(data stored in ACNUC7421 zone)

EMBL: CP001827

ID   CP001827; SV 1; circular; genomic DNA; STD; PRO; 1413462 BP.
XX
AC   CP001827; ABFQ01000000-ABFQ01000227;
XX
PR   Project:PRJNA18811;
XX
DT   04-DEC-2009 (Rel. 103, Created)
DT   01-SEP-2017 (Rel. 134, Last updated, Version 5)
XX
DE   Dehalococcoides mccartyi VS chromosome, complete genome.
XX
KW   .
XX
OS   Dehalococcoides mccartyi VS
OC   Bacteria; Chloroflexi; Dehalococcoidia; Dehalococcoidales;
OC   Dehalococcoidaceae; Dehalococcoides.
XX
RN   [1]
RP   1-1413462
RX   DOI; 10.1371/journal.pgen.1000714.
RX   PUBMED; 19893622.
RA   McMurdie P.J., Behrens S.F., Muller J.A., Goke J., Ritalahti K.M.,
RA   Wagner R., Goltsman E., Lapidus A., Holmes S., Loffler F.E., Spormann A.M.;
RT   "Localized plasticity in the streamlined genomes of vinyl chloride
RT   respiring Dehalococcoides";
RL   PloS Genet. 5(11):E1000714-E1000714(2009).
XX
RN   [2]
RP   1-1413462
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Glavina del Rio T., Dalin E., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Richardson P., McMurdie P.J., Behrens S.F.,
RA   Muller J.A., Goke J., Goltsman E., Lapidus A., Spormann A.M.;
RT   ;
RL   Submitted (19-NOV-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; ea78f1e9d8669668eee2210d9a5f73b4.
DR   BioSample; SAMN02598415.
DR   EnsemblGenomes-Gn; DhcVS_1097.
DR   EnsemblGenomes-Gn; DhcVS_1169.
DR   EnsemblGenomes-Gn; DhcVS_1220.
DR   EnsemblGenomes-Gn; DhcVS_1221.
DR   EnsemblGenomes-Gn; DhcVS_1222.
DR   EnsemblGenomes-Gn; DhcVS_1223.
DR   EnsemblGenomes-Gn; DhcVS_1225.
DR   EnsemblGenomes-Gn; DhcVS_1246.
DR   EnsemblGenomes-Gn; DhcVS_1247.
DR   EnsemblGenomes-Gn; DhcVS_1248.
DR   EnsemblGenomes-Gn; DhcVS_1281.
DR   EnsemblGenomes-Gn; DhcVS_1297.
DR   EnsemblGenomes-Gn; DhcVS_1441.
DR   EnsemblGenomes-Gn; DhcVS_1462.
DR   EnsemblGenomes-Gn; DhcVS_1507.
DR   EnsemblGenomes-Gn; DhcVS_1518.
DR   EnsemblGenomes-Gn; DhcVS_163.
DR   EnsemblGenomes-Gn; DhcVS_265.
DR   EnsemblGenomes-Gn; DhcVS_304.
DR   EnsemblGenomes-Gn; DhcVS_326.
DR   EnsemblGenomes-Gn; DhcVS_364.
DR   EnsemblGenomes-Gn; DhcVS_513.
DR   EnsemblGenomes-Gn; DhcVS_54.
DR   EnsemblGenomes-Gn; DhcVS_55.
DR   EnsemblGenomes-Gn; DhcVS_62.
DR   EnsemblGenomes-Gn; DhcVS_626.
DR   EnsemblGenomes-Gn; DhcVS_627.
DR   EnsemblGenomes-Gn; DhcVS_629.
DR   EnsemblGenomes-Gn; DhcVS_637.
DR   EnsemblGenomes-Gn; DhcVS_639.
DR   EnsemblGenomes-Gn; DhcVS_641.
DR   EnsemblGenomes-Gn; DhcVS_654.
DR   EnsemblGenomes-Gn; DhcVS_662.
DR   EnsemblGenomes-Gn; DhcVS_667.
DR   EnsemblGenomes-Gn; DhcVS_711.
DR   EnsemblGenomes-Gn; DhcVS_712.
DR   EnsemblGenomes-Gn; DhcVS_713.
DR   EnsemblGenomes-Gn; DhcVS_714.
DR   EnsemblGenomes-Gn; DhcVS_722.
DR   EnsemblGenomes-Gn; DhcVS_757.
DR   EnsemblGenomes-Gn; DhcVS_778.
DR   EnsemblGenomes-Gn; DhcVS_830.
DR   EnsemblGenomes-Gn; DhcVS_831.
DR   EnsemblGenomes-Gn; DhcVS_870.
DR   EnsemblGenomes-Gn; DhcVS_871.
DR   EnsemblGenomes-Gn; DhcVS_872.
DR   EnsemblGenomes-Gn; DhcVS_892.
DR   EnsemblGenomes-Gn; DhcVS_893.
DR   EnsemblGenomes-Gn; DhcVS_895.
DR   EnsemblGenomes-Gn; DhcVS_896.
DR   EnsemblGenomes-Gn; DhcVS_918.
DR   EnsemblGenomes-Gn; DhcVS_966.
DR   EnsemblGenomes-Gn; EBG00001014826.
DR   EnsemblGenomes-Gn; EBG00001014827.
DR   EnsemblGenomes-Gn; EBG00001014828.
DR   EnsemblGenomes-Gn; EBG00001014829.
DR   EnsemblGenomes-Gn; EBG00001014830.
DR   EnsemblGenomes-Gn; EBG00001014831.
DR   EnsemblGenomes-Gn; EBG00001014832.
DR   EnsemblGenomes-Gn; EBG00001014833.
DR   EnsemblGenomes-Gn; EBG00001014834.
DR   EnsemblGenomes-Gn; EBG00001014835.
DR   EnsemblGenomes-Gn; EBG00001014837.
DR   EnsemblGenomes-Gn; EBG00001014838.
DR   EnsemblGenomes-Gn; EBG00001014839.
DR   EnsemblGenomes-Gn; EBG00001014841.
DR   EnsemblGenomes-Gn; EBG00001014842.
DR   EnsemblGenomes-Gn; EBG00001014844.
DR   EnsemblGenomes-Gn; EBG00001014846.
DR   EnsemblGenomes-Gn; EBG00001014848.
DR   EnsemblGenomes-Gn; EBG00001014849.
DR   EnsemblGenomes-Gn; EBG00001014851.
DR   EnsemblGenomes-Gn; EBG00001014852.
DR   EnsemblGenomes-Gn; EBG00001014853.
DR   EnsemblGenomes-Gn; EBG00001014855.
DR   EnsemblGenomes-Gn; EBG00001014856.
DR   EnsemblGenomes-Gn; EBG00001014858.
DR   EnsemblGenomes-Gn; EBG00001014859.
DR   EnsemblGenomes-Gn; EBG00001014860.
DR   EnsemblGenomes-Gn; EBG00001014861.
DR   EnsemblGenomes-Gn; EBG00001014862.
DR   EnsemblGenomes-Gn; EBG00001014863.
DR   EnsemblGenomes-Gn; EBG00001014864.
DR   EnsemblGenomes-Gn; EBG00001014865.
DR   EnsemblGenomes-Gn; EBG00001014866.
DR   EnsemblGenomes-Gn; EBG00001014867.
DR   EnsemblGenomes-Gn; EBG00001014868.
DR   EnsemblGenomes-Gn; EBG00001014869.
DR   EnsemblGenomes-Gn; EBG00001014870.
DR   EnsemblGenomes-Gn; EBG00001014871.
DR   EnsemblGenomes-Gn; EBG00001014872.
DR   EnsemblGenomes-Gn; EBG00001014873.
DR   EnsemblGenomes-Gn; EBG00001014874.
DR   EnsemblGenomes-Gn; EBG00001014875.
DR   EnsemblGenomes-Gn; EBG00001014876.
DR   EnsemblGenomes-Gn; EBG00001014877.
DR   EnsemblGenomes-Gn; EBG00001014878.
DR   EnsemblGenomes-Gn; EBG00001014880.
DR   EnsemblGenomes-Gn; EBG00001014881.
DR   EnsemblGenomes-Gn; EBG00001014882.
DR   EnsemblGenomes-Gn; EBG00001014883.
DR   EnsemblGenomes-Gn; EBG00001014884.
DR   EnsemblGenomes-Tr; DhcVS_1097-1.
DR   EnsemblGenomes-Tr; DhcVS_1169-1.
DR   EnsemblGenomes-Tr; DhcVS_1220-1.
DR   EnsemblGenomes-Tr; DhcVS_1221-1.
DR   EnsemblGenomes-Tr; DhcVS_1222-1.
DR   EnsemblGenomes-Tr; DhcVS_1223-1.
DR   EnsemblGenomes-Tr; DhcVS_1225-1.
DR   EnsemblGenomes-Tr; DhcVS_1246-1.
DR   EnsemblGenomes-Tr; DhcVS_1247-1.
DR   EnsemblGenomes-Tr; DhcVS_1248-1.
DR   EnsemblGenomes-Tr; DhcVS_1281-1.
DR   EnsemblGenomes-Tr; DhcVS_1297-1.
DR   EnsemblGenomes-Tr; DhcVS_1441-1.
DR   EnsemblGenomes-Tr; DhcVS_1462-1.
DR   EnsemblGenomes-Tr; DhcVS_1507-1.
DR   EnsemblGenomes-Tr; DhcVS_1518-1.
DR   EnsemblGenomes-Tr; DhcVS_163-1.
DR   EnsemblGenomes-Tr; DhcVS_265-1.
DR   EnsemblGenomes-Tr; DhcVS_304-1.
DR   EnsemblGenomes-Tr; DhcVS_326-1.
DR   EnsemblGenomes-Tr; DhcVS_364-1.
DR   EnsemblGenomes-Tr; DhcVS_513-1.
DR   EnsemblGenomes-Tr; DhcVS_54-1.
DR   EnsemblGenomes-Tr; DhcVS_55-1.
DR   EnsemblGenomes-Tr; DhcVS_62-1.
DR   EnsemblGenomes-Tr; DhcVS_626-1.
DR   EnsemblGenomes-Tr; DhcVS_627-1.
DR   EnsemblGenomes-Tr; DhcVS_629-1.
DR   EnsemblGenomes-Tr; DhcVS_637-1.
DR   EnsemblGenomes-Tr; DhcVS_639-1.
DR   EnsemblGenomes-Tr; DhcVS_641-1.
DR   EnsemblGenomes-Tr; DhcVS_654-1.
DR   EnsemblGenomes-Tr; DhcVS_662-1.
DR   EnsemblGenomes-Tr; DhcVS_667-1.
DR   EnsemblGenomes-Tr; DhcVS_711-1.
DR   EnsemblGenomes-Tr; DhcVS_712-1.
DR   EnsemblGenomes-Tr; DhcVS_713-1.
DR   EnsemblGenomes-Tr; DhcVS_714-1.
DR   EnsemblGenomes-Tr; DhcVS_722-1.
DR   EnsemblGenomes-Tr; DhcVS_757-1.
DR   EnsemblGenomes-Tr; DhcVS_778-1.
DR   EnsemblGenomes-Tr; DhcVS_830-1.
DR   EnsemblGenomes-Tr; DhcVS_831-1.
DR   EnsemblGenomes-Tr; DhcVS_870-1.
DR   EnsemblGenomes-Tr; DhcVS_871-1.
DR   EnsemblGenomes-Tr; DhcVS_872-1.
DR   EnsemblGenomes-Tr; DhcVS_892-1.
DR   EnsemblGenomes-Tr; DhcVS_893-1.
DR   EnsemblGenomes-Tr; DhcVS_895-1.
DR   EnsemblGenomes-Tr; DhcVS_896-1.
DR   EnsemblGenomes-Tr; DhcVS_918-1.
DR   EnsemblGenomes-Tr; DhcVS_966-1.
DR   EnsemblGenomes-Tr; EBT00001540929.
DR   EnsemblGenomes-Tr; EBT00001540932.
DR   EnsemblGenomes-Tr; EBT00001540933.
DR   EnsemblGenomes-Tr; EBT00001540934.
DR   EnsemblGenomes-Tr; EBT00001540935.
DR   EnsemblGenomes-Tr; EBT00001540936.
DR   EnsemblGenomes-Tr; EBT00001540937.
DR   EnsemblGenomes-Tr; EBT00001540938.
DR   EnsemblGenomes-Tr; EBT00001540939.
DR   EnsemblGenomes-Tr; EBT00001540940.
DR   EnsemblGenomes-Tr; EBT00001540941.
DR   EnsemblGenomes-Tr; EBT00001540942.
DR   EnsemblGenomes-Tr; EBT00001540943.
DR   EnsemblGenomes-Tr; EBT00001540944.
DR   EnsemblGenomes-Tr; EBT00001540945.
DR   EnsemblGenomes-Tr; EBT00001540946.
