
FT   gene            339527..339703
FT                   /locus_tag="Tter_0315"
FT   CDS_pept        339527..339703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0315"
FT                   /product="lysine biosynthesis protein LysW"
FT                   /note="TIGRFAM: lysine biosynthesis protein LysW"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41237"
FT                   /db_xref="InterPro:IPR005906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE81"
FT                   /inference="protein motif:TFAM:TIGR01206"
FT                   /protein_id="ACZ41237.1"
FT                   /translation="MAATQTGTCPECEAEIALADVEKGEIVQCPDCGAELEVRDTNPIV
FT                   LELAPEEEEDWGE"
FT   gene            339789..340637
FT                   /locus_tag="Tter_0316"
FT   CDS_pept        339789..340637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0316"
FT                   /product="lysine biosynthesis enzyme LysX"
FT                   /note="TIGRFAM: lysine biosynthesis enzyme LysX; alpha-L-
FT                   glutamate ligase, RimK family; PFAM: RimK domain protein
FT                   ATP-grasp; protein of unknown function DUF201;
FT                   ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp; KEGG: afw:Anae109_2113 alpha-L-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41238"
FT                   /db_xref="GOA:D1CE82"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011870"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE82"
FT                   /inference="protein motif:TFAM:TIGR02144"
FT                   /protein_id="ACZ41238.1"
FT                   /translation="MKVGVLLSRVRAEEKLIFEEFDARGIDVERIYDPELVLDIESPIN
FT                   GYDVILERAINHSRAVSALRLFNDWGIPTVNTYEVATICGNKLETSAALARCGVPTPRT
FT                   LIAFTPESALKAIESIGYPVVLKPLIGSWGRLISLVNDRYAAEALLEHKEILGSYHHSI
FT                   FYIQEYVEKPGRDIRAFVVGDKTIAAIYRYSDHWITNTARGGQASNCPVTDEINEISVA
FT                   AAKAVGGGVVAIDLVESPEGLKVLEVNYTMEFRNSIQPTGVNIPAYIVDYVIARGEGAP
FT                   P"
FT   gene            340634..341680
FT                   /locus_tag="Tter_0317"
FT   CDS_pept        340634..341680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0317"
FT                   /product="N-acetyl-ornithine/N-acetyl-lysine deacetylase"
FT                   /note="TIGRFAM: N-acetyl-ornithine/N-acetyl-lysine
FT                   deacetylase; PFAM: peptidase M20; KEGG: gbm:Gbem_3178
FT                   peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41239"
FT                   /db_xref="GOA:D1CE83"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010175"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE83"
FT                   /inference="protein motif:TFAM:TIGR01902"
FT                   /protein_id="ACZ41239.1"
FT                   /translation="MSWQLDILREMLELYSPTGSEDQVSSFLVDLFRSEGLEAYKDEAG
FT                   NFIGIVGRGQPEIMLLGHIDTVPGKIPVREEDGKLYGRGAVDAKGPMAAFVCAAIQAKR
FT                   QDGVNATLKVVGAVGEEGDSRGARYLVKNHLPEYLIIGEPSGWDSIVLGYKGSMHVHYV
FT                   LNKSMSHSAGPERSAAEEALDFWNHVVEFCRELNQEKRVFDQLSPSLRSINTYSDGFIS
FT                   TVEMDINFRLPLAYSPDDLGQRLRDFAGKGKISILYGDPAFKADKNTPLVRAFMQSLRS
FT                   VGVTPRFKVKTGTSDMNVVAPEWRCPAIAYGPGDSSLDHTPEEHIYISEYEKSIDILVK
FT                   ALKYLEEA"
FT   gene            341686..342552
FT                   /locus_tag="Tter_0318"
FT   CDS_pept        341686..342552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0318"
FT                   /product="lysine biosynthesis enzyme LysX"
FT                   /note="TIGRFAM: lysine biosynthesis enzyme LysX; alpha-L-
FT                   glutamate ligase, RimK family; PFAM: RimK domain protein
FT                   ATP-grasp; protein of unknown function DUF201;
FT                   phosphoribosylglycinamide synthetase; KEGG: ade:Adeh_1691
FT                   SSU ribosomal protein S6P modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41240"
FT                   /db_xref="GOA:D1CE84"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011870"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE84"
FT                   /inference="protein motif:TFAM:TIGR02144"
FT                   /protein_id="ACZ41240.1"
FT                   /translation="MKIGVLLSRIRIEEKLIFKAAERLGVDIVRIDDRDLIFDLGKKDF
FT                   PEVDIVLDRGLVHSRAEYTLRILESWGIPTVNSYKATITCDNKFLTNMALIEHGVPTLR
FT                   TMLAYTPESAIEAIERLGYPVVLKPNTGSWGRLLAKINDRDAAEAVLEHKEILGSYHHS
FT                   IFYIQEYVQKPGRDIRAFVIGDSVIAASYRQSDHWITNTARGGISAPCPITPEIEDLAL
FT                   RAANAVGAEIAGVDIIETPEGYKVIEINVGAEFHGLIETTDRDIPGEIISYLVSKAHKS
FT                   TVEPVAS"
FT   gene            342581..343624
FT                   /locus_tag="Tter_0319"
FT   CDS_pept        342581..343624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0319"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: gur:Gura_1051 N-acetyl-gamma-glutamyl-
FT                   phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41241"
FT                   /db_xref="GOA:D1CE85"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037535"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE85"
FT                   /inference="protein motif:TFAM:TIGR01850"
FT                   /protein_id="ACZ41241.1"
FT                   /translation="MLKVSIVGASGYGGGELLRLLLDHPEVEVAQVTSESNAGKFVYKV
FT                   HPNLRKRTDLKFVSSSELEKCDVLFLALPHGTAMEKIDHWMELAPVIIDLSADFRLRNP
FT                   EDYPKWYGHDHTHPELLGKFVYGMPELHREEIKNSNYISSGGCLSTAAILGLYPLFQAG
FT                   VVDLDKPVVIEGKTGSSGAGGGVSLSSHHPERSGAMRSFKPTGHRHTAEIVQELSFHGK
FT                   PKISFSATAIEAVRGILSTAHVFLNKEMDERELWRIYRKAYAGEPFMRIVKESSGVYRY
FT                   PEPKILTGSNYCDVGFELDPDNGRVVVMSAIDNLMKGAAGQAVQAFNVRFGFPETTALE
FT                   FPGLHPI"
FT   gene            343645..344439
FT                   /locus_tag="Tter_0320"
FT   CDS_pept        343645..344439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0320"
FT                   /product="acetylglutamate kinase"
FT                   /note="TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: noc:Noc_2995
FT                   acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41242"
FT                   /db_xref="GOA:D1CE86"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037529"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE86"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ACZ41242.1"
FT                   /translation="MLVIKIGGSKGINVDKILEDVPNIQDKMVIVHGANYELNQVSEQL
FT                   GHPPRIVTSSTGQVSRFTDRRTMEIFMMVYCGKVNKTIVEKLQRLGVNAVGLSALDGGI
FT                   AKGRRKDQIRVIEDGKPKVLRGDYAGSIQQIDTRLINLLLDNGYLPVLTPPAISHEGEA
FT                   INVDGDKLAMEIAAALHADKFLIFSDTPGLLRNLEDENSLITRVGPDEIEEAMQVAEGR
FT                   AKKKVLAAGEALKRGIGQVIFADGRVDAPIQKALSGIGTVIG"
FT   gene            344453..345628
FT                   /locus_tag="Tter_0321"
FT   CDS_pept        344453..345628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0321"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /note="TIGRFAM: acetylornithine and succinylornithine
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   bha:BH2897 acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41243"
FT                   /db_xref="GOA:D1CE87"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR037537"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE87"
FT                   /inference="protein motif:TFAM:TIGR00707"
FT                   /protein_id="ACZ41243.1"
FT                   /translation="MDIQQIENETLVPMYAKRDIALVRGEGYYLWDSEGNRYYDFASNY
FT                   GVNILGHSHPAITNAISQQASTLISCHQSFYNDVRAKYLQKLSEKLPEGLDKVFFCNSG
FT                   TESVEAAIKFARAATGRSRIIATKRGYHGRTYGALSATADKKYREPYMPLVPDFEHVPY
FT                   ADLEALERSLSEDVAAVILEPVQGESGIYPAPKEYLAGVRAATRKFGALLILDEVQTGF
FT                   RTGKYFAFEHYDIVPDILCLSKAVANGFPMGLTITSRDVASRLPAGTHGNTFGGNPLAC
FT                   AVALVVLEEIDRGDLLSNAANMGAYLIDRLRSMNSPVVREVRGLGLMIGVELKDRPTKY
FT                   LRLLQERGFIALPAGATTIRFLPPIVIDQQAIDALIEVFEEVLTAQNFVRS"
FT   gene            345653..346723
FT                   /locus_tag="Tter_0322"
FT   CDS_pept        345653..346723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0322"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; homoserine
FT                   dehydrogenase NAD-binding; KEGG: jan:Jann_1468
FT                   oxidoreductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41244"
FT                   /db_xref="GOA:D1CE88"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE88"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACZ41244.1"
FT                   /translation="MGGVPEEFQVDYKPSFPADYSPGIGIIGCGGIVKNAHLPAYKKYG
FT                   LRVVGVYDVLPQATEGVIETFGVERVYNSLEDLLADPAIEVVDIATHPAERFELINKAL
FT                   DAGKHVLSQKPLALTLSEAKQLVSKAEHKRLKLAVNQNGRWAPPWRVATLLIQKGVIGD
FT                   VLSVTHLYDINYSWVTGTNFDLIKHFAIYDYSIHWVDITRCWMEGKVPNLVRAREYRTP
FT                   VQPQDSLTPWGMWIDFEYPDGYSAFIRGIGCSQTSQEGHYFWIHGQEGTIRGSVLGSDY
FT                   VELEKDGSYHKYELEGQWFPDGFAGSMAELLSSVREDREPYNSASHNLLSLQMVLAACK
FT                   SAESSGKPVRLEEVEN"
FT   gene            346720..348330
FT                   /locus_tag="Tter_0323"
FT   CDS_pept        346720..348330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0323"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: ypk:y0252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41245"
FT                   /db_xref="GOA:D1CE89"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE89"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACZ41245.1"
FT                   /translation="MKLGAMDYLLPGKTPGEMFTLAKSLGFHGVEINLHREHLRSDNGQ
FT                   LVQIKNASEATGVEVSSLVLGEHNYGGVSSSDQDVVSQAKEDIKAAIGWARELGASIIL
FT                   VPFFGKGEIITQGDFERAVEAFRELCPEAEAFGIKLCYEGTLPAQRIKEMASAVGSPAG
FT                   FGCYFDLANVVWRGLDTATEIRTLGSLVSQVHIKDCLAGTGDCHPGHGFVDFAESSKAL
FT                   REIGFDGWLVLETPASPPPIVQRDATFARKWFPEVGLPEWPQFGAFTWDYQPEDWSKLV
FT                   EDFVSYGLKYVQLSGPLLTSALASDSGYASALSYFKNSELSVAAIGAYRNLVAPDDGRR
FT                   RENIDFLKRCIEAAPGLGTYVVATETGSCNPESDWLPTQLNKTEQAWNMLLDVLDELVP
FT                   VAKENNVVLALEGYVNNVLYNFCQIEALNRRYDGDNLQLVLDPYNYISSYLLPVHERLT
FT                   QGFLFRFESSFVLAHLKDVSAKGAEVETPEFGAGVFRQQPYLEFLRTQRFDLSLILEHL
FT                   PMDHIPSVIKQVLSITDQN"
FT   gene            348346..349557
FT                   /locus_tag="Tter_0324"
FT   CDS_pept        348346..349557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0324"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="KEGG: sfu:Sfum_0061 argininosuccinate synthase;
FT                   TIGRFAM: argininosuccinate synthase; PFAM:
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41246"
FT                   /db_xref="GOA:D1CE90"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE90"
FT                   /inference="protein motif:TFAM:TIGR00032"
FT                   /protein_id="ACZ41246.1"
FT                   /translation="MEKIKKVVLAYSGGLDTSVILAWIKENYGAEVIAFTADVGQGEEV
FT                   EEAKQKALATGASKAYALDLREEFVRDFVFPVIRAAAVYENQYLMGTSIARPLIARELV
FT                   RIAREEGADAIAHGATGKGNDQVRFELTAYALQPDIKVIAPWREWSFKGRTDLINYAKE
FT                   KGIPVPVTPERPYSIDANLFHISYEGGVLEDPWVAPPKGMWRLTRDPEDAPDVPEEIEI
FT                   EFEAGNPVAVNGQRMGPLELLQCLNQIAGKHGVGRVDIVENRFVGMKSRGCYETPGGTL
FT                   LHIAHRAVESITLDREVMHLRDQLIPQYAEMVYNGFWYAPERIALQKFMDDIQQRVSGV
FT                   ARLKLYKGNAYVTGRKSDASLYDHKTVTFEEDEVYNQADAGGFIRLQALRLRTHAAKRL
FT                   GPGE"
FT   gene            349604..350734
FT                   /locus_tag="Tter_0325"
FT   CDS_pept        349604..350734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0325"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /note="KEGG: ade:Adeh_1294 dihydroorotate oxidase A;
FT                   TIGRFAM: dihydroorotate dehydrogenase; PFAM: dihydroorotate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41247"
FT                   /db_xref="GOA:D1CE91"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE91"
FT                   /inference="protein motif:TFAM:TIGR01036"
FT                   /protein_id="ACZ41247.1"
FT                   /translation="MATGIYKHLVLPLLDRLDSETWHERVRHGLHTVEQVPLGPEFLEI
FT                   LAWKGRRVVDPRLKVSLAGVQLENPLIVGAGWDKSGISIRALYALGFASVEVGTVTPRP
FT                   QPGNPRPRQFVLSSGVVINRLGFNNPGADAVAANLESYKSDNIPVGISIGKNKDDPEDR
FT                   APLAYAEVARKLYPYGSYFVINVSSPNTPGLRSLQRKEALLSIAQSVLDVMDSYGARKP
FT                   LFIKIAPELSYQEVDEILDVVLQLGLAGVVATNTVALGDVKARYGEGWRLQPGGLSGDD
FT                   EVFRHMSTSKVAYIYSQTKGSIDIIGVGGVKDAHTALEKILAGATAVQVVTAIRSEGLA
FT                   VAARTNLGLLEWLDKNGVKSISNVVGARYEDFLDTK"
FT   gene            complement(350720..351097)
FT                   /locus_tag="Tter_0326"
FT   CDS_pept        complement(350720..351097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0326"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kpn:KPN_01146 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41248"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE92"
FT                   /inference="similar to AA sequence:KEGG:KPN_01146"
FT                   /protein_id="ACZ41248.1"
FT                   /translation="MAKDIVLAIDNSSETLTQICEAAGRAGINLEGGCCFFCEGQGVFH
FT                   ALVEDIEGFKRVIKEAGFKIREERDVLLIDIEDRPGALGEVLRELIEAGLKVDLLYLAT
FT                   RTRVAIGTNDHARATATLLGI"
FT   gene            complement(351114..353309)
FT                   /locus_tag="Tter_0327"
FT   CDS_pept        complement(351114..353309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0327"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="KEGG: rce:RC1_0515 1,4-alpha-glucan branching
FT                   enzyme; TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM:
FT                   alpha amylase all-beta; glycoside hydrolase family 13
FT                   domain protein; alpha amylase catalytic region; SMART:
FT                   alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41249"
FT                   /db_xref="GOA:D1CE93"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE93"
FT                   /inference="protein motif:TFAM:TIGR01515"
FT                   /protein_id="ACZ41249.1"
FT                   /translation="MQIEGACRIEDLINGTCYDPHSILGMHPVERNGRRCIELRVWVPG
FT                   AIKVSALDYKTNEEILPLERVHEAGFFIGTFPTRTEVFPYRLRISTAHHTWVQEDPYRF
FT                   LPTIGELDLYYIGEGTHRKLYEVLGAHLREIDGVKGVSFAVWAPNARGVSVIGDFNGWD
FT                   KRRYPMRVLGSSGVWEIFLPGVQVGEKYKYAINGADGIEREKADPLAFYSELRPRTASI
FT                   IYDLSGYKWKDREWMLRRLENNPYKKPMNIYEVHLGSWKRHPDGSWLSYRELADELVPY
FT                   VKRMGFNYVEFMPLLEHPYDGSWGYQVTGFYSATSRFGTPDDLRYLIDRCHQAGIGVII
FT                   DWVPAHFAVDEHGLCRFDGTYLYEHEDIRRRFQPDWGTFSFNYGRNEVRNFLTASALFW
FT                   VKEFHVDGLRVDGVSSMLYLDYSRGPGEWTPNKYGGRENLEAIDFLREMNSLVYAEGEG
FT                   AITIAEESTAWPGVSRPVYLGGLGFGFKWNMGWMHDTLEYFRKDPIYRKYHHNDLTFSM
FT                   VYAYNENFILSLSHDEVVHGKGSLVNKMPGDEWQQFANLRLLFAYQWAHPGKKLIFMGD
FT                   EFGQRSEWNHDWQLDWWVLQFGYHQGVQRLLQDLNRLYLHEPALYRLDHDPKGFTWLDY
FT                   SDWENSVISFARWSGDGNNHIVCAFNFTPVPRYNYRIPAPHLGKYREVLNTDAQIYGGS
FT                   GIGNMGEVSSEVVMHNGHPYSVAITLPPLGAVFFKPM"
FT   gene            complement(353340..355472)
FT                   /locus_tag="Tter_0328"
FT   CDS_pept        complement(353340..355472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0328"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /note="KEGG: tgr:Tgr7_0567 glycogen debranching enzyme
FT                   GlgX; TIGRFAM: glycogen debranching enzyme GlgX; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; SMART: alpha amylase catalytic sub
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41250"
FT                   /db_xref="GOA:D1CE94"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE94"
FT                   /inference="protein motif:TFAM:TIGR02100"
FT                   /protein_id="ACZ41250.1"
FT                   /translation="MNFTFCPGKPYPLGATWDGSGVNFALFSPGAEKVELCIFNNPFEE
FT                   KESVRIPVTNKTNYIWHVYLPEARPGLLYGYRVYGPYDPARGLRFNHNKLLIDPYAKAI
FT                   AGDIKWSDDVFGYRITGHDDQDLIASETDSSPYVPKSVVVDTSFTWGDDKRPNIPWKDT
FT                   IIYELHVKGFTQLHPGLPENLRGTYAGLAHHEIIKYLKDLGVTAVELLPVHHFVRDRYL
FT                   VEKGLTNYWGYNTIGFFAPDSAYSSSGFMGQQVHEFKTMVRKLHKAGIEVILDVVYNHT
FT                   GEGNHFGPTLSFKGMANDRYYRLSPDSPRFYIDYTGTGNTLDTTEPYSLRLIMDSLRYW
FT                   IQEMHVDGFRFDLAATLGREAHHFDKFGSFLDIISQDPVISQVKLIAEPWDLGEGGYQL
FT                   GNFPEGWAEWNDRYRDNIRRFWRGDPGQVRELGWRLSGSSDIFASGGRGPNASINYVTS
FT                   HDGFTMRDLVSYNSKHNEANGEGNKDGTDNNLSWNCGFEGETDNQAVLSLRRRQIRNFL
FT                   TTLLVSQGTPMILHGDEVGRTQRGNNNAYCQDNETTWQPWDLEEWQRELLEWTKQVIAF
FT                   RKAHPVLRRGEYYKGQIIEGYGTKDLTWLRPDGREMTEEDWLNQEIRAFGMLLSGASAL
FT                   ECVDDNILVIFNASKRNITFYLPQPPSGLRWQLVLDTSNPRYQETLNRRVAKNYRLAPT
FT                   SMAIFKYPIQSPRTES"
FT   gene            complement(355469..356926)
FT                   /locus_tag="Tter_0329"
FT   CDS_pept        complement(355469..356926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0329"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   mch:Mchl_2940 trehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41251"
FT                   /db_xref="GOA:D1CE95"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE95"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACZ41251.1"
FT                   /translation="MNNKLYISNKYNNLVEALHDALERASLDLQLPAYLESNRWFGAHT
FT                   RHLQSARFERWVEVPNSGGACLCVVTAIDASNNLTDYLLYLRPAEPEEEQTEIADGMQF
FT                   EDARQALLRLLTDDQSLSGFRLDAVAEVVTTPRCEGEGRTLQGEQSNTSVILDESCIMK
FT                   LYRKLEQGRNPEIELGRYLSNLRFDKTPSLLAFLKLSSSDGYDVDALVLHEYVPNQGDC
FT                   WSWALQKARLFLENVEQDSEAGAWLDQETETLQGASNIGSTLAEFHSLLARADIEGLQP
FT                   EQASQQDFDNWVESVQNEANNALEALNRVQYPDESLKNLVAEATSLQPDPPSQLGLKTR
FT                   IHGDLHLGQLLVGKDRFLIIDLEGEPAKPLFERNSLESPLVDVAGMLRSWNYVAMSLSK
FT                   QYPEKKTLLSIWENLVSNQFLRSYIDAADSSDTKFLPQDDQSTRQLLDLFKLRKALYEL
FT                   RYELDYRPDWVDIPAVSIKNLLESNLR"
FT   gene            complement(356923..358578)
FT                   /locus_tag="Tter_0330"
FT   CDS_pept        complement(356923..358578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0330"
FT                   /product="trehalose synthase"
FT                   /note="KEGG: mxa:MXAN_3684 trehalose synthase; TIGRFAM:
FT                   trehalose synthase; PFAM: alpha amylase catalytic region;
FT                   SMART: alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41252"
FT                   /db_xref="GOA:D1CE96"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="PDB:5X7U"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE96"
FT                   /inference="protein motif:TFAM:TIGR02456"
FT                   /protein_id="ACZ41252.1"
FT                   /translation="MSNLNDDPTWYKDAIIYEVGVRCFFDSNNDGSGDIPGLTAKLDYI
FT                   ESLGVTAIWLLPFYASPLKDGGYDISDYRSLHPDFGTIEDFKVFLDEAHRRGIRVITEL
FT                   VLNHTSDQHQWFREARSNPNSPYRDYYVWSDTDDKYKDARIIFIDTERSNWTWDQEAGK
FT                   YYWHRFFSHQPDLNYDNPKVQQEILDIVGYWLDMGVDGLRLDAVPYLYEREGTNCENLP
FT                   ETHEFLKKLRKFVDDNWPNRMLLAEANQWPEDVVAYFGNGDECHMAYHFPIMPRMYMAL
FT                   RREDRHPITEILRRTPPIPETCQWALFLRNHDELTLEMVTDEERDYMYHEYAKDPRMRL
FT                   NLGIRRRLAPLLDNSERRIQLMHLLLFTLPGTPIIYYGDEIGMGDNVYLGDRDGVRTPM
FT                   QWSGDRNAGFSRANPQALYLPPIRDPVFTYEAVNVEAQEQVPTSLLNWMKRTIQIRKKY
FT                   PVFGRGSIRFLQPSNRAVLAYIRQYQDTTILCACNLSRFCQAAELDLSDFKGLYPVELY
FT                   GKTVFPQIGELPYLLTFGPHVFYWFELKPQEQLP"
FT   gene            complement(358585..360543)
FT                   /locus_tag="Tter_0331"
FT   CDS_pept        complement(358585..360543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0331"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: alpha amylase catalytic
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41253"
FT                   /db_xref="GOA:D1CE97"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE97"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACZ41253.1"
FT                   /translation="MADQQPDPFYRISIVSVRPQIDCGRFPIKRIVGDRLRVTADIIKE
FT                   GHDTLGAEVRYRRQGSEEWESVPMSYSYDDDEWSAEIPIEFIGMLEYTVAAWTEVFISW
FT                   THELSRKVAAGRDVSSELLEGLELIRQAEARAVGEPKVLLAGYINRLQEASTQREKVDL
FT                   ALTPELAQLVSSHEAREDLTLYNKWLRVIVDREKARFGAWYEMFPRSQTDDPHKHGTFR
FT                   TAMKRLEAIKDMGFDVLYLPPIHPIGFTNRKGRNNALVAQPGDPGSPWAIGNQYGGHDA
FT                   VNPELGTIEDFDAFVREAQNLGIEVALDLAIQCSPDHPYVREHPEWFRKRPDGTIKYAE
FT                   NPPKKYEDIVALDMWCEDFLSLWNELKRVVLFWIEHGIRIFRVDNPHTKPVAFWEWLIS
FT                   EIKREHPDVIFLSEAFTRPKKLQLLAKIGFSQSYTYFTWRNSRWEIEQFMHELLHTEQV
FT                   EFLRPNFFANTPDILTEYLQKGGRPAFKIRLALAATLSPTYGIYSGFELIENVPLHPGS
FT                   EEYLNSEKYEIRVRDWNAPGNIIPYIKTINQARKQNRALQLYTNLTFHYPDNPNIIAYS
FT                   KISEDGSNRILVIANLDPFNWHECTVHLNGEALHIAPWDTYTVHDLITDAYYQWHGTAN
FT                   YVRLDPNYEPVHLFRIE"
FT   gene            complement(360764..362014)
FT                   /locus_tag="Tter_0332"
FT   CDS_pept        complement(360764..362014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0332"
FT                   /product="2-oxoglutarate dehydrogenase, E2 subunit,
FT                   dihydrolipoamide succinyltransferase"
FT                   /note="TIGRFAM: 2-oxoglutarate dehydrogenase, E2 subunit,
FT                   dihydrolipoamide succinyltransferase; PFAM: catalytic
FT                   domain of components of various dehydrogenase complexes;
FT                   biotin/lipoyl attachment domain- containing protein; E3
FT                   binding domain protein; KEGG: mxa:MXAN_6036 2-oxoglutarate
FT                   dehydrogenase, E2 component, dihydrolipoamide
FT                   succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41254"
FT                   /db_xref="GOA:D1CE98"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE98"
FT                   /inference="protein motif:TFAM:TIGR01347"
FT                   /protein_id="ACZ41254.1"
FT                   /translation="MAVEIRVPDLGESVVDVTVLKWHKQPGDSVEEGDVVVELETDKAN
FT                   VEVPAPSSGFLESISIQEGESASVGDLLGTITETPSQAREPSQPEAPQEREAVSPQAAH
FT                   HTEVQPKATPSVRRLAEELGIDISKIEGSGAGGRITREDVLAMRQAPSGAQQAESSKTV
FT                   EAQPIKETTPAPSEAPARELSELERRERMSTRRRVIARRLVEAQHTAAMLTTFNECDMS
FT                   NVIEIRRRLGPRFQEKYGVKLGFMSFFTKAVVAALKEFPYLNAEIDGEDIILKYHYDIG
FT                   IAVGAKEGLVVPVIRNADRKSFAEIEKEIDELATKVRNNTISLEEVRGGTFTITNGGIY
FT                   GSLLSTPILNPPQVGILGMHAIKERPVVVEGQVVVRPMMYLALTYDHRIVDGSDAVRFL
FT                   VRIKELIEDPTSLMLES"
FT   gene            complement(362004..364841)
FT                   /locus_tag="Tter_0333"
FT   CDS_pept        complement(362004..364841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0333"
FT                   /product="2-oxoglutarate dehydrogenase, E1 subunit"
FT                   /EC_number="1.2.4.2"
FT                   /note="KEGG: bha:BH2206 alpha-ketoglutarate decarboxylase;
FT                   TIGRFAM: 2-oxoglutarate dehydrogenase, E1 subunit; PFAM:
FT                   Transketolase central region; dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41255"
FT                   /db_xref="GOA:D1CE99"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE99"
FT                   /inference="protein motif:TFAM:TIGR00239"
FT                   /protein_id="ACZ41255.1"
FT                   /translation="MWGKNDKLYGLNAGLVAELYLRYLADPSSVDPSTRAYFDRVGNPF
FT                   PEELEELVTQAELPTEIDVLKIVGAARLARLTREYGHMAAQLDPLGTPPPGDPELELDT
FT                   HGLTEADLEKLPASVVGGPLAQTSRNALEAYRKLRDIYCGSIGYDFDQVQDSKERDWLR
FT                   DMVESRRFAIGDDPEFDRKLLERLSEVETFERFLHRYFPGQKWFSIEGLDMLIPMLDEI
FT                   ISRAAESGVREVVIGIAHRGRLNVMAHILEQPYEKIIAEFKHGLEHTKGTSNTDVGVDS
FT                   WTGDVKYHLGATLNLKTNLGCTIPITLVPNPSHLEHVNPVVEGRARAAQEDRSLPGPPR
FT                   QDERASLAILIHGDAAFPGQGIVAETLNLSRLPGYRTGGTIHIIANNQLGFTTEPSEGR
FT                   STTYAGDLAKGFEIPTVHVNADDPHACILTARLAETYRETFRKDFMIDLIGYRRYGHNE
FT                   SDEPSFTQPLMYEKIRKHPTVREIFAQKLIQRGIVSTEEVQAFVSKVEGKLRRAMQAEV
FT                   EDGRSPESEMELLEPEKDHFLQETKVSRELIAEINESLLSLPEGFEVHPKLWRTLARRR
FT                   DALERGEIDWGHAETLAFATILMNGTPIRISGQDTERGTFSQRHMVLHDVKTGQRYIPL
FT                   QAIPQARASFAIYNSPLSENAVLGFEYGYSTHAPETLVLWEAQYGDFVNGAQVMIDQFI
FT                   VSGQAKWRQKSGLVLLLPHGYEGQGPEHSSARIERFLQLAANDNIRIVYPSNAAQYFHL
FT                   LRRQAASLKSSPKPLVVFTPKSLLRHPLAMASVEDLVDGRFQKVIDDPRSDDIAPRVNR
FT                   IILCSGKIYVDLVSSKEYREANHVAIARVEELYPFPAREILQVVSRYSAAKEVVWVQEE
FT                   PRNMGAWNYIALRLRKILDPDINLGYIGRPDRASPAEGSVTLHNVQQSRIIKAAFGEAP
FT                   DISISGIRETVRHGS"
FT   gene            365078..366901
FT                   /locus_tag="Tter_0334"
FT   CDS_pept        365078..366901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0334"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase; KEGG: glo:Glov_1076 pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41256"
FT                   /db_xref="GOA:D1CEA0"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEA0"
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /protein_id="ACZ41256.1"
FT                   /translation="MSLAEDIKAIPVGKTPEVINDFSIVAATVNGSGSQTSNLTLIRAL
FT                   FRMGIPVNGKNLFPSNISGLPTWYTIRVNKDGYIARKERAEILVAFNPQTAAEDIQALP
FT                   PGGVCIYPAESKLPLVRDDIVYYSVPVKPFVEATGADPKLREKFASMVYVGALAELLGI
FT                   DRQEIRAALSQQFRGKEKVVDQNFQVIVSAADWVKENITKKDPYRVERMEATRGKILID
FT                   GNSAAALGAIFGGVTVAAWYPITPSTSLIEALQSYLPKLRTDKDGNHTYAVVQAEDEMA
FT                   ALGIVLGAGWAGARAMTSTSGPGISLMTEFAGLGFFAEIPGVIWDIQRIGPSTGLPTRV
FT                   SQGDVLKVYFLGHGDTRHVCLIPGTVAECFEFGYKAFDLAERLQTPVFVLSDLDLGMNL
FT                   WMSDPFEYPSEPMDRGKVLSAEDLQRIGEFARYRDVDGDGIPYRTLPGTDHPLAAYFTR
FT                   GSGHNEYAQYSERPDDWRRNMERLRRKHETARKLVPKPVIESWADSSVGIVSFGSVHHP
FT                   VMEAIDLLAEKGLSTDYLRIRALPLEETLREFIRKHDRTYVIELNHDGQMVNLIRMEFP
FT                   EVADKVISIAYCDGLPMTANYIANALLEKEC"
FT   gene            366905..367957
FT                   /locus_tag="Tter_0335"
FT   CDS_pept        366905..367957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0335"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: glo:Glov_1075 thiamine pyrophosphate
FT                   protein domain protein TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41257"
FT                   /db_xref="GOA:D1CEA1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032686"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEA1"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ACZ41257.1"
FT                   /translation="METITKPGSSPGRKVNRIGLERTDYRGGVSTLCAGCGHDSISSQI
FT                   MTAAFELSLKPEQIIKLSGIGCSSKSPAYFLGRSHGFNAIHGRMPAVATGATLANRKLL
FT                   AIGVSGDGDTGSIGIGHFKHMVRRNIPLVYIIENNGVYGLTKGQFSATADIGQKLKHAG
FT                   INELPPMDLCMEAIIAGCGFVARSFAGDAKQVRQLLKAAMSFKGTAVIDIISPCVTFNN
FT                   AEDSTKSYPYGKANEEPLHEIGFVPKYEEIVVDYDPGTVKEVELHDGSVIQLRKLDRDY
FT                   DPTNKVEALRLLEEAQANREFITGLIYFNEDRPSFPEVMRLPEKPLAELQEEDLRPPKE
FT                   ALEAIMSGLM"
FT   gene            complement(367958..368752)
FT                   /locus_tag="Tter_0336"
FT   CDS_pept        complement(367958..368752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0336"
FT                   /product="Coenzyme F420-dependent N5 N10-methylene
FT                   tetrahydromethanopterin reductase-like protein"
FT                   /note="KEGG: swi:Swit_2098 luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41258"
FT                   /db_xref="GOA:D1CEA2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEA2"
FT                   /inference="protein motif:COG:COG2141"
FT                   /protein_id="ACZ41258.1"
FT                   /translation="MKLGIVFSPASNWQEIFQAALLADKLGLDSVGFWDHYHSMKPEWG
FT                   YVCGWASYGAIACATERVKLVPMVICNLNYALGVMAKETSMLALISDGRFELGIGAGDY
FT                   PEEYAAWNLPYPDAEFRIALLRENMLALREVWQGKQVTFNGQKVKLQDATCAPPPSKPP
FT                   RIIVGAGKSKKLIRSALEYADEINIYADQELVRYTKRVISNSNKPIGLSVYLHFDWDQW
FT                   PQDISQEIAKWKQVGIDRLFINVGYEWPLQEKVREIASAIID"
FT   gene            complement(368775..369161)
FT                   /locus_tag="Tter_0337"
FT   CDS_pept        complement(368775..369161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0337"
FT                   /product="methylated-DNA/protein-cysteinemethyltransferase"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S- methyltransferase DNA binding; KEGG: bba:Bd3645 putative
FT                   methylated-DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41259"
FT                   /db_xref="GOA:D1CEA3"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEA3"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ACZ41259.1"
FT                   /translation="MSTPKEAKSFKEIVWKIVSSIPKGKVMTYGQIAALAGYPGSAQVV
FT                   GWILHYTPPELNIPCQRVVNRFGGLAAGYGWGGVYSHKKDLEKDGVEVREDFTVDLQKY
FT                   QWFPPQELVDEWLSFKLERLSQDS"
FT   gene            complement(369164..370093)
FT                   /locus_tag="Tter_0338"
FT   CDS_pept        complement(369164..370093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0338"
FT                   /product="ADP-ribosyl-(dinitrogen reductase) hydrolase"
FT                   /EC_number="3.2.2.24"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   rpd:RPD_2408 ADP-ribosyl-(dinitrogen reductase) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41260"
FT                   /db_xref="GOA:D1CEA4"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEA4"
FT                   /inference="protein motif:PRIAM:3.2.2.24"
FT                   /protein_id="ACZ41260.1"
FT                   /translation="MSTDQGDLKLLSKARGTLIAAACGDALGGPLELMGKNEIRRNLGQ
FT                   VRDFIGGGWLSLSPGEVTDDTQMMLEVARSIATLGRVDPQDITTRLVEWMNSNPKDIDH
FT                   TVFESLSLIRDGTPIYEASKLVIEREGFMNGSRGNGCLIPCVPIALLLYKREQALVKQT
FT                   RSVASITHANPVCQWAAVALNMMISELLRGRFEQVVVRVADKVPQPEISEMLRSIEKKS
FT                   EDDLDNSGDVLATLESAIWAFGNTSSLEDAIIKAANLGGDADTRAAVTGALAGAHYGIE
FT                   SIPQRWLERLEPAQELIVLAEQIVRTSR"
FT   gene            complement(370090..370461)
FT                   /locus_tag="Tter_0339"
FT   CDS_pept        complement(370090..370461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0339"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bcr:BCAH187_A3673 glyoxalase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41261"
FT                   /db_xref="GOA:D1CEA5"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEA5"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACZ41261.1"
FT                   /translation="MSIAIHHVQIAIPKGGEDKAREFYSQILLLTEVPKPPTLASRGGI
FT                   WFSTGNLELHLGIDPNFSPSTKAHVAFLVDDLDGIKHRLLQYGVKVIDDHLLPGFHRFY
FT                   TEDPFGNRIEILQVQEEKA"
FT   gene            complement(370587..371198)
FT                   /locus_tag="Tter_0340"
FT   CDS_pept        complement(370587..371198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0340"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: manganese and iron superoxide dismutase; KEGG:
FT                   aba:Acid345_3693 superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41262"
FT                   /db_xref="GOA:D1CEA6"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEA6"
FT                   /inference="protein motif:PRIAM:1.15.1.1"
FT                   /protein_id="ACZ41262.1"
FT                   /translation="MHELPPLPYDYNALEPYIDEQTMRLHHDKHHGTYVNNLNQALEKY
FT                   PELQNKSAEDLLRDINSIPEDIRTAVRNNGGGHVNHSMFWVIMKPNGGGEPYGPIADAI
FT                   KQTFGSFEEFKRQFNDAGAKRFGSGWVWLVRTPDGQLQVISTANQDSPLMEGLYPIMGN
FT                   DVWEHAYYLKYQNRRAEYLEAWWNVVNWDEINRRFEQSSK"
FT   gene            complement(371330..372109)
FT                   /locus_tag="Tter_0341"
FT   CDS_pept        complement(371330..372109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0341"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aba:Acid345_0544 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41263"
FT                   /db_xref="GOA:D1CEA7"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEA7"
FT                   /inference="protein motif:COG:COG5343"
FT                   /protein_id="ACZ41263.1"
FT                   /translation="MKIEHNNHEQLYEVITAYVLGALEPEDMRLMECHLQSCMDCTSVL
FT                   DELLPVASILGMASEQHSPPPSVKQRLLDRIRSEERTPHEQVIAPRTASTGSFWARFFL
FT                   GSNTLKFVAPAALAVVILALGVIALLQRGQINQLKADVEEQRTIVALLTSPSTQVAEMQ
FT                   QNSIHGRMIMNPNNNKAYLVIQGLPPIPEDKDYQIWLIKDGHKQSAAVVHPNGTLAVVL
FT                   SAPEPIGQYSAMGITREPKGGSPQPTSNPIIVSSLKD"
FT   gene            complement(372116..372706)
FT                   /locus_tag="Tter_0342"
FT   CDS_pept        complement(372116..372706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0342"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 4 domain protein; KEGG:
FT                   sus:Acid_7860 ECF subfamily RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41264"
FT                   /db_xref="GOA:D1CEA8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEA8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACZ41264.1"
FT                   /translation="MSNQPLDDQAIMERLSRGDLSAMEALYDCYSRAVYSMILRIVQDQ
FT                   QVAEELTQETFFRAWKQAKSFSNDRGKCASWLMSIAHNIAIDEIRRCKARPKSIRSEDS
FT                   SNYLMNLPDSSLEDPDEIIMGGIRRNIVLEALRELPENQRKVLEMSYFGGLTQSEIADK