DR   EnsemblGenomes-Tr; EBT00001540947.
DR   EnsemblGenomes-Tr; EBT00001540948.
DR   EnsemblGenomes-Tr; EBT00001540949.
DR   EnsemblGenomes-Tr; EBT00001540950.
DR   EnsemblGenomes-Tr; EBT00001540951.
DR   EnsemblGenomes-Tr; EBT00001540952.
DR   EnsemblGenomes-Tr; EBT00001540953.
DR   EnsemblGenomes-Tr; EBT00001540954.
DR   EnsemblGenomes-Tr; EBT00001540955.
DR   EnsemblGenomes-Tr; EBT00001540956.
DR   EnsemblGenomes-Tr; EBT00001540957.
DR   EnsemblGenomes-Tr; EBT00001540958.
DR   EnsemblGenomes-Tr; EBT00001540959.
DR   EnsemblGenomes-Tr; EBT00001540960.
DR   EnsemblGenomes-Tr; EBT00001540961.
DR   EnsemblGenomes-Tr; EBT00001540962.
DR   EnsemblGenomes-Tr; EBT00001540963.
DR   EnsemblGenomes-Tr; EBT00001540964.
DR   EnsemblGenomes-Tr; EBT00001540965.
DR   EnsemblGenomes-Tr; EBT00001540966.
DR   EnsemblGenomes-Tr; EBT00001540967.
DR   EnsemblGenomes-Tr; EBT00001540968.
DR   EnsemblGenomes-Tr; EBT00001540969.
DR   EnsemblGenomes-Tr; EBT00001540970.
DR   EnsemblGenomes-Tr; EBT00001540971.
DR   EnsemblGenomes-Tr; EBT00001540972.
DR   EnsemblGenomes-Tr; EBT00001540973.
DR   EnsemblGenomes-Tr; EBT00001540974.
DR   EnsemblGenomes-Tr; EBT00001540975.
DR   EnsemblGenomes-Tr; EBT00001540976.
DR   EnsemblGenomes-Tr; EBT00001540977.
DR   EnsemblGenomes-Tr; EBT00001540978.
DR   EnsemblGenomes-Tr; EBT00001540979.
DR   EnsemblGenomes-Tr; EBT00001540980.
DR   EuropePMC; PMC3146451; 21635780.
DR   EuropePMC; PMC4703385; 26734727.
DR   EuropePMC; PMC5440377; 28533514.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001827.
DR   SILVA-SSU; CP001827.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000265
CC   Source DNA and organism available from Alfred M. Spormann
CC   (spormann@stanford.edu)
CC   Contacts: Alfred M. Spormann (spormann@stanford.edu)
CC             Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-PGF and Stanford
CC   Finishing done by Stanford
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Dehalococcoides sp. VS
CC   GOLD Stamp ID         :: Gi00938
CC   Greengenes ID         :: 238523
CC   Isolation Site        :: Texas
CC   Isolation Country     :: USA
CC   Oxygen Requirement    :: Anaerobe
CC   Motility              :: Motile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Fresh water, Groundwater
CC   Phenotypes            :: Dechlorinates Tetrachloroethene
CC   Energy Source         :: Chemolithotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1413462
FT                   /organism="Dehalococcoides mccartyi VS"
FT                   /strain="VS"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:311424"
FT   gene            259..1593
FT                   /gene="dnaA"
FT                   /locus_tag="DhcVS_1"
FT   CDS_pept        259..1593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="DhcVS_1"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_1"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61182"
FT                   /db_xref="GOA:D2BJX0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJX0"
FT                   /protein_id="ACZ61182.1"
FT                   /translation="MSIRPAQELWETALGEIELQVNKPNFRTWFAKTVGLKYDGSEFII
FT                   GVPNTFVAEYLEVNQRSLIEKTLINITHSPVELGFQLVQSAQVPAAAPQTAREKTVSPF
FT                   NPRYTFESFIVGSCNRLAHAASLAAAQNPGKSYNPLYIYADAGLGKTHLLQAIGHLANL
FT                   NRRKALYVSGEQFTTDFISSIRNGQTEEFRARYRDVDLLLLDDVQFIGGKEQTEECLFH
FT                   TFNDLHNSNRQIVISADSPPKSLPQLAERLRSRFEWGLTIEIEPPDEKTRFELLQLKAE
FT                   QSGAELNMDTLEYLAQEVKHNIRELEGSLNRVLAYARLLRATITPDLAARALSDIGSRP
FT                   VRENSPLRPSNIISAVSQVFQVPTTELLGAARDKDTALARQFAMFMLKQQNSASLVEIG
FT                   QSLGGRSASTVSHACDKIQMELENSAFLRLKMSEVQNHLSQQRLP"
FT   gene            1924..3198
FT                   /locus_tag="DhcVS_2"
FT   CDS_pept        1924..3198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_2"
FT                   /product="GTP-binding protein, GTP1/OBG family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_2"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61183"
FT                   /db_xref="GOA:D2BJX1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJX1"
FT                   /protein_id="ACZ61183.1"
FT                   /translation="MFDRVEIRIKAGDGGSGKVSFRREKFVPYGGPDGGDGGDGGNVYL
FT                   EADSGLYSLLNFKHKRVHKAANGENGMGSRCTGHNGADLVIKVPVGTVATIVEENGQKR
FT                   VLADLAADGDRTLVARGGQGGLGNTHFVSSTNQAPMLAQKGQPGGEYDLILELKLIADV
FT                   AIIGYPNVGKSSLLSLLTAAKPRVANYPFTTLSPVMGVIQRPEGAFVMAEVPGLIEDAH
FT                   LGRGLGHDFLRHISRTRMVIHLLDGTSDNPIDDMIKVNSELYLYDASLSERPQVVAVNK
FT                   IDDELVQLRREELTEIFKEAGLEVFFISALTGEGVEVLLTKVAEKLAILKAADAPETEI
FT                   DQEIKVFRPAPKGKMGFRITRLEDGWQVEAPEIERIIEHSDIEDLEVRRQIMVLLKHRN
FT                   VQQALIKAGAVIGQKIITGRMEWYL"
FT   gene            3186..3800
FT                   /gene="nadD"
FT                   /locus_tag="DhcVS_3"
FT   CDS_pept        3186..3800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="DhcVS_3"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_3"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61184"
FT                   /db_xref="GOA:D2BJX2"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJX2"
FT                   /protein_id="ACZ61184.1"
FT                   /translation="MVSLKTGILGGTFDPIHTGHLILAEEVKSRLVLDEIIFIPTGQPY
FT                   YKADKTISPAADRLDMVKLAISGKPYFRVMDIEIKRSGPTYTADTLNDLKLILPEKTEL
FT                   YFILGWDNLEALPHWHKASEIIRLCQLVAVPRIGQVKPDVDELDDKLPGLQQSLIMLSK
FT                   PEVDISSSLVRERLENGQGVEHLVPAAVAAYIKEHRLYLRK"
FT   gene            complement(3883..5811)
FT                   /gene="gyrB"
FT                   /locus_tag="DhcVS_4"
FT   CDS_pept        complement(3883..5811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="DhcVS_4"
FT                   /product="DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_4"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61185"
FT                   /db_xref="GOA:D2BJX3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJX3"
FT                   /protein_id="ACZ61185.1"
FT                   /translation="MLDVNKAKPGANSENYTASDIQVLEGLAAVRKRPGMYIGSTDQRG
FT                   LHHLVYEIVYNSVDEAMAGVCDRIKVIMFKDGSVSVEDNGRGIPVDIHPVTKISALETV
FT                   MTVLHAGAKFGGKTYQVSGGLHGVGASVVNALAEWTTVKVRRNGKIYQQSYQRGKPSTP
FT                   LEEIGVSDGSGTTTIFKADSQIFSTTEYDFEILTDRLREIAYLNKGLEVYIYDEQSDQE
FT                   RTYYFEGGITGFVRHLNRNREVRHRQPIYITKKSDSTILEVAIQYNDGYSDSTLTFANC
FT                   VNTIDGGTHLTGFRSALTRAFNDYAHKSKFLKDTDPNLMGDDVREGIVAIVSVKLPEPQ
FT                   FEGQTKGKLGNIEIKSFVESAVAEQLSLYLEEHPDDTKRILEKCITAAKAREAARKARD
FT                   LIIRKSALDTGTLPGKLADCSERDASLCELFLVEGDSAGGSAKQGRNRRFQAILPLRGK
FT                   ILNVEKASPDKMLAHEEIRAIITALAAGIDNDFDPAKLRYNRLVLMTDADVDGSHIRTL
FT                   LLTFFFRHMPRLITESHLFIAQPPLYKIKIGSTEHWVYNDAEKETLLSQTKSTKVDIQR
FT                   YKGLGEMSAEQLWRTTMDPASRTLLEVKVEDAAKADQIFNLLMGGEVAPRKAFIQSHSR
FT                   TVKNLDI"
FT   gene            complement(6015..8201)
FT                   /gene="spoT"
FT                   /gene_synonym="relA"
FT                   /locus_tag="DhcVS_5"
FT   CDS_pept        complement(6015..8201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /gene_synonym="relA"
FT                   /locus_tag="DhcVS_5"
FT                   /product="relA/spoT protein, GTP pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_5"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61186"
FT                   /db_xref="GOA:D2BJX4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJX4"
FT                   /protein_id="ACZ61186.1"
FT                   /translation="MEFADLKEKASKYLPPEKLVFLEEAYNYAAAAHTGQMRKSGEPFI
FT                   EHPLNVALTLADLQLDVSTLSAALLHDVPEDANISLEQIDKKFGPDVAKLVDGVTKLSK
FT                   LALGPAIEDARRPGGNASLRQAENLRKMLVAMSEDLRVVFIKLADRFHNMRTLQALSAE
FT                   KRRSIAKETMEIYAPLAHRLGIWELKWQLEDLAFRYLDPRHYRQVANLVDSKLAQRKNY
FT                   IEHVSAILQSEFEKNGLKVELSGRPKHLYSIYQKMEKYASQGKQFEDIYDVLALRVLVN
FT                   DIPDCYHAIGIVHSLWHPIPGAFDDYIANPKPNGYQSLHTAVMSLGTTPLEVQVRTYQM
FT                   HHIAEYGVAAHWRYKTAGKEDVNFEDRIGWLRQLIEWHRDMRGAEEFLESVKTDIFNDQ
FT                   VFVFTPKGEIKDLAKGATPIDFAYRIHTELGNRCIGAKANGRLVPLDYQLKNGEVVEIV
FT                   TTKKDRGPSRDWLNANMGYIKTHHAREKILAWFKKQERTENLERGRELLEKELKHIGIK
FT                   TVDREALAKAFKYENADEFLAAIGYGAVSVHQVSMKLLSQQEQPRVVAPPLQTAKPSSQ
FT                   SSVSVMGTGSLLTNIAKCCNPVPGDDIIGYVTRNRGVTVHRQDCHNILHEEERERLVSV
FT                   DWGMPKEELYPASMRIQAWDRVGLVRDVSTVVAEEKISILSMTVTENDDKTTTLSMTAQ
FT                   IKSLSQLTRLMAKLEGIRGIISINRVGTDGSRSG"
FT   gene            8329..9585
FT                   /gene="hisS1"
FT                   /locus_tag="DhcVS_6"
FT   CDS_pept        8329..9585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS1"
FT                   /locus_tag="DhcVS_6"
FT                   /product="histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_6"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61187"
FT                   /db_xref="GOA:D2BJX5"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJX5"
FT                   /protein_id="ACZ61187.1"
FT                   /translation="MYQSPRGTEDILPEDQPYWHFVRQQAARIAALYGYQQTDTPVFED
FT                   AGLFVRSVGEGTDIVSKEMYTFEDRGGDKLTLRPEGTAPICRAYLEHGMQTRTKPVKLY
FT                   YLSSIFRYDRPQAGRYRQHHQFGFEAIGEADASLDAEVIEMAWRLYNLLGINDLSLELN
FT                   SIGCRECRPAYISALKAYYGQHEGKLCSDCKTRLDKNTLRLLDCKREECQCVAENAPRS
FT                   TDYLCLDCLAHYNRLKECLTVMDLPFHENFRLVRGLDYYSRTVFEIQPSIEGAQSTIGG
FT                   GGRYDGLIEQLGGESTPAIGFATGIERIILNLKRQGITPPSLPSPSVFLAYMGEAASLA
FT                   SVALASDLRKAGIGIYQTYAQKSIKAQLRQANSLGADWAVILGEEELKQGCAVLRNMKE
FT                   AGQATIPLDQLICEIKKQI"
FT   gene            9582..10745
FT                   /locus_tag="DhcVS_7"
FT   CDS_pept        9582..10745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_7"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_7"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61188"
FT                   /db_xref="GOA:D2BJX6"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJX6"
FT                   /protein_id="ACZ61188.1"
FT                   /translation="MTKNILIIGGYGNAGSCIAMLLLQETDARIFLGGRNLEKARYVAE
FT                   GLNQLENIQRVEGVKLNVEDPQSLKEAFCGMDIVVVASNTPEYARQIAFAALEAKVDYI
FT                   DIQYSDRKLHQLKLLSQKINNANLCFITEAGSLPGLPSALVHFSHQDFTTLEKLSVGAI
FT                   ICQNWKSAISEERTNEVMRQLSDYQPYVYKDYHWKHLGWFRPGTSRTFNFGPFGRFSCG
FT                   PMTLEEMRSLPGMYPNLKELGFYLGGFNWFTNWISIPLLNLGLRFLGKEAKRSLGRLMV
FT                   WGLRNFDSQPYGMAIKVSARGERGGVRERQDILLSHKDAYMFTAIPLVACLKQYIDGSA
FT                   RRSGLHYMGHLVDSKRLVADMEKMGMTIRFQTQLMDKPPVERPRVEA"
FT   gene            complement(10742..11380)
FT                   /locus_tag="DhcVS_8"
FT   CDS_pept        complement(10742..11380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_8"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_8"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61189"