FT                   VGEPLGTIKTRMRLALQHLRRNLIEKGIKPEQL"
FT   gene            372999..373178
FT                   /locus_tag="Tter_0343"
FT   CDS_pept        372999..373178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41265"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41265.1"
FT                   /translation="MQVDDISNHDREDEEQLQKIREWYKQARSMGISKETFYREMIPIV
FT                   GIESLDNALEGYDE"
FT   gene            373227..373886
FT                   /locus_tag="Tter_0344"
FT   CDS_pept        373227..373886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0344"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: smd:Smed_3882
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41266"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB0"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACZ41266.1"
FT                   /translation="MPETKILLVRHADVHNPDQIVYGRLPRFRLSKLGEAQAEATAEFL
FT                   SKEDVKYIYTSPMLRARQTAKAIAKYHPDAKLRISKLLAEINTSWQGIPWSQIGANANL
FT                   YEPIKDPENETIEDVAKRMLRIIRTLVRRHPGETVICVSHADPIKIAWVALEGKELTFE
FT                   NIRKPPYPDRASVTTITFNDDHVVSIKYENPAISVRVTPEQESEKKPSRKKVPVGV"
FT   gene            complement(373917..376262)
FT                   /locus_tag="Tter_0345"
FT   CDS_pept        complement(373917..376262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0345"
FT                   /product="VanW family protein"
FT                   /note="PFAM: VanW family protein; KEGG: bca:BCE_0672
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41267"
FT                   /db_xref="GOA:D1CEB1"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="InterPro:IPR038054"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB1"
FT                   /inference="protein motif:PFAM:PF04294"
FT                   /protein_id="ACZ41267.1"
FT                   /translation="MGSTEHWSQPTETIPTIKPKASSQRRQSRNGSVLRTYLPLVGISV
FT                   FLCAFLLLAVSVGYSYYYRSKIYPNVYSLGINLGGMTPEQARQALNAKAMEYVRTPLVL
FT                   TQGEHTWKITPAELGLQPNVDPAVQQAYKYGRDGNIFHQFAERIPIGRRTVRIQYVLDK
FT                   SKIDNYVNNKLAPQIARPATDSKLTVSGDGTILASKEVDGQKLNTSMAIQQIYSALVNL
FT                   RKGDIALPVVTVKANITQSTWRDRQNLVLKLSKPVTLRFENRSWTITSDEIEQAIVAES
FT                   GAEGVVGKIEPSKLMPILANINKDIALPPEPAKLEIKGNQVALTPEQPGRRVDYSATLS
FT                   AIYAALQSSGETDLATKEIEPIVTTSVLENARSQLEKLLASPLKLHFKDQSWEIPTSTL
FT                   ADWTSIDIDKANRTSSVKLDPNKVNEFVDNLASEINQNPINGELTWRGKLVVLRESQDG
FT                   QDLDTEKTKDLIAQAAFSDDRDVDLPVKVTKPKIPTDNLAALGIKESIGWGSSEFTGSP
FT                   PERVHNIQTAAGYLNNTVVAPGETFSFEKAIGEISVERGYQEGLTIVADQTVPGIGGGV
FT                   CQVSTTMFRAAFWAGLPIVERHQHSYLVPYYQLDGDPPGFDAAVYFPYKDLKWKNTTGH
FT                   YILIEAKWTDTKLTITLYGTDPGYEVTRGKPVITNIVPPLPDKTIYDPTLPPGTKEQVD
FT                   WAHEGMDVTITRTVTKNGKVVLQDSFFSRYKPWGNIYRVGPPKKEPSKKEPPKKETKNK
FT                   NKESENKDKQQKKDVNNSKDSTKKIEQR"
FT   gene            376441..376812
FT                   /locus_tag="Tter_0346"
FT   CDS_pept        376441..376812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0346"
FT                   /product="protein of unknown function YGGT"
FT                   /note="PFAM: protein of unknown function YGGT"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41268"
FT                   /db_xref="GOA:D1CEB2"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB2"
FT                   /inference="protein motif:PFAM:PF02325"
FT                   /protein_id="ACZ41268.1"
FT                   /translation="MSRIDDDNARSLNEDRIYEERYVEVDRRSLLAYRWARVVYFVFGI
FT                   IEGLIAIRFVLRLLGANPNSQFAALIYNLTAPLLAPFRGLFSEPSFGTAVIEWRSLVAI
FT                   AVYMLLSYVLVRLGYLLFS"
FT   gene            376936..377385
FT                   /locus_tag="Tter_0347"
FT   CDS_pept        376936..377385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0347"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: dvm:DvMF_1241
FT                   ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41269"
FT                   /db_xref="GOA:D1CEB3"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB3"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACZ41269.1"
FT                   /translation="MTIQDKRTSELVDLLRNAGMRVTPQRLEIVSALVHGSHPSAEEIY
FT                   EQVSAKLPTTSLATVYNTLEALKSLGQVLEVRPPQGGIRYDVLRPYGHSHLVCKRCGRV
FT                   EDAPQQILENGEVSLKVPDIGWSDLEIRLDLEGICPYCREVGADG"
FT   gene            377378..378121
FT                   /locus_tag="Tter_0348"
FT   CDS_pept        377378..378121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0348"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="PFAM: iron dependent repressor; regulatory protein
FT                   MarR; FeoA family protein; SMART: iron dependent repressor;
FT                   KEGG: tcx:Tcr_0904 iron dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41270"
FT                   /db_xref="GOA:D1CEB4"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB4"
FT                   /inference="protein motif:PFAM:PF02742"
FT                   /protein_id="ACZ41270.1"
FT                   /translation="MASSQATETTHVTASMEQYLLAMYCLRRENQPLIGARLAEWLDVS
FT                   PASVTGMIHRMSQEGLVQVGRGKQITLTTKGWQIALTTARRHYLAERLLTDMLGVDWYR
FT                   AHVEAERWQHAITDETEEKLWIALGRPTTCPHGSPIPGTGACFSPHSRKLTDVEVGREL
FT                   IVERISDSATENIDLLKFFQDHLIMPGKKLSVREINSITQAVTVETENGPVALGIEAAR
FT                   QVIVVPAHLFQQRKPPERLRKDSTF"
FT   gene            complement(378111..378962)
FT                   /locus_tag="Tter_0349"
FT   CDS_pept        complement(378111..378962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41271"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41271.1"
FT                   /translation="MRGSFIACVIALLLCLGFIGDASANSGPFISISTSKGKPGTKVTL
FT                   DGKGFTPNAQVIIAANPEGIIISKGKSDHKGNIHLSLPIPPQEKIPNLEGSNLRIFAVE
FT                   PVSGKQSNEVQFNYLGSDTPSILATVKAFEFSIKLKVSEDEANKNYTFWAVYGPPNSSQ
FT                   VAHRLTDPDGDLVYTFTDEVVGKSLLIVKIVRGTGVKTTSTGAEPGDPQLVLQDLGVLE
FT                   VNRNITLEINETSANKEVPEVESATSRNLVPQGLPLTGGGGMSIWDRFCYMESHKLPGV
FT                   RK"
FT   sig_peptide     complement(378888..378962)
FT                   /locus_tag="Tter_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.947 at
FT                   residue 25"
FT   gene            complement(379037..379996)
FT                   /locus_tag="Tter_0350"
FT   CDS_pept        complement(379037..379996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0350"
FT                   /product="Glyoxylate reductase"
FT                   /EC_number="1.1.1.26"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: dal:Dalk_2294 glyoxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41272"
FT                   /db_xref="GOA:D1CEB6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB6"
FT                   /inference="protein motif:PRIAM:1.1.1.26"
FT                   /protein_id="ACZ41272.1"
FT                   /translation="MYRVYITRKIPEAGLRLLKDHGFELDIWPGDLPPSKEELKRGISQ
FT                   ADAMISLLTDKIDEEVISNARNLKVIANYAVGYDNIDLEAATKAGIVVTNTPDVLTETT
FT                   ADLAWALMLSVARRLIEGVSHVKDGKWRTWEPQLLLGQDVYGATLGIVGMGRIGQAVAR
FT                   RAIGFQMKVLYTSRSEKTGIDAQKVSLDELLAQSDFISLHTPLTKETRHMINKSTLKRM
FT                   KPTAILINTARGPLVDTAALVEALREGQIAGAGLDVTDPEPLPRNHPLLYLPNCIVVPH
FT                   IGSASQRTRDLMSEIAARNVIAVLEGSQAPNQVNILGS"
FT   gene            380120..380941
FT                   /locus_tag="Tter_0351"
FT   CDS_pept        380120..380941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0351"
FT                   /product="peptidase M55 D-aminopeptidase"
FT                   /note="PFAM: peptidase M55 D-aminopeptidase; KEGG:
FT                   bsu:BSU12920 D-alanyl-aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41273"
FT                   /db_xref="GOA:D1CEB7"
FT                   /db_xref="InterPro:IPR007035"
FT                   /db_xref="InterPro:IPR027476"
FT                   /db_xref="InterPro:IPR036177"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB7"
FT                   /inference="protein motif:PFAM:PF04951"
FT                   /protein_id="ACZ41273.1"
FT                   /translation="MRVYISADMEGISGVVHPSQIDPNGSDYLRGRRLQTGDVNAAIEG
FT                   ALQAGASEVIVNDSHWVQRNILLEDLHPCARLISGSTKRLGMVHGVEGADLALFIGYHA
FT                   KHGTPYAIADHTWSSSCVDDLRLNGHSIGEFALNAYICGYFGVPVVMASGDQALENEAK
FT                   ALIPGIQVAVVKLATGRWAAECLPLSESRKLIRSCAKEAVSVRNIQPLSPPSPCEVELD
FT                   LMVTEMADRAEYVPGVHRIGGRTIGFECEDIIKAFEMFRTVVNAASLFTPF"
FT   gene            381028..382395
FT                   /locus_tag="Tter_0352"
FT   CDS_pept        381028..382395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0352"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG: sil:SPOA0312
FT                   glutamate-1-semialdehyde 2,1- aminomutase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41274"
FT                   /db_xref="GOA:D1CEB8"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB8"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ACZ41274.1"
FT                   /translation="MMGHLTRELSAVVDRYIQQRPRSAEIYQRAVEDLPDGVTHDKRFM
FT                   TPFPTYIQRAKGSRKWDVDGNEYVDYVMGHGALLLGHCHPEVTQAVVEQVQKFTHPGGS
FT                   HELEVEWAELVKSLIPSAEKVRFTSSGTEATHMAIRLARAYTGRKKIVKLEGHFHGWHD
FT                   GVAKAQTPPYDRKTPGIPDEISELTLVSPAKLESIEKIFSSDRDIAAIIFEPSGASYGT
FT                   VPLPEGFVQGLKDLSDRYGVLLICDEVVTGFRWSPGGVQALAGIKPDLTTLAKILAGGF
FT                   PGGAVAGRADILDLISHASDPAKRIVHQGTFNANPVSAAAGVECLKIVGSSDVCQQAAS
FT                   KAAVLRSRLNEKFEDLQIPGCAYGESSICHIIIGEEVPNRVRGDLQRPDLPEDVLRTKG
FT                   TNQQLMWLFDLAMMNEGVDLFSGSAFVSSYHTDEDIDLTIDAFVKVVSELKNEGYL"
FT   gene            382410..383339
FT                   /locus_tag="Tter_0353"
FT   CDS_pept        382410..383339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0353"
FT                   /product="Asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="PFAM: peptidase T2 asparaginase 2; KEGG:
FT                   spe:Spro_2851 asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41275"
FT                   /db_xref="GOA:D1CEB9"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEB9"
FT                   /inference="protein motif:PRIAM:3.5.1.1"
FT                   /protein_id="ACZ41275.1"
FT                   /translation="MGKFVVVASANGRVGIEEAARVLANGGSALDAVEVGCRLVESNPE
FT                   DHSVGLGGLPNLIGEVELDASIMDGTTLRAGAVAAVKGYEHPISIARKVMELTPHVCLV
FT                   GSGAERFAKEMGFEPTDLLTPESKRLWEERIRGESSDVDPGMIRYHEQIIQWLSLISDP
FT                   EKPAGGTVNFLALDREGNLACGVSTSGWYCKYPGRIGDSPIIGAGNYADSRFAAVGCTG
FT                   RGELAMRIPAAYTVVVRVQRGESLINALCQTMQDINKLEDPYATGLSMVALDKDGNHAA
FT                   VSNRPDTTYVWLEEGMDSYQESPRIYVA"
FT   gene            383419..384345
FT                   /locus_tag="Tter_0354"
FT   CDS_pept        383419..384345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0354"
FT                   /product="ribokinase"
FT                   /note="TIGRFAM: ribokinase; PFAM: PfkB domain protein;
FT                   KEGG: pmr:PMI3049 ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41276"
FT                   /db_xref="GOA:D1CEC0"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEC0"
FT                   /inference="protein motif:TFAM:TIGR02152"
FT                   /protein_id="ACZ41276.1"
FT                   /translation="MTARVVVVGSSNTDMVVPVPHIPGVGETVLGGDLIIAPGGKGANQ
FT                   AVAAARLGAEVVFIGAVGSDDFGQKAIKGLNADGIDTSYVKIVDGTPSGVALIMVDPSG
FT                   NNSIAVSPGANSRLFPEDIELSSKVLQNARILLTQLEVPLDTVATALEFGKKMDCVTML
FT                   NPAPAPATGLPSDIISHVDVITPNEVEARALVGRDMPSEDLAKALLDLGVKIVILTLGE
FT                   RGALVAQQDKLVAVEPFAVSPVDTTAAGDAFSGALAVAIAEGLELIDAVRFANAAAALS
FT                   VTKMGAQPSMPTRAELETFLSRHQISG"
FT   gene            384352..385221
FT                   /locus_tag="Tter_0355"
FT   CDS_pept        384352..385221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0355"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   tdn:Suden_1355 site-specific DNA- methyltransferase
FT                   (adenine-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41277"
FT                   /db_xref="GOA:D1CEC1"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEC1"
FT                   /inference="protein motif:PRIAM:2.1.1.72"
FT                   /protein_id="ACZ41277.1"
FT                   /translation="MSSSNKIFFGDNLRVLESLPSNSVNLIYIDPPFNTGRRQVRISMS
FT                   VDRDDQGDRKGFGGYKYLTKVLGKLSFDDIYDDYLAFLEPRLREAHRVLTANGALYFHI
FT                   DYREVHYCKILLDSIFGRDNFLNEIIWAYDYGGRSKRKWPTKHDNILYYVKDRNNYVFN
FT                   ADEIDRLPYMAPSLVGGDKAKLGKLPTDVWWQTIVSPTGKEKTGYPTQKPLAILERIIR
FT                   ASSCPGDIVLDFFAGSGTTGVAAHKLGRSFILVDNNEEAIRVMRSRFRDVPVEFITLED
FT                   YKYEDKAV"
FT   gene            complement(385218..385835)
FT                   /locus_tag="Tter_0356"
FT   CDS_pept        complement(385218..385835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0356"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG:
FT                   phosphoglycerate/bisphosphoglycerate mutase family protein;
FT                   K01834 phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41278"
FT                   /db_xref="GOA:D1CEC2"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEC2"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACZ41278.1"
FT                   /translation="MTVRLILVRHGESEANAIGIMQGRMDSPLTRKGRQQAEAVAQKLA
FT                   KILVPSNVFSSPLSRALETAKIIATKFELEPVIIPELQERDLGLATGMTWEQASSLWPE
FT                   NAWDIKIGKPSGAWPQGETRVELQQRAHKALEKILSIQKSGTAIVVSHAGLMRALIKQI
FT                   MYKHMNTDLDPKISNCSITELQITDGKYNLLCLNDTSHLELV"
FT   gene            385965..387698
FT                   /locus_tag="Tter_0357"
FT   CDS_pept        385965..387698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0357"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; Cna B domain protein; KEGG: gme:Gmet_0751
FT                   peptidase S8 and S53, subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41279"
FT                   /db_xref="GOA:D1CEC3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034084"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEC3"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ACZ41279.1"
FT                   /translation="MVLSSSIRRLVIVVTTSLALFFLTISQSPGYAYAASRNSDLEPRV
FT                   LTTGRILVKFRSGTDASKVLQAASIQSGIIVDRVNPLGVKVVRPRTVLAQSLGTLERLA
FT                   NHIEQNPSVIYAQPEVLLQPQDVIPNDPDYPRQWGLQRIRAPKAWEISTGSSTVKIGIV
FT                   DSGIAMNHPELKDRYAGGYDFVQHDTYPQDTDGHGTHVAGIAAATGNNGIGIAGVGWRT
FT                   KLLVARVLTAEGATDTDVAKGIIWVTDHGASVINISLGTYYDSDTLHQAIQYAQEKGVL
FT                   VVAAAGNESTNIPLYPAAYPGVIGVAATNQDDRYASFSNYGSYVDISAPGVDIYSTYPG
FT                   GYAYMSGTSMAAPFVTGAAAVIKAEFPWYSANQIWQRLKAGADDLGPKGLDTRYGYGRL
FT                   NLYRSLAVPGTLIGRVRNAKTGNVLPGVRVQLYGTPRYTYTDSQGRFVFRNIRYGAGKL
FT                   IFSKQGYAQGMRNIFIEPAATEYTGIRLAPLARLSGYVRSSSGTPLSNAVVSVTSQEGS
FT                   DLQDTTDSYGRYFIKNVPIGIVRVTASLKDYTSVTKNVSTTMGTTTSVSFTLKPLLAPG
FT                   N"
FT   sig_peptide     385965..386069
FT                   /locus_tag="Tter_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 35"
FT   gene            388153..389829
FT                   /locus_tag="Tter_0358"
FT   CDS_pept        388153..389829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0358"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to hedgehog protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41280"
FT                   /db_xref="GOA:D1CEC4"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41280.1"
FT                   /translation="MTLKIRQPFLITCLIISALVLSMIAPTLFGGTTSAHGKNPPGNNG
FT                   TIKVDGRDFDDHPNNEPHPGCVFQIDFYGFDKGDYYATVTFETQAPTEPKDQVILQDKV
FT                   FIGEDDASGGGSESGLDASVKYDLSQYLSQYEPHSNQGYHIKLTIHAPGSKGNDVKHKV
FT                   FWVNCKPENPQPTPTPTATPVPSPSVSPSPTPLPSESPTPSPSMSPTPVPTPSIVPSPS
FT                   PSESPLPSPSVSPTPQPSHSPVPSVSPSPSQSPLPSPSNTPIPSNSPSPSVSPSPSPST
FT                   TPVPSPSISPIPSPSPSVAPTPSPSPTAIPSPSPSVSPTPVPSTSPSPSVSPVPTPSPS
FT                   TSPTPSPSESPAPSPTPVPSPSFSPTPSPSESPVPTPVPSVSPTPSPSTTPLPSPSNSP
FT                   KPSPSPSVMPTPVPSPSISPLPSPAPSESPMPTPVPSPSPSATPVPTPQPSPSPSELPA
FT                   PSVSPTPIPSSVPSPLPSPSPSGSPTPIPMPAPSVSPSPSASGVPVPEASPSPSPSHMP
FT                   TVPRTGDGGMASTGSGSSLPVAGYYLGLILVATYMLLRRKW"
FT   sig_peptide     388153..388266
FT                   /locus_tag="Tter_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.790 at
FT                   residue 38"
FT   gene            389971..391296
FT                   /locus_tag="Tter_0359"
FT   CDS_pept        389971..391296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0359"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   mca:MCA2192 dolichyl-phosphate-mannose- protein
FT                   mannosyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41281"
FT                   /db_xref="GOA:D1CEC5"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEC5"
FT                   /inference="protein motif:PFAM:PF02366"
FT                   /protein_id="ACZ41281.1"
FT                   /translation="MAEIAGKELVEKKEWNSLAIRAIPLLLILVSFAFYLYRLSVPPQY
FT                   IYDEVYHAYTAAQYASGNTDAYLWYKRAPREGVAYEWTHPPLGKLLIADSILIFGDNSF
FT                   GWRFASAVFGAIGIGVAYWLGYSLTGYMVVGLLTSFLLLFDGMYYVQSRTGMVDIFLVV
FT                   FLMLALLMAYKYLTATNGRTRYLFLTGVFIGLAVSTKWNAVYVYAFLGLSLVVCSAYTL
FT                   YKSRAPVSKWLLEAGLLFAFMLLVPAVLYLLSYTQFFLSGNGIKDFFKLQYQMYYYHSH
FT                   LKATHNYQSKWWEWPLTLRPVWYYVKYYPDGRIANIYTNGNPVIYLALIPAVLWAASDW
FT                   IDENWKALLIVVLGFFGAWLPWALVPRIAFAYHFLPSVPFGCVALAYTIRQFLSRGGTW
FT                   RTAAICYCVAVVAMFVFLFPIYSAIPLTRAQFDMRILIPSWR"
FT   gene            391301..393253
FT                   /locus_tag="Tter_0360"
FT   CDS_pept        391301..393253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0360"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mca:MCA0997 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41282"
FT                   /db_xref="GOA:D1CEC6"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEC6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41282.1"
FT                   /translation="MLGVLLLISCLILGILVLYLLVPGLTFEERIFYGFDLGVILISIA
FT                   CFVSAIFFGFNLLQVCLTSLCLLIVSFVLTFWLRSQVAARIKNELQDFRSRLKLRETVW
FT                   FAEMLLVIGVFFFHLYYNSWRLYPDGWYAGHSFIWGDLPIHTGLIESFVEIRKFPPPNI
FT                   YFSGTLLSYPFMADFFSSILMILGWSLGPAFVIPGFLLGICTVAGIYLLALRISRSVFA
FT                   SLLTVVLVLLSGGMGFIVFLVEANRSGNFIHTLLNLPSYYTGLRDYAMTYPNIVLGFFL
FT                   PQRPFLLALPLGMLMLSLLYRFRLSRRPYDMLLVGLASALLPLVHPHTLVTIGIVSGYL
FT                   VVEYLVLSFLCNDKQGCYRALLSGVLFSLPVTVGMLQVLWQLGNLGATSNGGLSVQITT
FT                   RAIATENYIWYWLKNVGLFLPLAGLIFVVQGALPNRIRSFYAPFALIWFIATLVVMQPF
FT                   DCCNRKLLVYWYLVSAVVISLVLVKLILTGDIISRFLVAFLIFLLVFTGSLDLFRASIP
FT                   SQSRYLEFSNEDIAFANQVKERLPADAVYITATQVHHPITDLAGRQVVLGPPYLANDWG
FT                   LPWRPRMEDLQLIYTGSSRAQDLIRKYGARYLVIGPTERQLFRVNKQYYQERFPVVLRY
FT                   GQYTVFDVSSVYGSR"
FT   gene            complement(393254..394507)
FT                   /locus_tag="Tter_0361"
FT   CDS_pept        complement(393254..394507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_0642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41283"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41283.1"
FT                   /translation="MTKLKPRLLVFLILCLMVTTLSPLISINRASAAVTTWRALFLVYR
FT                   STDVTFTWNGQTQRVRTSMSSSDLQKALYVIRRVPSTVYNWSRGNTYLSQTIVYPDHPI
FT                   SSVTSLGANGFWVSPLDIKADINKYAPQGRYDSIFVIWRLDTDSGKRVPSLGWGWTVRP
FT                   GPWANGAGYTTVNIPQQHGDWLGRYPEQIFLHEWTHQVTGFYEQLGYRMPNIDRASDYG
FT                   YSREEAGQVFLSDVLSGRVPYGSTYIGVKPSIWASSTPRYLYAAQSSNYLPRVTSLTPG
FT                   TGTSYVGRSYSFTATYYDSNGAKNINKAYIKFQSSYYNRSVKIWYNQDKNKIYMKDLSN
FT                   GVLYSAVPGKDVVLRGNIVQINARYTTVSLSGNQLTIRWSIVFEPRADNNNYRVLASVR
FT                   DDSGAYPDYKLMAYRYVR"
FT   sig_peptide     complement(394409..394507)
FT                   /locus_tag="Tter_0361"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.865 at
FT                   residue 33"
FT   gene            394774..395994
FT                   /locus_tag="Tter_0362"
FT   CDS_pept        394774..395994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0362"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: bsu:BSU37170
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41284"
FT                   /db_xref="GOA:D1CEC8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEC8"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACZ41284.1"
FT                   /translation="MDFGLSEEHVMVQDLVSDFAQREIAPKARENDINEYWDKDIVKRM
FT                   GELGLLGAPIPEEYGGSGMDYHSLAIICEELERAETAFRVVMSVHVALNSLTLLQWGNE
FT                   DQKQRYLIPQARGEKLATFALTEPGHGSDAANIETTARREGDYYVLNGQKTWISLADKA
FT                   DHFLLFATLDRSKGYKGITAFILERGFEGLSTSTIHGKLGVRAGNTGQIFLDNVRVPIE
FT                   NRLGEEGEGFKIAMSAIDQGRLTVAAGAVGLARACLEASLKYCHDREAFGQEIGKFQLV
FT                   QQMIANMQLGIDTAKLLVHRAAWLKNHGIRSTRETSMAKWYACNVALKAAEDAIEIHGA
FT                   NGYSNEFPVERYWRNARGAVIYEGTREIHTLIQAEYALGYRKDHPLRCPQPPVKGYDPS
FT                   SFPSRHL"
FT   gene            396010..397194
FT                   /locus_tag="Tter_0363"
FT   CDS_pept        396010..397194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0363"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: bca:BCE_5475 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41285"
FT                   /db_xref="GOA:D1CEC9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEC9"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACZ41285.1"
FT                   /translation="MSRTAILSAVRTPIGKLGGALASLSAVDLGAIVIRSAIERAGIPP
FT                   SEVQHVIMGNVIGAGLGMTPARQAAFRAGLGREVTADTLNRVCGSGMRAIALADALIRL
FT                   GEHNIVVAGGMESMSNAPYLIPKARWGYRMGNGELLDAMIHDGLWDPILHVHMGNHGSS
FT                   VASKEGVTRQQQDEWALRSHKRAIAAIDAGRFDDEIIPVEVSSNKGDKSLVDQDEAPRR
FT                   DTSMEALSRLKPVFDPNGTVTAGNAPGVNDGASALVLASEDYVRAHGLRPLAFILAQGA
FT                   AAWDPPYLAYTPAMAAQQALCKVNMLIDDMDLIEINEAFASVAIISIRKLNADPEKVNV
FT                   NGGAIALGHPIGASGARIVTTLLHELHRRGGGYGLAAICSGTAQGDALVLQVEG"
FT   gene            397199..398359
FT                   /locus_tag="Tter_0364"
FT   CDS_pept        397199..398359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0364"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: bcb:BCB4264_A5464
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41286"
FT                   /db_xref="GOA:D1CED0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED0"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACZ41286.1"
FT                   /translation="MGLSNCLALPEDYQVLRSIVRKFAEDRIRPQVLQNDREARFPAGI
FT                   IEELGQLGFMGAPINPQYGGSGSDFLSYAILIEELSRVDPSIGTIVSAHTSLTAVPLQR
FT                   WGTEEQKGKYLSLLASGKTLGAFALTEPESGTDAASIQTRASRDGDHYFLTGTKVWITN
FT                   ASHAGLFIVFARTDNRGNHKDISAFIVDRESPGLVVDPSESKLGIKAAHSCTVHLDGVK
FT                   VSARDRLGEEGQGFKIAMQSLDGGRIGIAAQAVGIGQACLEMSIQYAVQRRQFGRPIAE
FT                   FQAIQWKIADMATQVEAARLLTYRAAMLEDKGENITLAASMAKLFASEMCVSAAREAIQ
FT                   IHGSLGYSAEYPVEKFYRDSKVTEIYEGTSEAQRMVIASRLLKELQ"
FT   gene            398490..399506
FT                   /locus_tag="Tter_0365"
FT   CDS_pept        398490..399506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0365"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 3 domain protein; sigma-70 region 2 domain protein;
FT                   sigma-70 region 1.2; sigma-70 region 4 domain protein;
FT                   KEGG: bha:BH1376 RNA polymerase sigma factor RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41287"
FT                   /db_xref="GOA:D1CED1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED1"
FT                   /inference="protein motif:TFAM:TIGR02393"
FT                   /protein_id="ACZ41287.1"
FT                   /translation="MLSEIHDVPFQDPHFSHQYEDLPEEAEYDKQEEDLSEDLDDSVRM
FT                   YLREIGLVPLLTAEQEVELAKKMERGKKAQSVLDSGKYEPEQRDKLLAEVDEGERARRH
FT                   LIEANLRLVVSVAKKHMNRGLSLLDLIEEGNIGLMRATDKFDYRKGFKFSTYATWWIRQ
FT                   AVTRAIADQARTIRLPVHITETMNHLYKASRKLSQELGREPTCEELAEYMGMNPEKVRL
FT                   IMRASRHPLSLEGPVGTDGDSSLGQFIPDSTTETPVDLAIGEVLKRELSKVLNSLTEKE
FT                   RKVMVLRYGLEGSSPHTLEEVGHRLGVTRERVRQIEAKALEKLRKPGKLNHLRDFLD"
FT   gene            399533..400540
FT                   /locus_tag="Tter_0366"
FT   CDS_pept        399533..400540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0366"
FT                   /product="dihydrodipicolinate reductase"
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   mxa:MXAN_4674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41288"
FT                   /db_xref="GOA:D1CED2"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED2"
FT                   /inference="protein motif:PFAM:PF01113"
FT                   /protein_id="ACZ41288.1"
FT                   /translation="MGEPIVSEIRVISFGLGPIGSEVARVAASKSNMRLVGAVDIDPSK
FT                   VGRTVEEVTGAPSEVIVSSSLEEALQNTEADLILHTTSSFLEVVKPQIESAIEKGLSVV
FT                   STCEELSYPWRTYPGLATELDMKAKEANVRILGTGVNPGFVMDAFPLTVTTVCQKVDRI
FT                   HIERVVDAGGRRLQLQRKVGAGLTVEEFRQLVATGNVRHVGLPESAWMIIDAMGWECKD
FT                   FEESIEPIVAEREILAAIGNIQPGQVAGVRQTIRAYGRDIEKLVLDLKMYVGADEPVDH
FT                   IQIWGIPDLDLRFDGGVHGDRATASIVVNAASVLMNLPPGLRTMLDVMPLRFRS"
FT   gene            400546..401217
FT                   /locus_tag="Tter_0367"
FT   CDS_pept        400546..401217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41289"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41289.1"
FT                   /translation="MKHLLSGLLAILIATCWACSPLGFLTQGSGSSKVHLPTPTGFSSP
FT                   AAVVTPTTNSPASTPSVIPSATPSKVISSSIAFESKIYNYTLKLPAGWYGVSGGISSAG
FT                   VRGDVFYPRKPGVEAYITVFAEDLNPGVNLDSYVDASVNNISRIAGVRVQRLGDYRGGL
FT                   ISGQWLAWTDFSKSPEVFYIRQLVWVYGSKAWVMTLRSKDKNLSNYISVLEFMAATWRA
FT                   E"
FT   sig_peptide     400546..400602
FT                   /locus_tag="Tter_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.914 at
FT                   residue 19"
FT   gene            complement(401236..401391)
FT                   /locus_tag="Tter_0368"
FT   CDS_pept        complement(401236..401391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msl:Msil_0116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41290"
FT                   /db_xref="GOA:D1CED4"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED4"
FT                   /inference="similar to AA sequence:KEGG:Msil_0116"
FT                   /protein_id="ACZ41290.1"
FT                   /translation="MSLLWLLIILLIIAILFGGWGYGRYGPYVSIGPVALIILIILILW
FT                   LTGSLT"
FT   gene            401558..403264
FT                   /locus_tag="Tter_0369"
FT   CDS_pept        401558..403264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0369"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: vha:VIBHAR_05108 ATP-binding ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41291"
FT                   /db_xref="GOA:D1CED5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ41291.1"
FT                   /translation="MQEDIPIKIESFTWRYRGRKEPAVQSLSLEVKQGDFVVIMGPSGA
FT                   GKSTLAISLNGLIPHFYRGKMEGNVFIFGKSTRDSRVGELARYVGLVFQDFEAQLFSTN
FT                   VALEVAFGPENFCVHPDEIGLRIRESLAKVGLQGFEERRPATLSGGQKQRLAIASVLAI
FT                   QPRVLCMDEPTTDLDPIGKEGVFKIARSLEQEEDVTLIVIEHETEEALNADRIVLMRDG
FT                   QVVADYPAKEMLRKVDLMEECGVMPLQVPQFFSVMGVPEMELPLTPEEGVQEFRRRGYR
FT                   VDEGAYTKLVEEEKSRMESNHEVIIEVRNLSHMYPGGVLALEDVNLNVHKGEFLAILGQ
FT                   NGSGKTTLVKHFNGLLYPTSGSVRVNGEETRKLGIRTLGQHIGYVFQNPDHQIFSDKVY
FT                   DEVAFGLRLRHTPESEIKQRVADALRAVDLEGYEDADPFSLTKGERQRVAVASVLAGNP
FT                   EVLILDEPTTGLDYSQQRSMMELVKRLNESGSTIIVVTHSMWLVAEYADRVVVMKDGRV
FT                   YLSGTVREVFSREEELRDAALKPPQIVSMSNLLGYTVRSVEELVHVTKENR"
FT   gene            403265..404026
FT                   /locus_tag="Tter_0370"
FT   CDS_pept        403265..404026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0370"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: bha:BH0166
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41292"
FT                   /db_xref="GOA:D1CED6"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED6"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ACZ41292.1"
FT                   /translation="MDPYYLYIDRDSIFHRLDPRTKMLLLLVTFVLVFISLNPLYLLAI
FT                   LLLVLLAGYVAGVLVNLRRIRFVLFMITLVTIVLWSLFQQGTTPLFWIVERESVVYAVS
FT                   VAIRIDTMVIAGLIFLSITRNEDIAMALVRIGIPYRFAFVVSTALRLVPTIASTTTTIT
FT                   QAQRSRGLDLDTGGPIQRIKNYIPLLIPVFISTIRSTNIFSMALESKGFGAMPSRTYYL
FT                   QLKMVGRDFVVIFIALGLLVFIILARILGYL"
FT   gene            404059..404889
FT                   /locus_tag="Tter_0371"
FT   CDS_pept        404059..404889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0371"
FT                   /product="protein of unknown function DUF1393"
FT                   /note="PFAM: protein of unknown function DUF1393"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41293"
FT                   /db_xref="GOA:D1CED7"
FT                   /db_xref="InterPro:IPR010387"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED7"
FT                   /inference="protein motif:PFAM:PF07155"
FT                   /protein_id="ACZ41293.1"
FT                   /translation="MKEVFTMWKYTQMIVLTALSAAIYAAVLIPFKGFVIIPSLTEVRP
FT                   ANVFPFVFGLLFGPAGAWGAAIGNLIGDFFGTLTLGSIGGFVGNFLLGYIPYKLWGAIF
FT                   YNSKDKEPSINSGKKLAAYIAVVIVSSAACALVISWFADLIRLAPFAALSVIITINNAI
FT                   AGIVLGPFILLIIYPRIKQWGLLWTEIMRPEDVSPSVSPRLGQLLVWIGAIGGVIVGLI
FT                   IALGLYNQAMAAAGFGKGTQGGVALAIIMIPFIALVFIGGWMLGGKEQVLAMQE"
FT   sig_peptide     404059..404136
FT                   /locus_tag="Tter_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.857) with cleavage site probability 0.830 at
FT                   residue 26"
FT   gene            complement(404914..405339)
FT                   /locus_tag="Tter_0372"
FT   CDS_pept        complement(404914..405339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0372"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   afw:Anae109_3080 heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41294"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED8"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACZ41294.1"
FT                   /translation="MQDKKQNLPIRLYRGEGHLVIAAPMPGLEPQDIRITVSMDKVVLS
FT                   GSERGPKQHLRDLIISEWSVGPYYREVELPERVNPSLVNATYGNGIVVVSMPLLTKEEH
FT                   IEPQEFTLTPLESTRGEHVGHSGKDMTPVDMSQRAKK"
FT   gene            405461..405889
FT                   /locus_tag="Tter_0373"
FT   CDS_pept        405461..405889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0373"
FT                   /product="protein of unknown function DUF101"
FT                   /note="PFAM: protein of unknown function DUF101; KEGG:
FT                   cbd:CBUD_1267 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41295"
FT                   /db_xref="InterPro:IPR002804"
FT                   /db_xref="InterPro:IPR023572"
FT                   /db_xref="InterPro:IPR036820"
FT                   /db_xref="UniProtKB/TrEMBL:D1CED9"
FT                   /inference="protein motif:PFAM:PF01951"
FT                   /protein_id="ACZ41295.1"
FT                   /translation="MGNMSDIYDYEYFDHDADVGIVGRGSSLESAFESAAKAMFAVMLD
FT                   LEAVKPEKEVVFEFEEEDPELALFTWLNKLLVLAREYDLALGKFHLVRQGNKWIGKAWG
FT                   QPWSTDLERGTEVKGATFTMLSVEQENGVWQARCVVDV"
FT   gene            405908..407341
FT                   /locus_tag="Tter_0374"
FT   CDS_pept        405908..407341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0374"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   nmu:Nmul_A0903 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41296"
FT                   /db_xref="GOA:D1CEE0"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEE0"
FT                   /inference="protein motif:PFAM:PF01139"
FT                   /protein_id="ACZ41296.1"
FT                   /translation="MDLSKLEKIDEYTWTVPLKPGEKRAPVVLYGTKELLRSMDDKVLE
FT                   QITNVAKLPGIVGKAMTMPDAHWGYGFPIGGVAAFDPEEGGIISAGGVGFDISCGIRCL
FT                   RTDLSLRDLEPYAERLADELYKTIPAGVGEEGEIKLSPKELDRVLEGGAEWAVREGYGV
FT                   PEDLEYIEEHGRMEGAVPEFVSKEAKKRQKGEMGTLGSGNHYLEVQVVEKVYDQKAAEA
FT                   FGLWEGQIVVSIHCGSRGLGHQIGTDYLLSLAKAAQRLKIDLPDRELACAPITSPEGHE
FT                   YIGAMNAGINCALANRQILTHLTRQAFRKIIPGTKVETLYDVSHNTCKREKHVIDGRER
FT                   FVYIHRKGATRAYGPGHPDIPQRYRNIGQPVLIGGSMGTGSYILVGVDTSEQRALSTAS
FT                   HGAGRALSRRQALKQWSGKEIIQQLAARGIIVRAHSSRGVAEEAPDAYKNVDLVAEATE
FT                   YAGLANRVALLRPKICVKG"
FT   gene            407424..408275
FT                   /locus_tag="Tter_0375"
FT   CDS_pept        407424..408275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0375"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; amino acid- binding ACT
FT                   domain protein; KEGG: ade:Adeh_2012 formyltetrahydrofolate
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41297"
FT                   /db_xref="GOA:D1CEE1"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEE1"
FT                   /inference="protein motif:TFAM:TIGR00655"
FT                   /protein_id="ACZ41297.1"