FT                   /db_xref="GOA:D2BJX7"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJX7"
FT                   /protein_id="ACZ61189.1"
FT                   /translation="MYTVLSLLIGYLLGSIPSAYLVTRRLTGRDIRQMGGGNVGGLNTF
FT                   REVGVGAGAAVVLMDMAKGALAVSVSYYLLAQNAQWVILTGLIAVIGHNWPIWLDFKGG
FT                   KGLGPAFGAMLFLLPVYGLPQQLLILALLVFIPFSITRNVALATGIALFSLPFLVWYGS
FT                   YSEFATLISVLLFLMIGIKFVLDNRKSLRDPANRRNLIVDHWKRPDKGS"
FT   gene            complement(11401..12321)
FT                   /gene="ilvE"
FT                   /locus_tag="DhcVS_9"
FT   CDS_pept        complement(11401..12321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="DhcVS_9"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_9"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61190"
FT                   /db_xref="GOA:D2BJX8"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJX8"
FT                   /protein_id="ACZ61190.1"
FT                   /translation="MGTSYAYFKKQIIPLEDAKIGVMTHALHYGTGVFEGIRGNWNNEK
FT                   KQMYIFRLKEHYTRLLTGAKVLKMNLPYTVDELCKITIDLIKKCGFKEDIYIRPLAYKS
FT                   SETFGVRLHNLECDLLVVAIPWGRYIDKDTCHCCVSTWRRPDDNVMPPQLKSTGIYLNN
FT                   AFTKTEAVENGFDEGIMLTPDGHVSEGSGENLFIVRKGKLITPPICDSILDGITRNSVM
FT                   ELAEKELGLEVLERSIDRVELYMAEECFLTGTAAHLTPVSEIDHRKVGNGEIGPLTAKL
FT                   KDLYFEAIKGNIAKYSSWCTSVYNL"
FT   gene            complement(12467..13642)
FT                   /gene="dinP"
FT                   /locus_tag="DhcVS_10"
FT   CDS_pept        complement(12467..13642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinP"
FT                   /locus_tag="DhcVS_10"
FT                   /product="DNA polymerase IV (Y-family)"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_10"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61191"
FT                   /db_xref="GOA:D2BJX9"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJX9"
FT                   /protein_id="ACZ61191.1"
FT                   /translation="MMAIRRVMHADLDAFFVSVEQAIRPELKGKPVIVGGKPERRGVVA
FT                   AASYEARKLGIHSGMPLLTAKHLCPQAIFIEGTHQLYREYSEKFMQILADFSPFLEPMG
FT                   LDEAYLEVTGFESLHGSIGEMACKIRRRITAELGINASIGIANSKVVAKIATEHAKPNG
FT                   QCEVPAGEEAAFLAPLDISVMPGIGKKTEQHLKSLGIDTLGKLAAPPASFLKSSLGAYA
FT                   PYLSNAAKGIDNRPVEMPAEAKSISRETTFETDTRNHTFLEAKLGYLSEKIAATLRKRG
FT                   KQVRVVQIKIRFADFTTLTRQKHLNHPCSGNREIFQTALTLMNNLLTSDRQAVRLLGVG
FT                   ISDFCGPEKQLELDPARARLEKLDASLDKIRQKYGFGSVQTGRTYKLKDMF"
FT   gene            complement(13639..13851)
FT                   /locus_tag="DhcVS_11"
FT   CDS_pept        complement(13639..13851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_11"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_11"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61192"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJY0"
FT                   /protein_id="ACZ61192.1"
FT                   /translation="MHLPHGSKMLEILPGDVYKLRKPHPCGGTDWKVDFAGSDIGITCL
FT                   CCSHHLLLPRPLFEKKVKCLIKRGE"
FT   gene            complement(13899..14711)
FT                   /gene="pyrF"
FT                   /locus_tag="DhcVS_12"
FT   CDS_pept        complement(13899..14711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="DhcVS_12"
FT                   /product="orotidine 5-prime-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_12"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61193"
FT                   /db_xref="GOA:D2BJY1"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJY1"
FT                   /protein_id="ACZ61193.1"
FT                   /translation="MKFLEKLKQAGNRNKSLLCVGLDPDPKLMPVGMTALEFNREIIAA
FT                   TAPFVCGYKLNLAFYEALGKQGWEMLSETCNLIPPELLTIADAKRGDIGNTSKAYARAV
FT                   FDELDCDGVTVSPYLGYDSLEPFIEYQDKGIFILCRTSNHGSTDFQMLKTEYLGQKRFL
FT                   YEVVADKALQWNRYENIGLVVGATQQEELKNLRLSYPKLPFLIPGIGAQGGDLKATVEN
FT                   GTNPNGELALICASRGILYARSGSEFAQGAAEAANQMRDAINHYRKRF"
FT   gene            14853..15554
FT                   /locus_tag="DhcVS_13"
FT   CDS_pept        14853..15554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_13"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_13"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61194"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJY2"
FT                   /protein_id="ACZ61194.1"
FT                   /translation="MSMKKEFANKDFRRIEAGHGFEINLIRSDSFEIWLDAPEDGFKNI
FT                   EIKQEGDKLWLMYSPSIFSLKNLLPGWYLPRATVKMPLLGGLYVNGATRARLEGFDTDG
FT                   KLEIRLSGASQLEGEVKAGEALIKAEAASEIKLKGVFKKLKLELESGSKVQMEGWAEEL
FT                   EAEAIGVSRIALDGMVCKHAKVKLENASQAELRVEEVLNVKLNGASELKYAGSPCFNEV
FT                   EIKGSSSLSKN"
FT   gene            15503..16387
FT                   /locus_tag="DhcVS_14"
FT   CDS_pept        15503..16387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_14"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_14"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61195"
FT                   /db_xref="GOA:D2BJY3"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJY3"
FT                   /protein_id="ACZ61195.1"
FT                   /translation="MLQRSGNKRFIQPEQKLIKWYNQSPSRRFQVKKAGLLWLSIFLVL
FT                   TLVLLGGGCIPGVDGFITGNGAVENRAFDYTDFNRVEISNVITADISCSDSFEISVSTH
FT                   ENIFEYLELEKSGQTLRIGLKDHFSFTNVKIEASICLPELVGLNISGASEAVVSGFNSV
FT                   NDFTALVTGASRLALRNMMVGQSSFYINGASVASGDLVCGNAGIEVSGASRLELSGQGG
FT                   DIDVLAEGASTVNLEKFLAASAIVEAAGVSNIRVYTNGDLYIKASGVSSVKYFGTPVIK
FT                   NIDISDISSANKG"
FT   gene            16439..17752
FT                   /gene="folC"
FT                   /locus_tag="DhcVS_15"
FT   CDS_pept        16439..17752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="DhcVS_15"
FT                   /product="folylpolyglutamate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_15"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61196"
FT                   /db_xref="GOA:D2BJY4"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJY4"
FT                   /protein_id="ACZ61196.1"
FT                   /translation="MTDYESATSRAAANYDLRRVVELLMRLRNPHMGIPAVHLAGTKGK
FT                   GSTAALIASVMSVAGYRTGLYTSPHLLDFRERIRLDGKMISKAHLVRLMASISPLVEEM
FT                   NDHAYLGKITSFEVMTALAFEFFHRQQATFQVIETGLGGRLDATNVITPNLSVLTPISL
FT                   DHTEVLGDSLAKISAEKAGIIKHFVPVVSAAQRPEAMAVIRERCLKTGSKLIEVTDGYK
FT                   AELLGYTAQGQSLKLSGRQAEYRLCLPLLGHYQRQNALTALASLEVLIEGGFKISPEDI
FT                   CEGFRRTKWPGRFEVIKGNPLLVLDGAHNQEAVAELLLSLEEYLAAVKIEKEKRVLVFG
FT                   TSFDKNVQAMSALLARYFGTVVLTQSVHPRAMKPDLLRKAFDGRGLKVLEADSVPKALE
FT                   LAGRIAPADGLMCVTGSLFVAAEALKGQSQLRLGTGSE"
FT   gene            complement(17961..18224)
FT                   /locus_tag="DhcVS_17"
FT   CDS_pept        complement(17961..18224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_17"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_17"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61197"
FT                   /db_xref="GOA:D2BJY5"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJY5"
FT                   /protein_id="ACZ61197.1"
FT                   /translation="MQSSLIGKIEKAKRYAQEKDRIRFNQLSVQFRGENDIHTTEYING
FT                   KWHCTCNFFAAWGMCSHTMAMEKVLENMLPDEALSNVFAELP"
FT   gene            18525..18986
FT                   /gene="dtd"
FT                   /locus_tag="DhcVS_18"
FT   CDS_pept        18525..18986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="DhcVS_18"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_18"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61198"
FT                   /db_xref="GOA:D2BJY6"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJY6"
FT                   /protein_id="ACZ61198.1"
FT                   /translation="MKAVIQRVSRASVMVGGETAGEIGPGLAVLLGVAEGDTEADAEYL
FT                   VSKIINLRIFADGEGKFNLSLKDLCRELLVVSQFTLLADTRKGRRPSFFEAAQPEEADR
FT                   LYNLFIRLCREEGVQAATGKFGAMMMLEIHNDGPVTIILDSRDRLNPRQ"
FT   gene            19038..19466
FT                   /locus_tag="DhcVS_19"
FT   CDS_pept        19038..19466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_19"
FT                   /product="transcriptional regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_19"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61199"
FT                   /db_xref="GOA:D2BJY7"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJY7"
FT                   /protein_id="ACZ61199.1"
FT                   /translation="MHKQNSIAGELANDGFRLTPQRVLILEALDMAEGHISAEDIYAEV
FT                   GQEYPNINISTVYRTLELLKGQGLVLETDMSDGRLRYHSVNKGSRHYLVCRKCGKITDL
FT                   SEDMVREQEQSILKKYGFAADFKNLVIYGQCQKCGDSA"
FT   gene            complement(19520..20824)
FT                   /locus_tag="DhcVS_20"
FT   CDS_pept        complement(19520..20824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_20"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_20"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61200"
FT                   /db_xref="GOA:D2BJY8"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJY8"
FT                   /protein_id="ACZ61200.1"
FT                   /translation="MSCMRASLLYGRVNVRPAKCFLIKHIGHNDIMGMVGFIPAPKFKL
FT                   FDLLPGYTHIKLVTHHKTLAEYKPALVLTAHRCHPAVRYTNNSLSLFGKLLIIVNYPLA
FT                   GQADKSGALPFKVKNSMNKLIRQADTFNLLQLFFFIHRHIGCMLCHISLLFWSGNIVIE
FT                   GTRAVNPVYIDKQAAIKLNNPMENRKLGRFIIAVAIISFTASTMLYLLHYFIFQDSRHI
FT                   FIYMLGDLAFIPLEVFLVVVVIERILTSREKHALSQKMNMVVGAFYSELGNALLGKLLD
FT                   SFDNPEQISSQMAVDKNWSNAEFKKALTYSAHFSHMPNPGKLDLQHLKNLLDAKRSFML
FT                   TLLENPNLLEKDDFTDLLWASFHLGEELDARQSLENLPETDKAHIANDVKRMYALLLNQ
FT                   WIKYLIHLKSQYPHLYSLVLRTHPFQPSPNAVIHE"
FT   gene            complement(20844..20984)
FT                   /locus_tag="DhcVS_22"
FT   CDS_pept        complement(20844..20984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_22"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_22"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61201"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJY9"
FT                   /protein_id="ACZ61201.1"
FT                   /translation="MANRIAEQIERTIFQFKWLFMPPKAKYAYLWNRSRASLQADYYGL
FT                   R"
FT   gene            complement(21041..23428)
FT                   /gene="comEC"
FT                   /locus_tag="DhcVS_23"
FT   CDS_pept        complement(21041..23428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comEC"
FT                   /locus_tag="DhcVS_23"
FT                   /product="DNA internalization competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_23"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61202"
FT                   /db_xref="GOA:D2BJZ0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR004797"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJZ0"
FT                   /protein_id="ACZ61202.1"
FT                   /translation="MIISLISLGLIGGVALSRLGLPVLPFIMLAAVLGGFWLIFRKRYR
FT                   LLLDLSLGVLALSGGILLSDSQINTNSDPSQLSYYNDSGKLELKGVITENPDNRDRTSL
FT                   IVLNVSSIATTYGWQDVSGNILLTLPSYPEYNYGEEIQINGYLKTPENFEGFDYKAYLA
FT                   NQQIYSVMVYPEITLLSEGNGNPVMAAIFSFRQSLSDSLSKAMPEPESSLAKGILLGER
FT                   SGIPEDIQTEFSISGTTHLLAISGANLSILSGILLTALGWVLGKRGYIYIYLTLILIWG
FT                   YSLLSGFDPPVIRAVIMASIFLSAELLGRQKNAMPALCLAAAVMVAFSPSILWSVSFQL
FT                   SFMSMLGLILVYPMLKELNLRLLERFGLSEGILRTALGIVLDGLGVSLAAIAGIWPVLL
FT                   YYFENISLIGPVATLLAMPAMPFIIVLSFLTALLGLVFPAGAVFMGYLTWLPCRYMLTV
FT                   VSLTASLPGVLLAGIRPGAILMGIYYFLLGVLYQAYKHFLKIPARSHANPSSAIKLRWV
FT                   LAGMAVPVLVFSFSLNPSADQKMHVYFLDVGQGDAILIQYQNQDILIDGGPSPQALCNE
FT                   LDKHLPFFDRNIEMVILTHPDSDHLSGLLEVLERYSVTEVLLPQTQSQDALYQNYQNLI
FT                   EEKAIPARTAQTGMQITLANGAVLEVISPFEGLVSKEADKDNNQSTVLTLSCGQINYLF
FT                   CADIETPAEYQLITNRLLENTTVLKVAHHGSKYSSSTEFLNVTSPVFGLISAGADNRYG
FT                   HPHPETLSRLGLVIAENRIYRTDIWGSLDFATDGQSLYIFRS"
FT   gene            complement(23425..23925)
FT                   /gene="comEA"
FT                   /locus_tag="DhcVS_24"
FT   CDS_pept        complement(23425..23925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comEA"
FT                   /locus_tag="DhcVS_24"
FT                   /product="competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_24"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61203"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJZ1"
FT                   /protein_id="ACZ61203.1"
FT                   /translation="MKVTKKFALLLGLALSLITAQGCSETAPLEVYTPSQISQNQLEIN
FT                   ISGNIKLPGIYPGNTQDTLQSLLEAAGGLMDNSELATIYLSFNPSVSASSAQKIDLNRA
FT                   EIWLLVALPGIGEARANDIITYRNQNGGFKNTLELMLIPGFSQSLYDQIKDLICVFETA
FT                   DMP"
FT   gene            complement(24091..24756)
FT                   /gene="trkA1"
FT                   /locus_tag="DhcVS_25"
FT   CDS_pept        complement(24091..24756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA1"
FT                   /locus_tag="DhcVS_25"
FT                   /product="cation transport protein, Trk system"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_25"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61204"
FT                   /db_xref="GOA:D2BJZ2"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJZ2"
FT                   /protein_id="ACZ61204.1"
FT                   /translation="MYVVVIGGGRLGYYLLKALLNDGHEVLLIEKNSSLCDGINKEMGS
FT                   VCLHGDGCETAVLTEAGTSRADLLIAVTGDDEDNLVACQVAKYKFNVPRTIARVRNPKN
FT                   ESVFKQLGVDSTVNSTNIILEHIEHEVPSHAMTHLLTLHGKDLEIIDIRIPENALTVGK
FT                   QIHDLVLPPQTIISLIVRKDSKPILPRPETTVQAGDQFMIVTSAVNEAEIRDILTSTA"
FT   gene            complement(24761..25165)
FT                   /gene="trkA2"
FT                   /locus_tag="DhcVS_26"
FT   CDS_pept        complement(24761..25165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA2"
FT                   /locus_tag="DhcVS_26"
FT                   /product="cation transport protein, Trk system"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_26"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61205"
FT                   /db_xref="GOA:D2BJZ3"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJZ3"
FT                   /protein_id="ACZ61205.1"
FT                   /translation="MKVVIMGCGRVGAQLATMLDKEGNEVISLDIDAYSFRRLPADFKG
FT                   TALLCNGMDEESLKKAGIETADAFVAVTQGDNRNIMAAQIAKKIFNVPKVVCRIYDPLR
FT                   RDLYTLLGLDAISPTTIFAQMLKDKIEGKE"
FT   gene            complement(25169..25597)
FT                   /gene="uslA"
FT                   /locus_tag="DhcVS_27"
FT   CDS_pept        complement(25169..25597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uslA"
FT                   /locus_tag="DhcVS_27"
FT                   /product="Na+/H+ antiporter C-terminal domain/universal
FT                   stress protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_27"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61206"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJZ4"
FT                   /protein_id="ACZ61206.1"
FT                   /translation="MEFERILVPVDGTETDEEAISLACTISKVSGKTRVFAVHIIPVER
FT                   ALPLDAELSSAITKAEGILAKAEEIAEKQGVKLETDLLQAREVANAIIDEAVEKEIDLI
FT                   LIGLSYKTRFGEFCMGDVLPYILQNAPCRVIVYHQRKV"
FT   gene            complement(25674..27119)
FT                   /gene="trkH"
FT                   /locus_tag="DhcVS_28"
FT   CDS_pept        complement(25674..27119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkH"
FT                   /locus_tag="DhcVS_28"
FT                   /product="cation transport protein, Trk system"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_28"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61207"
FT                   /db_xref="GOA:D2BJZ5"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJZ5"
FT                   /protein_id="ACZ61207.1"
FT                   /translation="MKINNVLHYLGLVVAIVGGFMFIPFIFSLINAGPDQLAFGISIIV
FT                   TLSAGFLLWRFTPITERRISLRESLAIVAGSWIMAALFGSLPFIISGVLPSVIDCIFEA
FT                   MSGLTTTGASVFSNVENLPQGILVWRSLTQWIGGLGIIMLFVTILPMLGIGASQLMEAE
FT                   TPGQQERLTSRIRDTARTLWLLYLGFTVAGFIALVIAGLPGFDAFNIILTTTPTGGFAP
FT                   VSSIGVYNNLAVELILIFFMVASGINFGLYYYLLWKGRPAKFFGNPEFKLYIGILVGCI
FT                   LLINWDLVANAGINIFEGLRQASFQTASVMTTTGFATADFAQWPHFSQAILLVLMVVGA
FT                   SAGSTGGGLKVIRLLVLFKYTYRRILLTFNPNAVIPIKIGGNVISDKLISRSVGLTILY
FT                   FATLWAGFLIMSAIGLDFVTALSSITSCLGNIGPALGTVGPMASYADIPGIGKVVLLTA
FT                   MLVGRIELFTLLVLFVPAFWRWR"
FT   gene            complement(27123..28487)
FT                   /gene="trkA3"
FT                   /locus_tag="DhcVS_29"
FT   CDS_pept        complement(27123..28487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA3"
FT                   /locus_tag="DhcVS_29"
FT                   /product="cation transport protein, Trk system"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_29"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61208"
FT                   /db_xref="GOA:D2BJZ6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJZ6"
FT                   /protein_id="ACZ61208.1"
FT                   /translation="MYIVIAGGGTVGFNIASMLVVEDHEVVVIEQSETAVEYLNRQLDI
FT                   KTIFGNAAIPRILRDAEVQRADLVLAVTDRDETNMVICFIAKEMGAATTAARIRNSEYT
FT                   GYFIPPAKSTLSARRIIRPKSLGIDVFINPEVEMAREILGILSSFYSTPVEQLANGLVQ
FT                   IRNFTIEGSPMAGKTLGELNFIKPCVVASIARKEALLVPQPELVLENEDALYLVAERDN
FT                   MDYLGRMFSAIQRPAHSVFILGGSQIGLLVAEGLADHDVDVKLIEPDEEKSQKAAIRLE
FT                   KAVVLRGDPTDRDFLTEQGVPSADAFVATTENDEFNILSCLVAKNLGVDRSLSVINKPS
FT                   YIPLAEAVDIDVAGSPAIITARKIAHFVLSGGAIAAALLESGQLEAVEFVVSPQASIIN
FT                   QKVNQLDIPKEATIGAVVQNNQVIIPPDEAVIHAGDHVIVVSQLNVLHDVEKLFK"
FT   gene            complement(28491..28643)
FT                   /locus_tag="DhcVS_30"
FT   CDS_pept        complement(28491..28643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_30"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_30"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61209"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJZ7"
FT                   /protein_id="ACZ61209.1"
FT                   /translation="MLKEEILKPISRREHCHHQVFRVERKQKSRISSLISHLKQFRNSI
FT                   SKQRD"
FT   gene            29156..29815
FT                   /locus_tag="DhcVS_31"
FT   CDS_pept        29156..29815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_31"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_31"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61210"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJZ8"
FT                   /protein_id="ACZ61210.1"
FT                   /translation="MRCRVGIGGQLPKISIIPREEKFFDLLEMSAKNMVSTAHELDELV
FT                   NNWVDVDDKVARIADLEHEGDSIAHQIINLLHRTFVTPFDREDIALLAHTMDDVTDFIH
FT                   SAADFMFIYKTGRPGERAKELAGIIVLAAKEVSLAVPHLRYKSEMKQVIAHCVEINRLE
FT                   NMADVAFRAALGELFTDSKDMANIIKWREIFEHMETATDRCEDVANVLEGVALKNA"
FT   gene            29808..30809
FT                   /gene="pitA"
FT                   /locus_tag="DhcVS_32"
FT   CDS_pept        29808..30809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pitA"
FT                   /locus_tag="DhcVS_32"
FT                   /product="phosphate/sulfate transporter, PiT family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_32"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61211"
FT                   /db_xref="GOA:D2BJZ9"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D2BJZ9"
FT                   /protein_id="ACZ61211.1"
FT                   /translation="MPDASFIPYLLIILLAIGFAFVNGTNDTANAIATVVGTRVLSPRK
FT                   AIIMAALANLVGVFTGTAVARTIGKGILGPESLTYETVIAGLVAAVIWSTVATRKGLPV
FT                   SLTHCLVAGLAMAGVAMAGVGAVDWGILLKIIAAVGIAPIMGMAGGYLLMVALLWIFRR
FT                   SVPSKTHGLFSHLQIFSAAFMAFSHGRSDGQMPMGIIALGTVLYTGNAGLWDAIPIWII
FT                   ILSALSISAGTAIGGWRVIQTVGVRMTNLRPINGFAAETAAATVIQIAASIGIPVSSTH
FT                   AISSAIMGVGATRRLSAVRWGVAGNIVGAWLLTFPICGALGFLVAGLFKLVF"
FT   gene            complement(30806..31423)
FT                   /gene="gmk"
FT                   /locus_tag="DhcVS_33"
FT   CDS_pept        complement(30806..31423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="DhcVS_33"
FT                   /product="guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_33"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61212"
FT                   /db_xref="GOA:D2BK00"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK00"
FT                   /protein_id="ACZ61212.1"
FT                   /translation="MTNWNFNKAEKPLLLVVSGPSGVGKDAVLARMKERKLPLTYVVTT
FT                   TTRPKRETETEGIDYNFIKPSEFQQLIGQNELLEWANVYGNFYGVPKAPIRQALSRGFD
FT                   VIVKVDVQGAASIKKIVPNAVFIFLMPPDMEELTRRLEQRLTESPESLKRRLATAPLEI
FT                   EKLPDFDYVVVNPEGEIDNAVREIMSIIAAEHCRIHPRSIEL"
FT   gene            complement(31404..31694)
FT                   /locus_tag="DhcVS_34"
FT   CDS_pept        complement(31404..31694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_34"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_34"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61213"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK01"
FT                   /protein_id="ACZ61213.1"
FT                   /translation="MFIELVHIGFGNILAMNRVIAISPPSSAPIKRIIQESRTKGFLID
FT                   MTNGRKTKAVIFTDSGHIVLAALAPETITGRLSISRGGAVKPELVDDKLEL"
FT   gene            31903..32751
FT                   /locus_tag="DhcVS_35"
FT   CDS_pept        31903..32751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_35"
FT                   /product="GltD-like oxidoreductase, FAD/NAD(P)-binding,
FT                   PyrK"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_35"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61214"