FT                   /translation="MSYNIRLLIDCPDRKGLIAAISSFIAMHNGNILSADQYVSDSGRF
FT                   FMRLVIEGEGFGLRKEEFGAAFTPLARQYSMNWQIYYTDQPKRVAILVSKQDHCLVDLL
FT                   WRWDAGELPAEIPLVISNHTNAASRVEAYGIPFYHLPVTKETREEQEDKILELLDKYSI
FT                   DLVVLARYMQILTPKVVNAYRQRMINIHHSFLPAFVGANPYHQAHARGVKIIGATAHYV
FT                   TEELDAGPIINQDIAHVSHRDTVQDMIRIGREVERRVLARAVRWHLEDRVLVDGNRTVV
FT                   FE"
FT   gene            complement(408281..408847)
FT                   /locus_tag="Tter_0376"
FT   CDS_pept        complement(408281..408847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0376"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   sus:Acid_5395 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41298"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEE2"
FT                   /inference="protein motif:PFAM:PF02698"
FT                   /protein_id="ACZ41298.1"
FT                   /translation="MIIALLLVIVWFGNVLIEIHKVGNTDNAVKSDAILVLGAAQYNGR
FT                   PSPVFRARLDHALALYKKRLAPKVVVVGGKARGDTYTEADSGVRYLLRRGIPSSSLVAV
FT                   PHGRSTYSSLRAAKNMLQPKHVRSLIIVSDRFHMYRSLEMAKSLGFRVTGSPTPDSPID
FT                   KDPAAETRYVIREALAYTAYRISGR"
FT   gene            complement(408936..409868)
FT                   /locus_tag="Tter_0377"
FT   CDS_pept        complement(408936..409868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0377"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: pap:PSPA7_5505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41299"
FT                   /db_xref="GOA:D1CEE3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEE3"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACZ41299.1"
FT                   /translation="MNVEDKLLDTGPGLVKKGAPSAIHILLALLAVYLIWGSTYLGIKF
FT                   ALSSFPPLLLGGIRFLIAGSVLYIWLRFQGHSKPTREQWLSCALVGALLLLIGNGGVGF
FT                   AEQNVASSLVALVIAATPLWAAIFLSLMGRKPGKLEWIGLTIGFLGVALLNLDGQLRSE
FT                   PISAAIVIASSICWSFGSVISQRLSIPSGLMASACEMLTGGALMLLIGLILGEKISLPI
FT                   TFEASVAIIYLTMIGSLVGFTAYSFLLENVRPSLATSYAYVNPIVAVILGAFIGNEHIS
FT                   PMIIVSMPLIILGIAIVVMTKSPSMEKED"
FT   gene            complement(410057..410377)
FT                   /locus_tag="Tter_0378"
FT   CDS_pept        complement(410057..410377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41300"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEE4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41300.1"
FT                   /translation="MAVDRMPAQWRRALGRWERWKSRGRLKPEFEELTYVMLEKLREVN
FT                   DPQELIKKYYLGNYWALRIARKMYPDREDLWDMGMTADVAYAMRYQELTGESIAEDEPE
FT                   ED"
FT   gene            complement(410404..411396)
FT                   /locus_tag="Tter_0379"
FT   CDS_pept        complement(410404..411396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0379"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_2702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41301"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEE5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41301.1"
FT                   /translation="MIRRTRTLINLMKEVSLDEVREKASMPFALVITGPSRELRQKTTN
FT                   LLSGGASYTSGTLIEHDANTGWSPVFERASLVLYVLDHGQVRQSDLELLGRIARIGLPI
FT                   IVLLLNAAALVGDQNTLDRFNSMIRDSHAKIKLVRIQDSIETLLRTILQELDAFDIAIA
FT                   RQLPPFRPIVANQLISEASRANAQFALMSNIPMVIPIIGNIAAASADLLVLTKNQIMLV
FT                   FKLAAVNGQDIHSGRKILAEIIPVVGAGFFWRTVARELADLMPFGVGAIPKTIIAYAGT
FT                   FVVGRSAQYYYSTGLQPSNDLLRKFYSDALERARKLFPKQDTEPKEQTD"
FT   gene            411589..411750
FT                   /locus_tag="Tter_0380"
FT   CDS_pept        411589..411750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41302"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEE6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41302.1"
FT                   /translation="MVESPEGEIFLRTHLIEEGAHPVSNEDLDYISKAVYHQFVLPQLH
FT                   TDVSEEFH"
FT   gene            411835..412092
FT                   /locus_tag="Tter_0381"
FT   CDS_pept        411835..412092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0381"
FT                   /product="glutaredoxin"
FT                   /note="PFAM: glutaredoxin; KEGG: pin:Ping_3209 glutaredoxin
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41303"
FT                   /db_xref="GOA:D1CEE7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEE7"
FT                   /inference="protein motif:PFAM:PF00462"
FT                   /protein_id="ACZ41303.1"
FT                   /translation="MEHSATIVVYSTSWCGDCKRAKMVLDSMNINYKLIDLELHPHAEE
FT                   EMLKVNGGIWRVPTIILPTGKVLVEPSVNELLAALEGRAA"
FT   gene            412284..412574
FT                   /locus_tag="Tter_0382"
FT   CDS_pept        412284..412574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0382"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: nis:NIS_0956 MerR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41304"
FT                   /db_xref="GOA:D1CEE8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEE8"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACZ41304.1"
FT                   /translation="MEYRNDRSFPKYTISVVSEMTGVPVHTIRQYEQQGLIRPARTTGK
FT                   TRRYSDEDVEMIMQIADLARKGINYPGIREVLRIRKEHTSNHPDKPNKQSA"
FT   gene            412593..413069
FT                   /locus_tag="Tter_0383"
FT   CDS_pept        412593..413069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0383"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: mgm:Mmc1_2024
FT                   heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41305"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEE9"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACZ41305.1"
FT                   /translation="MALQRWDPFREVLSLRDAINRLFEESWVSPTSIVTRTTVGMPVDI
FT                   EERDNEYVIKASLPGFKPEDVNVSVTGDTVTISAEQKGEEERKGANYLVRERRFGSVSR
FT                   SFTLPTRIDANNAKATFEHGELVLTLPKAEEAKPKQIQINVGGQLQSGQEQVQQ"
FT   gene            413159..413665
FT                   /locus_tag="Tter_0384"
FT   CDS_pept        413159..413665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0384"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: bcr:BCAH187_A5499
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41306"
FT                   /db_xref="GOA:D1CEF0"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEF0"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACZ41306.1"
FT                   /translation="MFDAALLVLRVVVGLLFIGHGAQKLFGWFGGGGLKGTAHFMESLG
FT                   LTPGRYWAVLAGLSEFVGGLLMLTGLLNPIGPLAILGAMIMATVKAHWGKPIWSSSGGA
FT                   ELPVVYGAIAVALLLTGYGRYSLDNLLNISLPSWVVLAGFLVIMLLLVLATVPGVSRSA
FT                   KYSTS"
FT   gene            413866..414675
FT                   /locus_tag="Tter_0385"
FT   CDS_pept        413866..414675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0385"
FT                   /product="serine/threonine phosphoprotein phosphatase"
FT                   /note="KEGG: xca:xccb100_3125 serine/threonine
FT                   phosphoprotein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41307"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEF1"
FT                   /inference="similar to AA sequence:KEGG:xccb100_3125"
FT                   /protein_id="ACZ41307.1"
FT                   /translation="MTCSWKYAFASVIGTYHLSRGLPCQDAIRVSLCRLEKEDVLLAVV
FT                   SDGAGSAARGDEGSEFACQFFVEKLHDFVLSGSEICTLDRELCVGWVKDYLSHLEERAN
FT                   SCEAQISDYASTLLAAVVGSRSAVFLQIGDGAIVASTEDDPDSYTAIFWPQKGEYESTT
FT                   FFLTDNNSHENLLILSLDDVSICDLAIFTDGLQRIALDFTENEAYNPFFRGMFNPLRGQ
FT                   FDGYLQELSEQLKNFLGSPRVNEYTEDDKTLLLASRVIGQQLSEVPD"
FT   gene            414780..415808
FT                   /locus_tag="Tter_0386"
FT   CDS_pept        414780..415808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0386"
FT                   /product="Membrane dipeptidase"
FT                   /EC_number="3.4.13.19"
FT                   /note="PFAM: peptidase M19 renal dipeptidase; KEGG:
FT                   mlo:mll3679 membrane dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41308"
FT                   /db_xref="GOA:D1CEF2"
FT                   /db_xref="InterPro:IPR000180"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEF2"
FT                   /inference="protein motif:PRIAM:3.4.13.19"
FT                   /protein_id="ACZ41308.1"
FT                   /translation="MMSVDSALIPVLDGHNDVLLRVAYRQEGEDYSFFLENQDGHLDLP
FT                   RAKAAGFAGGFFAIYIPPVSDDSHAPLDRYYALEQAMLISSCLFQLERQSGGELKVVQD
FT                   VGELEGQVKSGRIGAIMHMEGAEPIDEDLHALEVFYRAGLRSIGIVWSRPNAFGYGVPF
FT                   VFPSTPDIGPGLTDAGKRLVKACNELGILVDVSHLNEAGFWDVVKISEAPIVATHSNVH
FT                   AICPVSRNLTDRQLDAIRDSDGMVGLNFAVAFLRPDGKRIADTPIDIMIRHIDYLVERV
FT                   GIDRVGLGSDFDGALISSHISDVTGLPKLLNALREHGYSQEELEKMAFRNWLRVLKLTW
FT                   KS"
FT   gene            complement(415821..416282)
FT                   /locus_tag="Tter_0387"
FT   CDS_pept        complement(415821..416282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0387"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; KEGG:
FT                   sus:Acid_0068 MOSC domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41309"
FT                   /db_xref="GOA:D1CEF3"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEF3"
FT                   /inference="protein motif:PFAM:PF03473"
FT                   /protein_id="ACZ41309.1"
FT                   /translation="MARLYQINISKGGVPKHRVEDATVDYLGILGDYHNDREHHGGPDK
FT                   ALCMFSLELIEQLRSEGHNIAPGHLGENLTISGLNWEQIIPGTKLLIGDTLLVEVTGYT
FT                   NPCYKIGAFFKDGKFSRVSQKTHPGNSRVYARVIVPGRIKQGDQVTIVP"
FT   gene            416400..416879
FT                   /locus_tag="Tter_0388"
FT   CDS_pept        416400..416879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0388"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: mca:MCA2731 flavin reductase-like domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41310"
FT                   /db_xref="GOA:D1CEF4"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEF4"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ACZ41310.1"
FT                   /translation="MDQAVKKQVLRSFTYGLYLITVKDGEEANCFTANWVSQASFEPPM
FT                   VVFSMENDSRSIGMIQRSGAFAVHVIPEGYRDFAGRMGRSSKQNPNKISEVEWEPGEVT
FT                   GSPILKELAGWVECRLVGTLPAGDHTLMLGEVVNAGIGRDLRPLTLSEAGFKYSG"
FT   gene            416872..417351
FT                   /locus_tag="Tter_0389"
FT   CDS_pept        416872..417351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0389"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aha:AHA_0137 GltR"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41311"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEF5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41311.1"
FT                   /translation="MVRWFRNRQVSNDRLVVALIKRYYFGANLEDFLSLAGFKLLQPTS
FT                   SEELLDLLSRHDPALVVVDLTQCDVSVLPDIVARSNGSKTLAFGPAHEEKLLNSAVDAG
FT                   FDEVVLNTYYHRELKSILTRLLPGYVLPEVDRKEKRRPDYLDIPANRDPRGESQF"
FT   gene            417348..418805
FT                   /locus_tag="Tter_0390"
FT   CDS_pept        417348..418805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gur:Gura_1568 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41312"
FT                   /db_xref="GOA:D1CEF6"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEF6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41312.1"
FT                   /translation="MRGTRKLWFAGLLMVLPSLYFVLRYPLIGNIKLTDMGWMSGHSQQ
FT                   GLWEFLLAITCMFLVYSYAIITCTHVDNYSARYPVFICGVALVIIFAFMYPTTAIDVFV
FT                   YAARSRVFTHYGADPMTTPANKFFFDHFVRFAQQYGDNISVYGPLWNLLAAPITVLSGE
FT                   SMGKAIVGFKLLAVLSTIASAILIYLVLREISPQGASLGVLLFLWNPLVLWEIPGNGHN
FT                   DLVFLIFVLLAILAWQRGFGFVSPALLLAGAMVKYVPFILLPIFLVAIGSQSLRKSLDL
FT                   RKILFGVVSCCVVLLISFWPFYNPWAIYESIREQDRIMLVSPASALINLLSGGKVDQDI
FT                   ASWVKLTGRGIFLIVLLILLWVVWKSPKFLPFAVFECLFMYLILAAWSVQNWYGVWLVA
FT                   IAALINGWHRARAISMSIGMLYVYGLFIWVRYLWIQDGIELLYWGVLMIFLLPVAFTLV
FT                   QYGLRIFLDKRPSAKGEAATSLVSISS"
FT   gene            complement(418802..420883)
FT                   /locus_tag="Tter_0391"
FT   CDS_pept        complement(418802..420883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0391"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_1852 mechanosensitive ion channel
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41313"
FT                   /db_xref="GOA:D1CEF7"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEF7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41313.1"
FT                   /translation="MIEKILLAYLAALIVIGLPGYIWSKLLFPCIDWVERIAASIAISI
FT                   GIVPAIALLLTRMSDTGITPAIAYTSVILAIAIGIALYLLLGPSPKPEMLPSLQISSPS
FT                   APALVGISALAVVAYAMIIGRLDVQKYSPRVVPLVLAIGGLWFLAKGRPAKLWWVKFEP
FT                   SYKSRALSYLQGILVILLSLFRGYSGPVLRDWPYIRGHDQYAHAIMTNLMISQGYSRDY
FT                   MIYPPGFHTLTAILSHVSHLSPLDIYIVLSPALMILPALGCYVLASRMIGPRYAFPAAV
FT                   FASLVFDSSWLYLVVGIYVDVITGQFLLAMFLATVTTIVCNKLRNLKRQALLLALLGFT
FT                   IVLYHTVSTLYLAIISLAVIVLLLPYLLWKDRRDAVALASSFLLMAILSLPVLWETYDL
FT                   PHVIAAFLGSTAKRGAAQLASSLLHTQIPLTIARLPNYLSPIGFWIGCIGLLVLLVSLV
FT                   FLPPRYRLTLALLLVWGIAFFGAARTPTSISPWRFDRDTAIPLSILSAVALVAMFGKVR
FT                   RAWIIQLAALTLIIFALFTDIQRNLYFSSLPSGYLVMNRSIEAAAEWLKEHNDGGRIIS
FT                   TPYIHHAANNALLAIAGYSELESAPADNLRDPRTVLPGEQQQEVSLSLWVVTHPDSGRT
FT                   IQILQQYDVRYIVVFEGFEKYLDEPYKETISSDIFLDYPNLYRLEYQGYGVMIFKVLA"
FT   gene            complement(420959..421195)
FT                   /locus_tag="Tter_0392"
FT   CDS_pept        complement(420959..421195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_4897 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41314"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEF8"
FT                   /inference="similar to AA sequence:KEGG:MXAN_4897"
FT                   /protein_id="ACZ41314.1"
FT                   /translation="MEDVNQNAQQITGVSNVAYDLMSVLQNFLEAMSAIEVYKEDAEEA
FT                   NDQELLELFNRIQSDLGSYVEDLKPLLVSRLQS"
FT   gene            complement(421302..422345)
FT                   /locus_tag="Tter_0393"
FT   CDS_pept        complement(421302..422345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0393"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; short-chain dehydrogenase/reductase SDR;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: scl:sce7003
FT                   NDP-sugar oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41315"
FT                   /db_xref="GOA:D1CEF9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEF9"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACZ41315.1"
FT                   /translation="MSNEKVLITGGAGFLGINLVRHLLRKGFRVASLDIAEFDYPERNQ
FT                   VEVIKGDIRDKALLDQVMVGVDYVVHTAAALPLYSPKDIYTTDVIGTRNVLDSAYTHGV
FT                   KRVVHISSTAVYGIPDHHPIREEDRLEGVGPYGQAKIQAEMICLEYRAKGLIVPIIRPK
FT                   SFVGPERLGVFALLYDWAYTGHNFPVLGSGRNRYQLLDVEDLCDAIELCLTLPENKVND
FT                   TFNIGAKVFSTVREDYQAVLDYAGHGKKVIPIPAAPAIFILRLLEKLGISPLYKWVYET
FT                   APKDSYVSIEKAEKQLGFKPKYSNKEALIRNFQWYIDNIDKFQNKSGVSHRVPWKQGAL
FT                   SLAKLIF"
FT   gene            422446..423654
FT                   /locus_tag="Tter_0394"
FT   CDS_pept        422446..423654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0394"
FT                   /product="Myo-inositol-1-phosphate synthase"
FT                   /note="PFAM: Myo-inositol-1-phosphate synthase; Myo-
FT                   inositol-1-phosphate synthase GAPDH domain protein; KEGG:
FT                   sme:SM_b20249 putative myo-inositol-1- phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41316"
FT                   /db_xref="GOA:D1CEG0"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEG0"
FT                   /inference="protein motif:PFAM:PF07994"
FT                   /protein_id="ACZ41316.1"
FT                   /translation="MHALTIRSSHAYTPLYVCKNRERGNEVADKKVRVAIIGVGNCASA
FT                   FVQGVHYYKDAPEDEWVPGLMHVNLGGYHIRDIEFSAAFDVASTKVGKDLSEAIWAAPN
FT                   NTLKFADVPYLGVPVYRGMTHDGLGKYLSNMIEKAPGPTSNIVQILKDTGTDVVVNYLP
FT                   VGSEMATKWYVEQVLEAGCAFVNCIPVFIAREEYWQRRFLEKGLPIIGDDIKSQVGATI
FT                   THRVLTRLFEERGVKLERTYQLNFGGNTDFYNMLERDRLESKKISKTNAVTSQLEHSKL
FT                   DEKNVHVGPSDYVPWLEDRKWCHIRMEGTIFGGAPISLELKLEVWDSPNSAGVVIDAVR
FT                   CAKLALDRGLAGTIAGPSAYFMKSPPVQYHDDVARRMTEDFIEGKDDTCLPFKTTIDTA
FT                   EKV"
FT   gene            423765..424328
FT                   /locus_tag="Tter_0395"
FT   CDS_pept        423765..424328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0395"
FT                   /product="Ankyrin"
FT                   /note="SMART: Ankyrin; KEGG: bcz:pE33L466_0197 ankyrin
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41317"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEG1"
FT                   /inference="protein motif:SMART:SM00248"
FT                   /protein_id="ACZ41317.1"
FT                   /translation="MRVAERSGAVSYVGSHKGAATLSFLDIWALHKAANFGQIEIVQNL
FT                   LELFPSKIDSFDQDGWAPLHLASFSGHVHVVELLIKMGANLNLGSLNEKSYMPIHAAAH
FT                   GRNAAVVAVLVRNGAYADAQDSAGHTAMHIAAQNGDTRIIDILVRHGAAVDIRDKHGQT
FT                   PLDVALGANRQAAADLLQMYLDVE"
FT   gene            424364..425230
FT                   /locus_tag="Tter_0396"
FT   CDS_pept        424364..425230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0396"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   rpb:RPB_4430 luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41318"
FT                   /db_xref="GOA:D1CEG2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019921"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEG2"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACZ41318.1"
FT                   /translation="MKVGVTFPQIEIGNDPHVIKDYAQAAEDLGYNHLLVFDHVLGADP
FT                   TNRPGWRGSYSIDDPFHEPFVLFGYLAAVTQKLELVTGVIILPQRQTALVAKQAAEVDV
FT                   LTGGRLRLGVGVGWNEVEYEALGMNFHNRGRRIEEQVEVLRLLWTQKVVTFHGKYHHIT
FT                   EAGINPLPVQRPIPLWMGGSADVLLRRAARMADGWFPQMPPNQTAEEALSRLRAYLQAE
FT                   GRDPNSFGLEARITIAGLSEDDWVAQFKGWEKLGATHISVNTMRAGLSSPQDHINAIRR
FT                   FKEVIGF"
FT   gene            425794..427362
FT                   /locus_tag="Tter_0397"
FT   CDS_pept        425794..427362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0397"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: scl:sce5041 trehalose/maltose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41319"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEG3"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACZ41319.1"
FT                   /translation="MKRSEKNGQRLNRREFMRLLAIGSASVVGADLLAACGGGGSETPT
FT                   TGVGPSPSPSQPSASMGVTPTPVVGASPTPAVGPTETVISGEATPPVSPTGTAGRGLSI
FT                   DISSIPTSPKEAPDVPNAEDAKRYSGQTITYYGDSVGTGHDFDVAAANKFKEQTGINVK
FT                   VIPRPKAADQQFQTYSRLFQAKSPNGDVLLLDVIWPPQFAPFLLNLSDSLGDRAQMMYP
FT                   GTIQASTVNNALVAMPWFTDFGLLYYRKDLLQKYGINNPPATWDELERYAKQVMDAERQ
FT                   AGNRNFYGFVWQGQAYEGLTCNALEWLASTGGGTFIDQNGKVTINNPNAVEMLNRVRGW
FT                   VGSIAPRGVTTYQEDDSANAFVSGSALFCRQWPYVYALASAEDSKIRGKFDVTALPARS
FT                   GEPHAATIGGQSLGISRFSQHQEAAIEFVRYLTSPEVLAWRAIAGSYAPPMPGVSEIPE
FT                   IVEQRPFLKVQATRVARPSAQLGTRYNQGSNAIYQGVHNIENGADAKTVLPTVAQQLQS
FT                   LLGSS"
FT   sig_peptide     425794..425886
FT                   /locus_tag="Tter_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.887) with cleavage site probability 0.372 at
FT                   residue 31"
FT   gene            427432..428370
FT                   /locus_tag="Tter_0398"
FT   CDS_pept        427432..428370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0398"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: scl:sce5040
FT                   trehalose/maltose transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41320"
FT                   /db_xref="GOA:D1CEG4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEG4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41320.1"
FT                   /translation="MAQQIRLARARQEKSSQENSALARRQARVAWLFLIPTLLVVAIVA
FT                   AWPMIQVVWLSLTNAQLLSPTPPKFIGLDNYVRLIHDSIWWHTVWNTVLFTVITVTFEF
FT                   VLGMVIALVVNSQFKARGFMRAAMLVPWAIPTVVSAMMWKWMYNDIYGVINDLLVNKLH
FT                   ILDHNVAFLAVPSLAIPSVAAIDIWKTTPFVALLLLAGLQVIPNDIYEAATVDGATAWQ
FT                   RFFQITLPLLRPAIAVTLIFRTLDALRVFDVFYVMFGNDQSRMPMAVYVQNYLVQFQDV
FT                   GYSSAISMFIFMIIGIFVVAYVTTLGVEVEQ"
FT   gene            428367..429227
FT                   /locus_tag="Tter_0399"
FT   CDS_pept        428367..429227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0399"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: scl:sce5039
FT                   trehalose/maltose transport system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41321"
FT                   /db_xref="GOA:D1CEG5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEG5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41321.1"
FT                   /translation="MSRSRSWKVITKLLFYLLVAVIIVYTVFPFYWALRSAITPTGELF
FT                   STPVSYWPSRPTLEHFRAIFSNDLFLRAILNSTIVAGSVTIISLAIGSLAAYALGRFKF
FT                   RGRTPVMYIILSMTVFPQIAVLSALFQLVNFLHLFDTLGALILTYLIFTLPFTVWVLIT
FT                   FFRSMPQELEQAAYVDGATPFQTFRLVLLPLAAPGIVTSGLLAFIAAWNEFLYALSFIQ
FT                   TPQKRTITFALQAFTPENAATSNFAVPWGQIMAATLVVTLPLIVLTLIFQRRIIAGLTA
FT                   GSIKG"
FT   sig_peptide     428367..428480
FT                   /locus_tag="Tter_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.619) with cleavage site probability 0.266 at
FT                   residue 38"
FT   gene            429267..429944
FT                   /locus_tag="Tter_0400"
FT   CDS_pept        429267..429944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0400"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; SMART: phosphoesterase PHP
FT                   domain protein; KEGG: afw:Anae109_2621 phosphotransferase
FT                   domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41322"
FT                   /db_xref="GOA:D1CEG6"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEG6"
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /protein_id="ACZ41322.1"
FT                   /translation="MSTNDLVRAELHCHTSWSRDCLMRPDRLVQVCIEKGIEVLAITDH
FT                   NEIGGAFEVASIAPFTVIVGEEIKTREGELIGYFLKRYIPQGLSAEDTAMEIKSQGGIV
FT                   SVPHPFDSLRNSRLKTEVLERLITKNLVDIIEAFNSRTTKPEDNTKAEIYAASKGIPVV
FT                   AGSDAHTYPEVGTGTTLLSPFSNADEFLMSARQAVLTEARLSPWPVHLASTWAKIAKKV
FT                   KML"
FT   gene            429941..431404
FT                   /locus_tag="Tter_0401"
FT   CDS_pept        429941..431404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0401"
FT                   /product="protein of unknown function DUF512"
FT                   /note="PFAM: protein of unknown function DUF512; KEGG:
FT                   gbm:Gbem_0981 protein of unknown function DUF512"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41323"
FT                   /db_xref="GOA:D1CEG7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007549"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEG7"
FT                   /inference="protein motif:PFAM:PF04459"
FT                   /protein_id="ACZ41323.1"
FT                   /translation="MIHGGEVVRVQPNSIADDLGLQPGDVLLQINGRPLRDIIDYRFYG
FT                   AADYVELLVKRGQEYIIFEIEKDPDESLGVEFARPTFNPIRQCANACPFCFVDQNREGM
FT                   RDSLYIRDDDYRYSFLFGNFVTLTNLTPSDWRRLEEQRLSPLYVSVHTTDPDLRRRLLG
FT                   YPKAPDILEQLARLREIGIQVHTQLVLCPGLNDGPQLERTIDDLAALYPTVLSIAVVPV
FT                   GLTQFRGGSVRAGGRHNRIIASQASTPVRSYTPEEAKQVVKQVDRRRAQFRKELGTNLV
FT                   FASDEFYLMAGKSVPAAKHYEGFPQLENGIGMVRYMLEGFKESRRKLPERLKSTRKVTI
FT                   LCGTLPAKVLRQVADKMQDACSGLSVDVIPVENKFYGPSTNVSGLLVGEDLVPIIESIE
FT                   GTDLILIPRVALDNDGRRLLDGVTLQDLRDVAKYPLEPAVDMKETVDLILRMDAGEELG
FT                   KSVPPPRIGGFEFSPVPNSDTFGQYVTYS"
FT   gene            complement(431500..432582)
FT                   /locus_tag="Tter_0402"
FT   CDS_pept        complement(431500..432582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0402"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   rpb:RPB_3120 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41324"
FT                   /db_xref="GOA:D1CEG8"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEG8"
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /protein_id="ACZ41324.1"
FT                   /translation="MFTKSSKVWVLLLLFLQLVVVGCGAGNSTPTIGSTSANITPTTSS
FT                   ESNQNSQNTSSNLKQVTLALGYIPTVQFAPYYVAQEKGFYKEEGLNVKFNHGIISDLIK
FT                   MVGTGKIPYGVASGDEVLVARSQGVPVVYLGAYFQKYPVVLITRSEDHITDIKQLKGKV
FT                   IGVPGQFGATYTGLLALLHSANMNEKDVKIRSIGFTQVQALERKQVDAVMGYANNEPIQ
FT                   LRHLGVKVNTIPVWEHLNLVSNGLITSQDKLSSDPQEAAAVVRATMKGLQYTIDHPEEA
FT                   FQISLKYVPEAAQDKEIQMEVLKSSIELWQSQATKEHGLGYTDPNMWKTTLDFLKSIGL
FT                   IKHDVDLSKVYTNQFVERSR"
FT   sig_peptide     complement(432505..432582)
FT                   /locus_tag="Tter_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.365 at
FT                   residue 26"
FT   gene            complement(432603..433418)
FT                   /locus_tag="Tter_0403"
FT   CDS_pept        complement(432603..433418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0403"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bbr:BB0643 putative
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41325"
FT                   /db_xref="GOA:D1CEG9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEG9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41325.1"
FT                   /translation="MRQESYGLPAYKISTGAGELKGKLSLWGWVIASLILAILLWEAIV
FT                   LVGKYPTYILPTPMEVWQRFLQSLADGTWWTHTRITLLESILGFALGFGVAAVFGYILA
FT                   HWRAVERLLSPHIAASQALPVVAIAPLITLWFGYGLLGKVIVCALVVFFPILVNTIVGI
FT                   RNVPRDLIEVAQVYGAGWWQTFWMVELPLSLPVLLGGIRLGLTLSITGAVVGEFVGADV
FT                   GLGVLLNISKGMFDTPLMFVALITLALMAASFYGIALLLEKILLAWHYE"
FT   misc_binding    complement(433575..433696)
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam(RF
FT                   00050), score 112.10"
FT   gene            complement(433719..434135)
FT                   /locus_tag="Tter_0404"
FT   CDS_pept        complement(433719..434135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41326"
FT                   /db_xref="GOA:D1CEH0"
FT                   /db_xref="InterPro:IPR021414"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEH0"
FT                   /inference="similar to AA sequence:KEGG:AT1G44920"
FT                   /protein_id="ACZ41326.1"
FT                   /translation="MSVAERERPLGRGTTYLLVAGDVLAIVLFVVLGFRSHHIQVHYLA
FT                   NLIRVATPLLAGWFIVSMFTGAYRPTAVLGEFMKRSALTWIGGILLGLLIRGLVLREGF
FT                   IFTFMLVTLAVTGVLLLGWRLVYFLIISGRSPSR"
FT   gene            434373..435275
FT                   /locus_tag="Tter_0405"
FT   CDS_pept        434373..435275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0405"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rle:pRL110512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41327"
FT                   /db_xref="GOA:D1CEH1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEH1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACZ41327.1"
FT                   /translation="MELRELRECDLLDLLDLCSRTLPLDKFSINLLKHRIFQEPEHRPE
FT                   YQLSLWDGDKLVSVMLGGVRTSEEGPAPAIRLFATDPAYQRRGYATQLLKELINRIQAD
FT                   GMKTLRVGGSAPIYFWPGVDVRYTPAICFLIKHGFQIADVRCFNMEVDLLSRDWDTSAD
FT                   EDRLAREGFVFRRLSLDDREEFSKWLLDVWGSTWQCEALATYQNEPISTHIALRDGRIC
FT                   AFASYGGTAFENGFGPTGTEEQLRGKGIGRILFYRCMRDLRMLGHEKCEVIWVGPIPFY
FT                   AKVADAKINRVFWVLGKQI"
FT   gene            435296..436318
FT                   /locus_tag="Tter_0406"
FT   CDS_pept        435296..436318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0406"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Semialdehyde
FT                   dehydrogenase NAD - binding; Oxidoreductase domain; KEGG:
FT                   bha:BH1248 NADH-dependent dyhydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41328"
FT                   /db_xref="GOA:D1CEH2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEH2"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACZ41328.1"
FT                   /translation="MPVRVAILGCGLIAQREHIPAYVKSEDAQITVFASRDLSKAERLK
FT                   NEYGANAATDDWKEAILRDDVDVVDICLPNYLHAPAAIAAAEAGKHIIVEKPIARTIAE
FT                   ADAMIEAANKNGVKLMVAHSLRFAPPAEEAQRLVSEGFIGEVKAVRALLNHAGPIEYWG
FT                   ATDTWFFELTKSGGGALLDLGIHVADLVQWVVGAPASSVSAMVVNSGRFGDVEDMGMAT
FT                   IRFSNDVLGFIQASWNYRPKNEANLVVYGDKGTLYAWAYPGKPLVANLRSEDSPDGKLV
FT                   ELEVPQSSRRNNPFDYFVRWVLDKAEPFSTGEEARAALQIITGAYASAKSRCEVELPRF
FT                   "
FT   gene            complement(436308..437066)
FT                   /locus_tag="Tter_0407"
FT   CDS_pept        complement(436308..437066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0407"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; KEGG: mpo:Mpop_4104
FT                   phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41329"
FT                   /db_xref="GOA:D1CEH3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEH3"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ACZ41329.1"
FT                   /translation="MQDRVDRDFTREEQPLAVGDEHLSELEERIGAAPARISILLLGFV
FT                   GSLMLILLMAIIARDIFPEQSISLDRTIYLYLRNHASSFPGPLFVLGTYLGSFIVIGPL
FT                   TAAICALLFLKGYRRTPTFLVVSAVGGILVNQVFKDYVTRPRPSWPGIHQIGDYSFPSG
FT                   HAMNSVVFYIALASIIWVLFGKLYGTISFIIAIFLALFIGTSRIYFGYHYFTDVIGGYI
FT                   TGLLWVVIAATATQGGSHIIRQRRANKSKI"
FT   gene            complement(437088..437561)
FT                   /locus_tag="Tter_0408"
FT   CDS_pept        complement(437088..437561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu2687 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41330"
FT                   /db_xref="GOA:D1CEH4"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEH4"
FT                   /inference="similar to AA sequence:KEGG:plu2687"
FT                   /protein_id="ACZ41330.1"
FT                   /translation="MLETIVVISRTIHIVSAAAWLGGSIFYAFVLIPSLKEATIDEKLR
FT                   INIARRFQTIVSIAMWLLLASGGILTFDRLSNTRLGTTYVSVLVLKVALAIWMFFLAGS
FT                   LRRNRRKAQYNPYQEGVLARWRGTIPVPWVILVTGMVVFLLGAILTTMYQSTS"
FT   gene            437657..439075
FT                   /locus_tag="Tter_0409"
FT   CDS_pept        437657..439075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0409"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   ppd:Ppro_3253 FAD linked oxidase domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41331"
FT                   /db_xref="GOA:D1CEH5"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEH5"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ACZ41331.1"
FT                   /translation="MKESVIEELRSILGPSGLLVDQGDLLAYSIDGTWLEAMPDCVVLP
FT                   TSTQQVAQVMSIANRELVPVVPRGGSSNLSGGTIPINGGIVMSLTRMNKILEIDPDNLI
FT                   AVVQPGVITHDLQSEVRKYGLYYPPDPSSVQHSTIGGNVAENAGGLRCLKYGVTSKYVL
FT                   GMEYVTPTGEVGRAGGRVIKNVTGYQLEQLLIGSEGTLAIITEITLRLIPYPKYRRTLM
FT                   AVFDRLEDAGKAVSEITRAGIIPAAMELMDKSCIQVVEDYLRIGLPVAAEAMLLVESDG
FT                   YYESAVEAEIRHIDGILSELAAEVNLAEDESQAEELWRARRSVSPAVAKIKPNKLGEDV
FT                   CVPRSAVPEMIRRCQEIAEKYDLKLVIYGHAGDGNIHPNILFDKRDVDEVSRVQKAAAE
FT                   IFQAAVELGGTLTGEHGIGLLKKGFLGLALDSTTIGVMRTIKRALDPNNILNPGKIFPD
FT                   EASYLQVPFDVGRT"
FT   gene            439099..440250
FT                   /locus_tag="Tter_0410"
FT   CDS_pept        439099..440250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0410"
FT                   /product="Malate/L-lactate dehydrogenase"
FT                   /note="PFAM: Malate/L-lactate dehydrogenase; KEGG:
FT                   sat:SYN_02526 malate/L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41332"
FT                   /db_xref="GOA:D1CEH6"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEH6"
FT                   /inference="protein motif:PFAM:PF02615"
FT                   /protein_id="ACZ41332.1"
FT                   /translation="MANVEESRDQDYISVDHMALKSWVTEVFCKLGVPREDADVTADVL
FT                   VAADLRGIESHGVARLGRYTSRLMKGLISPVANPVIVRETSSTALVDGNNGLGQPVAMW
FT                   AMQLAIDKAREVGSGTVAVRNSNHYGIAGYYAMMALEHDMIGMSLTNSSPLVVPTGGRK
FT                   AVIGTNPIAVAIPAGKERPWVLDMATSVVPRGKLEVYARKNKPMPLGWAVDETGQPTTD
FT                   AQRVLDALTARLGGGILPLGGTALFSGYKGYNLSVMVDLLCGVLPGSNWGPKVDEPVDG
FT                   KLVPSRVGHFFWALRVDAFRPIDEFKQEMDDYIRMLKESPKAEGEDRIWVAGEKEWELQ
FT                   EEYSREGVPLYYKVVETLRGIGQEVGLPFDAMVLGAGHSTGMA"
FT   gene            complement(440290..441780)
FT                   /locus_tag="Tter_0411"
FT   CDS_pept        complement(440290..441780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0411"
FT                   /product="xylulokinase"
FT                   /note="TIGRFAM: xylulokinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: aba:Acid345_0904 xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41333"
FT                   /db_xref="GOA:D1CEH7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEH7"
FT                   /inference="protein motif:TFAM:TIGR01312"
FT                   /protein_id="ACZ41333.1"