FT                   /db_xref="GOA:D2BK02"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK02"
FT                   /protein_id="ACZ61214.1"
FT                   /translation="MYTIVERQDLLPKVHLLKIQAPKVAAAAAAGQFVILRIDAEGERF
FT                   PLTIADWDVKAGTVTVIYMEIGASTRKLAKLGAGDAILDFAGPLGKPTEIENFGTVVCV
FT                   SGGFAMATIVPIARAMKEAGNRVISVVGARSKDLFFWHDRLEKYSDEMIVCTDDGSAGI
FT                   KGVVTEPLRDLLASSTKVDRVIVIGPSVMMKFCSKTTQPFGVKTIVSLNPIMIDGTGMC
FT                   GCCRVSLDGQTRFACVDGPEFDGHKVDWDGLLVRQKSYVAEEAVAAERCRCKEEGCGNH
FT                   G"
FT   gene            32744..34141
FT                   /gene="gltA"
FT                   /locus_tag="DhcVS_36"
FT   CDS_pept        32744..34141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="DhcVS_36"
FT                   /product="glutamate synthase (NADPH), homotetrameric"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_36"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61215"
FT                   /db_xref="GOA:D2BK03"
FT                   /db_xref="InterPro:IPR006004"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK03"
FT                   /protein_id="ACZ61215.1"
FT                   /translation="MAKAGLNRIDMPKQAVNDRIQNFSEVATGYTPADAHTEAARCLQC
FT                   KKRYCVEGCPVNIDIPEFILALRDGDMPEAARILKKTNSLPGVCGRVCPQETQCEQACI
FT                   LNKKEASIAIGRLERFVADWEREHSAEVNLPKSLKPKSGKKAAVVGAGPAGLTAAAELA
FT                   RLGHDVTLLESLHTAGGVLMYGIPEFRLPKNIVQGEIEYVKSLGVKLELNSVAGRLFSL
FT                   DDLFKQGFQAVFLATGAGLPLFLNVQGENLSGVYSANEFLTRVNLMKAYNFPSSDTPVK
FT                   KGKKVAVIGGGNVAMDAARCALRLGAEEVSIVYRRSELELPARKEEVDNAREEGIKFHF
FT                   LTSPVRFLANEQGQVRAMDCQKMELGEPDASGRRRPIPVDGSEFEMDIDLAIIALGTRP
FT                   NPLVMQSAPDLQVNANGTVAADTSGQTSHKAVWAGGDIVTGSDTVISAMGAAKRSAVVI
FT                   DEYLRSL"
FT   gene            complement(34138..34476)
FT                   /locus_tag="DhcVS_37"
FT   CDS_pept        complement(34138..34476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_37"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_37"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61216"
FT                   /db_xref="GOA:D2BK04"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK04"
FT                   /protein_id="ACZ61216.1"
FT                   /translation="MELYVNQPLWTNQTLVTKAGVFLSNGAADRQTASARKKGGWGMNV
FT                   FRSALLCYVFAMLVLCFIPAWHSFISQITASLDQNLSLVIKLTADPLEYVWKWVLVIFI
FT                   MLLLSRRN"
FT   gene            complement(34461..34994)
FT                   /locus_tag="DhcVS_39"
FT   CDS_pept        complement(34461..34994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_39"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_39"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61217"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK05"
FT                   /protein_id="ACZ61217.1"
FT                   /translation="MKIDPEVRKEINQVLDAMKEAIETKDMEALVALVESEPNVLTVGP
FT                   CPDNVGLGQNGFKRWMQTLLDKATPVKFKYGFTTIKGNGPVAWLDTHVTYTCKNGENQK
FT                   DFDFYLSGVMEKADNGWHWSGMHLSAPTELEFPEGPPPQPEAEKPAEEPKPAAENEAAK
FT                   PEQSEDAPPEWNYM"
FT   gene            complement(35065..35673)
FT                   /locus_tag="DhcVS_41"
FT   CDS_pept        complement(35065..35673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_41"
FT                   /product="SAM dependent methyltransferase, UbiE family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_41"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61218"
FT                   /db_xref="GOA:D2BK06"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK06"
FT                   /protein_id="ACZ61218.1"
FT                   /translation="MLGINYSTVIDPFLRGVRRFIPEFGGIKPGERVLDVCSGSGAQVG
FT                   EYRRRGILGFGLDLSPDMLSLSRRLYDPAPPAASYFTEADARHLPFTDASFDYTSTTLA
FT                   LHDKPAQTRMEILAEMKRVVKPEGYILIADYTCPLPASFPGWVIRTIERIAGDDHYRNF
FT                   RHYLKNGGVPALLEKLDIKTEDTQSISYGLLTVTKAKIS"
FT   gene            complement(35684..35878)
FT                   /locus_tag="DhcVS_42"
FT   CDS_pept        complement(35684..35878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_42"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_42"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61219"
FT                   /db_xref="GOA:D2BK07"
FT                   /db_xref="InterPro:IPR016410"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK07"
FT                   /protein_id="ACZ61219.1"
FT                   /translation="MFDFFFGGIFGLISFAISLAFYFLPTIIALANHRRNTLAIFLLNF
FT                   LLGWTFIGWVIALVWSVKK"
FT   gene            36020..36391
FT                   /locus_tag="DhcVS_43"
FT   CDS_pept        36020..36391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_43"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_43"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61220"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK08"
FT                   /protein_id="ACZ61220.1"
FT                   /translation="MDTEQFKHIVAEAVDSLPEEFLELLDNVEIMVADRPSRIQRRNLD
FT                   MHRGEELLGLYEGVPLTERHASYGMVTPDRITIFRLAILDMVQTEEDIKNEVRRVVKHE
FT                   VAHHFGISDERLEEMGGPV"
FT   gene            36523..36969
FT                   /locus_tag="DhcVS_44"
FT   CDS_pept        36523..36969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_44"
FT                   /product="redox protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_44"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61221"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK09"
FT                   /protein_id="ACZ61221.1"
FT                   /translation="MSDTAVSAQSLHEQGFNCAQSILGAFAPSLGIETGIAFKLASAFG
FT                   GGMAARGDSCGVISGGLMVIGLKFGQTSAENKAAREKCNRLGREYIKQFEAEFGATACR
FT                   DLIKCNIGTPEGAKLVKEKGLREGLCSKLVYRGAQMLSALIEQA"
FT   gene            complement(36966..38069)
FT                   /locus_tag="DhcVS_45"
FT   CDS_pept        complement(36966..38069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_45"
FT                   /product="GTP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_45"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61222"
FT                   /db_xref="GOA:D2BK10"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK10"
FT                   /protein_id="ACZ61222.1"
FT                   /translation="MAVTIGIIGLAKSGRTTIFNAATRSNAATGSYSQSSSANIGIVKV
FT                   PDARLTPLEEMFHPKKLTPAEIKYFDVGASLKGGTKDSSFSGELLTQLQNVDALLNVIR
FT                   AFEDTAIPLPAGGINAERDLTTMNAELIFSDLTIIEKRLNRIGSQMKGAKPPERAALER
FT                   EKELMARIKEAMEKDIPARDIELDEEEAKILSGYQFLSSKPVLMVINIGEDDLPKAAEM
FT                   EAELNGRYGGKNYRVIVMCGKLEAELINMDEAEAAEFRSSYGLKETGLDRTIRASYELL
FT                   DLISFFTVGPDEVRAWTITRGTIAQKAAGKIHSDIERGFIRAEIVHVNDLLAAGSLAEV
FT                   RKRGQLRLEGKTYIVQDGDTANFLFNV"
FT   gene            38232..39491
FT                   /gene="holA"
FT                   /locus_tag="DhcVS_47"
FT   CDS_pept        38232..39491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="DhcVS_47"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_47"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61223"
FT                   /db_xref="GOA:D2BK11"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK11"
FT                   /protein_id="ACZ61223.1"
FT                   /translation="MFNGLFPYLRGYFHIIGNGNMFAEFVGHYNFFGHCFKSSKCSLRA
FT                   DCNIMQGSFALNFKGYAPVSLCYNISRRWLLNLLYIFTGSDDFSLKERLKQIKLALGDE
FT                   SLSSANTTMLEGKNLTAAELQNYVQTVPFLAPARLVIVNGLLERFEGSKGKAAAKDTAS
FT                   KTSPDEFARALSNLPPTTLAVLLDYTSSKDGDYREKEKVSALASNPLFKLVSPGAEVKH
FT                   FAPLSAQNLPGWVMQRAKQSSIQMSVPAARLLARFVGADLWTLSSEIEKLGLYAQGRVI
FT                   EEADVENMVGYAQEVNIFALVDAVLDCKVKDAQQSLTAFTAGGGSPGFLLFMLVRQLRL
FT                   MVRYTALKKRGLKEAEIFKAMGGSEYALRKTASQAACQNMDSLKAIYSKLLETDFNIKT
FT                   GRFEPELAMGLLVAELCGRK"
FT   gene            39466..40104
FT                   /locus_tag="DhcVS_48"
FT   CDS_pept        39466..40104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_48"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_48"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61224"
FT                   /db_xref="GOA:D2BK12"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK12"
FT                   /protein_id="ACZ61224.1"
FT                   /translation="MPNFAGENSLEEKRKQSLKEQLKAVNWGSLLLTFGALIALSFLLA
FT                   WGLNSLVDSLEIPLDEYAWLTYLLVFVMSILANATVIAPVPFAISIMVAAATNFNPVMV
FT                   ALFGALGGSLGEMSGYFAGRLGKKLAIPEGLVGYSRVESWIQKYGAWAIAFLAAQPVVP
FT                   FDVGGLIAGLARMPVHKFLPALFLGKFPKYIVMVYAGIGLIDWLPFLKS"
FT   gene            40138..41142
FT                   /gene="nagC"
FT                   /locus_tag="DhcVS_49"
FT   CDS_pept        40138..41142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagC"
FT                   /locus_tag="DhcVS_49"
FT                   /product="transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_49"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61225"
FT                   /db_xref="GOA:D2BK13"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK13"
FT                   /protein_id="ACZ61225.1"
FT                   /translation="MNRSNLEVILKPCLCLDIGGSKIRSAVVTHDGRVVAWEQEPTCAR
FT                   NGAEGVFENICRVLERLLERNNLCLSQFEALSAAVAGGIDMPNGLVTQSPHLPAWRDVP
FT                   LRDMLAERYLKTFLINDASAAALAEHKLGVGRGVKNLVYLTVSTGIGGGIIINDELYLG
FT                   QSGCAGEIGHMCLDINGTEDVCGNVGCLETLASGTAIVRRVQAELAGGEFSLLSERFRA
FT                   DYSALTAEDIGRAASEGDRLCQGVIRRAGEYLGIGLAGIANIFNPELIILGGGVSKLGE
FT                   IFIEPARKMLFKRAFRLAGDDVRLVASFLGDNAGVTGAALYAYGCLGDGNKTP"
FT   gene            41249..43879
FT                   /gene="alaS"
FT                   /locus_tag="DhcVS_50"
FT   CDS_pept        41249..43879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="DhcVS_50"
FT                   /product="alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_50"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61226"
FT                   /db_xref="GOA:D2BK14"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK14"
FT                   /protein_id="ACZ61226.1"
FT                   /translation="MAGAALFSSDELRENYLKFFEEKGHKRIASSSLIPHNDPTLLLTT
FT                   AGMVQFKPYYLGVAKPENPRMTSCQKCFRTTDIESVGDASHLTMFEMLGNFSIGNYFKK
FT                   EAIAWAWEYVTQRLNIPAERLWVTVYLDDDEAIALWKEQGVSEGRIVRLGAADNFWGPA
FT                   GDSGPCGPCSEIHYDFGQEMGCGKADCNPSCKCGRFCEIWNLVFVQFNQDKSGKRQNLP
FT                   APSIDTGMGLERLTILMQSKKNVYETDIFAPIVEKACQLSGKKYGCDTATDRALRIVSE
FT                   HSRGITFLIADGVIPDKAGRGYVLRRLLRRAVLFGRRLGLEKPFLVDMAGAVIARMSGI
FT                   YPELKKRQTYVLEMIASEEARFSETLATGLELLEEIVRQIKGGQISGQDAFKLYDTYGF
FT                   PVEMTTEIAAERGLSVDLGGFEAEMEVQRTKARSSRKFSFDAAATAEAVKNMRHGEKTC
FT                   FVGYELTRQKSTIMDILTEGGSVDSIEEGDEASIVLDESPFYAEMGGQVGDTGEIITGG
FT                   GRFEVKNTLHLPNGVFLHQGRVISGCLKISESAAAHIDEERRRDIARNHTATHILQTAL
FT                   RQVLGEQVQQRGSVVTPERLRFDFSHLRPMTKDEIRRAEEFVNDKIRRNLPVYAEEMPY
FT                   RHALEEGVTALFGEKYGDRVRVLRVGRPAVSAELCGGTHVSASGEISLFKIVSESSVGA
FT                   GLRRIEAVTGREAEAYINLQQDSLSELSGMLEAAPEESLRKLAELKEEIDTLKKTVQNL
FT                   ERQMSRGEAEELLSKAEDYKGIKLLVSRMTSVNADTLRETADFLRDKLGSGVIVLGTVS
FT                   EDKPFFLCMVTPDLIEKGYHAGNIVKKLSQIAGGGGGGKPNMAQGGGRDKAKLDEALQA
FT                   VKGML"
FT   gene            43926..44327
FT                   /gene="yqgF"
FT                   /locus_tag="DhcVS_51"
FT   CDS_pept        43926..44327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqgF"
FT                   /locus_tag="DhcVS_51"
FT                   /product="Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_51"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61227"
FT                   /db_xref="GOA:D2BK15"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK15"
FT                   /protein_id="ACZ61227.1"
FT                   /translation="MGDKWIGVALSDPLRILASPLVILRRDDDGKTVENIEALVKTHQP
FT                   DLLVVGLPVSLNGTIGPQAEKVKAFSGLLSQSLDTEIVFRDERFSTDEARRKMNDSGKN
FT                   NKTVRDDAAAAAVILQDYLDETNPPCFQP"
FT   gene            44349..45527
FT                   /gene="qrt"
FT                   /locus_tag="DhcVS_52"
FT   CDS_pept        44349..45527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qrt"
FT                   /locus_tag="DhcVS_52"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_52"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61228"
FT                   /db_xref="GOA:D2BK16"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK16"
FT                   /protein_id="ACZ61228.1"
FT                   /translation="MDKSFILNKTSPRSSARRGQLLTAHGQVETPVFCPVGSQATVKTL
FT                   TPEDLKSVNVNMILSNTYHLYLRPGIPVVKEMGGLHKFMNWDGVILTDSGGYQIFSLAN
FT                   LRKLDEGGVSFRSHIDGSTRYITPEDAVSFQQDLGSDIAMVLDECPHSEASENEVLAAM
FT                   ERTHQWAKRCLAAHTLKSQHLFAIVQGGLSPVLRQQSAEYLASLDFPGYALGGLSLGEP
FT                   KDITFETVRHTLRFLPGNKPRYLMGVGAPEDLLEGVSCGVDIFDCVLPTRVARNGAFFS
FT                   RLGRLNIRNASFATQKGPVDPECNCYTCRNYSAAYLHHLFRCEEILAYRLATIHNIAFL
FT                   SNLMQEVRTSIEKDCFEEFKGDFLARYQPTNESVRIEQKQKWLSARSGETPS"
FT   gene            45621..46763
FT                   /gene="adh1"
FT                   /locus_tag="DhcVS_53"
FT   CDS_pept        45621..46763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh1"
FT                   /locus_tag="DhcVS_53"
FT                   /product="alcohol dehydrogenase, iron-containing"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_53"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61229"
FT                   /db_xref="GOA:D2BK17"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK17"
FT                   /protein_id="ACZ61229.1"
FT                   /translation="MITTFELSTRIIFGVGSISSLNHEASLLGRHALLVTGKEAVRRLG
FT                   ILERALFLLKEACIQTTLFDRVEPNPRSSTVDAGIALAREKGIDLIIALGGGSAMDAAK
FT                   AIAFGLACEGPVWDYIKQGEYPEGDFLPLIMIPTVAASGSEANGNAVISNWENHEKRVI
FT                   SDNHLQPKVSLVDPLLTLSLPPRQTAQGGVDIFCHIAEPYLTAADSSPLRDGLAELAMR
FT                   LVVEYLPKAVKTPHDLQARTQLSWLSTIACSQFMSLGGKSGNMTMHGLEHALSGYYDIA
FT                   HADGLAALLPAYMRNLYPVRRHRIEMLGEKVFGQTDGIAAVENWLKKNNMGFSLKELGV
FT                   SEAKIDEIAAAAIVMSPWVKNHPGLLDKRVVTSLYSTAFN"
FT   gene            47031..49975
FT                   /locus_tag="DhcVS_54"
FT   rRNA            47031..49975
FT                   /locus_tag="DhcVS_54"
FT                   /product="23S ribosomal RNA"
FT   gene            50082..50199
FT                   /locus_tag="DhcVS_55"
FT   rRNA            50082..50199
FT                   /locus_tag="DhcVS_55"
FT                   /product="5S ribosomal RNA"
FT   gene            50378..52852
FT                   /gene="clpC"
FT                   /locus_tag="DhcVS_56"
FT   CDS_pept        50378..52852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="DhcVS_56"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_56"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61230"
FT                   /db_xref="GOA:D2BK18"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK18"
FT                   /protein_id="ACZ61230.1"
FT                   /translation="MSSRFDKFSERARRVLTYAQEEAQNLNHNYIGTEHILLGLVREEE
FT                   GVAARVLVNMEVNLAKVRSAVEFILGRGEHPATSETGLTSRAKKVIELGIDEARNLGHN
FT                   YIGTEHLLLGLLREGEGAAAGVLESFGVTVEKVRTEVGRILNQGLNKPKTSRTTPSRTP
FT                   QLDQLGFDLTAAARTGKLDPVIGRAKEIERVVQILSRRTKNNPALIGEPGVGKTSIVEG
FT                   LAQRIVSGDVPETLEQKHIISLDVASLVAGTKYRGEFEERLKKVIEEIKNAGNIILFID
FT                   EFHTMVGAGAAEGAVDAANILKPSLARGEVQVIGATTLDDFRKYVERDAALERRFQPVL
FT                   VEEPAIEDTLNILRGIKERYEEHHKLIISEEAIAAAANMAARYIPDRFLPDKAIDLVDE
FT                   AASRVRIKKRTKPVSLKEMKAIEDSYRRDKEAALATQQYDYASELRERELQIAEKIRRM
FT                   EDEWQNEQAMDKPVVGEEDIAQVVSMWTGVPLVQLTGDETERLLHMEEALHERIIGQEE
FT                   AIVTISKAVRRARAGLKDPRHPIGNFVFLGPTGVGKTELARALAQFMFGSEDALVRLDM
FT                   SEFMEKFAVSRLVGAPPGYVGYDEGGQLTEAVRRKSYCLILLDEIEKAHPDVFNILLQI
FT                   FDDGHLTDAKGRRVDFRNTIIIMTSNIGAELIRKGSGTIGFATQTDESKAQQTNFEHMK
FT                   DKLLGELKKSFRPEFLNRIDSVVVFHSLNKEQIRSIVDLMLKSVIKQMSEKGIGLEVTE
FT                   SAKDLLGKKGYDEVYGARPLRRTIQTMIEDRLSEDLLRAKFKAGDKVIVDIAEDEIIVR
FT                   LAEPAELSQATS"
FT   gene            52975..53364
FT                   /locus_tag="DhcVS_57"
FT   CDS_pept        52975..53364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_57"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_57"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61231"
FT                   /db_xref="GOA:D2BK19"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK19"
FT                   /protein_id="ACZ61231.1"
FT                   /translation="MACPLPEELKRKLNNGLLLMRTGMWVTIFLSLLHGFILLEYQAFQ
FT                   IALIVALGAGFIMWLGIMLTMRMPMAGGVLGLCFSLPLAVLIGYYLFQGVLVAPLAGLL
FT                   FGSIFYQGGCLVVIGSYESYLRRNI"
FT   gene            53427..54815
FT                   /gene="radA"
FT                   /locus_tag="DhcVS_58"
FT   CDS_pept        53427..54815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="DhcVS_58"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_58"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61232"
FT                   /db_xref="GOA:D2BK20"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK20"
FT                   /protein_id="ACZ61232.1"
FT                   /translation="MEKSRRVYVCSNCGRESLKWLGRCPGCQEWNTLEETTVVSPVGRK
FT                   NEPARVISPAAELSSLQAAETTRRSLSISEFNRVLGGGIVPGSLMLLGGEPGIGKSTLL
FT                   LQVAASVAQSGGKVVYVSGEENPAQIKMRAQRLGISGEGLFLMAETDLNAILAQLSVLS
FT                   PSLVVIDSIQTVFLPELEAAPGAINQVRESALRLMQWAKSSGASVFITAHVTKEGNIAG
FT                   PRILEHIVDVVMYFEGESQSAYRLVRSVKNRFGSTNEVGIFEMKSEGLVEVANPSQIFL
FT                   SNRQTNTVGSAVTAVLEGSRPLLVEVQALTNTTSFGQPRRTANGVDFNRTLMIAAVLSK
FT                   RLSMRLGTQDIIVNATGGIRLDEPAADLAIALAIASSYRDIGVCPETIALGEIGLSGEM
FT                   RTISHLERRLSEASRLGFKRALVPAGANCHNVHNIQIIPVSTVKEAVRLALTGVKTETE
FT                   DVFE"
FT   gene            54802..55485
FT                   /gene="ispD"
FT                   /locus_tag="DhcVS_59"
FT   CDS_pept        54802..55485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="DhcVS_59"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_59"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61233"
FT                   /db_xref="GOA:D2BK21"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK21"
FT                   /protein_id="ACZ61233.1"
FT                   /translation="MFLNEKVGAVIVAAGQSRRMEGQDKIFALLAGKPVLAHTLSVFQK
FT                   SPEIDDIALVMAEHNIEKAKELIKEYNFSKVIAVCPGGELRQDSVCSGLTALCDCGWII
FT                   IHDGARPLLDTASIPEGLEAAKLCGSAIAAVPLKDTIKEISPEGLVEKTLPREKLISVQ
FT                   TPQVFRADIIQKAYRRVGITATDDAQLVEKLKLPVKIFSGAYANIKITTPEDLLMAEIL
FT                   LKKGR"
FT   gene            55491..55964
FT                   /gene="ispF"
FT                   /locus_tag="DhcVS_60"
FT   CDS_pept        55491..55964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="DhcVS_60"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_60"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61234"
FT                   /db_xref="GOA:D2BK22"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK22"
FT                   /protein_id="ACZ61234.1"
FT                   /translation="MRVGNGYDVHRLAPGQKLVLGGVEVPFECGLIGWSDADVLTHAIM
FT                   DSLLGAAALGDIGLYFPPGDPKFKGISSLKLLEQVTALLAEKGFGIINVDSVIVAEEPK
FT                   LRGHVDTMRKHLAKAMGIDPGRVGIKASTSEQLGFVGREEGMAAWAVALVDEK"
FT   gene            55968..57341
FT                   /gene="cysS"
FT                   /locus_tag="DhcVS_61"
FT   CDS_pept        55968..57341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="DhcVS_61"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_61"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61235"
FT                   /db_xref="GOA:D2BK23"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D2BK23"
FT                   /protein_id="ACZ61235.1"
FT                   /translation="MKIYNTLSGKLEEFVPLEDGKVKMYVCGITPQSEPHIGHAMSYIN
FT                   FDVIRRYLSYKGYRVKYIQNFTDIDDKIIAKANAQGIEPSTLAERNIGVFLDAMAALNI
FT                   TPADYYPRATQEVPKIIEMVSGLIEKGYAYEAGGSVYLRVQKVDGYGKLSHRTLEQMMA
FT                   GARVEIDEEKEYPMDFALWKATKPGEPSWESPWGLGRPGWHIECSAMSLRYLGEQVDIH
FT                   GGGQDLIFPHHENEIAQSECFSGVKPFVKYWLHNGLLKLGEEKMSKSLGNLVTIKEALS
FT                   RYSADALRIFVLSSSYRNPLTYSEEALEAAEKGAERLRQTAARQDNPQSNETNVDVKTY
FT                   RERFTQYMDNDFNTSAALATIFDLSRELNRIEAEGGKSTDGQKLFKELADILGLSLKIA
FT                   EPETGTDAVPFIELLIELRKDLRLAKQYQLADKIRTSLDSAGILLEDSAGGTVWKAKK"
FT   gene            57449..57524
FT                   /locus_tag="DhcVS_62"
FT   tRNA            57449..57524
FT                   /locus_tag="DhcVS_62"
FT                   /product="tRNA-Ala"
FT   gene            57561..58559
FT                   /gene="xerD1"
FT                   /locus_tag="DhcVS_63"
FT   CDS_pept        57561..58559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD1"
FT                   /locus_tag="DhcVS_63"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_63"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61236"
FT                   /db_xref="GOA:D2BFY6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D2BFY6"
FT                   /protein_id="ACZ61236.1"
FT                   /translation="MSYRLSTQKSHDCSNIASYLLTAEDNLEKSLASFLLVCKVGQLSP
FT                   ATIHNYSYMVGKFIDFCSRNGVSTPPQITQLVVCLFIQELQMTNSAQSVLDYFKQVRRF
FT                   INWLRENDQISIDPLKNIRLPKVPRRIIQPFNKEQCQTLLDLVSLPTLEARRNKAILMV
FT                   FMDTGIRCQELADMKLEDLNFETETIKIFGKGAKERVVRISRRTQKALLEYQFERMKLM
FT                   PNDKCPFVWVSRLKNRYSRKQSHQLTNDGIRRMIENLGKKAGIQNLRCSPHTFRHTFAT
FT                   MSLLNGAGEFELQSLLGHSTLTMTRRYTASLTSQNAVLAHKKFSPVENMRL"