FT                   /translation="MPVVIGIDVGTTGVRVLAVDQSGNVVAESTSEYPLYTPRPGWTEQ
FT                   NPEDWWVATQESLHKVIQQVKDEILGLGLTGQMHGSVFLDERGDVIRPALLWNDQRTAK
FT                   QCEEMTEVVGYDKLISIAGNPALTGFQAPKILWLRENEPENYSKVRHVLLPKDYVRYKL
FT                   TGEFATDASDAAGTLLLDVKARDWSREILEALEIPLEWLPKVFEGPEVTGYVSQDLADS
FT                   LGLGSKIPVAAGGGDNAAAAVGTGIIKEGLMSSSIGTSGVLFVHSEEFRPDPSGRIHAF
FT                   CHAVPGKYHLMGVTLSAGGSLRWWRDLLGGLNYDQLSELASTAPPGSEGLLFLPYLTGE
FT                   RTPHLDPHARGSFFGLTARHDKSHMTRAVMEGVVFSMLDSLQIIRELNVEVNEVRAIGG
FT                   GARSQLWRQIQADIYRLPIKRTVAEEGPAYGAALLAGVASGIYKDVEEACSLIALRDEV
FT                   TYPDESRSDLYARYYEVYKSLYPSTKDAMHQLSELASM"
FT   gene            complement(441864..442601)
FT                   /locus_tag="Tter_0412"
FT   CDS_pept        complement(441864..442601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0412"
FT                   /product="6-phosphogluconolactonase"
FT                   /note="TIGRFAM: 6-phosphogluconolactonase; PFAM:
FT                   glucosamine/galactosamine-6-phosphate isomerase; KEGG:
FT                   dvu:DVU2313 6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41334"
FT                   /db_xref="GOA:D1CEH8"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEH8"
FT                   /inference="protein motif:TFAM:TIGR01198"
FT                   /protein_id="ACZ41334.1"
FT                   /translation="MAGKLSIVENSSEVARAGAEQFISRAKESIDDHGSFFVALSGGST
FT                   PVAMYKLLASDEYRGKVDWDKVLFFWSDERCVPPDHPDSNYGSAHQHLLQPLGITEDRV
FT                   FRMKGELPPEEAAREYEEIVKKAVPGDPPRFDLIFLGLGDDAHTASLFPETDALHVTDR
FT                   LVVHNYVPKLNTYRITFTSTLINAAASVVFLVSGEGKAEALKSVLEGEQNPTKYPAQMV
FT                   NPTSGALLWVVDRAAASLLSGTQ"
FT   gene            complement(442634..444178)
FT                   /locus_tag="Tter_0413"
FT   CDS_pept        complement(442634..444178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0413"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="KEGG: sus:Acid_5281 glucose-6-phosphate 1-
FT                   dehydrogenase; TIGRFAM: glucose-6-phosphate
FT                   1-dehydrogenase; PFAM: glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41335"
FT                   /db_xref="GOA:D1CEH9"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEH9"
FT                   /inference="protein motif:TFAM:TIGR00871"
FT                   /protein_id="ACZ41335.1"
FT                   /translation="MTTVIENPLRASTHIERTPQPCAIVVFGATGDLTHRKLVPALYNL
FT                   AVDKLLPPNFAIIGFARRPWSDDYFREEMLKGVQEFSRRKPDPKIWESFAQNLYYVQSE
FT                   FDNVEGYQKLKDFLDKLDSEKGLGGNRLYYLSASPSYYETIVERLGDVGLSGRSRRAEQ
FT                   GYTRIIIEKPFGHDLQSARELNDLLHQFFSEDQIFRIDHYLGKETVQNILVFRFANSIF
FT                   EPIWNRNYIDHVQITAAESIGIEGRGKYYEESGALRDMMQSHLLQLLNLVAMEPPVAFD
FT                   ANSVRDEKVKVLRAIRPIRGNAVADQVVRGQYGPGLIDGKEVPGYRQEPNVDPNSVTET
FT                   YVAIKLFIDNWRWQGVPIYMRTGKRLKKRVTEIAIQFKQPPLLLFGQQTDGIIEPNVLA
FT                   LRIQPDEGISLTVSVKTPGTRLNIRPVKMEFLYGTGFGIEPPEAYERLLLDAMIGDSTL
FT                   FTRHDEVEASWAFITDILDAWKQLPPPQFPNYESGSWGPRDADRLLYRDGREWRWL"
FT   gene            complement(444271..447104)
FT                   /pseudo
FT                   /locus_tag="Tter_0414"
FT   gene            complement(447127..449001)
FT                   /locus_tag="Tter_0415"
FT   CDS_pept        complement(447127..449001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0415"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: scl:sce8467 transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41336"
FT                   /db_xref="GOA:D1CEI0"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI0"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACZ41336.1"
FT                   /translation="MAVTTDQKTQIEQWHELAQQLRVDSLRCSTEAGSGHPTSSMSAAD
FT                   LMAVLMSKYLRYDFNNPENPGNDHLIFSKGHASPLLYSMFKAAGAITDEELMTFRKFGS
FT                   RLQGHPTPAIPWVDVATGSLGQGLPIAIGIALSGKYLEKLPYRVWVLCGDSEMAEGSMW
FT                   EAFQHAGYYKLDNLIAIVDVNRLGQRGETMLGWNLDGYAERAKAFGWHVIEIDGHNLEE
FT                   IDRAYEEAIQVTGQPTVILARTHKGRGVSFLEDKEGWHGKPIDKDSLPKAIEELGGERN
FT                   ITIEVPKPDPVEAPSRGENKPLELPKYEVGDSVATRGAYGDALKALGAARGDVVALDGE
FT                   VSNSTYSERFAKAYPDRFFEMYIAEQQMVAAAIGLGVRKWVPFASTFAAFLTRAYDFIR
FT                   MGAISRANIRLCGSHAGVSIGEDGPSQMGLEDIAMMRAVHGSTVLYPCDANQTAQLVAA
FT                   MADQNGISFLRTTREKTPVIYSSDEEFKIGGSKVVKQSSNDVATVVAAGITVHEAIKAY
FT                   EELQKEGVSIRIVDAYSVKPIDVATLIESLQATGGKLVIAEDHWPEGGLGEAVLSALAD
FT                   SGQVSLSDIKVKHLAVRDMPGSGKPQELLDAAGISAKHIANAVRELSK"
FT   gene            complement(449118..450512)
FT                   /locus_tag="Tter_0416"
FT   CDS_pept        complement(449118..450512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0416"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG: bat:BAS3177
FT                   gluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41337"
FT                   /db_xref="GOA:D1CEI1"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI1"
FT                   /inference="protein motif:PFAM:PF00370"
FT                   /protein_id="ACZ41337.1"
FT                   /translation="MSHKPSEPCVLSIDIGTSSIRSCLIDATGDIADNTLFAIEHSPTT
FT                   TPDGGSELDPEEAFTKVCAVIDKSLSAAREYSVLPAAVAMTSFWHSLMGIDHRGKAITP
FT                   VYLWADTRSAPYVDQLRSEASVDETYKRNGCPLHSSYWPSKLLWLRDSRPELYSQVDKW
FT                   LSFAEYVQLRFTGELRCAHGMASGTGIYLQREMSWDPFWIDLLDLRENSLPRLTSLREP
FT                   LGYLRVSDFPWKDLAGIPWYPAVGDGACSNIGSGAFDSSKVAINFGTSGAIRIVVDQYL
FT                   EPPYGLWLYRIDKDRLLFGGALSNAGNIYEWLTETLRISHEQAEQCLLTIQKVKPGLVF
FT                   EPYLAGERSPRWRPDATGTIRGLRLDTKPEDIFKAGMLGVLYEFAKVHDMLDNSLGSDD
FT                   RVTLLSGGAIIKSQALRKALSEVLRRPTMICLEEEPSARGAALLVLEAIGAVKELKDAP
FT                   TRLVAP"
FT   gene            450594..451103
FT                   /locus_tag="Tter_0417"
FT   CDS_pept        450594..451103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0417"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: adenylate cyclase; KEGG: dvm:DvMF_0460
FT                   adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41338"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI2"
FT                   /inference="protein motif:PFAM:PF01928"
FT                   /protein_id="ACZ41338.1"
FT                   /translation="MRETEIKLRVENLEEVEERLRRVGAMPREERVEEVDRIFRDVTGD
FT                   RLESQLLRLRTSAGKNTLTWKGEPKFRGGVKEREEEQTGVESAEAMIEILRRLGFEVDL
FT                   EFSKVRNYWELEGCMVSLDTLPFGRFIEIEGDEAAIVRVRRILELEAAEEVKLSYPEMA
FT                   RIHLGK"
FT   gene            451422..453290
FT                   /locus_tag="Tter_0418"
FT   CDS_pept        451422..453290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0418"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: sde:Sde_2028 oligopeptide ABC transporter periplasmic
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41339"
FT                   /db_xref="GOA:D1CEI3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI3"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACZ41339.1"
FT                   /translation="MDSHKRSFKMLLATGVMSLFLAACGGGGGGQTPTPSTASPSPSPA
FT                   ASPTPVASPVASPTPAASATPAVSQTPTVSETPTTGGQTSGGQAYKLGPALMGGGAENP
FT                   DADPNATLTIDYAKGAQTFDPQVESFVNEIQVSSQVFAPLLALDKDNNLVANAAESMTV
FT                   SPDGKTYTFKIRSGMTYSDGKPVTAENYAYAIKRACDPNVNGKYSSILYAIQGCQAWRE
FT                   ADLEKDKAKLPQLKAVVDKAVTATDDQTLVIKLTQPAGYFPYVMATWVTYPSRQDLVEA
FT                   GGTNWWKDPKYFIGNGPFKMVSYNPQQGVVFERNDNYFRGKPGVAKLVFKVINDPQVGF
FT                   LAYQRGELDAVGISSDQLPQIKGDLQKQLVRQVDAATFYIGFNLEKKPFDNQKVRQAIA
FT                   YALNREQYIRQINGGVGKPAGTFIPPGIPGHQDEVQQTYDPEKARQLLAEAGYPNGRGF
FT                   PPQKLYYDAEDSAAKKRAIFIQQNLKQVLNIDIVATPLESTTLQSMLNDRSKNPPIYRL
FT                   GWIQDYPHPQDWDSLVFGNNSPLAPNGWNDPEFNALVNKADKLPIDQAIPLYQQAEKIL
FT                   VEKAPVAFQFHSESLVLIKPNVKGVSHHLSDPLGLIYESDKIYKTK"
FT   sig_peptide     451422..451538
FT                   /locus_tag="Tter_0418"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.768 at
FT                   residue 39"
FT   gene            453431..454354
FT                   /locus_tag="Tter_0419"
FT   CDS_pept        453431..454354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0419"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bsu:BSU11440 oligopeptide
FT                   ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41340"
FT                   /db_xref="GOA:D1CEI4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41340.1"
FT                   /translation="MLRFIVNRLLWMIPVLWLVGTVTFFLMHAAPGSPWDVRVGGKNIS
FT                   PELEKSFNRKYGLDKPLVVQYLIYWRNVLKLDFGQSYSNESQTVVQRIMAGFPYSARIG
FT                   LYAWVMALVLGISLGIIAALKQNTWIDYVSLFFATVGYTIPSFVLGIFLLIIFAVKLGW
FT                   VPVLFAGWKSYILPSVALGLSTAAFIARLTRASVLEIIRQDYIRTARAKGLPPRIINLR
FT                   HIVRNALIPVVTISGPALASLITGTIIIENVFNVPGMGYLFIQSISARDYPVIMGTTLF
FT                   YTFFIVIGNLLVDLTYGLVDPRIKTS"
FT   gene            454377..455318
FT                   /locus_tag="Tter_0420"
FT   CDS_pept        454377..455318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0420"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rce:RC1_3365 oligopeptide
FT                   transport system permease protein OppC"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41341"
FT                   /db_xref="GOA:D1CEI5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41341.1"
FT                   /translation="MAEAADQITALREASAVRPRGLWVDAWRRLKRNKMAIAGAIYILI
FT                   MALIAIFADVLAPHNPNAIDPTAAPNTPPFWVAGHNPQYLLGTDSLARDELSRLIYGAR
FT                   VSLIVGFVPVFIVTAIGVTVGMTSGWLGGRADNIIMRIVDVVYAFPALLFYIVVQSAFR
FT                   DSKIGDIFGGLLLLFIAFAITDWVSMARLVRGEVLRLKNREFVEAAKALGVPTRRILIR
FT                   HILPNSLAPIIVSIAFGVPSYILAESSLSYLGLGVKPQTPTWGSMVYDSFPQVTYAPEF
FT                   VLMPSILIALIMLAFTFLGDGLRDALDPYMGK"
FT   gene            455454..456755
FT                   /locus_tag="Tter_0421"
FT   CDS_pept        455454..456755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0421"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pzu:PHZ_c0896 permease of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41342"
FT                   /db_xref="GOA:D1CEI6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACZ41342.1"
FT                   /translation="MSEGVVSGAAYKAGELERERFTRLNFRHNFLIMLADSISFQLATS
FT                   LMSQVTILPLFVREITDSTLAVGLITAIASLGTLLPAIFVAGYIEQKAIQKWYLFIVAL
FT                   IERFPILALSILTPLLGRSNPDLLLWVFFGAWTMHNLAMGLNMPSYFNLFSKVIPPNRR
FT                   GITWGLGGTIGGLLAILGSSLSGVLLERYGFPDAFALIFFIAFVILFVGILGFPFTREL
FT                   PSEDVTRHRSILEYLRRAPKLLLEDREFGLFVGAQAIYTLAFMASAFYTAYAIDRFGAS
FT                   PQQVALFTTILMGSNTVANLLYGTLADRRGNKIVLQVAMSSGVIAPLIAAMAPSIEWFY
FT                   IVFALNGLMIVGSNMGSSNMPLEFAPPGQVPTYSSINMAITAPLRSLVPILGGVIAGYG
FT                   YVIIFVIAMMAALLALLVTSMLVRDPRFTRSTKL"
FT   gene            456772..458190
FT                   /locus_tag="Tter_0422"
FT   CDS_pept        456772..458190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0422"
FT                   /product="fumarate lyase"
FT                   /note="PFAM: fumarate lyase; KEGG: pca:Pcar_0324 fumarate
FT                   hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41343"
FT                   /db_xref="GOA:D1CEI7"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI7"
FT                   /inference="protein motif:PFAM:PF00206"
FT                   /protein_id="ACZ41343.1"
FT                   /translation="MTDGRFRIERDSMGEVRVPADAYYGAQTQRAVENFPISDLRFPRR
FT                   FIKALGQIKMAAAEVNADLGLLDPEIARAIVQAAQEVIEGKMDSQFVVDIFQTGSGTST
FT                   NMNANEVIANRAIELLGGEIGTKSPVHPNDHVNLGQSSNDVIPTAIHVSTLSAIQEDLE
FT                   PALSELLAALREKSVEFMPIIKTGRTHLQDATPIRLGQEFEGYAGQVERALQRLSYAKA
FT                   ELSEVALGGTAVGTGINTHPEFARRVCEKLSQLNGFEIRETTNHFQAQSSLDACVLTSG
FT                   VLKTIAVSLMKIANDIRWLGSGPRAGIGELELPEVQPGSSIMPGKVNPVIAESLLMVCA
FT                   QVIGSDAVVATGGQWGNFELNTMMPVVAYNLLQSVEIMASASSNFARKCVRGLRATERG
FT                   PQLVEQGLAICTALAPEIGYDAAAKIAQEAHRTGRTIREVARERTQLSDEELDRILNPE
FT                   VMTEPGRNIGPAGG"
FT   gene            complement(458217..459236)
FT                   /locus_tag="Tter_0423"
FT   CDS_pept        complement(458217..459236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0423"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /EC_number="3.1.3.26"
FT                   /note="KEGG: bsu:BSU29530 signal peptide peptidase;
FT                   TIGRFAM: signal peptide peptidase SppA, 36K type; PFAM:
FT                   peptidase S49"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41344"
FT                   /db_xref="GOA:D1CEI8"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI8"
FT                   /inference="protein motif:TFAM:TIGR00706"
FT                   /protein_id="ACZ41344.1"
FT                   /translation="METPAQPQHQTQPQPQPRKRSWIPIVVFLSALVVACVACVALAVL
FT                   MGRSVESTAESIHEEAVQGSGEWKIAIIPVTGTIQESAGGFTTSAATPESLKAMLDQAE
FT                   NDSKVKAIILEVDSPGGEVVASDEMYREILDFKQRTRKPVVVRMVSTAASGAYYISMAA
FT                   DKIVANPMTLTGSLGVIMEYMNFSKAADKVGISQVVIRSGEFKDIGNPFRDPTKEERQI
FT                   LQQLVDEAYNQFVNVIAQGRKMPTSRVRQLADGRVYSGQQAKQLGLVDELGNLDKAVQV
FT                   AEQLAGIKNAQVVRYRHSVSLLSLLSSRLQMSTEPDAMKILRSAGYDITPRLMYIYRP"
FT   gene            complement(459249..459908)
FT                   /locus_tag="Tter_0424"
FT   CDS_pept        complement(459249..459908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0424"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpt:Bpet0646 DMT superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41345"
FT                   /db_xref="GOA:D1CEI9"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41345.1"
FT                   /translation="METLRILWAPNEEFPRLLKAGGTRWAVGTVSLLAFLNLITTLINL
FT                   NSGVLQLEQQYFPDVPRDVLQATQQAMKVLTPVAAATYPFITWLVLGVLMYLTGRVFGG
FT                   TGRLSSMLVVSGVSQLPLIVGLVAGSVLAAAASTTSPDSPAAAFLGSLSFSLLIGQFMW
FT                   MAWLAVTGIRHVHQLDPRKSTASCGLSCLGCLGVFFILMFVAAIILSLVITTRVSS"
FT   gene            complement(459908..460921)
FT                   /locus_tag="Tter_0425"
FT   CDS_pept        complement(459908..460921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0425"
FT                   /product="putative esterase"
FT                   /note="PFAM: putative esterase; KEGG: mxa:MXAN_4392
FT                   putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41346"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEJ0"
FT                   /inference="protein motif:PFAM:PF00756"
FT                   /protein_id="ACZ41346.1"
FT                   /translation="MKRGRVESITIQSEVLKTNPLGDPWERELLVYLPPDYSESSRGYP
FT                   VVYMLAGFSGTGRSFLNFQPWQPNIAERMDRLISQGVPPAILVMPDCFTSFGGSQYINS
FT                   TATGMYEDHLITEVVPLVDSSFNTLPGRDHRGIMGKSSGGYGALVLGMRHPDIFSAVAC
FT                   HSGDMYFELCYKPDFPKFVSAIERAGGLEVWWQQFNDKPKKSGSDFEAVNILAMAAAYS
FT                   PDPNKPLGIDFPFDLRTCQIRDDVWQRWLENDPIYMVDRYADSLRSLKLLFLDCGFRDQ
FT                   YNLHFGARILTSRLEELGVPYEYEEFDDNHSNTSYRYDVSLPKVIQALAEQDPGGS"
FT   gene            complement(461080..462225)
FT                   /locus_tag="Tter_0426"
FT   CDS_pept        complement(461080..462225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0426"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: vpa:VP0252 DNA-binding transcriptional
FT                   regulator CytR; PFAM: regulatory protein LacI; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41347"
FT                   /db_xref="GOA:D1CEJ1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEJ1"
FT                   /inference="protein motif:PRIAM:5.1.1.1"
FT                   /protein_id="ACZ41347.1"
FT                   /translation="MPRSDQIDDKQNKLGKARRFQGASLRDVAKLAGVSVKTVSNVVNN
FT                   YPHVTEETRMRVQRALEELNYRPNLSARNLRNGKSGLIALAVPEIDFPYFSELARLVIK
FT                   VAGERGYTVLIDQTGGARDREKLVLAGIRPQMVDGIIFSPIETGKEDLLERRDDTPLVL
FT                   LGEGATDGILDHVGIDNVKAARVAVRHLLDLGRRRIAAIGAQPGVVVQTGHLRLRGYYE
FT                   ALQEAGIGIDQDLIARAPVYHRHEGAEAMRKLLELKDPPDAVFCFNDLLALGAIRTLIN
FT                   FGLRVPEDVAVVGFDDIEEASYSNPTLTSISPNKEQIARIAMSMLISRMEEGTTTPPRE
FT                   EQVDFRLIARESTLGVRCQEQVVYDSLQEDKARNNSALMEG"
FT   gene            462651..464144
FT                   /locus_tag="Tter_0427"
FT   CDS_pept        462651..464144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0427"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: atc:AGR_L_3413 putative sugar transporter sugar
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41348"
FT                   /db_xref="GOA:D1CEJ2"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEJ2"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACZ41348.1"
FT                   /translation="MSEERQERSSSLLTRRQALKAIGMGAVGIALAACGGGAGSTPTAP
FT                   VGGQVSTPTSSPQPSPTTAPSPSASPGGKPTVAPTPLPPTPVVQEIGRGTEKVIFWHGL
FT                   GGADGETMQVLLQKYTKEKGIAVRSETYDWGLFYQKLPTSIIAGTPPDMAIMHEWAMAQ
FT                   FGTQGVLQSADDLFFNAGILDKSDYNEEILKKITIDGVAYGVPWDNHGWGLWYNTKLIK
FT                   DAGLDPNKLPKNGQEYLEWCYKLTTDENGKHPDENGFNPKKVAVYATHPSWLRPTLLST
FT                   IWQFGGEVFDPVKKKASLDSENCIKAVQYWVDLVHEHRVAAPTGAGTTSPADLYANNRL
FT                   VLMWEGSWMLNFFKDRPKLLPPVTKAASLPSLSDGTQAAWMSAHIFVIPNGIEGDRLER
FT                   AKNLIKWLEDHNAEWADSGQVPAKLSVQNSGIIQKLWSVSAFAKEFQTIGRTEPQHVAI
FT                   TEIQAQYEPAFDAALNKVMSVKDALTQANRRIQDILDRY"
FT   gene            464211..465143
FT                   /locus_tag="Tter_0428"
FT   CDS_pept        464211..465143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0428"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rle:pRL90124 putative
FT                   transmembrane binding- protein-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41349"
FT                   /db_xref="GOA:D1CEJ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEJ3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41349.1"
FT                   /translation="MNTTRLGDITAARVSSRSRMRTLRKQLPNYLFILPFLFFFTVFTA
FT                   WPILQGIRMSLYDWRVLAKTQRFVGLKNYQSLMRDDQWWETLGHTLYFTVLTVALMVVV
FT                   SLLTAAALKRNIPGREFFRVLFYTPVLLSVSVMGVVGNRVFDPTSGLLNYYITYVLNGP
FT                   QIGWVNNPRIVIPTLAIFTVWWGFGFPMLVFLAGLQNIPEHLYEAAKIDGASSIQSFFN
FT                   ITLPLLKPVTLFVVVTQFLAHMLVFGQPLLITGGGPGTASKTVMMYLWETGWKFFRMGY
FT                   ASTMAVALAVIMIIVSLVFFRLFGARVEY"
FT   gene            465165..466028
FT                   /locus_tag="Tter_0429"
FT   CDS_pept        465165..466028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0429"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: atc:AGR_L_460 lactose
FT                   transport system permease protein lacG"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41350"
FT                   /db_xref="GOA:D1CEJ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEJ4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41350.1"
FT                   /translation="MASAIAKVSFRRISLELVITYVYLIALGIITLAPIAYMVSQAFTP
FT                   EADQNQWPVRWLPEHPTVNNFQRLLADPTLPVLRWLFNSFFVSTSVMLLTLLLCSLAAY
FT                   AFARLEFPGRDVIFFIILISLMIPGAVTFIPVFLLMRDLKFLDTYNALIWPAGANAFGV
FT                   FMLRQYFITIPKELEEAALVDGANRFRIYWQIALPLVSPALVALGIFTFLGSWNDLFWP
FT                   LVVLSERTMYTLPVGLAFLGQGNYVQQGLTMAAATLASAPVLIVYAIFQRRIVQGIALT
FT                   GGLGGR"
FT   gene            466067..468838
FT                   /locus_tag="Tter_0430"
FT   CDS_pept        466067..468838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0430"
FT                   /product="glycoside hydrolase family 2 sugar binding
FT                   protein"
FT                   /note="PFAM: glycoside hydrolase family 2 sugar binding;
FT                   glycoside hydrolase family 2 immunoglobulin domain protein
FT                   beta-sandwich; glycoside hydrolase family 2 TIM barrel;
FT                   KEGG: rle:pRL90127 putative glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41351"
FT                   /db_xref="GOA:D1CEJ5"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEJ5"
FT                   /inference="protein motif:PFAM:PF02837"
FT                   /protein_id="ACZ41351.1"
FT                   /translation="MRDRICLDGTWDFCVDKDRSFSSADVAFEDTIDVPSAWQAAKPEL
FT                   RRYTGRAWYRKTIDYPDLPNDRVFRLCFGAVDHECTVWVNGVEVGRHSGGYTPFRLDVT
FT                   HALRSGRNEILVMVDDWGYRYQWAPRWLDQEVDPEFEKAASILHGKQTWYADVSGIWQS
FT                   VWLESLPVAHINGVKIYTDPQSGSVTFRVATSEAANGKELWVEVLDQGQVCAAASGLVA
FT                   GSTCELTLQLTNPKLWSLDSPNLYEACVRCGEDTVTERFGVRSFEARDGKFFLNGSPLY
FT                   MRGALDQDFYPGTIYAPPSKEYVYEQFRLAKELGLNTMRCHIKVPHPWYLEVADELGIL
FT                   IWEEIPSWGTVGREPNSYNVKPVPESTRREVLQTLEEMVDRDFNHPSLVIRTIVNEDWG
FT                   THLVMSQEDRSWLKQMYHKAKELDPTRLVVDNSACYGSRGPNLHVKSDINDFHVYALMP
FT                   DEYQFFASWVEHFAQAPLWTWSPYEDSEPRGDEPLVVSEFGNWGLPSLEPTKEDAEQEG
FT                   EPWWFMTGGWGGGIASEATHPTGVARRFHALGLDRVWDSYEDLARGTQRHQYEALRAEI
FT                   EVMRLYPSIVGYVITEFTDAYWEANGLLDFYRNPKYLHEKFSLINTDDVLIPDRRRGSY
FT                   WAGEELKVPIRYSKWSEGSISGAGVYYASKQLGGGRQQLSADITAQQGQVVNAGEIKLR
FT                   LPDVDSPTLIEIEVWLEHGGRKLAANTLELMCLPAISRRTSADVPLAVVAPESNLSTRL
FT                   RSMGCDLVSDLKDAEIAVATRVTPELDRWVKGGGKLLLVADETCPYLFTRPRAGSPWQG
FT                   NWCQSWTWILPGSFSRVYVQNPLGFLFREVMPRHVIMGYMPEHNADVLAGMFVGWLALP
FT                   AAVTTKYRVGKGMVLHTTFDLARSEAPVSDAMLADLVDHIASPEFYPERRLV"
FT   gene            468968..470593
FT                   /locus_tag="Tter_0431"
FT   CDS_pept        468968..470593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5756 TolB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41352"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEJ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41352.1"
FT                   /translation="MRAKTCTISALLHALVVLALLVSSCGGGNTSAGGAEKNMSQAPKV
FT                   STPTRLPSDSGTVGTPTTSPTKVVSQEPPSNGGANTGGSDLEGGSSDDAGNSNGEIGNG
FT                   SGQPIKDPVQTGSNSVVGKGSSDSGSGEETSLEKPYRPTKPKLQIPKPGPEYKIQLKIE
FT                   GYTTYVFAVRNGVRRVVLTEPARYFPGMFEKYIRLSPDNRTLTYAVSVKSHSPRMKMYT
FT                   IGIDGRNRRLIGDFPWQLWVASPVWSPDSKQIAYVVASGPGQEPGIELWVMNADGSNKH
FT                   RVVKDPSFNTSLFYGNVQNPIRWTPYGDLQYLDYNSGKIWTVDTTTGELSYRTADLKAP
FT                   QSDIPLIKSKYPIPIQSQNDPRWRFDIIRTCSDTMGNSGCAITVVSMSFNAYGIKTDPR
FT                   KLNKDLGRNACPIYWTWASKYFSEGKLELWGVWAFDWYSLDLALSMGRPAMVWLSDGLT
FT                   LDTSLLSHWVLVVGGSGHTPDGYRIYDPWDGTTYKTLAYYTSKGYGLTRVYVYAPKQPK
FT                   KPKTERSKNSSSGEQRQSKDSKRD"
FT   sig_peptide     468968..469066
FT                   /locus_tag="Tter_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.641 at
FT                   residue 33"
FT   gene            470676..472802
FT                   /locus_tag="Tter_0432"
FT   CDS_pept        470676..472802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0432"
FT                   /product="Amylo-alpha-16-glucosidase"
FT                   /note="PFAM: Amylo-alpha-16-glucosidase; KEGG:
FT                   aba:Acid345_3259 amylo-alpha-1,6-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41353"
FT                   /db_xref="GOA:D1CEJ7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="InterPro:IPR032856"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEJ7"
FT                   /inference="protein motif:PFAM:PF06202"
FT                   /protein_id="ACZ41353.1"
FT                   /translation="MDYLVISDNHTFMVCEFSGDILQNDKPNGLYYRDTRYLSLLHMYL
FT                   AGQSLDVLSHDDDTTYQANIILTNRRFEDEDGTRIPAGTLTVSRSYAVHGSLSQRLVLQ
FT                   NFNNFQVRTVLAMDLAADFMDMFEVRGIASGQRGELLDPHIEGNTVVLTYLGQDGVTRK
FT                   LYIFFAISPSRVHTQDSGGTHVVRAEWDVDLTPQGTMDIEMIFEPVESEPVEVRRHAHE
FT                   GAKVYNLILRRQRHETESWLDGSTKFFTDNVDLNNLIERSTLDIKALTGEYPTGRAIHA
FT                   GIPWFAVPFGRDSIITSMQTLPLNPDLAIATLRFLAKYQGKEDDPWRDEEPGKIMHEMR
FT                   FGELANRKLIPHTPYYGSVDATPLFVMLFAQVVRWTGDRALYSELLPSVMRALEWIDRW
FT                   GDLDGDGFLEYKTRSELGIRNQGWKDSQDSILYPDGSLVSPPIALVEVQAYAYAAKLWL
FT                   SQLVAEMGDQELANRLASEAANLKEAFNKHFWVSEASFFAQGLDDRKVPIKDITSNPGH
FT                   ALMCDIVDAELLPAFVHRLMQPDMLSGWGIRTRSLHDPNFNPVSYHNGSVWPHDNSLII
FT                   YGLYKNGFRDEANEVSYQILEASRYFRLNRLPELMCGFQRDEDNLRRPAEYPVSCSPQA
FT                   WAAGTVFMMLRSMLGIEADGLNHTLRLSPSLPAWIESIEVSNLRVAHERVHFAVSRDGE
FT                   VEVISRGDITILVE"
FT   gene            472820..473836
FT                   /locus_tag="Tter_0433"
FT   CDS_pept        472820..473836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0433"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   bcb:BCB4264_A2807 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41354"
FT                   /db_xref="GOA:D1CEJ8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEJ8"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACZ41354.1"
FT                   /translation="MIPVYTEVPTGPKITLSDQDLAVIAQNYGLGAILDKKLLNGAVNT
FT                   IVLLKTSQGAFVARAHRPWTTAERLESVHTVMQSLKDRGFPVPKVGRTLDDRTWIQIRD
FT                   RLVELQEYIPHDACIDSWDLYMHSFEILAKMHEYLLTLHVDHLFPPLVSTYVTPEQALK
FT                   MLEDTDAICVEKARELGAEDALHIRQQARDILEALDREWKGYADRLPRQVVHGDYGWSN
FT                   VLVKGGRIVGIIDFDFMAERERVFEVAYSLYWAFDRLEGDNWQNGFFPRVGRLVDRYNY
FT                   LSRWPLLDVEISVLPYEMARVPLYWIAEAGYTPDPIGQIMLYSRHLPKARKLLELAG"
FT   gene            473858..475039
FT                   /locus_tag="Tter_0434"
FT   CDS_pept        473858..475039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0434"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   sus:Acid_3616 aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41355"
FT                   /db_xref="GOA:D1CEJ9"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEJ9"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACZ41355.1"
FT                   /translation="MRLKRRTSYKAETFTESVIREMTRRVIDKHGANGINLAQGYPDFP
FT                   APQEIKDAACRAIQEDINQYAITWGARNFREAIAQKTKKFLGVDVDPETEITVCCGATE
FT                   GMISALMATLNPDDEVIIFSPFYENYGPDCILSGAQPKYISLNPPDWSFDRDELVSLFG
FT                   PRTRGIIINTPHNPLGKVYSKDELEFIAALCQEHDVLVFTDEIYEHIVYDDSEHISMMT
FT                   IEGMRDRTIVVNGLSKTYSVTGWRVGYVIAPPDITIAIRKVHDFLTVGAAAPLQEAGVV
FT                   AMQMPDEYYIKMRQEYQERRDLLYQGLVDIGFVAYKPKGAYYIMAEIEKFGLGDDVEFA
FT                   NHLIDDYGVAVVPGSSFYHNPELGRGLVRFAFPKRIETIAKAVERLSPLGKLL"
FT   gene            complement(475120..475818)
FT                   /locus_tag="Tter_0435"
FT   CDS_pept        complement(475120..475818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0435"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; SH3 type 3 domain protein;
FT                   SMART: SH3 domain protein; KEGG: bcy:Bcer98_1493 NLP/P60
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41356"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEK0"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ACZ41356.1"
FT                   /translation="MIRKILGLFLALVVAFVSLSFVSPTSEAAYVRPGSYATTTANLNL
FT                   RSGPSTYYYVKRVIPYGGRVYVLSGPYNRYWYKVRWSGTVGYVHGYYLRSGSTVRTTSY
FT                   YYSSKGQAIANTAKRYVGYRYAYYGNTPAEGFSCVGFTQWVYRLNGIWIPESLWGQYSM
FT                   GWGVSRSNLRPGDLVFFQNTFWRGLSHAGIYVGNGWMIDSGTPQTGVHWSYIYDSYWRY
FT                   RWFGARRLVN"
FT   sig_peptide     complement(475732..475818)
FT                   /locus_tag="Tter_0435"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.597 at
FT                   residue 29"
FT   gene            complement(476684..477154)
FT                   /locus_tag="Tter_0436"
FT   CDS_pept        complement(476684..477154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0436"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="TIGRFAM: D-tyrosyl-tRNA(Tyr) deacylase; PFAM:
FT                   D-tyrosyl-tRNA(Tyr) deacylase; KEGG: ade:Adeh_0179
FT                   D-tyrosyl-tRNA deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41357"
FT                   /db_xref="GOA:D1CEK1"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEK1"
FT                   /inference="protein motif:TFAM:TIGR00256"
FT                   /protein_id="ACZ41357.1"
FT                   /translation="MKILLQRVSRAEVRVDGSRVAKIDRGLLLFVGIAQDDDPEVIAPM
FT                   AEKVANLRIFEDEQGKMNLSALQVGAAILVVSQFTLLADARKGRRPSFIEAAPPDRASA
FT                   FIDCMVSCFRDMGFEVQTGRFGAHMEVELVNDGPVTIMLDSREILRRQTTID"
FT   gene            complement(477200..477505)
FT                   /locus_tag="Tter_0437"
FT   CDS_pept        complement(477200..477505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41358"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR018684"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEK2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41358.1"
FT                   /translation="MSQGGVIDQIREGMEVLSSDGQKLGKIKNIWYGAASGMSSAYSDE
FT                   ESCIEVRSGGLFSKETLYIPFREIVDVSGNNVKIKADAQTVHKNPAWHTKPSWIGQ"
FT   gene            477660..479465
FT                   /locus_tag="Tter_0438"
FT   CDS_pept        477660..479465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0438"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: bba:Bd2027 hypothetical protein; TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41359"
FT                   /db_xref="GOA:D1CEK3"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEK3"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ACZ41359.1"
FT                   /translation="MLQQEISQAKEAIREAIAQLGLPQPENIDLRQIPFSGQWGLATSV
FT                   CHQLARNEVQVDIPEGLSKKEARKLLEAASRERAQSLAESIANYLSRKGIFADVQAQNG
FT                   YVNMFFEPSDVALRLLATVHEQGDSYGRGNPKSETVMVEYGQPNTHKQFHIGHLRNTAL
FT                   GDSIARILDFAGYRKVLKASYIGDIGAHVIKWLWGYNKWHSGEQPPADPYKIGPWLESI
FT                   YVEANSAIESNPDYQREYRDLFARWDRRDPEVVELWRRTREWSLNYFRRIFKELDVNFD
FT                   VWFYESDFEEPGKKIVQDLLNKGVAEIDEGAPIVRIDQKLGLEKETYRTIVLQRSDGTS
FT                   LYQTKELALTRTKFDEYKVDRILNVVDVRQTLYFQQVFKVLELLGYEQARNSQHIPYEL
FT                   VSLPTGPMSSREGTTVGYDEFATEMYERALEVVREKNPEMPQEQQERIARIVSMGSMKF
FT                   GMLNRDNTRVLVFDKEEALDFDGFSAPYVQYAHARACRILEKAPDIDWENLRIGELSTV
FT                   ETNLLEMISRLNESVERAAREYKPLHVVNYVYELAKTFNEFYRVSPVLRAEEEVRNFRL
FT                   AVVYATKVCLANSLYLLGIEAPEVM"
FT   gene            479470..480756
FT                   /locus_tag="Tter_0439"
FT   CDS_pept        479470..480756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0439"
FT                   /product="Arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="PFAM: amidinotransferase; KEGG: bcy:Bcer98_0348
FT                   arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41360"
FT                   /db_xref="GOA:D1CEK4"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEK4"
FT                   /inference="protein motif:PRIAM:3.5.3.6"
FT                   /protein_id="ACZ41360.1"
FT                   /translation="MSSLQVSSESGVLRKALVHTPGGELSMVAPSRLRDFLFSDILYEK
FT                   GAREEHLTLVKVLREIFNVEVLQFTALLEEALSSSDPLDKLRLVEGVSDLEGLHAEDTI
FT                   KLKAAFEDESQNDASYLARLLITGKLVGSDLSISDFIRHNLYQLQPVPNLMFVRDLAAV
FT                   IGQEMFVGWNSQKVRRRENLLWRFILQHASIGQDITWHNWMMEDENSSPCYLEGGNILQ
FT                   PRPNILLIGHGVRTNSSAVERLIRHLQNVMEDTCYLFVIMLPDYIPHLDAVLSAISPFE
FT                   YVAFPPAVKGHSQYSVDVLQVVLQQGKQPKTQVVDLLDSLQSTIGEPLDIIPCGGSDTV
FT                   TQKREYWWGGASLLTVSPGKIISYNSPENTLNELSKRGYKIIQATDALSNPDSIRSCER
FT                   CVITLRGLELTRARGGPRSLVMPLVREGV"
FT   gene            480757..482052
FT                   /locus_tag="Tter_0440"
FT   CDS_pept        480757..482052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0440"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: sus:Acid_4006 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41361"
FT                   /db_xref="GOA:D1CEK5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEK5"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACZ41361.1"
FT                   /translation="MVNRPSIVLVTCHDLGTYLHCYGVPTPATPNLDRLAGEGLQFTNA
FT                   FCVAPQCSPSRSAIATGRYPHSNGVMGLTHHPFDWDLYPDEKHIAQILKDLGYATFLLG
FT                   HQHVTTNPSRLGFDLMFHDRRGEAVVNEFRRIVQAHDFQASPAYFEINLNQTHRPYEGE
FT                   GLDVQSQREVFVPGFLPEAPESRDEMLQFYRSVEVADKLVGDVLEIVDQYGLRNEIIFV
FT                   FTTDHGIAMPRAKCTLYDPGLRVSLLLRWPAGSFPTGQKIDSLVSNVDILPTLLAMIGI
FT                   DPLPEFLQGKSFLPSMVDDRAVRDEVFAEKTFHSYYDPMRAIRTDRYKYIVNFESSFLV
FT                   EVPGDIQMGVIFRRFTQLYSATQHPVIELYDLESDPLEEHNLAGNPDYADIERDLRGRL
FT                   LQWMEATDDPLLQGPVASPSYRKALNVLKESP"
FT   gene            complement(482049..484493)
FT                   /locus_tag="Tter_0441"
FT   CDS_pept        complement(482049..484493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_5677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41362"
FT                   /db_xref="GOA:D1CEK6"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEK6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41362.1"
FT                   /translation="MKNSLVAIFATALLCLTVLTTPSVKAVGDYGNVEGRVTYNGLPVK
FT                   GASISAGGQSVISDSQGRFRFDPLLVQDSWRAINVTVRASGLGVWRLYNAVIIPNDTLR
FT                   LDVKLSKHDVTLSQPLPGTTKNNLAPSKVSPEQDQNLKPAATTLGSQKVPPGVIRVYVT
FT                   DKTGLSPEDMWSCRYDPVPKGEVVEVPFKDYVKHVLPNEWFASWDMESLRAGAMAVKSY
FT                   AWYYVSRGGKWYWLGADVMDTTCDQVYNPAVSYASTDQAVENTWYQRLTENGYIVPAFY
FT                   RAGTKGDPGEQGSDVMSQWGSQYWATKGKTWDWILHYYYDPVDILPATEADLRIYSGPN
FT                   VTSTTPTWGEPFNVKVTVKNYGSEPMQLQELYIKLRGPNGEILDLGGDDNSNPIDPGEV
FT                   RTISKYVPRLAIDYPGLYGNYVLTVTYIDPGGFLAPGLPPGESSTSTSIPLTVVAPSYK
FT                   AQIYSITPDSPSYYEQTTGSLTVKLRNTGNATWYKNSSSIQNAVRLVTYNDAFHPSRFY
FT                   VEGSWLSSSRILMQDSLVMPGGIGTFRFKLNGDLPPGNYTEYFRLRVEGSFGSTYRGFF
FT                   GDQVAVNISVLDDSTPPSITINAPRYSTERSSELSFPISWQGNDEQTGVKDYDIYWKNG
FT                   TDYVPWKSATSSTSATFGNGDPINLAQGGNYLFRLRAEDIAGNVSSWRNFRVIVPFDDT
FT                   RFSYNSGWRSYYNPYARHYLHTYHYAYSYGRQATFSFYGRRVAWIGVKGPTRGMAEVWI
FT                   DGSRIATVDLYAPRYSTRTVVFEKSLGTRNARHTITIKVLGKRNQLSTSNRVDIDGIAV
FT                   LR"
FT   sig_peptide     complement(484413..484493)
FT                   /locus_tag="Tter_0441"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.754 at
FT                   residue 27"
FT   gene            484726..490083
FT                   /locus_tag="Tter_0442"
FT   CDS_pept        484726..490083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0442"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: tcx:Tcr_1150 diguanylate
FT                   cyclase/phosphodiesterase; TIGRFAM: diguanylate cyclase;
FT                   PAS sensor protein; PFAM: EAL domain protein; PAS fold-3
FT                   domain protein; GGDEF domain containing protein; GAF domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: EAL domain protein; GGDEF domain containing
FT                   protein; PAC repeat-containing protein; GAF domain protein;
FT                   PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41363"
FT                   /db_xref="GOA:D1CEK7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEK7"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACZ41363.1"
FT                   /translation="MIKEEVIETSQSDKLNSYEELKASLLKLAATAIRATGFQVILVNV
FT                   REGEGFRVITGTDDILLGTYTTFDFWNKLLKEEFRISQSYLVPPWHSRQVLQDVPDDMY
FT                   VIPDIPEAKSPEDWDPYHFLIVPLLDSKREVIGFFSVDEPVSGKVPSEDLIQDLETFAE
FT                   HAALAIEKFNLINELSDRVRQVDALYKVSKSINNFQDSEAALRFLVDTANELLHADFAV
FT                   LLVHEPAGDRAISTAEIDVETYDRLRRLSRELLSPEPTLYELHLADGTPSSRLIGVCVR
FT                   VGPEDGPMGVLGVFYQDENHPKDISYSILSSLAEQAFTALRNRHLYNAAVSRADRLRVI
FT                   QSIASRLNRLNDVRKIAKAISEELRQLVDFHACRIFLASDEYLVPAAVITDHSEYSPEE
FT                   VDNLRVGFGEGITGWVAQHGEPALLHDAAKDTRTRLIPGTNDIDESMLAVPIKYDDRVV
FT                   GVITLSKVGLNQFDNEDLQLLVILADQAAIAIENAKLVEKLSLEAEALRKSEERNQLIS
FT                   RATNDAIWDWDLSTNRIIWNDAIQRLFGYEADHEFETSIEWWEERCHPDDIERLRESLY
FT                   GAINSDADVWAEEYRFRKADGSYAYVLDRGYIVRDASGKAIRAVGSMLDITHRIEAAKA
FT                   LRESEERFKAIFEDSAIGMALIDQEGRILKTNKALTKILGYTQNDLIEKNFLELVHPDH
FT                   ESTLRGRFTRIFSGKNTHYHVEQRYIHKDGHEIWGNLTVSAIRSHSGDVDLAVCMLEDI
FT                   TSRKQADSRILFQARLLDQVPVAVIACDMQMRVVHWNSAASDLFGYTPQEAIGKEVFEL
FT                   ASTIDKSENIREVIQVVLREGSWRGEVDFPLEDRVVPAQVEISAVRDKRRMLVGLVAVI
FT                   VDLSDQKKVEERLRRQNVYLSALHEIALATMRRLDPSDVFRTLLTRAAPLFNEENGFVY
FT                   LEDDDTSKLRLWVGTGVFTDYENTWLEPGEGVSGRVWRTGKPVILKDYISWPHRARMFD
FT                   ELVFHAVMAVPIFLNGRSVGSLGFVSFTQGKVFSEDDLHLLHRLADLASIALENSRLYQ
FT                   QLEKELSERLKAEEELQARAKQQAAVAYLGQLALAEDDQDSLLRKAADTVADVLDVEYS
FT                   AILRDVDNGKTLVLEAGHGWPEGVIGSRLTAAREGHPPTPDKASFNIYPPEIRYLQSGV
FT                   IRSAISVGIGGQSSPYGLLCAYSLEPRIFSPDDINFLQSVSNILAAAIEYRRAAQDLMR
FT                   AEARYRKLVEQIPAVTYIEEMGMRGVVSYISPQVEDMLGYTPEEWTSNPDPWSRIIHPD
FT                   DYEDVATSMEKAEELGIPFRKEYRMISKSGEIVWVRDEAVIVRDAEGQPLFWQGVLVNI
FT                   TDKKKLEDKLAYQAFHDALTGLPNRALFMDRLKGALARAKRYNSCCAVLFLDLDRFKHV
FT                   NDSLGHQYGDQLLIEVGNRLLSVVRSADTVARRGGDEFTILLEPICELEYAKQVAERVI
FT                   KELEKPFLINGQELYISTSIGIALSNEYSDAEELIHNADVAMYWAKSRGRARYEVYDLS
FT                   MSTFTLEKLKLESELRRAVQREEFSLVYQPVVRLRDKEVVALEALLRWHHPERGLLLPD
FT                   QFLKELEDTGLIMPLTDWMLREVCRQHKEWQKRVAGELPLVSVNFTARQFQKATMLEDL
FT                   ASILQDMDVSPSCLQLEITETVAMDDAASTARTMKGLKDLGVKLALDDVGTGYSSLSYL
FT                   RKFPLDVLKVDRTFVMGLGVDPDSTAIVHALVMLAKSLGMLVTAEGVEKQVQVDALSTL
FT                   GCDLAQGYFFSRPMEPDRITDILVRHALR"
FT   gene            490108..490989
FT                   /locus_tag="Tter_0443"
FT   CDS_pept        490108..490989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0443"
FT                   /product="Spermine synthase"
FT                   /note="PFAM: Spermine synthase; KEGG: predicted protein;
FT                   K06983"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41364"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEK8"
FT                   /inference="protein motif:PFAM:PF01564"
FT                   /protein_id="ACZ41364.1"
FT                   /translation="MSSVVAHDTLWLSVDEARKLLEARQSGVNELESSFDLGLTKVKVL
FT                   LDSEGVKLPDGLRVSWSVIEEIAGHFRTGRLSNKCFILRGEEVVPIQSYSGYTNRFYSL
FT                   LATDGAPTLVAGGFPMHRIKGTDPLKDTAEKIKAIAPVIGKVLDTAMGLGYTAIMASKT
FT                   ADEVITVEIDPEVVEIAKLNPWSRELFENPKIKVIVGDSFEVIREFPDQYFDRVIHDPP
FT                   IVSLAGDLYSLDFYKQLYRVIRPRGRLFHYIGNPEHKMGHRVTRGVVIRLQEAGFKKVV
FT                   PRPQAFGVVAYK"
FT   gene            491086..491370
FT                   /locus_tag="Tter_0444"
FT   CDS_pept        491086..491370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41365"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEK9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41365.1"
FT                   /translation="MSYGYESTNLSDTAREIKQYIYDSTIYEKSPEPLKGDASWWADQT
FT                   GIPEEEIIPALEELVASNTLIKQEDDSNPVYIYVPMTVVSPELHGPTQE"
FT   gene            491425..491500
FT                   /locus_tag="Tter_R0008"
FT                   /note="tRNA-Trp1"
FT   tRNA            491425..491500
FT                   /locus_tag="Tter_R0008"
FT                   /product="tRNA-Trp"
FT   gene            complement(491848..493638)
FT                   /locus_tag="Tter_0445"
FT   CDS_pept        complement(491848..493638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0445"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: bsu:BSU01660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41366"
FT                   /db_xref="GOA:D1CEL0"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEL0"
FT                   /inference="protein motif:PFAM:PF01915"
FT                   /protein_id="ACZ41366.1"
FT                   /translation="MVPTIKRLLMAICILVLIGISACQDVVYRGSAITHASSSSWAEAT
FT                   LSKMTLREKIGQMFAVYVYGDSAYDTDPWAVNANRKLYGVDNASQIIQKYHVGSIIYFT
FT                   WTGNIKNAQQVARLSNGIQRSSMTQRVPVPTLISTDQEGGIISRLPSQIVRSPGNMALG
FT                   AARDKTYAFRAAYIVGKELRALGINQNLAPDADVNINPFNPVIGVRSFGDRSWLVARLT
FT                   AAQVRGYQSVDVAATAKHFPGHGDTNIDSHTGLPVIRHTQKQLEDIDLPPFRAAIDSGV
FT                   DVIMSAHIVVPSLDPSGRPATLSKPILTGLLRQKLGFKGVIMTDSLEMAGVRQMFPDSR
FT                   VPVEAIKAGADLLLMPPDLNLAINSVVNAVERGEISVSRINASVLRILELKARLGLPAN
FT                   PYVDADSVSSHVKTHWHILSAADISNHTITIIRNSGVLPLKPNSGRTVLVTGWGDEPTI
FT                   EVAAKMSSYGVRVTRYSTGDHPSSSVRDHAVYLARQKSLVVVLTRDIQWDTRQRELVKS
FT                   LIQTGKPVIVLSVELPYDLAYVTSAKTYVATYSYNPVSLRAAVRVMFGKASPVGKLPVR
FT                   IPKANAPQETLYPFGYGLGY"
FT   sig_peptide     complement(493564..493638)
FT                   /locus_tag="Tter_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.890) with cleavage site probability 0.580 at
FT                   residue 25"
FT   gene            493826..494920
FT                   /locus_tag="Tter_0446"
FT   CDS_pept        493826..494920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0446"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: lch:Lcho_3206 oxidoreductase domain-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41367"
FT                   /db_xref="GOA:D1CEL1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEL1"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACZ41367.1"
FT                   /translation="MDQTIRVGVVGLGFAGNVHTMAYKKIPGVEVVALAGLEEDRLQLM
FT                   GKEYSIPNLYSRWEDLVARSDLDAVSVCTPNYLHAHVAIAALESGKHVLCEKPLARNTE
FT                   EAQSMVDAALRNRRVLQTAFNHRQRGDIMILKQYIDSGTLGKIYYAKGYWMRRQGIPGL
FT                   GSWFTSKELSGGGPLIDLGVHVLDQLMFLLGEPEITTVSASTYAEFGHRGRGVRRSGLQ
FT                   KMFVGADFDVEDLATAFMRTEDGTTVCLEASWAVQADYDDDFGLDLYGTEGGAQMRVKR
FT                   YGWQDTLRIFTDHGDVPVTIAPQTWQGTGHQAVVENFIDAIRSGNWSAHAGHEGLRRVQ
FT                   IVEACYKSALEGREISLQSIRQNV"
FT   gene            494913..495533
FT                   /locus_tag="Tter_0447"
FT   CDS_pept        494913..495533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEL2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41368.1"
FT                   /translation="MFNVCPYCGLYSVEKAIDLDSSTAFCPYCGEGYQFVMKPLYVITG
FT                   ASGTGKSTICLQLAKALSGRYIVLETDILWGEVKAKPEDNYASYTNLWLRLAKNIHQSG
FT                   ISVVLCGSLFPPTVESCPEQRYFSRVIYLALTCQDEILRDRLLTRPGWRDSSSRAFINR
FT                   MLEFNRWFLNEGSRGDLRITLVDTSSMDVQQTINNIVNLILAS"
FT   gene            495543..496415
FT                   /locus_tag="Tter_0448"
FT   CDS_pept        495543..496415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0448"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   azo:azo1719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41369"
FT                   /db_xref="GOA:D1CEL3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEL3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACZ41369.1"
FT                   /translation="MISVDVLIPTMNRLQSLIMTLSGVALQSRTDLGVIVADQSDEPAT
FT                   RSEVVRSLCKLIEARGNRVCWYHRKERCGIAEQRDFLLRVSSADAVLYLDDDVIMESWV
FT                   VEKMANVLEEQGCAFVGAFPTQPTYIDDVRPHQQHIEYWVSRVRPEIVNPGDPEWHRAT
FT                   LHTAANLFHVAQGLGLPPGDVRLYKVSWIGACVMYDRRKLLEIGGFSFWRRLPRKLVGE
FT                   DALVQNILMRLWGGCGIVPSGTYFAEVPSNFPDQYRSRDHHALMLLPEMIKTHAPHTPM
FT                   PKPDAWKYW"
FT   gene            complement(496493..499588)
FT                   /locus_tag="Tter_0449"
FT   CDS_pept        complement(496493..499588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0449"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41370"
FT                   /db_xref="GOA:D1CEL4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEL4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACZ41370.1"
FT                   /translation="MDFEIREFRESDIPEIARLFKASDPAWPGGFFFGQIVPEDALRRM
FT                   SQEERINSTYLAWADGKVVGFINLLEVPQEEKSGYIGLLNSDPAYHGRGVGRELLKRAI
FT                   QRCVELGYETVTLHTWPGNTRAVPLYKKTGFFWGPEPSGFGELRNFLPLLLSHPLTKWY
FT                   FDQIDWYDHMKRDLQLGVDEERRSNGTLIYTYRWESPIGNLTAIFDQKTNKLVTLDTPR
FT                   IYLSLEIPKALMTAGESQKAMLVVENRAHEALRIALAASGKGGVEAQGLHPLVLAPAER
FT                   SSIPIDIKTSEDKRGDSSLKLEVAIGEHKVELEGYIKVKPRIDIHLNNVLLEPQRIKRA
FT                   LLSVGNLSSERANLQLAINTTAGLEARLQADSIALDAGEWAHIPIDLQANHNGSYKLIV
FT                   RYQSEDGDRREESFELVAVTPGDIYYQEKDNTLRIYTDRLELSLNLQGYELSVFDRRTE
FT                   GKVIDVSVNPGPPYWPEASIEHDSEKDICFEGRSLIVRAPISLKAKPKVAIDRLYKFCP
FT                   DGHLKISYRVLNKHENQDVGLTTSISPQPGNTLRHLYFETTEGVRSVRLKEVYLPEWQP
FT                   HYQMNPDCRWAAIETVEWTIGLLWDENYEARCPEWSDFSLKWPEHQLEAGQAMSTGEID
FT                   LILSTGRWQDVRREWLYRNNKNVESADEEPYVGPRISPKPIRVYNQKGRAKLTFRSFNP
FT                   REVQAKISLKGSDGFETLPAEYTLQGVSSIKAASADITVTSTKPRGVGEIEALVESPVY
FT                   TGKVKAPAIVLGNTDEVRITQTIDKGEEVWVIDNDWMTFSVWPRVLGTIYSLEADGKQW
FT                   LYHNFPEPKPRRWSYPVYGGIYPVLWEQGGYHPSQLGRLAGLKFVVDEYHTHLDSQIPL
FT                   HGIRLTTTVEHDSLLGLRFEVSYLTAHDSNILIVNTVLRNTGPERNISYSLQVNPAIEP
FT                   DFPALLRLYKDPVIIPGLQDMPDMNDTRAMGVQYSNDKVLGLVTGNEGVITGYSGGNEE
FT                   SRLIADHKLKLSGGQEISLWHYLVLAESSHDMLLYTSLADIK"
FT   gene            499758..500822
FT                   /locus_tag="Tter_0450"
FT   CDS_pept        499758..500822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:499809..499811,aa:Sec)
FT                   /locus_tag="Tter_0450"
FT                   /product="selenide, water dikinase"
FT                   /note="Contains selenocysteine; TIGRFAM: selenide, water
FT                   dikinase; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: ppr:PBPRB1545
FT                   putative selenophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41371"
FT                   /db_xref="GOA:D1CEL5"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEL5"
FT                   /inference="protein motif:TFAM:TIGR00476"
FT                   /protein_id="ACZ41371.1"
FT                   /translation="MDDRERIRLTSLASCAGUAAKLGPGDLAQVLQPFTGRNTSNLLVG
FT                   LDVADDAAVYRLDEGQALVQTVDFFPPIVDDPYTFGAIAAANSLSDIYAMGGTPILALN
FT                   IAGWPGNLPLDMLAQIFRGGMDKVEEAGAVIGGGHTVMDQEPKYGLCVTGLIHPGKITT
FT                   KGAVKPGDLLVLTKPLGTGVITTALKSGKVRDVDIQAAVDSMLRLNKVASELAVELGIR
FT                   AMTDITGYGLLGHAFEMSEASNVCLNIELSKLPVLPGALDYIRQDIYPGGLNRNRSYLT
FT                   GEQDGRKKISYDNSIIVDENLVKLAMDPQTSGGLLIAVPQEQADEFTARAEQRGQSIWI
FT                   IGFASEGYGVRLLP"
FT   gene            complement(500798..501817)
FT                   /locus_tag="Tter_0451"
FT   CDS_pept        complement(500798..501817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0451"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: sus:Acid_2997 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41372"
FT                   /db_xref="GOA:D1CEL6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEL6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACZ41372.1"
FT                   /translation="MKWKNMLLAASTLGVVAGTAIRRRRELDLRGQVVLVTGSSRGLGF
FT                   LIAKAFAHEGCRVAICARNEEELEQARAQLESHGADAIAVKCDISDRDQVSAMVDTVTR
FT                   HFGRIDILVNNAGIMVVGPVQTMNTEDFQQAMDVMYWGMFYTTMAVLPQMIQRRAGRIV
FT                   NITSVGGKISVPRLLPYTAAKFAAVGFSEGLRAEMKKHGIYVITVVPGLMRTGSHLGAY
FT                   FKGKHKAEFTWFSLGASMPVVAMDAEVAARQIVEATRRGTSEKILSWPAHLIVRIHGLI
FT                   PGITTDMLGVINRLIPEDPNSKEKIKGEEILKMMGNSPIAKIISSLAQNTTQGSKRTP"
FT   sig_peptide     complement(501764..501817)
FT                   /locus_tag="Tter_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.953 at
FT                   residue 18"
FT   gene            complement(501888..502667)
FT                   /locus_tag="Tter_0452"
FT   CDS_pept        complement(501888..502667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0452"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bca:BCE_0194
FT                   3-ketoacyl-(acyl-carrier- protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41373"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEL7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACZ41373.1"
FT                   /translation="MAERNLAGRIAIVTGATRRMGIGAAICRELAGRGADIAFTHWNDY
FT                   DRNMPWGGDEDGPGLLKTELESCGVRVLSIQADLSNPDSPKQILDQVEQELGPPSILVN
FT                   NAAYSINDGYEQLTAELLDAHYAVNMRAAILLSVEFARRFTLGEGGRIINMTSGQSLGA
FT                   MPKELAYIATKGAIEAFTRSLAPDVAPLGITVNAVNPGPTDTGWMSEELKCELLPRFPM
FT                   GRVGLPEDAARLVAFLASDDARWITGQVIHSEGGFLR"
FT   gene            complement(502660..504318)
FT                   /locus_tag="Tter_0453"
FT   CDS_pept        complement(502660..504318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0453"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bha:BH2025 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41374"
FT                   /db_xref="GOA:D1CEL8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEL8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ41374.1"
FT                   /translation="MLKVSNISKSYDGHVVLQDISFVVSSGEHIGLLGANGSGKSTLLR
FT                   LIAGLEAPDTGSIWIDPNSRVAYLPQYPESDLELTVKESIDKALGGLYAVEEQISEIER
FT                   KLSYTDHASIEDLLDQYTKLREMFDLLGGYELEAKVDAVLKGLRFDGELDTPVSHLSGG
FT                   NKTKLSIAKVILSDANLLLLDEPTNYLDLSSLLWLEEFLSKSSKSYIVVSHDRRFLDKT
FT                   VESILELDKRTHSIRTWPGNYTAYNRLSTMEKAKALERYQDFKAETERIQQDIRRTKEQ
FT                   AKSTESKTNSDTARRLAKKVAAKAKARERRLERYLEENKVERPPREWSLDLRDLGKEAI
FT                   DDNRTILDIQGLTVEFDGKRVIDNLSLHLRGRDRVAILGPNGSGKSTLLKSILGLVPYK
FT                   GRITIGQGVRIGYISQDLLEVSGDERVIDIFRSRVSMHEVDARNYLHKFLFQGDEAIRP
FT                   ASHLSYGQRIKLALALITASAANFLVLDEPTSHIDMPAIESLEESLSSYTGPLLLVSHD
FT                   RYFLKEVGVNRLEVICNGKLITYSSLEEYEEVLHG"
FT   gene            complement(504564..505532)
FT                   /locus_tag="Tter_0454"
FT   CDS_pept        complement(504564..505532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0454"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   rpb:RPB_4411 luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41375"
FT                   /db_xref="GOA:D1CEL9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019952"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEL9"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACZ41375.1"
FT                   /translation="MSIAVSIMIEGQNGLNWTRWQKIADAVENLGFAGLFRSDHFTNPE
FT                   PPELDSLEAWVSLTYLADQTQRIHFGPLVSPVSFRDPIMMARQAIAIDDLSGGRFILGV
FT                   GAGWQEREHRMFGYDLGDVPTRTRRFEEALQVIHLLLTSDSSVSFDGYFYKLREAILLP
FT                   RPSIVGGPPILVGGNGKKKTLPLAAKYARVWNGVWLSPEDFKDRSETLDELLAREGRSP
FT                   QDVRRTMMTNLLFAADDKELDQKIADLKRTRSELSNLSTLEAVRQIQKQNWIAGTPDLV
FT                   LEQLQAYEEAGLQEIMLQWWDFDHPERLQPFAETVLQPITR"
FT   gene            complement(505548..506951)
FT                   /locus_tag="Tter_0455"
FT   CDS_pept        complement(505548..506951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0455"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: bsu:BSU16160 ATP-dependent protease ATP-
FT                   binding subunit; TIGRFAM: heat shock protein HslVU, ATPase
FT                   subunit HslU; PFAM: ATPase AAA-2 domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41376"
FT                   /db_xref="GOA:D1CEM0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM0"
FT                   /inference="protein motif:TFAM:TIGR00390"
FT                   /protein_id="ACZ41376.1"
FT                   /translation="MQDFTPRQIVKELDKYIVGQDKAKRALAVALRNRYRRQQLPPEIR
FT                   DEVMPKNLMLIGPTGVGKTELARRLSKLVDAPFIKVEATKFTEVGYVGHDVESIVRELV
FT                   ETSVNMVHMKAMDRVKEEAEKAANERLINYLVRQSPKYKVLQEELESLADSEQESAAAS
FT                   TKKVVLERKMKRQRKRMAQMLAERRLDDEIVEIEVDPDPDLYSVVDIFADIGDSDESED
FT                   ATPLFSLDQSNRKRSRKVSVAEARRILVQEEAQKMIDFDAVIDEGVQKAEQDGIVFIDE
FT                   IDKLISNGYDSNADVSGEGVQRDLLPIVEGSNVVTRYGTVKTDHILFIAAGAFHDSKPS
FT                   DLIPELQGRFPLRVELEDLDAEDLKAILVEPDNSLIKQYQALLGTEGVELEFTPDGIDE
FT                   IARFAHEMNLKMENIGARRLQTVMERVLEDVAFDATDLEDKHVRIDRAYVKARLENLIE
FT                   NEDLSRFIL"
FT   gene            complement(507015..507572)
FT                   /locus_tag="Tter_0456"
FT   CDS_pept        complement(507015..507572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0456"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   aba:Acid345_0214 ATP-dependent protease peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41377"
FT                   /db_xref="GOA:D1CEM1"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM1"
FT                   /inference="protein motif:PFAM:PF00227"
FT                   /protein_id="ACZ41377.1"
FT                   /translation="MSHNPPMMRATTILAVLRDGLLAMAGDGQVTFGDSIFKHKARKVR
FT                   TLYDGKVLVGFAGAVADALTLFERFESQLQQYSGDLRRSAVELAKQWRTDRYLRPLEAE
FT                   LIVGDPGQLLLITGQGEVIEPDEGILAIGSGSVYALAAAQALLRHTNMDAEHITLEAMK
FT                   IAAELCIYTNDNITIETIRAEN"
FT   gene            complement(507681..507911)
FT                   /locus_tag="Tter_0457"
FT   CDS_pept        complement(507681..507911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41378"
FT                   /db_xref="GOA:D1CEM2"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41378.1"
FT                   /translation="MSIRDVVLIILGIALAIFVVLMTYITILGVMGHGIMASLMHRTDG
FT                   VMFFVMAAFPIFGVLLVLILAIWLSKREGGL"
FT   gene            complement(507908..509557)
FT                   /locus_tag="Tter_0458"
FT   CDS_pept        complement(507908..509557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0458"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: rpb:RPB_0220 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41379"
FT                   /db_xref="GOA:D1CEM3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM3"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ACZ41379.1"
FT                   /translation="MEVTEIIGRLKNNLSSQHIEFTDQDIEKIVEYGFLQNVLLTEDIM
FT                   QGLPYDVIPEYVWHTSPLEVDRSPKDSGDRMAPVSTTSKLSKSGELLDLPLSELSEMVR
FT                   SRKVSPVELVQSCLDNIDKYDKRLNAFQLVLGDEALQQAKRAEEDIVRGEYKGPIHGIP
FT                   IAVKDLFALRDHPTTAGSRILQNWVPDYDSAVVERIKSAGGIVIGKTRMSEFAYSPGAN
FT                   NTIYGHTLNPWNNDKDAGGSSSGSGVAVATRMALVGLGSDTGGSIRIPAAHCGIVGLKP
FT                   TFGRISLFGAVPLSWSLDHGGPLVRYTSDLPLVMALLSGQDKRDPRTSPASEWPYGDKV
FT                   TNEDTRSLRVGVIGYTGSDDPIGTHDVVTCWMKGVRALEEAGSRVEEVDIPDLERLWVL
FT                   NGALIGVEAATYHTHWLRTNKEAYSEFARYRLMSAFAYGPNIFMRIQQARALLRSKLNH
FT                   LWDRFDVITTPVVRHPAPDAGTPSHTLYTGPFNFLGWPALSVPVGVSSEGTPVGMQLVS
FT                   APWREDLLLVCSNVVEAALGPLALSGDRESTQ"
FT   gene            509705..510238
FT                   /locus_tag="Tter_0459"
FT   CDS_pept        509705..510238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0459"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: sus:Acid_5737 ECF subfamily RNA
FT                   polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41380"
FT                   /db_xref="GOA:D1CEM4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM4"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACZ41380.1"
FT                   /translation="MALIDMAEAKEIQVDEFERIFLSYWEEIYLYLYRMLRDSQEAEDA
FT                   AQETFLKLYSRPPAANSNYRAWLYKVASREGLNRIRSNNRRTRLISKIKSLWSNEVAPD
FT                   TTDIVLANAESVEVRDILARMRPQYAQVLLLRHHGLSYDEISKVTGISKNSVGTILVRA
FT                   EKQFATLLERGEGK"
FT   gene            510235..511350
FT                   /locus_tag="Tter_0460"
FT   CDS_pept        510235..511350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41381"
FT                   /db_xref="GOA:D1CEM5"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41381.1"
FT                   /translation="MRCPSEGDLRSMLDNYRQELWEHVRSCKACSRRLESISQRKQLSA
FT                   GKLLANNSANCSAQQSYRSFVSRVERSKNMEFSEFGRRNPRPVLALVALLVLLPVLVLL
FT                   TPIRSAAESLLNVMRVEKFTAITIDPSQLPFNIPAEKYQQKWNQQMAARFGKYDKADLQ
FT                   KELKEHNIRRVSSVDEASKAYKGPVATIPKQGSPEEIYVSGPESASFTIDLQKIRAELK
FT                   EAGIQGVTLPKQLDGKTFTLDVPSAVVMRYGQDDSGFVFVQGESPTLVIPEGVNMDYVR
FT                   QDILMTPGLPPDLVKQIQSIKDWQHTLVIPVPPGGDSKNVRIGRSEGLLVSDRTGEHNL
FT                   LLWKHDDRLYAIGGKISSEDAISIARSVVYP"
FT   gene            511437..512354
FT                   /locus_tag="Tter_0461"
FT   CDS_pept        511437..512354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0461"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: acp:A2cp1_0670 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41382"
FT                   /db_xref="GOA:D1CEM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ41382.1"
FT                   /translation="MSSPAIYVENLRKVYGNKVAVESLSLEVQQGEVFGFLGPNGAGKT
FT                   TTIKMLNGLITPTAGKVSVLGKKLGDLGARKQIGFLPEHFRFHEWLKAYEFLDFHGSLY
FT                   GMSKSERKKRIPEVLKLVGLEHRADSRLRTFSKGMLQRIGIAQAIIANPKLVFLDEPTS
FT                   ALDPIGRRDVRDLIVFLRDNGVTVFLNSHLLSEVERVCDRIAIIKEGKVAAIGPVDELL
FT                   HAEHIVDVRATNVTPSLLEAISHRFRLMDHSNNGYFSVSVPEQEVPALVEMLVASGANL
FT                   YELKPRQRSLEDIFVDIVQVSGDR"
FT   gene            512351..513193
FT                   /locus_tag="Tter_0462"
FT   CDS_pept        512351..513193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_2141 ABC-type transport system,
FT                   putative ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41383"
FT                   /db_xref="GOA:D1CEM7"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41383.1"
FT                   /translation="MRSLLIAKFTFKEALRKKLVIGVILLSIVFVALYVWGFSSLKNNF
FT                   DERIASGNPPPFSFEFFANALVLMGFYTVNFLCGVMAIFASVGSIASEIDNGTLHSIVP
FT                   KPIRRWEIVLGKWLGYAFMLAIYVLLMCAAVVITGKLIGDYVPPRYIYGSLLVVLVGIV
FT                   LLSITVLGSTLFSSLTNGIVVFMLYGVSLMGGIVKQVGEILDSSTLKNIGLATNLVIPS
FT                   DTLWRLASYVIQPRFSLQMGPTLLSSDTPPSNMMVVYAFAYITLALLIANWIFARRDL"
FT   sig_peptide     512351..512464
FT                   /locus_tag="Tter_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.947 at
FT                   residue 38"
FT   gene            complement(513264..513764)
FT                   /locus_tag="Tter_0463"
FT   CDS_pept        complement(513264..513764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0463"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: gsu:GSU0538
FT                   HSP20 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41384"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM8"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACZ41384.1"
FT                   /translation="MLNRNFWDPFREMIRLSEAMDRLFEESFVRPTSWMLGRGGETGYW
FT                   VPIDIVETDNDYIVKASLPGFKPEDIQVNITGETLTISGNYKAEEPKDARYVLRERCLG
FT                   SFSRTITLPVPVEADKAVAHFEHGELTLTLPKVEEVRTKQIKISVGEQPQLSSTAESAQ
FT                   PQA"
FT   gene            514018..515643
FT                   /locus_tag="Tter_0464"
FT   CDS_pept        514018..515643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0464"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="KEGG: sse:Ssed_0948 gamma-glutamyltransferase;
FT                   TIGRFAM: gamma-glutamyltransferase; PFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41385"
FT                   /db_xref="GOA:D1CEM9"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM9"
FT                   /inference="protein motif:TFAM:TIGR00066"
FT                   /protein_id="ACZ41385.1"
FT                   /translation="MSDLQQRSPKAEVPISDLPFHSFERISMGLRGVVCTSNPLASDAA
FT                   MWALKDGGNAFDAALAAAAVLTVVEPQSSHLGGDVFLVAYVAKENKVYALNGSGRAPRE
FT                   IDISAFAGGIPERGPLAATIPGAVHGWCEVSRRWGKLPLKRVLQPAIEYARDGFPISVR
FT                   LARSISTLASIISMSPYARQQFLSIDPKPGNILRQPALARTLESIADRGVDGFYQGEIA
FT                   KEMVRGIREQCGVFSEDDLREHDTIVVVPISTSYRGVKVLEQPPVSQGHILLEELNIVE
FT                   NFDLKSMGLLSADTLHVLIEAKKLAFADKARYLGDPEFSKIPVEELVSKEWGRRRAEEI
FT                   NLSRANPQPEFGHLGRSNTDTTYLAVADSEGNAVSWIQSIFFVFGSGVVAGNTGVLLNN
FT                   RMNGFTIQPGHPNTLEPGKRPVHTLNAYILMKDDKPWIVGGTPGGDYQVQTNLQVISNL
FT                   VDFDLNIAEANDAPWWASLEGNNIRVENRVRQDILAELEKKGHKIDVIGAWAGDRIVQL
FT                   VQFGSNGALLGASDLRGEGYAAAW"
FT   gene            515691..516788
FT                   /locus_tag="Tter_0465"
FT   CDS_pept        515691..516788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0465"
FT                   /product="Mannose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /note="PFAM: mannose-6-phosphate isomerase type I; KEGG:
FT                   aba:Acid345_0569 mannose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41386"
FT                   /db_xref="GOA:D1CEN0"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014628"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEN0"
FT                   /inference="protein motif:PRIAM:5.3.1.8"
FT                   /protein_id="ACZ41386.1"
FT                   /translation="MPKLYPLIFEPELKEKIWGGRKLETILGKKLPPDVPIGESWEAYG
FT                   GNVVAYGDYRGMTVDQLVDELGSDLLGASIWESYDGIFPLLFKYIDANEFLSVQVHPDD
FT                   EYARTKAGYPKGKTESWYIVHAEPGAKLVHGWKKDTSPEEVEDAVRNNKLEELLEYIDV
FT                   QAGDVVFAPAGTVHAVGGGILLAEIQENSDITYRLYDWGRVGFDGKPRELHIKESLETL
FT                   DYHATAQHKNTPLSVAWDGVTRSYLVACRYFVAELMAGSVAFELDFQGDRFEILSLVSG
FT                   AVKLEWADNKISLRPGTTTLVPAALGRLRIVPESEDVRMLRMYVPRGLKEDVVEPLLSA
FT                   GYSLEQVLALGGDIRHNDIASVVQR"
FT   gene            516795..517280
FT                   /locus_tag="Tter_0466"
FT   CDS_pept        516795..517280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0466"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: pde:Pden_2512 YbaK/prolyl-tRNA synthetase associated
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41387"
FT                   /db_xref="GOA:D1CEN1"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEN1"
FT                   /inference="protein motif:PFAM:PF04073"
FT                   /protein_id="ACZ41387.1"
FT                   /translation="MKQAVSRVVEAARSAGVEITPIEYEDKTHTAQAAADAIGVEVGQI
FT                   VKSLIFLAGDGYLLVLVSGKNRVDVDKLARIVGQEVKRADAKTVKELTGYTIGGVPPVG
FT                   HTQKPLAVLMDRDLLDYEVVYAAAGTDRVNFAIATTDLLRITGARPCDIKDQQEQGS"
FT   gene            complement(517341..517994)
FT                   /locus_tag="Tter_0467"
FT   CDS_pept        complement(517341..517994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41388"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEN2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41388.1"
FT                   /translation="MKRSWIIGLTLALITLFTVTVGVLAIGGVRSNTYKQAASQETTLD
FT                   EATKQELSQRALRFTLEHKVLSGTPQVLLARDLVLDDLLGLGMCPSADIDPANEHLAIV
FT                   VVKADVDWGDVQGQTNKPLEARRFGYLLYILDSTAPGSGPKLEVASRFGGSFRHILHDP
FT                   SLPDDVPAGAPPGTRQVDKAITLDKCPPIGKEYHTPSGQVEPPVNPTTVVEKQN"
FT   sig_peptide     complement(517917..517994)
FT                   /locus_tag="Tter_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.750 at
FT                   residue 26"
FT   gene            complement(518206..518337)
FT                   /locus_tag="Tter_0468"
FT   CDS_pept        complement(518206..518337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41389"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEN3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41389.1"
FT                   /translation="MFKVIAAITPLIIGILLVQTAFANNYGVSLHKSATWNPLETAL"
FT   sig_peptide     complement(518266..518337)
FT                   /locus_tag="Tter_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.996 at
FT                   residue 24"
FT   gene            complement(518538..519035)
FT                   /locus_tag="Tter_0469"
FT   CDS_pept        complement(518538..519035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0469"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: bam:Bamb_5585
FT                   MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41390"
FT                   /db_xref="GOA:D1CEN4"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEN4"
FT                   /inference="protein motif:PFAM:PF02308"
FT                   /protein_id="ACZ41390.1"
FT                   /translation="MEDFIPSIHDLIMSGQILLSLLLGGVIGFEREARNKPAGLRTHMM
FT                   VAAGTTAFTLASIYGFSMVSGQITRDPARVAAQIVSGIGFLGAGTIFRSGSSIRGLTTA
FT                   STIWLVASIGMLVGVGMYWLAIFTTVISTVVLSFMPAPIYKLERRLRVGEPSITPDDDD
FT                   EL"
FT   gene            complement(519071..520570)
FT                   /locus_tag="Tter_0470"
FT   CDS_pept        complement(519071..520570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0470"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: gme:Gmet_1676 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41391"
FT                   /db_xref="GOA:D1CEN5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEN5"
FT                   /inference="protein motif:TFAM:TIGR01311"
FT                   /protein_id="ACZ41391.1"
FT                   /translation="MSKYVLALDQGTTSSRAIIFDQEGNIVSLAQRPIDQIYPHPGWVN
FT                   QDAEHIWEVTLSVMKEAVQQSQLGISQIAAIGITNQRETTILWDRATGKPVGPAIVWQS
FT                   RQTSHLVDDIFRRGKAERYQQITGLVPDAYFSATKILWMLEQDPEVRRRAEQGDLAFGT
FT                   VDSWLLWKLSGGKVHLTDYSNASRTMLFDINELEWSDELLADLNIPKHILPGLCDNSGI
FT                   ICHADSSILGAEIPVAGVAGDQQAALFGQTCFSPGEAKNTYGTGSFCLMNIGEKPTHSK
FT                   HKLLTTIAWGINGKVEYALEGSIFVTGAAVGWLRDGLGIIKTSEEVEQLASSVKDSGGV
FT                   FFVPALVGLGAPYWDQYARGTIIGITRSTTAAHIARATLEAIAFQTRDVVEAMIADSGI
FT                   DLHELRVDGGAVKNDLLLQIQADILGVPVVRPTMTEVTALGAAYLAGLATDVWADQQDL
FT                   KAHWKEDRRFEPSINADQRESLYSTWKRAVERACRWEKPTE"
FT   gene            complement(520601..522244)
FT                   /locus_tag="Tter_0471"
FT   CDS_pept        complement(520601..522244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0471"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   mxa:MXAN_7329 glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41392"
FT                   /db_xref="GOA:D1CEN6"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEN6"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACZ41392.1"
FT                   /translation="MDELSRQEEWKSATSRNFDLAIIGGGIMGTGIARDAAMRGLKVAL
FT                   FEKEDFGHGTTAAATRLIHGGLRYLEMYDFKLVREDLREREILLRIAPHLVFPLSFILP
FT                   LYDRGFIYRNKLRIGMILYDLLSYDKSLPNHTFLSRAETVRRLPGIAVDKLQGAAMYYD
FT                   ATAPLTERLCVENVISAKENGAVVLNHAKVVGLLRSNSSINGVRVLDLLDGREYEVTSR
FT                   LVINASGPWLNQVASDLGLGDDIIRTTKGVHLVTPKISEDAAVLFARSDQRLFFVVPWL
FT                   KFSYIGTTDTDYKGDMDEVTATEEDVDYLLSEVKRAFPGQSFDTIYYTTAGVRSLAKIE
FT                   GVPESKVTRKHIILDHYKRDGIKGIISLIGGKLTAYRGISKDVVDLACEQLGVKIPSRT
FT                   AAVPLPGGYTGKFSDYLLNQLAGSADRYPLDAEQIEHMIRLYGSRYKEVAAMTIEDPDL
FT                   SSRLHPDYPDSRADVKHAVTKEYACTLADYMLRRSDIGFSEDRGEKAASAVGAEMAALL
FT                   NWTKDRQDQEVESYLAFVRNSRLSIPSGTF"
FT   gene            complement(522298..523584)
FT                   /locus_tag="Tter_0472"