FT   gene            58743..59021
FT                   /locus_tag="DhcVS_64"
FT   CDS_pept        58743..59021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_64"
FT                   /product="transposase IS3/IS911-family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_64"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61237"
FT                   /db_xref="GOA:D2BFY7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D2BFY7"
FT                   /protein_id="ACZ61237.1"
FT                   /translation="MPRKAFTAEQIINKLREAELILNQGTTVPEACRKIGVTDQTYYRW
FT                   RKEYGGLNVDQAKRLKDLEKENVQLKRLVADLSLDKAILKEASRGNS"
FT   gene            59228..59857
FT                   /locus_tag="DhcVS_65"
FT   CDS_pept        59228..59857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_65"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_65"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61238"
FT                   /db_xref="GOA:D2BFY8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2BFY8"
FT                   /protein_id="ACZ61238.1"
FT                   /translation="MQIAGWRVNHKRVERIWRKEGLKVPQKQSKRGRLWLNDGSCIRLR
FT                   PEHKDHVWSYDFVAERTINGRAFRILNIIDEYTRECLAMKIGRRITSQEVIDKLFELFL
FT                   LRGIPKNIRSDNGPEFTAKQIRNWLNRIGVNTLFIEPGSPWENGYIESFNGKLRDELLN
FT                   REIFFTLTEAKVLIEEWRKDYNQIRPHSALGYRPPAPEAVMSAVLT"
FT   gene            complement(59884..60474)
FT                   /locus_tag="DhcVS_66"
FT   CDS_pept        complement(59884..60474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_66"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_66"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61239"
FT                   /db_xref="GOA:D2BFY9"
FT                   /db_xref="UniProtKB/TrEMBL:D2BFY9"
FT                   /protein_id="ACZ61239.1"
FT                   /translation="MNTLVRLIQAVLLVIMLIIAWNAVAYFVNSADSGDSTPTVRSIPT
FT                   KQSILQAPLTLDGLKTSGRYADGYVFLDFYDSYRLVNYLNKYDYSETHQPYNAGSRYGM
FT                   YFSDVFYLVPGDNLKIVIYSDVPLGQDLNCEISKYTNKGPVGVTPSYNVERYENGYRAV
FT                   LSCYATESGTYQFRLWHQDKTASKRCAIVFYFE"
FT   gene            60563..60781
FT                   /locus_tag="DhcVS_67"
FT   CDS_pept        60563..60781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_67"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_67"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61240"
FT                   /db_xref="GOA:D2BFZ0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D2BFZ0"
FT                   /protein_id="ACZ61240.1"
FT                   /translation="MMTEKTIEQRFGERIRNLRKQAGVSQEELADRAGVHRTYLGGIER
FT                   GERNPSLKNIYAISKALKVPVSDLFKN"
FT   gene            complement(60931..62484)
FT                   /locus_tag="DhcVS_68"
FT   CDS_pept        complement(60931..62484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_68"
FT                   /product="cobalamin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_68"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61241"
FT                   /db_xref="GOA:D2BFZ1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D2BFZ1"
FT                   /protein_id="ACZ61241.1"
FT                   /translation="MNTATRYATRQITDQAGRQVYFGCLPQRIISLAPSLTEIVYALGA
FT                   EDLLKGVTDYCDYPPEAKNRPKAGGYSTVDVDQIGKIQPDLILAGQIHLKDIVPRLEAL
FT                   GYPVLVLEPSTVEGLLETIRIVGKCTGRAKAAELLAESLGRRTDFITAKIASLSPENRP
FT                   LVYVLHECQTWKTFGSDTIGDTLIEMAGGYNIGRDFGRYYPYPAKEDIKLKNPDIIIAE
FT                   TGYGDNPREPLNIAFSEPVLAEVTARRTGQVFGIHSDLVSRAGPRMVDGLECLAHLIHP
FT                   ELFPAKSAVCCGRVYIAGVGPGLAKWVSPRVKELVAEADILVGWEQDLKPVKSLIKSQR
FT                   IFLQEPGNYLEVPKLAALEAQKNGDTIVVLKTGDPLVAPAGLDGIVSTFNGFEVEVIPG
FT                   ISSVQLAAAKAGISLYDAAIITYHPLPHDGGKDLREKRRRMLNALSWGLHLIVLTGVRQ
FT                   LPNATARYLLDRGIAPDSRVMVIENPACPDEKITNCSLADVSSQRWGWLSVMVVFNKPD
FT                   "
FT   gene            complement(62481..63287)
FT                   /locus_tag="DhcVS_69"
FT   CDS_pept        complement(62481..63287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_69"
FT                   /product="CbiZ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_69"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61242"
FT                   /db_xref="InterPro:IPR002808"
FT                   /db_xref="UniProtKB/TrEMBL:D2BFZ2"
FT                   /protein_id="ACZ61242.1"
FT                   /translation="MQLKNTGYSPVTLEREVCSLPGIKAEVFSTRVWGAPANLLAVFFD
FT                   ENHAALSGTDGYGSIRLVCNCYLPKDLCDYLHFNHKDYDDYLKDLKQEMASFYSLETQE
FT                   IFMLSTGVSMDEVCYTLESGDKLWVCAWVTAGFKHNAMRIGVDKGAGLEVEGECQPCGT
FT                   INIITATNARLDSAALASSFVTVTEAKVVALQDLNIHSSFNPALQATGTGTDQIVAVSG
FT                   RDCGCRYVGGHTRLGEMTARAVTSACQKALSIQLAKDPNYHSGSKK"
FT   gene            complement(63301..64452)
FT                   /locus_tag="DhcVS_70"
FT   CDS_pept        complement(63301..64452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_70"
FT                   /product="aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_70"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61243"
FT                   /db_xref="GOA:D2BFZ3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D2BFZ3"
FT                   /protein_id="ACZ61243.1"
FT                   /translation="MDELIYLDNAASTPIDPRVVTAMMPYFTRHYGNPSAIHPMGRRAD
FT                   EALETAREQVAALINCQPEEVIFTSGGTESDNLAISGAAMAGRGRHIITSEIEHHAVLE
FT                   ACHALEKKGFKVTYLPVDSFGQVSPKDVEAAITPQTALVSIMAANNVIGTLQPVAEIGA
FT                   VCRRQGVIFHTDAVQMAGHLPLDVKQDNIDLLSLSAHKFNGPKGVGILYAKGDVPLAPL
FT                   ILGGGQESGLRSGTENVPGIAGLGLAAGIAKLEMAEEAGRVSSLRKKLAEAILGFVSGS
FT                   RLNGHPQKRLPGNLNISFEGVEGEYLSKELAKQGICVSTGSACSSASHEAPYVLLATGL
FT                   ERDLANCSIRLSLGKMTTPEHIQKTADTLSAVVSQIRRQTPVW"
FT   gene            complement(64464..64724)
FT                   /locus_tag="DhcVS_71"
FT   CDS_pept        complement(64464..64724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_71"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_71"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61244"
FT                   /db_xref="UniProtKB/TrEMBL:D2BFZ4"
FT                   /protein_id="ACZ61244.1"
FT                   /translation="MAREMTHCYVKIPVKPLDDIAMEKLRQLEQKLGLPLIAFSARSNE
FT                   YARLSAEELAELDKLGAELDASIVAYSRGKTARPAGQSCRI"
FT   gene            complement(64740..65696)
FT                   /gene="cobD"
FT                   /locus_tag="DhcVS_72"
FT   CDS_pept        complement(64740..65696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobD"
FT                   /locus_tag="DhcVS_72"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_72"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61245"
FT                   /db_xref="GOA:D2BFZ5"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:D2BFZ5"
FT                   /protein_id="ACZ61245.1"
FT                   /translation="MNEYILILILAVLWDLALAEPPAAIHLTVWIGRVISLVEKVGLKI
FT                   RNHALQYIFGMAASLFLIALFGWLTYLLLDYLGGLSFALYLIAAFLILKTTFCLRFNAR
FT                   MSLLVEKYLKGGDYRIESAAPEIRYLLTTVERDKEDGFAPPMISSTIRSLAENASDFLV
FT                   APLFYFLILGVPGAVAYRVCNTLDGMLGHRGEYEYLGKFAACLDDIINYLPARLTGLMF
FT                   ILAAFVSGMDGKNAWRIALRDQSKTESPNAGWPMASVAGALGVRLERAGHYALGDAAKP
FT                   LSPGHIGQAVRLFGVMSAISIAGSTGILLAVYLLSLN"
FT   gene            complement(65711..66244)
FT                   /gene="cobA1"
FT                   /locus_tag="DhcVS_73"
FT   CDS_pept        complement(65711..66244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobA1"
FT                   /locus_tag="DhcVS_73"
FT                   /product="ATP:corrinoid adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_73"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61246"
FT                   /db_xref="GOA:D2BFZ6"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BFZ6"
FT                   /protein_id="ACZ61246.1"
FT                   /translation="MFKVSDQPGFVQVFYGDGRGKTSAAMGEIVRAVSAGLRVGVVFFM
FT                   KGERRNAEYSSLKALGVEYAVFGRSGFLSGADARAEDARLCRQALTFAAGQISSDKWDL
FT                   VVLDEINNALYYGFIETEDILRLLSIKPARTSLVLTGKTVDKEVAEKADLVDKFRKLKH
FT                   PYDQGILARAGIDY"
FT   gene            complement(66237..67994)
FT                   /gene="nrdJ1"
FT                   /locus_tag="DhcVS_74"
FT   CDS_pept        complement(66237..67994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdJ1"
FT                   /locus_tag="DhcVS_74"
FT                   /product="ribonucleotide reductase, cobalamin-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_74"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61247"
FT                   /db_xref="GOA:D2BFZ7"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:D2BFZ7"
FT                   /protein_id="ACZ61247.1"
FT                   /translation="MKLSQNARIVLEKRYLKRDGDGNIAESSEDMFRRVADTVAAAENA
FT                   YNPPGKAACMAEEFYCMMTGFEFLPNSPTLLNAGRELGLLSSCFVLPVADSVEGISKTI
FT                   GEAMVIHQYGGGTGFAFDAIRPEDDPVKSGHTVAGGPVRLVGVFSEAANYIKQAGVRCG
FT                   CNSASLPVNHPDILKFIRAKDEGNHSANFGINIALTDSFIQKVRLGADYELVNPRTGRV
FT                   SGSLSAAEVFYRIARSSWETGDPGIMFIDRINKDNPTPRLGEFITTDPCGGQPLLPYES
FT                   ATLGTINLSGMLLKEGNCCRVDYPRLGGLITKAVRFLDDVLEVNRYPTAEVEKAAKATR
FT                   KIGLGFMGFAEMLIKLGIRYDSADAVSAADELMAFVKEAACQATEELALERGAFPAFAG
FT                   SIYAKRGAKPRRNATCLTFTNTGTTSIIADTSVGIHPIYSLVMVRNILDGQRLLDINHA
FT                   FEETARERGFFSPALIEKLLTGESPCNCPEIPEDYRRLLVTARDIQPEWCIRVQAAFQK
FT                   YTDNAISQTVNFPANASVEDIADLFLKAHELGLKGVTAYRDSSRESQVLCTGADCRDIA
FT                   RKYFEDCCV"
FT   gene            complement(68003..68743)
FT                   /locus_tag="DhcVS_75"
FT   CDS_pept        complement(68003..68743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_75"
FT                   /product="radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_75"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61248"
FT                   /db_xref="GOA:D2BFZ8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D2BFZ8"
FT                   /protein_id="ACZ61248.1"
FT                   /translation="MNIYQITYEPNYRVLGLHFWGCNLFCRGCYKNYRIEDLSLPGSSV
FT                   EQLKDAPRAKNPARFLTLEEVLEKTEGLTPRDIFFMGKEASLDPELPLLAARLHARHKS
FT                   FHTLLTNGHKLTDLSDIDEAVFGFKSASESVHREYTGLSNTGILANFKKVYQSGKKVQA
FT                   EIAFIPDLVEEEEIGMLAKTIAEIDRRLLFRVTAYFAVPGAPWPSACREQVEDAASVAR
FT                   RYLDNVVTMASDSRDNGWKPEVIF"
FT   gene            complement(68749..69528)
FT                   /locus_tag="DhcVS_76"
FT   CDS_pept        complement(68749..69528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_76"
FT                   /product="adenosylcobinamide amidohydrolase, CbiZ"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_76"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61249"
FT                   /db_xref="GOA:D2BFZ9"
FT                   /db_xref="InterPro:IPR002808"