FT   CDS_pept        complement(522298..523584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0472"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   gdi:GDI0629 putative UTP--glucose-1-phosphate
FT                   uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41393"
FT                   /db_xref="GOA:D1CEN7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEN7"
FT                   /inference="protein motif:PFAM:PF01066"
FT                   /protein_id="ACZ41393.1"
FT                   /translation="MSKHALGAIIPAAGLGERLQCVGSPKPLVKIGGLTLLERTIRTLR
FT                   LGGVDGKIVVVVGHRGDEVSKFAASRKLDVVIVTNPDYQRGNGTSVMAGLDHMPERFVV
FT                   AMVDHLHPPQSVKTLLECEGDFVAAVDTKPSFADVEEATKVRLEGDKILDIGKKIPEFN
FT                   AIDTGLFLCHRDSLRELVPAQDEALSWNTVKRMWLASGRQIIACDLQGLPWIDVDTPED
FT                   MAKAIDVIMSWAPSGKDGFVSRNFNRHISRRITRLLANTPTTPNQISIMSLLLAVAGSL
FT                   LIARRAYVPGGLLVQLSSIIDGCDGEIARVRLQQSNQGAIFDSVLDRWADSAVITGMAL
FT                   SSESRSSLVAGSLALSGSLLVPYSRARIEAELGQIPSSMLSIGMTRDVRLALLAIGSIL
FT                   RKPRETLLSIGLLSNLEVLRRLLQLARAS"
FT   gene            complement(523904..525373)
FT                   /locus_tag="Tter_0473"
FT   CDS_pept        complement(523904..525373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0473"
FT                   /product="glutamate synthase, NADH/NADPH, small subunit"
FT                   /note="TIGRFAM: glutamate synthase, NADH/NADPH, small
FT                   subunit; PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: sus:Acid_3815 glutamate synthase
FT                   (NADH) small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41394"
FT                   /db_xref="GOA:D1CEN8"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEN8"
FT                   /inference="protein motif:TFAM:TIGR01317"
FT                   /protein_id="ACZ41394.1"
FT                   /translation="MVRNKLTAFIEIARHAPPRRPVEERVKDWKEVYVDLPEDVVQVQA
FT                   ARCMDCGVPFCHRGCPLGNLIPEWNDLVYRNHWKEAIERLHATNPFPEFTGKLCPAPCE
FT                   DSCVLSINSDPVTIKQVEWKIIDHAWREGWIKPNPPAIRTGKKVAIVGSGPAGLAAAQR
FT                   LNQAGHWVTVFERDDRIGGLIRYGIPEFKMDTSILNRRLNLLEQEGIVFKPNVNVGVDI
FT                   TADELLREFDAVILAIGATKPKDIRVPGRDLKGIHFAMEYLTMQNRRCEGDYIPDSEFI
FT                   SAEGKDVIIIGGGDTGADCLGTAHRQRAKSVTQFQLWAPPPKERAPNNPWPELPYVFTI
FT                   SAAHEEGGTREFCVSTKEFIGDENGHVRAIRAARIEVEYDEHGRRRAKEIPGSEFEMPA
FT                   DLVLLAMGYAGPETDGIVSQLGLELTERGNIATDAQKMTKIPGVFAAGDARIGQSLIVW
FT                   ALQEGRDVAKYVDLYLTENQRDSGQEKNYAA"
FT   gene            complement(525363..529940)
FT                   /locus_tag="Tter_0474"
FT   CDS_pept        complement(525363..529940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0474"
FT                   /product="Glutamate synthase (ferredoxin)"
FT                   /EC_number="1.4.7.1"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase;
FT                   glutamate synthase alpha subunit domain protein; glutamate
FT                   synthase; glutamine amidotransferase class-II; KEGG:
FT                   afw:Anae109_0854 glutamate synthase (ferredoxin)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41395"
FT                   /db_xref="GOA:D1CEN9"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEN9"
FT                   /inference="protein motif:PRIAM:1.4.7.1"
FT                   /protein_id="ACZ41395.1"
FT                   /translation="MGKREELQATCKRPYGMPDAEGLYDPSFEKDACGVAFVVDIKGRK
FT                   SSDVVQKALLALQNLLHRGAVGAEKNTGDGSGILIQIPHNFLKAECLKLGFELPEPGEY
FT                   AVGMVFLPKVEEQAKPCQELFEQEIMRAGQKVLGWRDVPQDNSMIGDIARSGEPLMRQV
FT                   FIGKGEAIEDEEHFERVLYLIRRRVEKAVDNSNIPSKDMFYVPSLSCRTLVYKGMLSAD
FT                   QLPAYFADLRSPLLESAIALVHQRFSTNTFPTWSLAHPFRMLAHNGEINTLRGNINWMR
FT                   AREGQMESELFDDDLRDILPVIQEGGSDSATLDNVLELLVRAGRSLPHAMMMLIPEAWS
FT                   GHEGMSEIKKNFYDYHASLMEPWDGPAAVAFTDGRLVGAVLDRNGLRPARYYVTKDDQV
FT                   ILASEVGVLDVAPEDVVYKGRIEPGKMLLIDTVEGRIVDDAELKARIASEKPYGRWLSE
FT                   NRVKIDDLPAPPHVPEPDHNTVLQRQQIFGYTHEENRIIIIPMAKNGEEPIGSMGTDTP
FT                   IAVLSERPQLLFNYFKQLFAQVTNPPLDAIREELVTSVDTLLGPEKNLLKPEPDSCRQI
FT                   EIPSPIIDNEQLAAIINFEAPGFKTKVLPMLFSARDGVKGLERALDKLFEEADKAIDEG
FT                   YTILVLSDRGVNKDLAPIPSLLATAGLHHHLVRNGKRTKVGLIVETGEAREVHHYCLLI
FT                   GYGAGCINPYLAFETIDDLIRDGHITGIDHATAVKKYIKAVNKGVLKVMSKMGISTLQS
FT                   YRGAQIFEAIGLNQEVVQKYFTGTPSRIGGVGLDVIAEEALARHRRAFPERPIPGQPDL
FT                   EWGGEYQWRRDGEYHMYNPETIAKLQYATRSGQYNIFKEYSRLIDDQSRKLATLRGLFE
FT                   LKFSDKPVPLDEVEPVESIVKRFATGAMSFGSISQEAHETLAIAMNRIGGKSNTGEGGE
FT                   DPARYIPDPNGDSRRSAIKQVASGRFGVTSEYLVNADEIQIKMAQGAKPGEGGQLPGNK
FT                   VYPWIAKVRHSTPGVGLISPPPHHDIYSIEDLAQLIYDLKNSNPRARISVKLVAEVGVG
FT                   TVAAGVAKAHADVVLISGHDGGTGASPISSLKHAGIPWELGLAETQQVLVKNNLRSRIV
FT                   VQVDGHLKTGRDVVIAALLGAEEFGFATAPLVVLGCIMMRVCHLNTCPVGIATQDPVLR
FT                   KRFAGKPEYVQNFFYFIAQEVRELMAQLGFRTMDEMIGRIDKLDIRPAVNHWKAKGVDL
FT                   SSILHQPEEYKYYAIRCTESQYHGLETALDNQLIELCKDSLENGTPIRIEMPIRNVNRT
FT                   VGTMLGSELTRRHGGKGLPDDTIHIKFRGSAGQSFGAFLPKGITLELEGDANDHVGKGL
FT                   SGGKIIAYPPSESRFVPEENILIGNVALYGATSGEAYFRGKAGERFAVRNSGAHAVVEG
FT                   VGDHGCEYMTGGRVVVLGKTGRNFAAGMSGGIAYVLNEDGNFERRCNLEMVELEGLEED
FT                   DIETIHRMIQKHYEYTNSSVAAKILDNWDYYLPMFVKVMPKDYKRVLQEQKQQPQEVVE
FT                   VSHGS"
FT   gene            complement(530525..531268)
FT                   /locus_tag="Tter_0475"
FT   CDS_pept        complement(530525..531268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0475"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: tcx:Tcr_0985
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41396"
FT                   /db_xref="GOA:D1CEP0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEP0"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACZ41396.1"
FT                   /translation="MRRFWLEVRYLFTIQILEERGWLAGTIFFTTVFPLLLVFGLGLIG
FT                   SGQTKEGLTYIITGSTISSLTFVGITMVGQSLGWMKDRGDFLYYASLPISKSSLIVAVM
FT                   ASKLVLQLPGIIAALVGGTLMYDLHFKPNPVVIIILPLTALALSGLGAAIGLLSPSYQL
FT                   VNIFSQVAGITVMFAAPVMIPWESLPRVLQWFGWLLPPSYAADALRRAVLGINDTRLMM
FT                   DLLVLTTCALVSIIGVTRGLRWRLR"
FT   gene            complement(531265..532287)
FT                   /locus_tag="Tter_0476"
FT   CDS_pept        complement(531265..532287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0476"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sus:Acid_4381 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41397"
FT                   /db_xref="GOA:D1CEP1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEP1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ41397.1"
FT                   /translation="MRLTTTTSYSSTTDSERSALAIDVRNLTKKYKNGKVANDHLSLQV
FT                   DRGTIFGLLGPNGAGKTTLVLQILGLLAPTSGSIYVEGIDVISNPEKVKPLAGYMPQTR
FT                   IAMRNLEVDRALYITGRLRGQSHEQARKQSEGLLEMLDLTEHRKQFIDRLSGGLLRVAA
FT                   MGMALMGDPHLVVLDEPTNELDPVRRRMVWDVILGLQDYYKHPVTCLLVTHNVLEAERI
FT                   VERVAIIDKGKVAAIGTPGELKSQLGDEVRLEVVIKPDVLTEEIALKVEETLHDFGRVI
FT                   PFRQGQYAVFVPRVGVGSATDKILGALDGLVDDFRLSPPSLEDVYIHVTGSKIELEDEQ
FT                   "
FT   gene            complement(532244..533374)
FT                   /locus_tag="Tter_0477"
FT   CDS_pept        complement(532244..533374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0477"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; sigma-70 region 4 domain protein; KEGG:
FT                   xca:xccb100_3196 RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41398"
FT                   /db_xref="GOA:D1CEP2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEP2"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACZ41398.1"
FT                   /translation="MTPNAQSFEVQERERLVRIYRSLTGDPDTAEDLAQEAIIEAWRNK
FT                   HKLHDPSGRWRWLSNIARKVYLRWSRDRARDYRRMEIVGQDLSNRLELMEDPELSIELE
FT                   REELATILDEALRHLPAETRSILLQHVVEGMPQADIARKLGISEGAVAVRIHRGKLLLR
FT                   KILLSRPDYVGIYNIGASPSSWQPTDIWCPFCGLDKLQGKLDPATDTFMMKCPTCTPSP
FT                   DDQLINGSNIGIARSYTTLNGALNKLMKEACEYYGQGLRTRRTQCLSCGTTIPLWIELA
FT                   PDSECPIKTSMHFITAICQHCQEESRSLLAGHALSLPQGRAFWKANKRIRMLPEQNVER
FT                   EGRKAAVTAFESVSRSAKYEVVYALDNYDILLINNR"
FT   gene            complement(533570..536428)
FT                   /locus_tag="Tter_0478"
FT   CDS_pept        complement(533570..536428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0478"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein; DSH
FT                   domain protein; helicase domain protein; type III
FT                   restriction protein res subunit; SMART: DEAD-like helicase;
FT                   helicase domain protein; KEGG: AGAP009600-PA"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41399"
FT                   /db_xref="GOA:D1CEP3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEP3"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACZ41399.1"
FT                   /translation="MLLSHEHIKSSFESLYPFELDDFQKEAIDAYLKEGSVLVAAPTGT
FT                   GKTVIAEFGVHDAWLRGHRVMYTTPIKALSNQKYRDFRARYGDDVGLLTGDVIENSHGR
FT                   ILVMTTEVLRNMLLQTPWELEDVACVVFDEVHYLSDPERGTTWEEAIILCPEHIQLICL
FT                   SATVSNAQEIADWISRVHRPTKLIAHYERAVPLSYYYFIDNTILPAFDKNGKLNKKLLN
FT                   LGGEARQRFRRRVNLSVQESLESERTEPKPPDIVRVLRDKDMLPAIYFLFSRKDCEIAA
FT                   ELCRSMRLQLVTSKEQRDEIKRVIDLFSQRMLPEDRNLAQVKTVLDLARQGIGFHHAGL
FT                   LPILKQLVEELFSRGLMKVVFATDTLALGINMPARSVVIGQMSKFDGQGVRPLIPNEFQ
FT                   QMAGRAGRRGIDKIGHVIVPYSSWVSFREAMEIATGELHPVQSAFVLRYNTVLNLWDPP
FT                   KGDRVLYVLQQSLMQFQTNRQIRELSEEIKQWQVQIDSIDRGCLIGYSDGEELLSEYQE
FT                   LNHTRTAIAKRLEELRREQRALQERLKELPWKKPSREALRKLFRSLVPGTMVHLSQKGW
FT                   CIYAGRSADGTIHLICDGKVHKLAAYNEIDYLPNPEDRIDLPIEISEDVCSGEIVELDE
FT                   LVWRKLQANIQQLELPDLEALIRRHREQIALSISDQMEALKFDEEQTQAELNDLLERIR
FT                   NHPCDACEVRKQHQRNIREAARLMQRRAEAELELEERSRESERQIRKVLKGIVSVLHQF
FT                   GYLEDGYQTEKTDLLANLFDTNGLIICEMIYRGYLDNLSPPDIAEVLSWFAYDRDRQFS
FT                   NMHILPKHLINLRRQLDDLETRILRAESRAGVQISQGYNPYFFGMMRAWCNGASLSQIL
FT                   DKVDIGEGDLVMTFNKTLDLIRQVRDMLVQADPGSPLLPKLDQATALARRGIIEQSYRL
FT                   GFSLDDDTKEIAESPLPESTIE"
FT   gene            complement(536429..536620)
FT                   /locus_tag="Tter_0479"
FT   CDS_pept        complement(536429..536620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41400"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEP4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41400.1"
FT                   /translation="MWQAQTFMSQDEETALAEMLTWLNENEEIIVEYQAIQVHQPDGTH
FT                   VCVVAYRARRLEPQAFIT"
FT   gene            complement(536919..537530)
FT                   /locus_tag="Tter_0480"
FT   CDS_pept        complement(536919..537530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41401"
FT                   /db_xref="GOA:D1CEP5"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEP5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41401.1"
FT                   /translation="MTLWLKVRRAWICTITVLVTVLLIDLSKYLYLAIPNLLGGDMLKM
FT                   PMPLILGIAICIVLGWGLGSGNPPLEAVASRPTQLLDTTYTLAITLLSLILCIILHSIS
FT                   KADVILAAGRNVLGYAGIMLLGRSFLGSNAATVLPTGFAIIVAMLGQDQYGRTYDWAWP
FT                   LAGSEYKLSWVLAAILLIVGITCYLGRMTILNNSAWGNEN"
FT   gene            complement(537549..538439)
FT                   /locus_tag="Tter_0481"
FT   CDS_pept        complement(537549..538439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41402"
FT                   /db_xref="GOA:D1CEP6"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEP6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41402.1"
FT                   /translation="MLPDLRILSVAFVVILAQAVLGFTIGIWLPTVVAAPLTLIALFLW
FT                   MTLPPGLNTFWVRHLTGDFSGCCSLNTDIAPSAIAGSILLALSFLVASLILLTQRIGLI
FT                   RISASLLIAIAGFTLGASLVRGLGPEPLVPRNPKLLVCSNQWPKVCVWPEHKSRLNEVS
FT                   EIARRAATAWKSTGINVPNTFSEYSSLQRNENSFGFSILANRVIITNSMAYSMLPPTPD
FT                   CPEDKPWLGGENQEYLNAWLDEVAGLTPNQISSVFSPDVLQTVARVRHMSISEQRAWYE
FT                   RNFRMAQRCASISHR"
FT   sig_peptide     complement(538335..538439)
FT                   /locus_tag="Tter_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.878) with cleavage site probability 0.459 at
FT                   residue 35"
FT   gene            complement(538778..539521)
FT                   /locus_tag="Tter_0482"
FT   CDS_pept        complement(538778..539521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0482"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: aba:Acid345_2797 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41403"
FT                   /db_xref="GOA:D1CEP7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEP7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ41403.1"
FT                   /translation="MSISFRGITFRYWRSASPVLDEFSWDVPMGRTVLLGPNGAGKTTL
FT                   LSIGADLLRPKRGQVLLGNLNPRRRTQRGQYRRAVGWMPQQIRAVPGLTAREQVAYAGW
FT                   LKGLSRSGAWESAAQALDRVGLRNLMDRKASELSGGQLRRVGLAQVLVHSPSVMLLDEP
FT                   SVGLDPAQRARFREILYELPPDIPVVVSTHQVDDLSELFNTVVVLESGKLRFTGTVEDF
FT                   MSLAPSNLDGRNAEIAYSKVINGEY"
FT   gene            complement(539791..540051)
FT                   /locus_tag="Tter_0483"
FT   CDS_pept        complement(539791..540051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41404"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEP8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41404.1"
FT                   /translation="MLITKKYMAITTTFICILALATVAQAEGSWTSYITGALTGFDSRT
FT                   WYDGHMDHAHTKIRFAGCRDNNYANDPNDNVTVQLTKEGFL"
FT   sig_peptide     complement(539971..540051)
FT                   /locus_tag="Tter_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 27"
FT   gene            540383..540766
FT                   /locus_tag="Tter_0484"
FT   CDS_pept        540383..540766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41405"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEP9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41405.1"
FT                   /translation="MAKISIPIPEVVWRNETFDIPEDKIQVVMEALQSRQEAIIKSVAQ
FT                   RNEEILHKLQSLNLSKQGISTSRRFLMLGSGMATGLLLVALLPKAVRSVRGSQQTVEQG
FT                   EQATSQENAGVRLERVEVPADTA"
FT   gene            complement(540884..543019)
FT                   /locus_tag="Tter_0485"
FT   CDS_pept        complement(540884..543019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0485"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: bcy:Bcer98_2485 DNA topoisomerase I; TIGRFAM:
FT                   DNA topoisomerase I; PFAM: DNA topoisomerase type IA
FT                   central domain protein; TOPRIM domain protein; DNA
FT                   topoisomerase type IA zn finger domain protein; SMART: DNA
FT                   topoisomerase I DNA-binding; DNA topoisomerase I
FT                   ATP-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41406"
FT                   /db_xref="GOA:D1CEQ0"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEQ0"
FT                   /inference="protein motif:TFAM:TIGR01051"
FT                   /protein_id="ACZ41406.1"
FT                   /translation="MANKLVIVESPTKAKTISRYLGRGYSIKASMGHVRDLPKSKLGVD
FT                   TEHDFQPQYLIPRDKSKTVKELKESVASAREVYLATDPDREGEAIAWHLIQATGMDTSK
FT                   ARRVVFHEITPDAVRNAMANPREIDMRLVDAQQARRVLDRLVGYNISPLLWKKVKRGLS
FT                   AGRVQSVALRLVVDREREIQSFVPVEYWTISADLAKQPAKGRKPSRKDQFRALLVRIND
FT                   EKVEISNEEQARAIIEALEGATYKVLEVKQREIQRKPAPPFITSTMQQEASRKLNFNAR
FT                   RTMSVAQSLYEGVSLGDEGDVGLITYMRTDSTNVATVAQEEARQVIAQLFGDKYLPEKP
FT                   PVYTKKAKNAQEAHEAIRPTSVKRHPDAIKQYLTSDQYKLYKLIWQRFIASQMANAIID
FT                   GTTVDIAAEPRSGGAPYIFRATGSVIKFDGFLVVYQEGKDDDQEEELGSKALPPMTEGE
FT                   VLNLIQLLPEQHFTQPPPRYTEASLVKALEEQGIGRPSTYAIILSTLQERYYVVKDGKA
FT                   LVPTELGMLVNDLLVEHFPDIVDVNFTSQMEEELDDIASGERAWVPVIKEFYGPFERKV
FT                   RIAEEEMQKVDIQDEPAGENCPNCGRPMVFKMGRYGKFIACSGFPECRTTKAIVNRTGV
FT                   QCPACRQGELVERRSRKGRRSIFYACDRYPDCEFTISAKPLPQPCPACGGLQVEDGKNG
FT                   QKCIRCDGQGNILQKSA"
FT   gene            complement(543179..544249)
FT                   /locus_tag="Tter_0486"
FT   CDS_pept        complement(543179..544249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0486"
FT                   /product="Mannose-1-phosphate guanylyltransferase (GDP)"
FT                   /EC_number="2.7.7.22"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: sat:SYN_01031
FT                   mannose-1-phosphate guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41407"
FT                   /db_xref="GOA:D1CEQ1"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEQ1"
FT                   /inference="protein motif:PRIAM:2.7.7.22"
FT                   /protein_id="ACZ41407.1"
FT                   /translation="MYVIVLAGGGGTRLWPHSRSNNPKHLLRLVKSDTTMIQETVRRIL
FT                   PLTSPDKILVVTNHKHADEVRKQLPEIPHDNVLEEPVGRNSGPAVGYGALHVAHVDPEA
FT                   VILTCPADHVILKEEEFRSAVKAAAQVALDNYLVTMGISPGYPDTGYGYMELGEEIKQV
FT                   DGYKVHRVLRFTEKPDLQTATEYVNSGRFVWNSGMFIWKASVILEEISKYMPNLHAALQ
FT                   KIKDVVGTPEERHVVNELWPQLEDLSIDYGVLEKSDRVVTIPVDIGWSDVGDWGALAEI
FT                   LEKDENGNSLIGDVMTFDTRNSLIYSSGCLVTTIGLEDMIVVSTGDAVLVCPKSRAEEV
FT                   RKIVNKLREMGRDTHL"
FT   gene            544452..545306
FT                   /locus_tag="Tter_0487"
FT   CDS_pept        544452..545306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0487"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gsu:GSU1789 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41408"
FT                   /db_xref="GOA:D1CEQ2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEQ2"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACZ41408.1"
FT                   /translation="MKSIRPALVIVPCYNERDNIGNLINEILAQSDDFDILVIDDNSPD
FT                   GTAEVVKALQREHPQVHLMQRSRKLGLGTAYRAGFKFALDRDYRYIITMDADFSHQPCY
FT                   LPKMLELAASADLVIGSRYVPGGGTSGWPVHRRFISGFANWLARTVLGLSAHDCTAGFR
FT                   CYRRETLIRVDPDTILSSGYSFLIEMLYKVETQRMRVVELPIIFVDRIAGKSKISRYEI
FT                   YKALYTLGRLKFPNLPWGRIARIGGKYGEPGAVAISIFALLSMVWALVKRKDISDDFDA
FT                   SER"
FT   gene            545405..545716
FT                   /locus_tag="Tter_0488"
FT   CDS_pept        545405..545716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0488"
FT                   /product="ribosomal protein L21"
FT                   /note="TIGRFAM: ribosomal protein L21; PFAM: ribosomal
FT                   protein L21; KEGG: hha:Hhal_1848 ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41409"
FT                   /db_xref="GOA:D1CEQ3"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEQ3"
FT                   /inference="protein motif:TFAM:TIGR00061"
FT                   /protein_id="ACZ41409.1"
FT                   /translation="MYAVIRTGGKQYKVAVGDQLSVEKLPAEAGQAVQFDDVLLVADGE
FT                   NVKVGTPTVEGALVKATVLDQERGPKIRIFKFKAKKRYRRRAGHKQNYTRVKIDEIVA"
FT   gene            545736..545996
FT                   /locus_tag="Tter_0489"
FT   CDS_pept        545736..545996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0489"
FT                   /product="ribosomal protein L27"
FT                   /note="TIGRFAM: ribosomal protein L27; PFAM: ribosomal
FT                   protein L27; KEGG: ribosomal protein L27; K02899 large
FT                   subunit ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41410"
FT                   /db_xref="GOA:D1CEQ4"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEQ4"
FT                   /inference="protein motif:TFAM:TIGR00062"
FT                   /protein_id="ACZ41410.1"
FT                   /translation="MAHKKGVGSSRNGRDSNPKYLGVKKFDGEYVKPGMIIVRQRGTKI
FT                   RPGDNVGLGKDYTIFSLVEGTVKFTPYSKTQKKVSVVPLAQ"
FT   gene            546025..546309
FT                   /locus_tag="Tter_0490"
FT   CDS_pept        546025..546309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0490"
FT                   /product="ribosomal protein L31"
FT                   /note="TIGRFAM: ribosomal protein L31; PFAM: ribosomal
FT                   protein L31; KEGG: cha:CHAB381_0223 50S ribosomal protein
FT                   L31"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41411"
FT                   /db_xref="GOA:D1CEQ5"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEQ5"
FT                   /inference="protein motif:TFAM:TIGR00105"
FT                   /protein_id="ACZ41411.1"
FT                   /translation="MKPNIHPQYVEATVHCSCGNTWKTRSTKPNIRVDLCSKCHPFFTG
FT                   EQRIVDTAGQVDRFMRRLERRQAGRGGGTPVTIPAEERPTVAEAESQEQ"
FT   gene            546414..546956
FT                   /locus_tag="Tter_0491"
FT   CDS_pept        546414..546956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0491"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   bph:Bphy_1696 RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41412"
FT                   /db_xref="GOA:D1CEQ6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEQ6"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ACZ41412.1"
FT                   /translation="MSDKPRLRQLKAKALKDFLRGVQRPEVDLVFLLQDLEDPVNVGAA
FT                   FRIADGCEASEIILTGKTPTPPDSTIAGVGRGAHRRIPWRYVEHADEALVELKGMGYMA
FT                   CAIEVAEGAVPYYSLKYPDRVCLVVGHEYHGVTTRTLSVCDNAVYIPMYGKIKSLNVHV
FT                   ALAVVAFHVLHQQLICG"
FT   gene            complement(546943..548385)
FT                   /locus_tag="Tter_0492"
FT   CDS_pept        complement(546943..548385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41413"
FT                   /db_xref="GOA:D1CEQ7"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEQ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41413.1"
FT                   /translation="MLSQIIAPKNWVIVLLTGSESCLLYLAMLVFSSEPRFVPPMIWMW
FT                   LLGVIAYFIPRLFQGRSHELYAGMTISCFLATSVLSVKYLCYPQIAWSDADWIRDYLLS
FT                   LLGEGNLSVHNPGFVSLASIIIWLRQVLRNTPDSEDIEYYLRIAVIPISILTVIGIGRL
FT                   GNNPSVTSLIVLSLAGCYTLGIASLAVSNSFRQEGEELIGKGIVGRWLISSLFPIAILA
FT                   LLGIGLSLLLYSPQTSLIDILLKIVSTILGWILLIISLIVQLILVPVIYLIAKIFEPAL
FT                   NRLNLNPLPERPPRNAQEDLERIIRQRGEGLPQHTLEIALIVGVLLIVLFLLIRHRPSR
FT                   DKLTKASVQREHAYGDLELGKTLRNLLARLARRGKKMATDPLMFLLRDSRWRYTAEVRR
FT                   TYREVLGLYREIGKPRLPYETPLEHSTHQGLSSLVELADLYDLARYSRKPLTAQDAARA
FT                   RELAEEIRSKLRVETNSSSSHR"
FT   gene            complement(548389..549585)
FT                   /locus_tag="Tter_0493"
FT   CDS_pept        complement(548389..549585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0493"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   bcr:BCAH187_A3053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41414"
FT                   /db_xref="GOA:D1CEQ8"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEQ8"
FT                   /inference="protein motif:PFAM:PF01882"
FT                   /protein_id="ACZ41414.1"
FT                   /translation="MQERHHVYWLICGLVLLLGGAIGRNIVITTLGLVLVGTVGVSWLW
FT                   SRYALRGIRFHRKVLNPKIFPGESTEIEMEVTNLKPLPIPELRIREYLDRSLIPSGTTS
FT                   RGPYGSNVHIWHHVSIGPLEKVRWRYKVTCTRRGYYRVGPILMKTSDPLGFFDSESHVP
FT                   ATSRILVYPRLVPIEQLAPQYRLPFEGSKTTPGVIVDPSNVVGARPFVPEDTRRQIHWR
FT                   ATARSSQLQSKIWRPLQAHSMVICLNLEGTTVPWVPPDIDSVELGISVAATLINQASQS
FT                   RWACGLIVNSLHPGTWNPVNIRPSRDQKAFMNMMEILAKIPAHESMKFTDVLARERRQF
FT                   PQEAIIVVITCVMTPGIEEQIHINRALGREVIVIDPKLAVTNSKQAAASAITENVRQD"
FT   gene            complement(549592..550533)
FT                   /locus_tag="Tter_0494"
FT   CDS_pept        complement(549592..550533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0494"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   bcr:BCAH187_A2274 methanol dehydrogenase regulatory
FT                   protein; magnesium chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41415"
FT                   /db_xref="GOA:D1CEQ9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEQ9"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ACZ41415.1"
FT                   /translation="MSARELAEVIKQNVRRVLVGADKPTEMLLVALVAQGHVLIQDVPG
FT                   VGKTTLARALAKSIDTSFSRIQFTPDLLPSDITGAYYYNQRESQWLLREGPIFAGIVLA
FT                   DEINRAAPRTQSALLEAMQEGQVTIEGETRDLPSPFLVIATQNPIELEGTFPLPEAQLD
FT                   RFLLRISMGYPSREDEKRVLLTHSPQSIRHIEPVTSTRQILDATEEATAVTVEESIAEY
FT                   IVDLIRATREHPAVQLGGSPRAGTALLRASRALAALRGRDYVLPDDVKELAVPVLAHRL
FT                   VLTQESMLRGRSAEEILQEIIEQIQVPVEAEA"
FT   gene            550664..552991
FT                   /locus_tag="Tter_0495"
FT   CDS_pept        550664..552991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0495"
FT                   /product="penicillin-binding protein 2"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: sfu:Sfum_2589 peptidoglycan
FT                   glycosyltransferase; TIGRFAM: penicillin-binding protein 2;
FT                   PFAM: penicillin-binding protein transpeptidase; NTF2
FT                   domain protein transpeptidase; Penicillin-binding protein
FT                   dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41416"
FT                   /db_xref="GOA:D1CER0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR007887"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D1CER0"
FT                   /inference="protein motif:TFAM:TIGR03423"
FT                   /protein_id="ACZ41416.1"
FT                   /translation="MYRYGRYSGYRRRRRARRLRILAIALVVVILVGSLLYTTRAGNNI
FT                   LSNIGLRGASPQATPTSNIAAQPTSRPTTVTSPSPNNNVPPTAVVTPEATPTSQPKPTA
FT                   TSTPSKSPVETAKAYIANWEAGSYSDMYKLLSDESQKQYDRQYFVTRYQQIAAMATIQS
FT                   VDASLNTSDAINAGNGNIIRFPFNVTIHTRLVGDIKEQNLLTLVKEDGVWKVQWGPNMI
FT                   FKDLSGDNLIRMFPYSAPRGSIYDRKGRPLAIEGTIAQIGVVPGQIKNEKVLLQRLSQA
FT                   LGVSEDYIKSRYQGGQPDWFMPIRDLTKQQAAQLQKQVGDIPGVAFQERVGREYPQGPI
FT                   LAQVIGYVGAITAEDLKKPEYKDYSPTDVVGRAGLEAWGEPYLRGKPGGKLAVVTPDGE
FT                   IVKVIKEVRAVPGDDIYLNIDLDLQIQAEQELSKGGYRGAIVAMNPNNGDILALVSEPS
FT                   YDPNDFVVGISQKEWEALNRKSSGYPLINRATGSSYPMASTFKPISLAAALEAGIYKPT
FT                   SMFYDPGYWNKLGENPPRRDWKPGGHGWISLESGLVQSCDIVFYEVGLALYKKRFDYLS
FT                   EFAKKWWLGRSPDVDGVVNASGQVPGPGVPYPGWGPGDNVNLAIGQGALNVSPLQVAMV
FT                   YSTIANGGTIYKPLLIDRIVAGDGSGKIIKKYKPTVLGRAPVSQETMDVIHRALKDVTS
FT                   SQVGTAYYVFKDFPIPVAGKTGTGQQDEKLPFAWFAAYAPADKPSITVVALAENAGEGS
FT                   VIAAPVVKNVLADYFNVNARTR"
FT   sig_peptide     550664..550789
FT                   /locus_tag="Tter_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.809) with cleavage site probability 0.176 at
FT                   residue 42"
FT   gene            complement(553051..555348)
FT                   /locus_tag="Tter_0496"
FT   CDS_pept        complement(553051..555348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0496"
FT                   /product="nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /note="PFAM: nucleic acid binding OB-fold tRNA/helicase-
FT                   type; KEGG: scl:sce0281 signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41417"
FT                   /db_xref="GOA:D1CER1"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="UniProtKB/TrEMBL:D1CER1"
FT                   /inference="protein motif:PFAM:PF01336"
FT                   /protein_id="ACZ41417.1"
FT                   /translation="MNIKPRLFLRLCLILVLLASVAICMQSPPVKADQPEARLIINEVM
FT                   SNPITDWNHDGVVNRGDQWVELYRDGGSYVDLDGWIIDDGPGGSLPYRFDSFSTEWRYI
FT                   VVFSSQTLIDFGQAGDVVRIYKPDGSLSDELEVPEMQDDSSASRYPDGSDSIRVDLVPT
FT                   PLYPNGSRGVITPPTPTPDPTPTPESMTIDSARRSPAGKLVQIRGTVTAPPNSVGNKRM
FT                   YVQDYTGGVLVLTASSITGIATGQEVIVTGTMGTYYGEIALRPVDGGIKLTGQSYEVSP
FT                   MDIRARDIGPRFESRLVRLSGEVSASSKPDLMLVDGSTSIPARVHISSPSTVSWLSPQK
FT                   GDQLQVTGILSSVNGRYRLVPRFNSDISITRSADLPESKPINYLRTNIAFARTLSTDIP
FT                   VEVTGIVTTPPNLLGKGTMYVQDTSAGILVTGNLTRLHPGQQVTIRGRTSIYYSQHRIE
FT                   ADKIEPSQTYTQVMPRDISPVDVGPSTEGLLVRLSGAVSGSSWPSIYLNGGATRIYFAD
FT                   GTRIKNPKAEAGDYLTVVGIVSRWNDNYRVMPRFASDIILSKTIQNTQWLDTTLGALRS
FT                   LPMGTRVRFTAQVTAPPGSLGEERMYVGSGGLGIALHLTNDKYPKLIEGDVVQVQGVLD
FT                   TYHKERIVRLESGSDITRLSVGAPVQPVRVSTSKIGRDLEGALVTIAAPITARSWPSLY
FT                   MNDGSGEVVVKIDEGTGIPRFEGGKHDFAQITGIVSRWDDTWRLLPRKASDIQIVTIPK
FT                   GMPATGQGGSRS"
FT   sig_peptide     complement(555250..555348)
FT                   /locus_tag="Tter_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 33"
FT   gene            555561..556034
FT                   /locus_tag="Tter_0497"
FT   CDS_pept        555561..556034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41418"
FT                   /db_xref="UniProtKB/TrEMBL:D1CER2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41418.1"
FT                   /translation="MRFNIIDPVGTVSFVAPCHAMKVFTAACSQNPRSLQELLDYSESY
FT                   DPDLKRYVLHGLAVFDEHNTKENPEAIRNVLSSTAPEGTPPFRIIDNITREVSLMPVKA
FT                   GLVIFNLIAKRIIQVQNSYADIERKDRGRVRRNGKPTRMLFRYELPPDWQLVP"
FT   gene            complement(556036..557001)
FT                   /locus_tag="Tter_0498"
FT   CDS_pept        complement(556036..557001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0498"
FT                   /product="Prephenate dehydrogenase"
FT                   /note="PFAM: Prephenate dehydrogenase; KEGG: nma:NMA2045
FT                   putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41419"
FT                   /db_xref="GOA:D1CER3"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CER3"
FT                   /inference="protein motif:PFAM:PF02153"
FT                   /protein_id="ACZ41419.1"
FT                   /translation="MSRIAIVGLDLVGTSLGLALKDWLAKQKTDSSTIPLQIAGFDYDP
FT                   DRQKRAEKLGAIDKSFWGLPSAIEDAAVIIVTGPLEEASRTIAEIIPLINWSTVITTTN
FT                   PRIADTLQIFNTYVHKEEQISFVAGHPMISLAREGSPSKELFRGMMYGVFPHSGAKAQD
FT                   IDLIVGIVHAIGAKAYFADPTEYDSQFAATSLLPAMLVAILARTVRSDSGWQDISRFSQ
FT                   TDLEQIAKFLGPFPEELATDAQNHAKDLKRWLERYHEQLGALIDSLDRDNQDTQSEIRQ
FT                   LLEQANQVRQEWGEKPGREATETTGLQDFIKRMFVGRRNR"
FT   gene            complement(557017..557577)
FT                   /locus_tag="Tter_0499"
FT   CDS_pept        complement(557017..557577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41420"
FT                   /db_xref="GOA:D1CER4"
FT                   /db_xref="UniProtKB/TrEMBL:D1CER4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41420.1"
FT                   /translation="MSFKKSALLLWPISALAWASIAYYIFSINIGAESDIFAVTRLLYY
FT                   GLLVIAPITAAIPICRLTDSRIFWFESLIYWAGLLYMFTFVPPDRYGLPGYLLFMVMFF
FT                   GACYTIFMPIGYAIGFRLFTLRAHKRDVNRARREAYLLALFLALSAAMNVAGLFNLINA
FT                   VLLLLILILIELFALAHKSGSEA"
FT   sig_peptide     complement(557518..557577)
FT                   /locus_tag="Tter_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.928 at
FT                   residue 20"
FT   gene            557790..559262
FT                   /locus_tag="Tter_0500"
FT   CDS_pept        557790..559262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0500"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="KEGG: bha:BH0020 inositol-5-monophosphate
FT                   dehydrogenase; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: IMP dehydrogenase/GMP reductase; CBS
FT                   domain containing protein; SMART: CBS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41421"
FT                   /db_xref="GOA:D1CER5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1CER5"
FT                   /inference="protein motif:TFAM:TIGR01302"
FT                   /protein_id="ACZ41421.1"
FT                   /translation="MLDDKFALEGYTFDDVLLVPAYSEVLPSEVSTSTCLTPRISLNIP
FT                   IVSAAMDTVTEARMAIALAREGGIGIIHRNLSIEEQVAEVDKVKRSEAGMIVEPVTLPP
FT                   YAQLSDAVAIMEKYHISGVPVVDEEGKLVGILTNRDIRFETDLTKPISSAMTSENLITA
FT                   PVGTTLEEAREILHRYKIEKLPVVDDEGRLKGLITVKDIQKKIQFPMATKDEKGRLRVG
FT                   AAVGVGPAGLERAEALIAAGVDVIVVDTAHGHTKAVIDIVREIKARWDVDVIAGNVGTP
FT                   EGAEDLVRAGADGVKVGIGPGAICTTRIVAGAGVPQLTAIYNCARAVAPYGATIIADGG
FT                   IQYSGDIAKAIAAGADTVMLGSLLAGVDESPGEVLIYQGERYKEYRGMGSIAAMKQRGY
FT                   SRDRYGQADIGNVSKLVPEGIEARVPYKGPLSNLVYQLVGGLRSAMGYCGARNIREMKE
FT                   NTKFMRITNAGLRESHPHDVVITREAPNYRLR"
FT   gene            559271..560119
FT                   /locus_tag="Tter_0501"
FT   CDS_pept        559271..560119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0501"
FT                   /product="parB-like partition protein"
FT                   /note="KEGG: glo:Glov_3176 ParB-like partition protein;
FT                   TIGRFAM: parB-like partition protein; PFAM: ParB domain
FT                   protein nuclease; SMART: ParB domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41422"
FT                   /db_xref="GOA:D1CER6"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:D1CER6"
FT                   /inference="protein motif:TFAM:TIGR00180"
FT                   /protein_id="ACZ41422.1"
FT                   /translation="MSRPKGGLGRGLDALIPQTSSTFDNLVHIDQIIANPYQPRGSMDE
FT                   GRLQSLVESIKQNGILQPLLVQRQGDHYQLIAGHRRLHAAKMAGVQQVPVVIREARASD
FT                   NMLLLALIENLQREDLNPIDEAKAYRELQRKFGFSTDEIAERVGKSRPAVANALRLLEL
FT                   APEVKEMLIQGQISEGHARALLGLRDPQSQINTARLVVERGLSVRQTEQLVKRLRDNSG
FT                   QRSSQAIDPEVTYLEERFRQALGTKVSLSRSRRGGKLVIHFYSEEELQSIYEVIVGDRS
FT                   R"
FT   gene            560433..562214
FT                   /locus_tag="Tter_0502"
FT   CDS_pept        560433..562214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0502"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase class-II; sugar isomerase (SIS); KEGG:
FT                   dps:DP2915 glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41423"
FT                   /db_xref="GOA:D1CER7"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D1CER7"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ACZ41423.1"
FT                   /translation="MCGIFGYVGKDRDVAGLVLDGLKRLEYRGYDSWGVAVVTDEGINL
FT                   TKQVGKIGDAQVNMPDSFLGFGHTRWATHGGVTDYNAHPHLDCTGRIAVIHNGIIENFS
FT                   ELRNKLLSQGHKLRSETDTEVVAHLLEEETKGLGSDPAGFADALRRVFMQLEGMNAVMA
FT                   LDSSSGVMVAAKNGSPLVLGYGEDGYYISSDASALLPHTRKVAFIADGQMLLITREGVS
FT                   ARDIQTGDPASLEVSQLEWSLEQAELGDYPHYLIKEIHEQPSILRSIAMTQGENATTLA
FT                   EMMRASYGTFFIGCGTAANAALTGQYLFSRIARFHVNFAVGSEFGYLEHFLTPQSLVIA
FT                   LSQSGETIDVIEPLIKAKKEKGVQVAALVNVLGSTLYRMADFSVLLGAGPEKCVLATKS
FT                   YTAKLAVLLMTAYALDGRLDEGKELVLRAADGVEELLRDGIRDKVEALAERIYDREHIF
FT                   LIGRGLSYSSALEAALKIKEVTYIHAEGFAGGELKHGVIALIEQGTPCIVFAPSDETQA
FT                   AILSGAQELKARGGFIIGISPKCSDVFDYWIPVADVGDASPIVNAVPAQLLAYCLSIKR
FT                   GTDPDKPRNLAKSVTVK"
FT   gene            562211..562939
FT                   /locus_tag="Tter_0503"
FT   CDS_pept        562211..562939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0503"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12;
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase;
FT                   putative RNA methylase; KEGG: bcy:Bcer98_1236
FT                   ubiquinone/menaquinone biosynthesis methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41424"
FT                   /db_xref="GOA:D1CER8"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1CER8"
FT                   /inference="protein motif:TFAM:TIGR01934"
FT                   /protein_id="ACZ41424.1"
FT                   /translation="MKTRYLPPPEQKAQYVREMFTSIAPVYDRLNSIISLGLHRLWRRT
FT                   AVRLSGLKPGDSALDVATGTGDFAITLAKAVGPTGRVVGIDFSEGMLRLAHEKIKRLGL
FT                   DGVIQFEWADALSLPFADGEFDAATVGFAGRNVTDLKGMFSEMRRVVRPGGRVVHLELS
FT                   RPTLPIFRDIYRIYFYHLVPVVGGALARSRSAYGYLPESLSVFPSPEEVARVMREAGLV
FT                   KVRYYPLALGTVTVHVGVVP"
FT   gene            562936..563637
FT                   /locus_tag="Tter_0504"
FT   CDS_pept        562936..563637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0504"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: ret:RHE_CH01980 putative hydrolase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41425"
FT                   /db_xref="GOA:D1CER9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D1CER9"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ACZ41425.1"
FT                   /translation="MSHAEDLRVVLFDALGTLIEITSPVDVFQRVMADMGYDLTREQIR
FT                   AAIRRAHQWWMSPTRVPGSTSEAERADRQKYAAMFLEDLGIDHDSSLVDEVAERGNWAR
FT                   WVSVYPDVIPALEALGRDYTLVVVTNGGPSMCDAINYAGLGRYFQEVFASWSVGYQKPD
FT                   PRAYNVPLARLRYRPSQACFIDDTPENVAGALDCGIRAVLLDRKGEHQGWTGERVSSLV
FT                   EFASLLAKREV"
FT   gene            563640..564167
FT                   /locus_tag="Tter_0505"
FT   CDS_pept        563640..564167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0505"
FT                   /product="glutaredoxin-like protein, YruB-family"
FT                   /note="KEGG: sfu:Sfum_3219 glutaredoxin-like protein, YruB-
FT                   family; TIGRFAM: glutaredoxin-like protein, YruB-family;
FT                   PFAM: glutaredoxin; PDZ/DHR/GLGF domain protein;
FT                   glutaredoxin 2; SMART: PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41426"
FT                   /db_xref="GOA:D1CES0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D1CES0"
FT                   /inference="protein motif:TFAM:TIGR02196"
FT                   /protein_id="ACZ41426.1"
FT                   /translation="MALPEVVIYTTPTCGFCRQAKDYLRQKNIPFVEKDVSVDRNAAYE
FT                   MIRISGQQGVPVIRVGNEIIIGFDRKRLDRVLQSAVEGKASLGVSVADSSRIALEHGVV
FT                   PIFGAYVGRVAAGSAAERAGLRPGDIITEVNARPIRNAEDLEKAIENLRKGSQVTLVWV
FT                   RGQDTLRSTVTL"
FT   gene            complement(564183..565067)
FT                   /locus_tag="Tter_0506"
FT   CDS_pept        complement(564183..565067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0506"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH1866 sugar transport
FT                   system (permease) (binding protein dependent transporter)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41427"
FT                   /db_xref="GOA:D1CES1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CES1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41427.1"
FT                   /translation="MTTKPQAARVRVAASPRKLSLSHIAERFLIYLLLSVLSFVFLVPF
FT                   FWLVSTSLKPRAQIFASNWIPDPIVWGNYAEVLRNTDFVLWTRNSLIVTFLAVVSVAFS
FT                   SALVAYPFAKMSFPLKGPLFALILATMMLPGAVTMVPTFLIWKKLNAVNTFYPLWAGNL
FT                   FGSAFYIFMLRQFFLTIPNDLKEAAIVDGASHLRIFWSVMLPLVKPAMLAVILFEFVAK
FT                   WNDYMTPLIYLNDPRKYTLPLGVATFMNSAGFETRWDLWMASSVLMTIPIIILFFMGQR
FT                   FFIEGIATTGLKG"
FT   gene            complement(565064..565993)
FT                   /locus_tag="Tter_0507"
FT   CDS_pept        complement(565064..565993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0507"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH1865 sugar transport
FT                   system (permease) (binding protein dependent transporter)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41428"
FT                   /db_xref="GOA:D1CES2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CES2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41428.1"
FT                   /translation="MRSVQAQRRYKKEEAITALLFISPWIIGFLVFTAGPMLASIYFSL
FT                   TEYNVLQPPEWVGLANYKEILTNDPLFWKSLYNTVYYTALYVPLHLAVALGLALLLNLN
FT                   VRGVPFWRTFFYLPSITPVVAVAILWRWILNPNSGILNRFLASVGLPTPGWTTDPNWMK
FT                   PALVLMSLWGAGGAMLIYLAGLKNIPRELYEAAQIDGAGRWARFLHITLPMISGVMFFN
FT                   LVISIIASLQTFAQPVLLFNTSEGGGSTTNDAVLLYIVYLFRQAFRYFHMGYASALAWI
FT                   IFVIIVIFTIIQFRLSQRWVYYEGGEQK"
FT   gene            complement(566034..567578)
FT                   /locus_tag="Tter_0508"
FT   CDS_pept        complement(566034..567578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0508"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bcz:BCZK1634 sugar ABC transporter, sugar- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41429"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D1CES3"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACZ41429.1"
FT                   /translation="MNGHHNREQDQHKLSRRKVLQLGSKLAILTIGGPILASCGGGGGG
FT                   GTPTAGMTSPSPSPASPSPAAPGVTPEATPAASMAPSASPTPASTAATGATGWQVRFKE
FT                   QATITAWGFNTDNTTARVRVNLFKQTYPNIQLRLVPEITDQKILTAVASGQVPDLFWIG
FT                   RNSVISWAARGALEPLNDLIENDDRFNMDNFYESAVKEVTWDDQIWAIPQFMDVRALWI
FT                   NHKPLQEVGIKPDDVDPKNWNQLQQYGVKLTKKQGNRLTRWGFDHKVQDGYMWMWSWAN
FT                   NSNLLSEDGRTATFATPENIEALRYAAETIQKQGGWKAFDAFRQTWQWDAQHPVIQNQV
FT                   ALTLYESWLLGMIAEFAPDHPFNVIPFTDKSGKIVTAVGGLAWAIPKGAKNKEAAWEFI
FT                   SFMSDAQVWLRGAKAQANEEKGKYVPSLTANKEADKLLREQVYSPINDAIDSAVALFPR
FT                   LLNNSQAPPPSPVNAEINDILNNDAVLPALRGEKSPEDALKAAQEKAQAAIDKFFK"
FT   gene            567707..568231
FT                   /locus_tag="Tter_0509"
FT   CDS_pept        567707..568231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0509"
FT                   /product="ATP/cobalamin adenosyltransferase"
FT                   /note="TIGRFAM: ATP/cobalamin adenosyltransferase; PFAM:
FT                   cobalamin adenosyltransferase; KEGG: pla:Plav_1609
FT                   ATP--cobalamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41430"
FT                   /db_xref="GOA:D1CES4"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:D1CES4"
FT                   /inference="protein motif:TFAM:TIGR00636"
FT                   /protein_id="ACZ41430.1"
FT                   /translation="MPVVSTRRGDDGFTNLWGSQRVPKYHDRPESYGTLDEANSFLGLA
FT                   RAMSNHQRVKTAIYEIQQDLYVMMAELATPDEDYEKSRYKITAEHVEKLDKLLEELKSQ
FT                   VELPRAFITPGDTMAGAALDVARTVIRRAERIIARLFHLEEISNQQVLRYLNRLSDVVW
FT                   VLGRYEEYQNR"
FT   gene            568360..568436
FT                   /locus_tag="Tter_R0009"
FT                   /note="tRNA-Arg1"
FT   tRNA            568360..568436
FT                   /locus_tag="Tter_R0009"
FT                   /product="tRNA-Arg"
FT   gene            complement(568793..569008)
FT                   /locus_tag="Tter_0510"
FT   CDS_pept        complement(568793..569008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41431"
FT                   /db_xref="UniProtKB/TrEMBL:D1CES5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41431.1"
FT                   /translation="MWPSDGRKQMMRKADALIEEARQKLGNGPEFIGWALDLQLRLRQA
FT                   AGKAYAETVLSDAHEETNHLPSNREM"
FT   gene            complement(569318..569662)
FT                   /pseudo
FT                   /locus_tag="Tter_0511"
FT   gene            complement(569745..570677)
FT                   /locus_tag="Tter_0512"
FT   CDS_pept        complement(569745..570677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0512"
FT                   /product="sodium/calcium exchanger membrane region"
FT                   /note="PFAM: sodium/calcium exchanger membrane region;
FT                   KEGG: psa:PST_1009 Ca2+/Na+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41432"
FT                   /db_xref="GOA:D1CES6"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:D1CES6"
FT                   /inference="protein motif:PFAM:PF01699"
FT                   /protein_id="ACZ41432.1"
FT                   /translation="MELLLAVLAVIAGMVLLEAGADKLTDAVQSLATRLRSSEAVVGLL
FT                   TVGGEWEELVVVVVAALTGHIEIGIGNIIGSCIANLAGSLPLGMLWSRKLIPDRAAKIY
FT                   SVVMLIATALATGVLWKGMNTGEGWLLVAAFVVYWSSLPLVIARGWLPSSAAEEESEEG
FT                   NSLVMLAIILASLLVLALGAELVVRGSAEIARRLGVSEYAIGATIVAIGTTLPDKAISL
FT                   VGGMKGSSGVVLANATGSNIFVLTLLLGLSAILGGAGGSSIGIDMWLLLGVSIAVTVMI
FT                   LRERLGRVEGALLLLFYAAYIAYALWRGA"
FT   sig_peptide     complement(570618..570677)
FT                   /locus_tag="Tter_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.801) with cleavage site probability 0.395 at
FT                   residue 20"
FT   gene            570849..571358
FT                   /locus_tag="Tter_0513"
FT   CDS_pept        570849..571358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0513"
FT                   /product="protein of unknown function DUF461"
FT                   /note="PFAM: protein of unknown function DUF461; KEGG:
FT                   bbt:BBta_4537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41433"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:D1CES7"
FT                   /inference="protein motif:PFAM:PF04314"
FT                   /protein_id="ACZ41433.1"
FT                   /translation="MQEMHPYESKHWLAKHIKRFAVLGTCLMPLLLLLAGCTTMAQGGP
FT                   PLTPASEDISVSGAWVRVVPGGTGSAYMTITNNGGAEDALIGVSTDIASSAMIHRTEVK
FT                   GGVASMTMVDRLPIPAHGKVELSPGGYHIMLEGLRQQLSPGDEVVLRLRFERAGEVMVR
FT                   AEVRRQ"
FT   sig_peptide     570849..570974
FT                   /locus_tag="Tter_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.688 at
FT                   residue 42"
FT   gene            571473..572132
FT                   /locus_tag="Tter_0514"
FT   CDS_pept        571473..572132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0514"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC; alkyl
FT                   hydroperoxide reductase/ Thiol specific antioxidant/ Mal
FT                   allergen; KEGG: tbd:Tbd_0337 putative SCO1/SenC family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41434"
FT                   /db_xref="GOA:D1CES8"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1CES8"
FT                   /inference="protein motif:PFAM:PF02630"
FT                   /protein_id="ACZ41434.1"
FT                   /translation="MRVPRIMWAGIAIVALMWAGLIALLVAQRMQGSTGPTDSQLADIR
FT                   AGTIGPNGEGTRIDPPAPLKNFTLPSSNGGELSLHDLRGKYVLLFFGYTHCPDLCPTTL
FT                   AQFRQIKQQLGSKAKDVSFVFVSVDPDRDTPAVLRRYVRSFDPSFIGLSGDHKVLDAIK
FT                   SDYGLYYQLNKDEGANYTVNHSSSIYLIDPDGRLIMVYSYGTNTEVITRDLERMLS"
FT   sig_peptide     571473..571556
FT                   /locus_tag="Tter_0514"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.836) with cleavage site probability 0.511 at
FT                   residue 28"
FT   gene            572107..572637
FT                   /locus_tag="Tter_0515"
FT   CDS_pept        572107..572637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0515"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: gur:Gura_0414
FT                   cytochrome c oxidase subunit II, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41435"
FT                   /db_xref="GOA:D1CES9"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D1CES9"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ACZ41435.1"
FT                   /translation="MTWNACSAKVARIVSVGVLSLLLAACGGGGGVATLAPSPSPTPQA
FT                   SAGQASPTPVPTASVSSPTPVASSGQASPTPASSAALIAEGEKLARSAGCLSCHTTNGR
FT                   PLTGPTWKGLYGKTVELTNGQKVKADDNYIRQSILEPQSQVVKGYNPIMPSYQGRLSDD
FT                   QIKAIIAYIKSLK"
FT   sig_peptide     572107..572214
FT                   /locus_tag="Tter_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.890) with cleavage site probability 0.370 at
FT                   residue 36"
FT   gene            complement(572621..573883)
FT                   /locus_tag="Tter_0516"
FT   CDS_pept        complement(572621..573883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0516"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sus:Acid_2815 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41436"
FT                   /db_xref="GOA:D1CET0"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1CET0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACZ41436.1"
FT                   /translation="MAVSGNTVVGSIWRNRDFLLLWIGQSVSMLGSRVSQFAFPLLVLA
FT                   VTGSPARAGLVSALGTLPYLLVTLPAGALVDRWDRRRIMLLCDLGRAVALGSIPLAFTI
FT                   GSLSWQHLAVVAMIDGTLSTFFSLAHSSALPHVVDRRQLSQALSAASTTDQASQMVGPL
FT                   IGGLLYTLGRGLPFLVDAVSYVVSGAMLMGVRRHLQGHAHAPSGKKIWHDVRDGIHWLW
FT                   KEPMLRFLLGVVGTIDLCSYGYTLIMVVLAQELGATPFQMGVLFATGGVGGILGALVTP
FT                   WLHARLRFGTMLLGVIWVWVLTWPPYAFAPNLWVLGVVNIVGWVLVPMLYVTEGSYRMT
FT                   VVPDAFRGRVNSVWRMLTIGLQPVSVAITGWMLGALGPTWTILLSTIPQAVAAIAALLY
FT                   KPLREAPKLAEIARDTATSGS"
FT   gene            574350..577754
FT                   /locus_tag="Tter_0517"
FT   CDS_pept        574350..577754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_0642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41437"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:D1CET1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41437.1"
FT                   /translation="MMRDKCLSCRRVLRGVYHHSHLKRVHLLWLPALLLAVLLVFGVRS
FT                   SASAAGDSQSQAAATAQRLISKISDRVGGASVGTPQLVYNPDGRTPAYYVVPIVRSGDV
FT                   VGLIGVSPDGGKWQWYTTNYAPTGFPQTSRSRAASMLGTSAASLKLVAGRDNRLYWQSP
FT                   DGRALDVDRPSRQGTSVTLQAQGAGATYDARPGKYSELEVQKAKRRATLSPQSTEADTG
FT                   SGTLPTRYNLDVPHYYQENNYYCGPASLEMIFDLYGPDISQYDIADAMPAKDWGSWSGA
FT                   FSDDLVRAARFSYISKAVLDPNLQGYKQRRLGYAAIQYFWSYYGTSDPDYPNRYRDLKR
FT                   LIVAGYPVVVLTWYDSRHITGHFRVVKGYDDSTDEFIVHDPWYTAPYYGPDVHFNQEFF
FT                   VDNLWTKFKRWAALITPWQVSVSAPRTVQGGSTFKVTATITYPAITPLTGWAQVSNSVA
FT                   TILLPSGFTTDDATQGLPQVTYSGTSQTVTWTVTAPEDFEGQANIRVTAKGLISSSSTS
FT                   YPSYSDWIGGMGGDTIYVNQPPASVSVSPSSLRSGPNQYQTIQATYSDPGGAGTISRAM
FT                   IRVSDPDNPSNDLLAAYDTATGKIYLLSPDGSSTLSTASAGSSYTLQSSYGSVDPSKTT
FT                   VSTSGNQMVITWAVSRPTSASGSTNVVYLQAKDKYGASSGWQKEGSWVLNSPATADAVA
FT                   DSGAVVSPGRTVQIRATYSDPDGASNIRTAQLLINTQLTGSGSVWVRYDTAQNAMYIRS
FT                   GDNTYWAGPVTPGSSQSQSNGRATLLGASSAVSRSGNTLYITWGLNFDQSFSGRQYSIY
FT                   SVAADNYTPDSALPWLKFGTYTVDAPPAVGNVTPGSGISSPGRKVYYTASYSDPDGASN
FT                   IADARLLIGTSTSDTRAVQLRYDANGNKLYLKDDNSSAWLGGVSPGSSSSVSNGLATLF
FT                   PNLTTISRSGNTLTIKWAISYGTALSGRQYNTYLMVRDDFARAQSWQREGTWIVDRSPY
FT                   VGTTSPRNSGTSNRSWVAFKTTWYDPDGASNIRRVTFYINSSPSGYKGLMAKYEANSNK
FT                   LWLKSADNSTWLGGVAPGAPDRIRNGYVSIDPPRIKVSSSGTQMTITWYVFFTRQIAGR
FT                   NMNIYMSIVDDFGRAQSPVKIGTWYVR"
FT   sig_peptide     574350..574499
FT                   /locus_tag="Tter_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.862 at
FT                   residue 50"
FT   gene            577759..578133
FT                   /locus_tag="Tter_0518"
FT   CDS_pept        577759..578133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41438"
FT                   /db_xref="UniProtKB/TrEMBL:D1CET2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41438.1"
FT                   /translation="MPGTAWASAEFALPRQATHHWVKLFMESMESGLPEPLEECPLPPA
FT                   PLPPLRGTAPGGVPLMEGTPHTTPLWIFHHAVVRESLCYGEGISPDLSLGAPQGWVYGV
FT                   FMEQTLHTAPSVGSPRDWVC"
FT   gene            579071..579613
FT                   /locus_tag="Tter_0519"
FT   CDS_pept        579071..579613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41439"
FT                   /db_xref="UniProtKB/TrEMBL:D1CET3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41439.1"
FT                   /translation="MADGEFGKRECRVGDWEGIAWMHSSPGKALGGVERQDPGDDRRDG
FT                   LEVVMPGRSTSPQGGDSAGQGQTSHDLFPISRSLNNREIGNKGCGALPGDGCRGAMRVM
FT                   RRRRLIEATEDWGTDLEGLDTGSLRTCEGGGGGMWCVVNPLPGMRVPCIWRVGGGVRWS
FT                   AGYTSRAALPGLQRVHL"
FT   gene            580101..580250
FT                   /pseudo
FT                   /locus_tag="Tter_0520"
FT   gene            complement(580253..581041)
FT                   /locus_tag="Tter_0521"
FT   CDS_pept        complement(580253..581041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41440"
FT                   /db_xref="UniProtKB/TrEMBL:D1CET4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41440.1"
FT                   /translation="MHGPPASQATRPGVPAAIWDTWRVVIIYYICPTFAIGHCCLHAST
FT                   RAGQEDPQPGGLPSQCCLQASTTPGYTLLRRCKHTGPQGPPGSMVRLAGLSSHRGRSLQ
FT                   ALSDRGETGPLVSPIRHAPYPTSLQASPKHRTSTWDRSTLASSRACLGGQGAQEDPHEP
FT                   QGIHLPGSSLRPGAGEESGTHPSLLPPIAGHLHPQRPHVSPQGALEEHHQATRARGHAP
FT                   PLLDAQGALATISGVQASTSGTRTRGTLEPLPRTCPPGVM"
FT   gene            complement(581446..581622)
FT                   /locus_tag="Tter_0522"
FT   CDS_pept        complement(581446..581622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41441"
FT                   /db_xref="UniProtKB/TrEMBL:D1CD24"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41441.1"
FT                   /translation="MRGPEDPAGAIRAVGGAGQMPGSGHSRGQLGPGRDDGLEGGVEAS
FT                   GWQAELAGHESCY"
FT   gene            complement(581850..582086)
FT                   /locus_tag="Tter_0523"
FT   CDS_pept        complement(581850..582086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41442"
FT                   /db_xref="UniProtKB/TrEMBL:D1CD25"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41442.1"
FT                   /translation="MKGVMDWRGRARRIVSWGCRAGEGYAGATSSGDVGELGGAGASGQ
FT                   LPGQGTLEGKGEGIGAGRVCLPLAHLLRGCLCM"
FT   gene            complement(582140..582328)
FT                   /locus_tag="Tter_0524"
FT   CDS_pept        complement(582140..582328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41443"
FT                   /db_xref="UniProtKB/TrEMBL:D1CET7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41443.1"
FT                   /translation="MGLCGSAAGSFECKAMAGTRDYRGRVRSGSPLPMEWRQDLPTPHT
FT                   WVLETSPWCKPAGSTYD"
FT   gene            582491..582772
FT                   /locus_tag="Tter_0525"
FT   CDS_pept        582491..582772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41444"
FT                   /db_xref="UniProtKB/TrEMBL:D1CET8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41444.1"
FT                   /translation="MTLRSGIRLWRCFLRSNPREWVEARGTSGPARLQSIVGQAASSGP
FT                   DTSLPGHTQALIYLLLITPQRRVTSSPQAPCTPLTTDPFEAIPDFPIT"
FT   gene            582990..583391
FT                   /pseudo
FT                   /locus_tag="Tter_0526"
FT   gene            complement(583404..583964)
FT                   /locus_tag="Tter_0527"
FT   CDS_pept        complement(583404..583964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41445"
FT                   /db_xref="UniProtKB/TrEMBL:D1CET9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41445.1"
FT                   /translation="MQGHKPLFPISRFLSNREFGNFSPSPWRSAPAPPPPSGGLPQAGC
FT                   LSWRVVSPPHSPVDLPPRSGEGVFVLWRGDLSRPLPWGTPGLGVWGIHGADSPHRSLCW
FT                   ITQGLGVLGIHERGLSTPLLCGSPRAGCVRDSWRGGGRESPPLLSMASPPPTKLHHSAI
FT                   QGGRGEHMSALRCPALSQGPPLP"
FT   repeat_region   584274..585218
FT                   /rpt_unit_range=584274..584303
FT                   /note="CRISPRs"
FT   gene            585449..586912
FT                   /locus_tag="Tter_0528"
FT   CDS_pept        585449..586912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0528"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: bcs:BCAN_B1216 arylsulfatase
FT                   D precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41446"
FT                   /db_xref="GOA:D1CEU0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEU0"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACZ41446.1"
FT                   /translation="MRVLYVDIDSLRPDHLGCYGYHRNTSPNIDSLAREAVVFQNCYIS
FT                   DAPCLPSRTALWSGRSGFHTGVVNHGGVASEPFREGPNRGHRDLFDRTGWMALLRSLGM
FT                   RTVTVSSFGERHSAWHWYAGFTEIYNPGKRGMDVADEVTPVAVDWLQRNAQSDNWFLHI
FT                   NYWDPHTPYRTPVEFENPFEGEPLPSWLTEEVRQRCWEGYGPHSAQEPSGWGQEDFHLR
FT                   YPRVPAQIDSMEAVRMWIDGYDVGVRYADEHVGRLLSVLDELRVLDETVVIIGADHGEN
FT                   LGELNVWGDHQTADQFTCRVPLIVRWPGLTSSPRVDRALHYQYDWAATLLELLGGQVPD
FT                   NWDGTSFAEAFRSGTEAGRPYLVISQNTWSCQRSVRFDNYICLRTYHDGYKQLQPLMLF
FT                   DLSRDPHEEHDLSGEMPQIVDRAMGMLEQWYSDMAATSLHDVDPMMTVLREGGPYYTRG
FT                   ELPAYIERLRATGRPHHAQALAARHRAEL"
FT   gene            complement(586956..589022)
FT                   /locus_tag="Tter_0529"
FT   CDS_pept        complement(586956..589022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0529"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_02389 dolichyl-phosphate-mannose--
FT                   protein mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41447"
FT                   /db_xref="GOA:D1CEU1"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEU1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41447.1"
FT                   /translation="MPNTSLKKLAYRALPLAIILGASILPLYWFSKYMIIRPDSAWYLL
FT                   QGFNLLSGRGYTVFDQLPMPLRGPVLPFVVGTLSMLLGNDPMQVAWGMKLLSLANPLII
FT                   FLITSRLSGYWAGCLAALLWSFLGISGHLEHAFTVDSLLLTFVLLQLAIILSDVESPRA
FT                   WKPIVSGLLLALAVLTKETAMVLLPVGIIYCLLMCRGFRWLVLHYAAAAIACAPWWVWV
FT                   WLKVREIYLFSSTQETLLRFRLQEWIVYIPLLLVACILVAVVLSRRGLRLKATWYDLSG
FT                   YRLAGYRQGAAGVVNGCWVLAVSWMLLRGAEGEVYNTSTWSYIWDVLRPEFHLWILVPL
FT                   AYVFALRQSFAKKPSWVVYTHYMFLWTPLALLLMVIKLAPRQWLVYQALVYIAIAAVIF
FT                   TLARRAITLLRDNNQFVGKVAGALSLAMLVALLTLTGTSQVRALTSPPEGYNIWETNVQ
FT                   AEMALYRWLSNNVPEGESLVIATHDRKASHQLNLTAFLTARDYRWVPLQIRRVKIGKLL
FT                   NRSYSRLTTPVWLDSQYYCSFRYLSVAAVLRQMSAADAEYIVVPLRANSYPGNNALVRS
FT                   MLRTGLFDLSYYRTVTLYSPEEHKDIQLTHVVLRRNGLKLGKATEVPTILDSSTLERLG
FT                   ECAAESAGDNSELAIVLALPNGMTLQQFTPEGKAEYQEIWRWAYSSTTPQPGR"
FT   gene            589102..589755
FT                   /locus_tag="Tter_0530"
FT   CDS_pept        589102..589755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0530"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Sigma-70 region 4
FT                   type 2; SMART: regulatory protein LuxR; KEGG: hch:HCH_02655
FT                   ATP-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41448"
FT                   /db_xref="GOA:D1CEU2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEU2"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACZ41448.1"
FT                   /translation="MTSNGIRTLDLALLITYILLTGLVAVTLAPLSSFWWIFPLCATAL
FT                   LLAILLGARGRSTGKDPVTMARIVRILHQSSTITPAQLASSTGMSLKDSRSVLESLVGE
FT                   GVLARSETDSDLYLRAYYPAAETLENRVKPQYLPEAPPAAGQTQNQDLLEPLSERELEI
FT                   LSLMASGHTNSEIARELYVAVGTVKSHVNNIYRKLGAKNRVEALSRARELGLIR"
FT   sig_peptide     589102..589236
FT                   /locus_tag="Tter_0530"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.663) with cleavage site probability 0.343 at
FT                   residue 45"
FT   gene            589922..590296
FT                   /locus_tag="Tter_0531"
FT   CDS_pept        589922..590296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0531"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_0988 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41449"
FT                   /db_xref="GOA:D1CEU3"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEU3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41449.1"
FT                   /translation="MSRVSAVLYSILISLFTLFVLLQVFFAGLAVFYTPVYWTWHITLV
FT                   HVFEWIPLFLIVFSLLGRMSAWARLSSIGLFLLLIVQYATANIREVPFISALHPVNALM
FT                   IFLIAILATYSSWREVLGGD"
FT   sig_peptide     589922..589990
FT                   /locus_tag="Tter_0531"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.602) with cleavage site probability 0.393 at
FT                   residue 23"
FT   gene            590296..591906
FT                   /locus_tag="Tter_0532"
FT   CDS_pept        590296..591906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0532"
FT                   /product="Bilirubin oxidase"
FT                   /EC_number="1.3.3.5"
FT                   /note="PFAM: multicopper oxidase type 2; multicopper
FT                   oxidase type 3; KEGG: bsu:BSU06300 spore coat protein
FT                   (outer)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41450"
FT                   /db_xref="GOA:D1CEU4"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEU4"
FT                   /inference="protein motif:PRIAM:1.3.3.5"
FT                   /protein_id="ACZ41450.1"
FT                   /translation="MSGARLSRRRFMKMGAIGAGGLLLACCGTCCGVARLADRFFDVGL
FT                   TGTRLQSRIPLPREFENPLPIPPVLRPVRRDSDTDYYRVVQMPASVEILPGSRTEIWGY
FT                   NGMFPGPTIRATSGRKVVVTHQNRLPIPTVVHLHGGKTPPEHDGYPTDLVLPSGQSHIH
FT                   QLEGHSLRVIGHGEYSYEYPNQQPAATLWYHDHRMDFTGPQVYRGLAGFYLLTDDQERS
FT                   LPLPSEDRDIPLMICDRSFDEDGSLMYPSVDPSLMGQPGVVNEYMDGVLGDVILVNGVP
FT                   WPYMNVSRVRYRFRVLNASNARRYRLVLDPPPPEGYSFTQIGSDVGLLESPVRLHKLEI
FT                   APAERYDLIVDFSAYQSGDVITLRNELGNGKTALVMQFRVSGKADEYSQIPSRLSEIER
FT                   LAASDALVRRRFVFARGVARNSSHTSVAPVAMWTINGQPFDPMRIDADVELGATEIWRI
FT                   TTNVHHPVHLHLAHFQVLSRNGGPPGPYDAGWKDTVDMGQGDTVEILARFDGYKGKYVF
FT                   HCHNLEHEDMAMMGNIRVS"
FT   sig_peptide     590296..590406
FT                   /locus_tag="Tter_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.456 at
FT                   residue 37"
FT   gene            complement(591949..592161)
FT                   /locus_tag="Tter_0533"
FT   CDS_pept        complement(591949..592161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41451"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEU5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41451.1"
FT                   /translation="MQKRIVMYSNRNEMDRGINRLTVEGWMVQSITALESRSYRVEFVR
FT                   SSYEEENLQVNAQTIAPSEPLSSFS"
FT   gene            592418..593605
FT                   /locus_tag="Tter_0534"
FT   CDS_pept        592418..593605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0534"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: aba:Acid345_3298 peptidase S1C, Do; PFAM:
FT                   peptidase S1 and S6 chymotrypsin/Hap; Peptidase S7
FT                   flavivirus helicase (NS3); PDZ/DHR/GLGF domain protein;
FT                   SMART: PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41452"
FT                   /db_xref="GOA:D1CEU6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEU6"
FT                   /inference="protein motif:PRIAM:1.3.1.74"
FT                   /protein_id="ACZ41452.1"
FT                   /translation="MKGSIRRLLLVLVMLPLLAACQFAPATTGSTTVTPTATSVASTNT
FT                   SSSSNGSTGNQLYSLTSATLNVPQLVQEVKDGVVEIIAQQTSDGSYIRGISQGYATGSG
FT                   FIIDTQGHILTNNHVIEGADKITVVLPDNRILSARLVGADPTTDLAVLKVEASNLKPLR
FT                   LGDSSKLQVGEPVVAIGNALGLPGGPTVTTGVVSALNRSEEEPISEQPGYYPGITQTGN
FT                   SLFGLIQTDAAVNPGNSGGPLLNMQGEVVGINTLGQRSTESGVTVEGINFAIPINTAKR
FT                   VADEIIRTGKVVYPYIGIRTQFLYPEVSVIENLPHVLGQYVASVEPGTPAEKAGLRRGD
FT                   IIIAIDGQRITNESMFVELLREHKPGDKITLTIRRDGRTITKEVTLTERPSSLSG"
FT   sig_peptide     592418..592504
FT                   /locus_tag="Tter_0534"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.472 at
FT                   residue 29"
FT   gene            593691..594362
FT                   /locus_tag="Tter_0535"
FT   CDS_pept        593691..594362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0535"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: sus:Acid_1354 YceI
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41453"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEU7"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ACZ41453.1"
FT                   /translation="MKRLVALLSVVMLLIAAVAYSYLKPTAAPSGPITADPVSTPSGDT
FT                   DARVFTISQDGSQARFIIDEVLNGSPKTVVGTTNQVAGQISIDPNDVSSTRVGTIRINA
FT                   RTFQTDSSQRDRAIQNRILETSSYEFITFTPREITGLPGDPAIGRTYNLKVTGDLKIKD
FT                   VSREVTFDVTVKPESQSRLTGKATATIKYADWGISIPQVPFVANVSDEVRLELDFLAVS
FT                   S"
FT   sig_peptide     593691..593756
FT                   /locus_tag="Tter_0535"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.694 at
FT                   residue 22"
FT   gene            complement(594422..596848)
FT                   /locus_tag="Tter_0536"
FT   CDS_pept        complement(594422..596848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0536"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="KEGG: afw:Anae109_2098 ATP-dependent protease La;
FT                   TIGRFAM: ATP-dependent protease La; PFAM: peptidase S16 lon
FT                   domain protein; AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   peptidase S16 lon domain protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41454"
FT                   /db_xref="GOA:D1CEU8"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEU8"
FT                   /inference="protein motif:TFAM:TIGR00763"
FT                   /protein_id="ACZ41454.1"
FT                   /translation="MNNQEQPEANIPSLLPVLPLRDSVIYPFAVLPIVVGQERSIRLVD
FT                   DSMRSRRLIVLVAQRSRNVEQAGPDDIYRIGTVATIHHLVRAPDGTLRIVVQGVQRVRI
FT                   LDFISTQPYLVARIDPAPDQTENNVEEEALRRVAVDLFRRMVEISPDLPNEILPTLDSI
FT                   QDPIQTFYFIAGAIQLDVDTRQELLELEPLEVKLRRLVEILQKELSIREISQRIQSETQ
FT                   ERLTQAQREAYLREQLRTIQSQLGEGPEQSEVNELRRRIEEAGLPEEARKEAERELNRL
FT                   STIPMASPEYAIIRTYLEWLADLPWNKLSGGTIDTQRAREILDEDHYDLEKVKDRIIEH
FT                   LAVRKLREQRVSNLSGQEGTGEQNTIPSGSGDTLREPILCFVGPPGVGKTSLGQSIARA
FT                   LGRKFIRMSLGGIRDEAEIRGHRRTYIGAMPGRIIQGMRRVGTKDPVFMLDEIDKITVG
FT                   FQGDPAAALLEVLDPAQNHSFVDNYLGVPFDLSQVLFIATANTLDTIPAPLLDRMEVIQ
FT                   ISGYTEQEKLFIAQRYLIPKQMRAHGIQDSELRFTEESIRKIIREYTQEAGVRNLDRQI
FT                   ATICRKVARAIADGAAQSIEITPDNLQEYLGHPRHFHSTAERITRPGVATGLAWTPTGG
FT                   EILFIEATMMPDPHPRVILTGMLGEVMRESAQIALSYVRSEADPLGVNPDAFTGKTVHI
FT                   HVPAGAIPKDGPSAGLAIVAALASLGSSRLVRSDVAMTGEITLRGKVLPVGGIKEKVLA
FT                   AHRAGIKTVILPKENEQDLEDIPQELRDQMRFVLVDNIEDAMQVALTELPVLEET"
FT   gene            complement(596866..597288)
FT                   /locus_tag="Tter_0537"
FT   CDS_pept        complement(596866..597288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0537"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: sal:Sala_0391
FT                   heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41455"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEU9"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACZ41455.1"
FT                   /translation="MRYRYLRYQYTISAPFDDLNVMSGLLGIRQPMFRLGSTVWRPMTD
FT                   ICETPRHINIIVELAGIKAEDIDVTLYENALVVEGERSINICGEDGVYRHAEIRHGPFR
FT                   LEIAIATSIDPEGVEANYDNGILRITLPKVAENNRS"
FT   gene            complement(597317..598063)
FT                   /locus_tag="Tter_0538"
FT   CDS_pept        complement(597317..598063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0538"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; KEGG:
FT                   aba:Acid345_0600 sigma-24, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41456"
FT                   /db_xref="GOA:D1CEV0"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEV0"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACZ41456.1"
FT                   /translation="MTARVEASIREPEDFPREAIKYLRPLVNYARRRIRYYESTGELAP
FT                   GFVHPIEVVDQALVEALRRYRELPPDSPLYPWLRRFVRRVLNNLVREARQRRREISLEQ
FT                   PIGGNYDSDYLMERPIRLMDVLPDPTAPIPEEIIERREFQSALASIIGHLPESWREPFL
FT                   MHVVDGMSVEEIARIEGQKPEDIRYRIELARNYLKEMLTEEYEELEGSAPSEDIFSKVE
FT                   SMHLEDEQSRKIQQKLESATKDISKA"
FT   gene            complement(598176..598661)
FT                   /locus_tag="Tter_0539"
FT   CDS_pept        complement(598176..598661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0539"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   aba:Acid345_4766 heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41457"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEV1"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACZ41457.1"
FT                   /translation="MSIQRWDPFREMMSLRDAVNRLLEESFVSPSLLMGTRESSFPVDI
FT                   EETDDNFVLRASLPGYKPEEINVSITGDTLTISAEHKEEGERREGSYLVRERRLGKVTR
FT                   TFTLPTRISGDQASAKYENGELVLTLPKAEESKPRRIQITTGAQTSQPSIEPQSTTQ"
FT   gene            598787..599710
FT                   /locus_tag="Tter_0540"
FT   CDS_pept        598787..599710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0540"
FT                   /product="Ribonuclease Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   mxa:MXAN_0663 ribonuclease Z"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41458"
FT                   /db_xref="GOA:D1CEV2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEV2"
FT                   /inference="protein motif:PRIAM:3.1.26.11"
FT                   /protein_id="ACZ41458.1"
FT                   /translation="MLDVTLLGTSGTLPLPGRYLSSALIRIGGKLFLIDCGEGTQVALR
FT                   AKGWGIRRIDSILLTHSHADHVLGLPGLLLTLAFSQRGAEEPLRIFGPPSVLPVLESIR
FT                   VFAPRLPYPVYFIPLEVGDEVDVTDNLKLFAGPTEHDVPCLSYSLYVPRSPKFDVERAN
FT                   SLGVPRDLWGRLQRGESVFVGEREIQPQDVLGPPRKGLKLVFITDTRFTEDLVSFASKI
FT                   QPPDLLISEGMYGDESMRPKDWDVPHMTFAEAAKVASASGARLLWLTHYSPMMADPSRY
FT                   IENARRIFPNAIAAQDGTEISLSYED"
FT   gene            599796..600860
FT                   /locus_tag="Tter_0541"
FT   CDS_pept        599796..600860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0541"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: smd:Smed_5686 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41459"
FT                   /db_xref="GOA:D1CEV3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEV3"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACZ41459.1"
FT                   /translation="MTVRVGFIGTGGIATSHLLNLASIEDAEVVALCDIAPNRVEEARE
FT                   YVNRNILTRSEAEGVEPRLIEAATYTDYRQMIRNERLDAVYICLPPFAHGDPEHAALDA
FT                   NLHMLVEKPVALDLRVANDILRRINEQGVIATAGYQLRYMGFIDKAIELLRNTVIGQTI
FT                   VLRFTRTPGTSWYHRQDRSGGMMIEMATHQVDLLRFLVGEIRKVYAAAATRINNLDNPE
FT                   YDIFDVNSSTFTFDNGAVCSFAINFLTGPSGLPDLRGVHIFCKDYILSMDISLKVRRGD
FT                   DVEEFGLEHDPMLEEDKAFIEAVKTSNPAILRSDYLSAVRTLAVTIANDRSARSGMPVD
FT                   VNELLRAEAPQAAW"
FT   gene            600883..601635
FT                   /locus_tag="Tter_0542"
FT   CDS_pept        600883..601635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0542"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: csa:Csal_0292 4-hydroxyphenylpyruvate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41460"
FT                   /db_xref="GOA:D1CEV4"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEV4"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACZ41460.1"
FT                   /translation="MLIGARQDCVLGDTLEDRMRILKALGYDFVELALTRSEIAGLDAH
FT                   SADYYKNIVESTGLPILSTSMGHFGHFASLNDEERAEIVSHVDKLITFTHDIGADAILL
FT                   ATQEESLKVSEYLSIYRQHILPLADKALDLGVTLALEHVNWYKPWALAELVKGLNHPAV
FT                   GIYFDMGNCLYVGENPKEQAKICAPYTAHLHIKGGPVAPLAAMPLEEIKSILEAGGFHG
FT                   RGCLEIMTVEGNRHLSEAMGLLRMAGYK"
FT   gene            complement(601637..602398)
FT                   /locus_tag="Tter_0543"
FT   CDS_pept        complement(601637..602398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0543"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41461"
FT                   /db_xref="GOA:D1CEV5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039967"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEV5"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ACZ41461.1"
FT                   /translation="MPTRHNPTLQKLVGIVNSDEDLHAIWRCQNVNGVDRLGMSDHGPV
FT                   HVQIVANLALRLLRLLMAKNIQPSIVKDHGMSEHDAEVVVVLAALLHDCGMSIHRDDHE
FT                   FMSLFIALPKLQELLSNLYSAAERRVIISETLHAIITHRSDGRPLTLEAGIVRVADALD
FT                   MAQGRSRIPFESGHVNIHSVSAAAIEKVEINQGQEKAIRVTIYMSNAAGIFQIDELLRQ
FT                   KLKGSGLETHVEVVAQVTGESDKRLVETFKF"
FT   gene            complement(602523..603167)
FT                   /locus_tag="Tter_0544"
FT   CDS_pept        complement(602523..603167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41462"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEV6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41462.1"
FT                   /translation="MSRKIISWLVVPLLVILLAGGILVAAALRSSQVPTRPGGGPTSAH
FT                   SPLIGLLIPKTDRKFGYGMLVPARWQAVDLGDRRAYVPPDSQHKSDRLVLTATNYRVLA
FT                   DRNKNLRVMQLELFRQHPDPVGWTKAIEMSWRDTGMRFQKESGLANGVIYSVRPAEDQM
FT                   QLVAFLVDAGQPMNLTMEGYGTYSSRETLVREGLLEDFQTMAQSLHAVDTK"
FT   sig_peptide     complement(603090..603167)
FT                   /locus_tag="Tter_0544"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.659 at
FT                   residue 26"
FT   gene            complement(603182..603799)
FT                   /locus_tag="Tter_0545"
FT   CDS_pept        complement(603182..603799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41463"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEV7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41463.1"
FT                   /translation="MRRAATVVGIVGAIALWAGFLVVCNRLGPAGVEPTSYYEGDVYAV
FT                   STSQAGPLRLLLWRVSYQPQQPLGRAIALTYTVVYLCLTNTGSSPVILYETREGSKGEP
FT                   PPPPPYYLLDDQGHRYPAVGAGWSWRTGEPEERFIGKALPGRTVDFTLDFNPIPTHVRH
FT                   LVLVMEDVRTQTGQSYDLRVEVPLPGEHEGQEGSTLVGCPGF"
FT   gene            complement(603862..604896)
FT                   /locus_tag="Tter_0546"
FT   CDS_pept        complement(603862..604896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41464"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEV8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41464.1"
FT                   /translation="MRTWIHIVFAISLLALMFPQAVRAAVPAATSSVVGRFVQQTDSVF
FT                   GYQMFVPATWEEVNLGDARGYIPTNTGETDNQILLTVTNAHTLAGNGSSNMTVVGLELL
FT                   RQKTSLSAWTQFQEQFWEAQNIPYERVPGPPAAAIYSLSQWDQIQLVAYTVYQGKLLVA
FT                   SLYGSGIYGSKEQLVSEGLFTDFALMVGSLEAVEATASKAIAADELVSITSVDRTTGTK
FT                   YVGNYHCHGSICGYDESYKMITRWDPTRDMIERLYEEHWYRHSDLRYSWLYNTYVTNDT
FT                   YPCEAGTTLLFRAIGKHTSASQYKVSDDWYPYRIDTRLRTNTYHVMNFGDNAIRWCAVY
FT                   QPFY"
FT   sig_peptide     complement(604822..604896)
FT                   /locus_tag="Tter_0546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(604979..606412)
FT                   /locus_tag="Tter_0547"
FT   CDS_pept        complement(604979..606412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0547"
FT                   /product="WD-40 repeat protein"
FT                   /note="PFAM: WD-40 repeat protein; SMART: WD-40 repeat
FT                   protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41465"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR037783"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEV9"
FT                   /inference="protein motif:PFAM:PF00400"
FT                   /protein_id="ACZ41465.1"
FT                   /translation="MYWESAHSKQQLGRGNNAVAKFALLGSLLLVGLLLSACVFGRAPN
FT                   GSGDVIGNKSVRSSGTAGSPTPSARAIGQPPLTTNTPTQQVSPYAAPTSMTTEAILRKR
FT                   PIVLVGHNGPVTVLAWSPDAKILASSSGVVTRNETFDPTVRLWSAKGKLLTTLRGHTAP
FT                   VTSLEWSPDGQLLASGSRDGTVRLWDAHGKQIKSLRLDEEQVYSLAWSPDGQILAVGSI
FT                   QQEQAGSTGLIQFKGVVRLFGVDGRLLKMLITDGGGGKWLHVEWSSDGSTLAAGAWGFR
FT                   LWQRDGKLVGTIGRLGAPATVMIWSPDGSMLATGNEDGLVSLYDHRGRVAAQLPGNGPI
FT                   VSLAFSPDGGKLALMSGNYVRMFDLRDPHAEPRTLYRYLGPLAEWSASNIVWSPDGVWL
FT                   AGRTPDSVLRVWRANGRRVVTLPGCNNEASVLAWSPDGKVIAAGGSHGDTICLWIWPTM
FT                   SIAGPLWASGSQNQMGGHR"
FT   gene            complement(606428..606817)
FT                   /locus_tag="Tter_0548"
FT   CDS_pept        complement(606428..606817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41466"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41466.1"
FT                   /translation="MSTEKVVEKLSKQVDRRRFLGIASKAALGFLLLLSSRRIQTAEAY
FT                   HTNCTNYNTVRTKYCCHLGYRDDCTSTESSNCFTYGTSHPSWWLWTCCYGTALVECREC
FT                   CKYSCSKAVLTPSCGSCGGTANVNC"
FT   gene            complement(606870..607133)
FT                   /locus_tag="Tter_0549"
FT   CDS_pept        complement(606870..607133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41467"
FT                   /db_xref="GOA:D1CEW1"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41467.1"
FT                   /translation="MKGQQSRPFSPWGHPLVEESLFCVLTRVHGLGRALAVAWVPLLFD
FT                   HRVTLLENLQGLRAYRPCLHRWHGYGLLVLALGLTIRCMLLH"
FT   gene            complement(607230..607904)
FT                   /locus_tag="Tter_0550"
FT   CDS_pept        complement(607230..607904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0550"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: regulatory protein Crp; cyclic nucleotide-
FT                   binding; KEGG: bra:BRADO3198 CRP/FNR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41468"
FT                   /db_xref="GOA:D1CEW2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW2"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACZ41468.1"
FT                   /translation="MDKSILHQLYPFSGMPQDLLRTLVNMTSYRLYAQGQLIIDLQEGR
FT                   DRTLILVSGLARVYRISTQGKELTLAKFVTGDILGLAPNDPILQPSNLLEAIADGTGIC
FT                   RVPREHFQQIIISDPEIASYCFCQLSERLGKAYDLIEEVVFMDVCTRLARTLSRLAKAN
FT                   EQRLVTATHQELAGMIGTSQEEVTRKLRHLRELGLINYQPHHRGIVVPNPDRLLSELND
FT                   LT"
FT   gene            complement(608190..609083)
FT                   /locus_tag="Tter_0551"
FT   CDS_pept        complement(608190..609083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0551"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41469"
FT                   /db_xref="GOA:D1CEW3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039967"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW3"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ACZ41469.1"
FT                   /translation="MEEESNRATSIDRQESEGFDLPQEPGPEVSPSGTTPLQPSEIIRL
FT                   PTRHNPTLQKLVGIVNSDEDLHAIWRCQNVNGVDRLGMSDHGPVHVQIVANLALRLLRL
FT                   LMAKNIQPSIVKDHGMSEHDAEVVVVLAALLHDCGMSIHRDDHEFMSLFIALPKLQELL
FT                   SNLYSAAERRVIISETLHAIITHRSDGRPLTLEAGIVRVADALDMAQGRSRIPFESGHV
FT                   NIHSVSAAAIEKVEINQGQEKAIRVTIYMSNAAGIFQIDELLRQKLKGSGLETHVEVVA
FT                   QVTGESDKRLVETFKF"
FT   gene            609226..610269
FT                   /locus_tag="Tter_0552"
FT   CDS_pept        609226..610269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0552"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein;
FT                   regulatory protein DeoR; KEGG: helix-turn-helix type 11
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41470"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW4"
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /protein_id="ACZ41470.1"
FT                   /translation="MSRLVKLGRLQRIERILYQNPQGLTIQRLAELCDVSIRTIYRDIK
FT                   DLEQIFEVPLTRENGRWKVVRTSYLPPVRFSLHEAMGLFLSYRLALRYMDKQNPDLEEA
FT                   WSKIGSVMPEPISRFFPETLREIKNKPLDREYNRTVRTLTSAWAEGRRVRIQYLSSRRS
FT                   TPKERLIEPYFMQPSGISHALYVIARDVEIDEIRTFKVQRIKDIELTDEKYEIPGDFDA
FT                   LEFLKNSWTIWSDEPVEVKVRFSPRVASAVKEAIWHPTQELKEEPDGSVIWTGRVSGIL
FT                   EISAWIRSWGAEAEVLEPKSLRESLVNDVQSLAKLYGLGLTESASKQEGQCTVEIQDTK
FT                   NFAHETS"
FT   gene            610296..611714
FT                   /locus_tag="Tter_0553"
FT   CDS_pept        610296..611714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0553"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="KEGG: acp:A2cp1_0251 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41471"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW5"
FT                   /inference="similar to AA sequence:KEGG:A2cp1_0251"
FT                   /protein_id="ACZ41471.1"
FT                   /translation="MVGSGPNGLAAAITLARRGLRVLLLEASDHLGGAAASLQLTLPGF
FT                   THDLGAAVLPLAFTSPFFLEMPLRDLGVEWVYPDVPLAHPLGPREVLLLHESIQETAIQ
FT                   FGDDGARYSRLISPLVSEWPGLARDLLAPAIKIPRTLSYIRFGVHALLPFSVLADALFS
FT                   TSHARTLLAGVAAHWAMPLTRPLTSVPILLLCTLAHITRWPMARGGTGRLIEAMAAYFR
FT                   DLGGVVQLSAPVHSLSDIPPAKAVLFDLAPRQVVDILGDRLPSGYRRACARYRHGPGVL
FT                   KLDWALSAPIPWISEACRSAGTVHLGGTFEEIADTERSVWEGHVPSRPFVILNQPSVFD
FT                   PGRCPGGYHTAWAYCHVPVSITNKEVEYLANRIESAIEELAPGFRDTILARSVLAPTDL
FT                   EYLDSNLVAGDLTGGVLDLWQVLARPVLSHVPYKIPVSGMYICSSSTPPGPGVHGMCGY
FT                   WAARSALRYTFHME"
FT   gene            complement(611693..612904)
FT                   /locus_tag="Tter_0554"
FT   CDS_pept        complement(611693..612904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0554"
FT                   /product="galactokinase"
FT                   /note="TIGRFAM: galactokinase; PFAM: GHMP kinase; GHMP
FT                   kinase domain protein; KEGG: vvy:VV2637 galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41472"
FT                   /db_xref="GOA:D1CEW6"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022963"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW6"
FT                   /inference="protein motif:TFAM:TIGR00131"
FT                   /protein_id="ACZ41472.1"
FT                   /translation="MTEEYRFKHIGALIRAFEMRYGGKPTIASRAPGRINLIGEHTDYN
FT                   DGWVLPAAINYEINVVCRPRNDSLVRLVALDMGKESDFYLENHNRTDFLWLRYPQGVAV
FT                   ELQNRGYKLRGMEAVYMGDIPVGSGLSSSAAVEVAFVHAFCRAADIELSGEEVALIAQR
FT                   AENDFVGVPCGVMDQFVSSLGRQDHALLLDSRSLEYQHIPINLPNVSLVILDTGVSREL
FT                   AGSEYKKRRQDCEEAVTRLSTRISGIKALRDVTLEQLEENLDLLTSTQRKRARHVIEEN
FT                   MRTLEAAEALRNGDAAAIGRLMKESHISLRDLYEVSSFELDTIVEIAWDTDGVIGARMT
FT                   GAGFGGVALALVHQDAVPTLYERVMQEYHARTGKEPKVFVCRAVDGAESALMEEVQVHS
FT                   IWNV"
FT   gene            complement(612901..613890)
FT                   /locus_tag="Tter_0555"
FT   CDS_pept        complement(612901..613890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0555"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="KEGG: gbm:Gbem_4017 galactose-1-phosphate
FT                   uridylyltransferase; TIGRFAM: galactose-1-phosphate
FT                   uridylyltransferase; PFAM: galactose-1-phosphate uridyl
FT                   transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41473"
FT                   /db_xref="GOA:D1CEW7"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR019779"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW7"
FT                   /inference="protein motif:TFAM:TIGR00209"
FT                   /protein_id="ACZ41473.1"
FT                   /translation="MSELRWHPLLREWVITATHRQDRTFLPPRDYCPLCPTKSGKHETE
FT                   IPVETFDIAVFENKFPSLQRQPPQPAIEPMGIFDVRPAEGVCEVVVYTPEHDTTLTDQS
FT                   VSHIRRLIAVWRDRYIELGSLPYVKYVFIFENKGEVIGVTLHHPHGQIYAYPFIPPLMQ
FT                   RELSALSEHRAKTGRCLVCDVLQQETNYGKRILFEEGNFVAFIPFYARWPYEVHIIPRR
FT                   HFGSLAEITSEESWDLAYALKRVLVGYDKLFGFSMPFIMALHQTPTDDQEHPYYHFQLQ
FT                   FYPPHRTSTKLKYLAGSETGAGTFINDSLPEEKAPELRAVIPDKESIE"
FT   gene            complement(613883..614056)
FT                   /locus_tag="Tter_0556"
FT   CDS_pept        complement(613883..614056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41474"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41474.1"
FT                   /translation="MAADSQSWQPEMIKSKEQKKDGRYIIYYTFTEHTDQQQVPAHGQD
FT                   QAVTSSEGNKDV"
FT   gene            614228..614605
FT                   /locus_tag="Tter_0557"
FT   CDS_pept        614228..614605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0557"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: bra:BRADO3246 sensor histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41475"
FT                   /db_xref="GOA:D1CEW9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACZ41475.1"
FT                   /translation="MVCSVAKGRILLVEDSLPTLLFLSDVLEDEGYEVKALSESSEVLK
FT                   VVGEFMPDVIISDINMPAIDGVTLSSIVRRSFPDLPIILCSATRPKPRQQHILDKLQHC
FT                   YFRIKPLCVQELLSLLEKLVE"
FT   gene            614701..615780
FT                   /locus_tag="Tter_0558"
FT   CDS_pept        614701..615780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0558"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: lch:Lcho_3206 oxidoreductase domain-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41476"
FT                   /db_xref="GOA:D1CEX0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEX0"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACZ41476.1"
FT                   /translation="MDKLHIGIIGVGWPGQRHIEGYKRREDVEIVAVSDVNTELAQQIV
FT                   DQYDLKAQIYADYHEMLQSANVDAVSICTPNFLHAPMAIDALDAGKHVLLEKPLAHNLE
FT                   SGIKIAQKVKETGLVFMIAFNNRFRPDSKLLKARIEEGLLGEIYYAKTGWLRGAAEFFL
FT                   RGWFTQKEKSGGGPLIDLGVHMLDLALWFMGNPRPVSVSGSVYYKFTDVMKASAGQADV
FT                   EDLSTAFVKLDNGGTIVLDVSWISHIKNPDEVYCQLFGTKGGAKIDRHTGTEDLDIYTV
FT                   VDGVTVLQKPEFNTWRQRQPGYMLYESFAGETSHFVDCVRENKQPESNIQHGLDVLRVL
FT                   DAIYKSAESGHEVIIDTNL"
FT   gene            615833..616492
FT                   /locus_tag="Tter_0559"
FT   CDS_pept        615833..616492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0559"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: rpc:RPC_0982
FT                   peptidase C56, PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41477"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEX1"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ACZ41477.1"
FT                   /translation="MTLSGQRKIILLAADGVHENEVLSIRERASAAGMNLVIASLTGAA
FT                   LQSVNGLDKGQLLEPDMAVDQVKPEDYDALVIPDGLYSVDALRGNTLVIEIVTKFLEEG
FT                   KPLGVIGHAPWILIESGLVTNRSLSSWHTLRVDILNAGGHWVKSPVHNDMALVSAASSD
FT                   YIEDFLDRFISEVQSGVHTSRGAAPGKDKVLESSEESFPASDAPGWVSSSEREEES"
FT   gene            complement(616503..618005)
FT                   /locus_tag="Tter_0560"
FT   CDS_pept        complement(616503..618005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0560"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: aba:Acid345_1459
FT                   aldehyde dehydrogenase (NAD+)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41478"
FT                   /db_xref="GOA:D1CEX2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEX2"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACZ41478.1"
FT                   /translation="MREYMNYIDGKWVPSSTGETFKSINPANGEVVAVLAKSSREDVDK
FT                   AVQAARRAFDKWRLYPAPRRGEILYEVGRILKERKEDLARLMTQEMGKVLTEARGDVQE
FT                   GIDMAFYVGGEGRRLFGVTTPSEMPNKFQMAVRDPVGVVAAITPWNFPIAIPTWKLMPA
FT                   LVAGNTVVFKPASDTPALGAELVKIFEEAGLPPGVLNLVTGTGEEVGKALLEHPGVDVI
FT                   SFTGSTDTGSQVLTQTASKNKKISLEMGGKNAITVMDDADIDLAIEGILWSAFGTTGQR
FT                   CTACSRLIVHKSIRDTLTEKLLSRIQNLRLGDGLDPETDVGPVINERQLNKIHQYVGIG
FT                   REEGAKLLIGGDRATDGELSKGFFYKPTLFTDVDPNMRIAQEEIFGPVLSMITVNSLEE
FT                   AIKVNNCTKYGLSSSIYTRDINKAFRAMRDFNTGIVYINHGTIGAEVHLPFGGTKGTGN
FT                   GHREGAVWAALDVFTEWKSVYIDFSGRLQRAQIDIDKINIES"
FT   gene            618130..618879
FT                   /locus_tag="Tter_0561"
FT   CDS_pept        618130..618879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0561"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_0127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41479"
FT                   /db_xref="GOA:D1CEX3"
FT                   /db_xref="InterPro:IPR011578"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEX3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41479.1"
FT                   /translation="MRRRRKSRFANSMEERFAAILDLLRLRWQYEPHTFVLRRRFDGSP
FT                   MVAFTPDFYLEEFDLYVELTMHKRRLVTLKNRKVRLMREKYPEHNIRLLYLHDCLSLIR
FT                   PVRSYKEREKVLRRLIPWASQEHYDRVRWHRRLVRRVSSSGRVHFLGKVLSLGADWAGK
FT                   ECIIWVYSDHLDIEIEGRTIASLECAYDNRKDKLLQVQSKVLIDNEPLEGNLLPAGRRI
FT                   LSLVQEDTGNASHGLVRCYAQASFQLF"
FT   gene            complement(619134..620036)
FT                   /locus_tag="Tter_0562"
FT   CDS_pept        complement(619134..620036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0562"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region; KEGG:
FT                   esa:ESA_03540 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41480"
FT                   /db_xref="GOA:D1CEX4"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEX4"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ACZ41480.1"
FT                   /translation="MARINVKVPEIRWETQRVKIPEANGKLGLPQNIGKSLETMISRRS
FT                   QPPKVDNKSRLIFLGIGAVLGAIAGLLFAPRTGRATRSYILQKGQRYLRVTSRQANRTL
FT                   RYTSHMVTGKARALYYRVAQKTDYDLTPETIEHRVETRLGEDPVIGRLPRLNVNAEPGG
FT                   VVYLRGSVPRENLRHRAELIASRVRGVTEVINEISVVPEGEKLKETGNHDLGLMRQVIN
FT                   KILDDDKLKEHAIEVEAEVGGTVFLRGTVHTENERLRAEKLVKGMPGVKTVVNDLAVVS
FT                   PAKDIVEGYREKTPPQQTH"
FT   gene            complement(620166..621785)
FT                   /locus_tag="Tter_0563"
FT   CDS_pept        complement(620166..621785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0563"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: bcu:BCAH820_0293 chaperonin GroL"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41481"
FT                   /db_xref="GOA:D1CEX5"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEX5"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ACZ41481.1"
FT                   /translation="MAKQIEFNESARASLKEGVDILANVVKATLGPKGRNVALDKKFGA
FT                   PNVTHDGVTVAKEIELEDPFANMGAQLLKEAATKTEDVAGDGTTTSIVLAQAIVHEGLR
FT                   NVAAGANPMQLRKGIEMATKKAVDAVKELATPVKGREDIAQVATVSSADSEIGNLIAEV
FT                   MEKVGKDGVITVEESKGLGFEVEYTEGMQFDRGYISPYFVTNAERMEAVIEEPYILVTD
FT                   KKLSSINDILPTLERVLQVTKNLVIIAEDVEGEALATLVVNKLRGTINALAVKAPGFGD
FT                   RRKEMLRDIAILTGAQVISEEVGRRLDSVQVEDLGRARRVVATKDETTIVEGYGDPNAI
FT                   KGRCEQIRAQIETTTSDFDREKLQERLAKLQGGVAVIKVGAATEVELKLRKTRVEDALS
FT                   TTRAAVEEGIVPGGGVALLYASEKLNPDDAEGDVRTGILIVKRALEEPMRQIAENAGQD
FT                   GGVVVQTVRQALHEGKKGYGYDAWADEYTDLVERGIMDAAKVTTSALENAASIAAMILT
FT                   TEALVTDIPEKEKAPSTPPMDY"
FT   gene            complement(621820..622128)
FT                   /locus_tag="Tter_0564"
FT   CDS_pept        complement(621820..622128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0564"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: sme:SM_b22023 10 kDa
FT                   chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41482"
FT                   /db_xref="GOA:D1CEX6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEX6"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ACZ41482.1"
FT                   /translation="MTQSATKTIRPLGDRIVVKPIEREEVTKSGIVLPDTAKEKPQMGV
FT                   VLAVGPGKILENGQRQPMDVQVGQTVLFAKYAGTEFELDGEDVLILRESDVMGILGE"
FT   gene            622351..623712
FT                   /locus_tag="Tter_0565"
FT   CDS_pept        622351..623712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0565"
FT                   /product="Arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="PFAM: amidinotransferase; KEGG: bcy:Bcer98_0348
FT                   arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41483"
FT                   /db_xref="GOA:D1CEX7"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEX7"
FT                   /inference="protein motif:PRIAM:3.5.3.6"
FT                   /protein_id="ACZ41483.1"
FT                   /translation="MSKLHVTNEVGRLRKVLLHKPGREMDLLTPENREEMLFEELLWLP
FT                   RASLEHRILASVLEVATGIGGVFYLEDLLSHSLADDLCRAELVDEILRVDTPLGMNRQD
FT                   AKSWLLTLPPQILADVLIGRPQVNGYDSLSSRYLGEGGIFTPLPNLIFMRDPAVVVGDS
FT                   AIVSSMHLQVRRRESLLLRHVLLRHPDIASTLLMDALDSSQEAQQGYIEGGDVLVLNER
FT                   TLVVGCSERTDYQGIDRLAQSLMKASADVEKIYVVLMPPRRAWMHLDTIITFLSQDECV
FT                   IYSPLILGLGSEGVTVLEVQLLGNRIRIKEHDDPLPTVLSRSEGIDLKWVECGGSDRLQ
FT                   QDREQWTDGANFFAIYPGVVVVYERNEATLEELHRHLGYEIIRIDDAVFPEDASTSNDG
FT                   VFLVDGRWISYPELVSMIAIGSGKKLAIAIPGSELSRGRGGPHCLTMPLWRDDI"
FT   gene            complement(623709..624521)
FT                   /locus_tag="Tter_0566"
FT   CDS_pept        complement(623709..624521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0566"
FT                   /product="protein of unknown function DUF62"
FT                   /note="PFAM: protein of unknown function DUF62; KEGG:
FT                   dal:Dalk_3152 protein of unknown function DUF62"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41484"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEX8"
FT                   /inference="protein motif:PFAM:PF01887"
FT                   /protein_id="ACZ41484.1"
FT                   /translation="MSRLPNLVTFITDFGLDWGPVGICHAVMRGINPQISIVDISHGIP
FT                   AFDIRAGAWVLTSIFPYVPPAVHVVVVDPGVGTQRLPIAILCRRGDVLIGPDNGVLIPA
FT                   TRRLGGIVEARKISNKALMRPDISYTFHGRDIFCPVAAHLSSGVSFEDVGEILPISDLV
FT                   QAPWREPEIYEHRVVAEVAILDKFGNIRTNIEAADWPLSTGEKIILKHKNNQVNLAVAR
FT                   TFGEVNRGDLLIYEDSSRFICIGQNLGHAGNTLGIGPGDTIQLERARS"
FT   gene            624614..625579
FT                   /locus_tag="Tter_0567"
FT   CDS_pept        624614..625579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0567"
FT                   /product="peptidase C60 sortase A and B"
FT                   /note="PFAM: peptidase C60 sortase A and B; SH3 type 3
FT                   domain protein; KEGG: sfr:Sfri_1626 sortase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41485"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEX9"
FT                   /inference="protein motif:PFAM:PF04203"
FT                   /protein_id="ACZ41485.1"
FT                   /translation="MSKIRIFNASFWLIFVMAFSFFINACGGNANSSAGIPSPTARSQE
FT                   VVASSPTPAPSPSVYEATQPTPTADGVVASPSPTPAQASPANTPPKESSTKYTRTMYVD
FT                   GIREGYVGVNLRARPSTESQSLLVIKNREPVRTTKGPMQGADGNLWFPASYNGKEGYIL
FT                   ATLLSAQRPAPPPVRLIIKNDRLDVDAAVEYVGLTPDGAMDVPKKWEDVAWYRLGPVPG
FT                   QQGNAVIAGHLDSTTGPAVFWKLKDIRIGDVVSVIDEDGHKINFKVTKIQSYFDEDAPL
FT                   YDIFGPTDKSRLNLITCDGSWDPKAKRYDKKLVVFTEKIS"
FT   sig_peptide     624614..624691
FT                   /locus_tag="Tter_0567"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.787 at
FT                   residue 26"
FT   gene            complement(625597..626898)
FT                   /locus_tag="Tter_0568"
FT   CDS_pept        complement(625597..626898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0568"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224 cysteine-
FT                   rich region domain protein; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; KEGG: bha:BH2135 glycolate oxidase
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41486"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEY0"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ACZ41486.1"
FT                   /translation="MCPSSNTLQSWDELDPPAYDIINACVQCGLCLSVCPTYLLTFKET
FT                   SSPRGRIHLLKAVWEGKLDARDPILDHQMYECLDCRACEAICPSGVRYGVLVESARAQL
FT                   ERKHPRSLWVRALRWIVFNKLFASMALFRAFSRALWLYQRIGLSRIARSTRILDILHLA
FT                   DKEALLPQIPSKFFVPEDQALPPKGNKRFRVGLFAGCIMSTAFAEIDRATIRVLQHNGC
FT                   EVVVPKRQGCCGALNVHSGERRSATEMMKANIQAFERLDLDYIIVNSAGCGATLKEYPH
FT                   FFKDDPGWHERAKHFSSLVRDVSEFLSEVGMSGPNRAVPVRVTYQDPCHLAHAQKVYRQ
FT                   PRELLASIPGVELVEMQESKLCCGSAGIYNITNPEISNQLLERKLEHALATGAEVIVSA
FT                   NPGCMLQLQKGLRHRGLDIQVKHLVQILDQAYGD"
FT   gene            626973..627941
FT                   /locus_tag="Tter_0569"
FT   CDS_pept        626973..627941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0569"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: pat:Patl_3506 inosine/uridine-preferring
FT                   nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41487"
FT                   /db_xref="GOA:D1CEY1"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEY1"
FT                   /inference="protein motif:PFAM:PF01156"
FT                   /protein_id="ACZ41487.1"
FT                   /translation="MKVIIDCDMGIDDAIAVAYALALQDVDVLGIGSVHGNIEADVAAE
FT                   NTLKLLKVMNRTDIPVAVGAPKPMIRPLSMAKFVHGEDGLGNANFAPSGLVPSDEHAAD
FT                   QIIRLARENPGEITLITTGPLTNAAIALLKEPKLPQLIPHVVVMGGTVEHPGNVGPVSE
FT                   ANIAHDPEAAQIVFSAPWKVTMVGLDVTMKTLLLEQHLDAWKQARTPLTEWLLRIVPFY
FT                   MQFYSQSLGYMACAMHDALAVGIAVGKVEVSESVTCPVWVNTVVGPGLGQTVADRRSES
FT                   MRATSEPYYFIGESNTEVIMKVDGDAFVSHLVDSIASYQVR"
FT   gene            627989..629122
FT                   /locus_tag="Tter_0570"
FT   CDS_pept        627989..629122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0570"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; PFAM: cell
FT                   envelope-related transcriptional attenuator; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41488"
FT                   /db_xref="GOA:D1CEY2"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEY2"
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /protein_id="ACZ41488.1"
FT                   /translation="MGTRIRIGRRINISPLWVAIAIIVLIAAPALYLAAKTWQTSRAIY
FT                   HEIPTQAQGALTPAPTGRIPIVIITPQATATRGVASQLTPYDPSKWVPSPTAEATPVVQ
FT                   SNIKEWNGKKRINFLLLGVDRRGNEIPRSDTIILASLDFEHNRAYVLSIPRDLYVNVPG
FT                   FNYWKINAAYALGENPKYKDQVGGGIGLLIMTLRQNFGIDIDEYATIDFEGFIKGIDAI
FT                   GGVDIRVPKKIVDNQYPSESGGYERVVFNAGLQHMDGEMALKYARTRHADSDFGRMRRQ
FT                   QQIILAVQQKAKNPSILLKAPTLLNIIKGHVETSLSPSEQLKLGRWAASLPKKNIEFYS
FT                   IEGPIGMTPDGQSVVYADWNAINPILKKVFGPQAGHP"
FT   sig_peptide     627989..628096
FT                   /locus_tag="Tter_0570"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.478 at
FT                   residue 36"
FT   gene            complement(629187..629555)
FT                   /locus_tag="Tter_0571"
FT   CDS_pept        complement(629187..629555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_1829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41489"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEY3"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_1829"
FT                   /protein_id="ACZ41489.1"
FT                   /translation="MKVAYIFSTSGHTVSYKLGKMILPQLEEDRHGAEVIGMFFFDDNT
FT                   YMLRKGDPVGERLSKVAKDKGIMLMLCDQCAVERGLAEIGPDGKCYPKDVVEGVQVGCF
FT                   PDLYAALGNNPPDQVITL"
FT   gene            complement(629818..630768)
FT                   /locus_tag="Tter_0572"
FT   CDS_pept        complement(629818..630768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0572"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: abo:ABO_0508 D-isomer specific
FT                   2-hydroxyacid dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41490"
FT                   /db_xref="GOA:D1CEY4"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEY4"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACZ41490.1"
FT                   /translation="MEKIEIIANSAIIERFGDQIRSVDQAIELIPIEKALSEDSIHPQV
FT                   LIRSEIPNDLLVQILDKFASIRWVHSYSAGVEGLIPILQHRDLVLTNSAGLHGEPIAEW
FT                   VIAMTLAHAKRFHLLFRHFQAHEWQAEECDELGGKTMVIVGAGGIGASIARRAKCLGMK
FT                   VVGVRSSGRSSEHFDEMLTSDSLHAALGKGDYVVIATPLTPQTQGMIGESELRAMKSSS
FT                   VLLNIARGKIVQTEALMKALSEGWIAAAYLDVTDPEPLPPDHPLWSTPNVFITAHTSGY
FT                   SPYSAERLVRFFCDNLKRWLQGEPLLNQVDLSRGY"
FT   gene            631051..631833
FT                   /locus_tag="Tter_0573"
FT   CDS_pept        631051..631833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0573"
FT                   /product="3D domain protein"
FT                   /note="PFAM: 3D domain protein; SH3 type 3 domain protein;
FT                   KEGG: bha:BH0055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41491"
FT                   /db_xref="GOA:D1CEY5"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEY5"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ACZ41491.1"
FT                   /translation="MKNLLSNKLSLCVLLLALVLPIASFPGKGYAYYGVTFYKGDKVQV
FT                   RNTGGAGLRVRVGPGLRYDKLTTMREGQVVTVVAGPIWSDGYGWYKVTGYDSAGNAGWA
FT                   AGWWLYRVSRADNTPPAQVAQVRVQEYSEESAASDSSSTTNTKVAVSRPSESNSGSTQV
FT                   SSSGRTYRVLTSGFNGAEFGSTGYMANGRRVHWGAVAVDPRYIPLGTRMYISGFGNQVF
FT                   VAEDTGGAIKGWRIDIWFPSVAQARQYGMQWRTITIIP"
FT   sig_peptide     631051..631146
FT                   /locus_tag="Tter_0573"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probabilit