FT                   /db_xref="UniProtKB/TrEMBL:D2BFZ9"
FT                   /protein_id="ACZ61249.1"
FT                   /translation="MTTKSELKKISLGSFEGFTADTVYYTAIGYPNNVFALRFNEMRDV
FT                   ISSRHGIMKSDFLTICHIPDELGLYMHDQSKSHFYYYGRLLADVLKEYDVEIENTAFLS
FT                   TGVQMRNLAFAVERYEELWVVCFTTAGVRHNAVRIGKDAAVGIERNGEFKGFGTICHVV
FT                   VTNASFDHGALVSSIITVTEAKNVALQEMDIRSSHNPDWLATGTGTDQVIVASGFGEKC
FT                   KYVQGHTVIGKMMADAVIKSTKEAVANCIRDTAGQPD"
FT   gene            complement(69558..70382)
FT                   /locus_tag="DhcVS_77"
FT   CDS_pept        complement(69558..70382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_77"
FT                   /product="radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_77"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61250"
FT                   /db_xref="GOA:D2BG00"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG00"
FT                   /protein_id="ACZ61250.1"
FT                   /translation="MTISNLKYQNNPKLWADKMDRQTNVYHVAYAPAIKKAYLFHWGCN
FT                   LECKGCLCKKEINCMALEENLDVVFRDPRFCPPQTPSAPLSFGKLISLLQDIELTEVAF
FT                   EGQEASLDPMLPDICRWLKERDCKVILHTNGVAMADASHIDDVIVSLKAITPEIYAGYT
FT                   CRSNASLLENFKKYYQAGVNLKAESVFIPGYIDLEETEKIARFIASVDENIPYRMDAYF
FT                   ESGDNPWRPPTPEEMQMALEVARKHLKNVYCTQQTKQNLSKADLLYEVVRLY"
FT   gene            complement(70398..71120)
FT                   /locus_tag="DhcVS_78"
FT   CDS_pept        complement(70398..71120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_78"
FT                   /product="tetrapyrrole methylase, precorrin-6Y
FT                   C5,15-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_78"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61251"
FT                   /db_xref="GOA:D2BG01"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG01"
FT                   /protein_id="ACZ61251.1"
FT                   /translation="MAGTVSRIYYPRVFVTGVGTGGRVFLTPAAEETVKNCGIIVGWPE
FT                   VIKNLGFGVENKLVLEQNCLNYQQLLAEAAGLARAKLEDIALLVMDDPLVYSAGLSGYS
FT                   DIFEDFRIEFIPAVSSLQLLAATARLSLEDCLQVVYKPDASGNIDQSDLALKRERMLKA
FT                   LKAGYHILVLSDLEQTLAQTACFLLEKGLAVETRVLVGEQMGTDSQKITEKSIMEVSRD
FT                   TSHWMSCMAVRQGKILKR"
FT   gene            complement(71125..71871)
FT                   /gene="rdhI"
FT                   /locus_tag="DhcVS_79"
FT   CDS_pept        complement(71125..71871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhI"
FT                   /locus_tag="DhcVS_79"
FT                   /product="radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_79"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61252"
FT                   /db_xref="GOA:D2BG02"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG02"
FT                   /protein_id="ACZ61252.1"
FT                   /translation="MKTNIYHITHTPTTGSVSLRFWGCNMSCHGCLCKEGIYDHLLKEN
FT                   RLGNLPQTENAFKPRRLLELDEVLARLDELKPQKVFLTGEEASLDPNYAAITRAFHERY
FT                   GCENVLYTNGFKMPVLEDTDAVEVGIKAISEDLHQRYTERSVEPIKQNFIRYAHSEVKL
FT                   TAASILIPGLVEIDEIERIAQFIASVNPDIPYFVLPYFPAGNNSWRKTSPYEVAEAVER
FT                   VSRYLTNVSGCQGVEQEILHEVERVV"
FT   gene            complement(71874..72626)
FT                   /gene="rdhH"
FT                   /locus_tag="DhcVS_80"
FT   CDS_pept        complement(71874..72626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhH"
FT                   /locus_tag="DhcVS_80"
FT                   /product="PP-loop ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_80"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61253"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR030662"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG03"
FT                   /protein_id="ACZ61253.1"
FT                   /translation="MEKAFVSWSGGKDCSLSLYRSLRDGYDVRYLASMFTEGTGRLYPH
FT                   HFTPELLISQAKAIGIPLEVTWTSGQEYTNNYIKMLKGFREEGITVAVFGDVSVGNPDA
FT                   LEHRMWVERVCQAADMRVVLPLWDEDRESIIGDLIDSGFETLIVAADNTNLGKGWLGRK
FT                   LDNELFEELKLLNASSPDGKVGLYHTLTVDGPIFRKKLEIADKKIIYKECGLYDGKPAV
FT                   APFWYLELEGCFLVDKPVLIAESAAGLE"
FT   gene            complement(72815..73114)
FT                   /gene="rdhB"
FT                   /locus_tag="DhcVS_81"
FT   CDS_pept        complement(72815..73114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhB"
FT                   /locus_tag="DhcVS_81"
FT                   /product="reductive dehalogenase anchoring protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_81"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61254"
FT                   /db_xref="GOA:D2BG04"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG04"
FT                   /protein_id="ACZ61254.1"
FT                   /translation="MAGFFSFPWDWLITGIVVGAAVMWLQNWLSMKNLKLMWYHWIIGL
FT                   IGLGFVLFGLQNLFAALKELEPRAALNFIWAIILPGILLLVLSWQLARAYNRKS"
FT   gene            complement(73132..74556)
FT                   /gene="rdhA"
FT                   /locus_tag="DhcVS_82"
FT   CDS_pept        complement(73132..74556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhA"
FT                   /locus_tag="DhcVS_82"
FT                   /product="reductive dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_82"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61255"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012832"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR028894"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG05"
FT                   /protein_id="ACZ61255.1"
FT                   /translation="MGKFHLTLSRRDFMKSLGLAGAGLATVKVGTPVFHDLDEVISNEN
FT                   SNWRRPWWVKEREFDKPTVDVDWGIYKRFDKFTYAPANARIAMFGQEAVMKANQDWNNL
FT                   VAKRLQEDTAGFTIRDRAMDEGLCEEGINGGYPAPRTASLPQDLADMADPPIVLSKGRW
FT                   EGTPEENSRMVRCVLKLAGAGSVAFGVASEDKAEKFIYTHEHVWGDFKHYKIGDYDDIW
FT                   EDEETRYHPHKCKYMITYTIPESEELLRRAPSNFAEATVDQAYSESRVIFGRMTNFLWA
FT                   LGKYICGGDCSNAHSIHTATAAWTGLSECSRMHQQTISSEFGNIMRQFCIWTDLPLAPT
FT                   PPIDMGIMRYCLTCKKCADTCPSGAISHEDPTWERAFAPYCQEGVYDYDFSHAKCSQFW
FT                   KQSSWGCSMCTGSCPFGHKNYGTVHDVISATAAVTPIFNGFFRNMDDLFGYGKNPGMES
FT                   WWDQEPRYRGLYREIF"
FT   gene            complement(74601..75023)
FT                   /locus_tag="DhcVS_83"
FT   CDS_pept        complement(74601..75023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_83"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_83"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61256"
FT                   /db_xref="InterPro:IPR024422"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG06"
FT                   /protein_id="ACZ61256.1"
FT                   /translation="MKIKHLLFTQCLVWILLLSMLCAFSGCSSSSSDINTTIPTAPTTS
FT                   TPPVVNKIDINELVNAYKEDWVKADSLYKGKVFSFTGKITKYLNARAIVLNDYILCKAS
FT                   LSQPFETIELGKEYAVNQKVCQGWSEIDGCVVFNTQ"
FT   gene            75451..78705
FT                   /gene="rdhC"
FT                   /locus_tag="DhcVS_84"
FT   CDS_pept        75451..78705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhC"
FT                   /locus_tag="DhcVS_84"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_84"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61257"
FT                   /db_xref="GOA:D2BG07"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR011110"
FT                   /db_xref="InterPro:IPR011123"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG07"
FT                   /protein_id="ACZ61257.1"
FT                   /translation="MKRQHTKNRTCCILLAASFLCVFSLPDRIFAAEDNITEHLSSDIV
FT                   FETIPVLNSFNEDLVFTITQDSYGYFWFGTNNGLAKYDGIKTTIFKNDSSNPASLPGTS
FT                   VQSLACGSDGTVWIGTNNGLCRIDSATNQISVLSGQSQSGCNINSISASDISVDASGNL
FT                   WIGTWDNGLIYYNISNSSVREFSSKTGFNLTSDHVWDICISRNNLIWFGTDDGTLACLL
FT                   PENENLTIYNYSPNNTSGLPENRSINSLLEDNTGNLWFGTDGGGLIKFNTGNSTFTQFK
FT                   LGLSVSSSVWDIILDSKGILWLATFGNGLVKFDLATDTYTHYKADSISEYGLKDNTIYS
FT                   IFQDQDNQIWLSTRYAGIQKFKYYDHGLDIVTILNEDGNPIRESITAIITAPNGTVWIG
FT                   TDGFNLIRYETQSDLFRRYIYNAPIGQYIDNDFISSLAIDKRGNIWMGTYSGNLIGFCP
FT                   ETEDFINPNLGAQEIDSVSVTSLLYSFEKDILWIGTVSGTICSFNPQNFEFVNYWQEYG
FT                   ISMHSRIEQIINYGPNNLLLKTAGNLYNLNLSQHAIQPINNLPPNISKSEIMAIYLAGE
FT                   KIWLCADKIYCLDLNLRLIFDLDVIQDYRIYNCTQFGTGIIWLQTSKGIAKIDQYEESI
FT                   SYYNLNVNWTYDALSNNFCFIDDNRLIIGSRNILMMVYTPNITQSNIPSQLILNSILAG
FT                   TSMLPASVTNNNEINLSYKQNYLEFNFVLLDYLDSTHNVYAYKLEGFDSNWRYTDSTQP
FT                   QAVYPDLPVGHYTFRLKAMNSEGLWTNTETLFNFKIDAPFWNEPWFYILCLAGFTGLVE
FT                   IIVLSRTRYISQQNRKLEILVYNRTKALQREILRQKKIRSALNEQIRRRKALINSLVHE
FT                   LRTPLTPIIGSSEILLEKLEGDARLYRVAKNISSAAESMNQRIRDLVDSAKSEIGMLKI
FT                   EKRPVDIQEFMSNLQDYLGTCACIKNQTFKFEISPDPQNIAIDEDRFRQVMINLINNSM
FT                   KFSPSGSQIEITAGPENERWHVSVKDQGCGIEQKYLGKIFKPYFCINSANRDSQGMGLG
FT                   LYIANQIIKLHGGRIWAKSEFGQGSEFIIDLPMDRK"
FT   gene            78702..79382
FT                   /gene="rdhD"
FT                   /locus_tag="DhcVS_85"
FT   CDS_pept        78702..79382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhD"
FT                   /locus_tag="DhcVS_85"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_85"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61258"
FT                   /db_xref="GOA:D2BG08"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG08"
FT                   /protein_id="ACZ61258.1"
FT                   /translation="MKILLIEDDKDIIEYITIALEMGHKDISLFTSMDGKRGLEILETQ
FT                   QPDLVMLDLMLPDMDGFNLLKSIKLSSNTPVIIITARASEIDIVKGLMLGADEYIIKPF
FT                   GQMEIIARIMAVVRSHKSNALDDIIRGDIRFNAFKSTISFYDKVISLSRTEALIINELF
FT                   NKDEQVTTYEEIGQALWGESYPGMQNAIRVYIMRLRTKLSQASSGKVLIRTKPGIGYYL
FT                   SLNS"
FT   gene            79559..80242
FT                   /gene="rdhD"
FT                   /locus_tag="DhcVS_86"
FT   CDS_pept        79559..80242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhD"
FT                   /locus_tag="DhcVS_86"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_86"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61259"
FT                   /db_xref="GOA:D2BG09"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG09"
FT                   /protein_id="ACZ61259.1"
FT                   /translation="MKVHIISNDTELLEAIILAFKVGWPKTSILSSNLGSQGLEILEKE
FT                   IPDIIILDLVLPDTSGFNVLKNIRLFSSVPVVIVTARAEESDIVKSLELGADECIVAPF
FT                   GQMELLARVKMVKRRSVSPVLNANINHNEVFIDIKNAQLTINQRSLHLTHTECLIMQCL
FT                   IEKLGQVVDFVELSEVLWGEDYPKAADNLRVYIRRLRAKLKTVWIDSTLIFSKPGVGYY
FT                   LSLPR"
FT   gene            complement(80747..81022)
FT                   /gene="rdhB"
FT                   /locus_tag="DhcVS_87"
FT   CDS_pept        complement(80747..81022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhB"
FT                   /locus_tag="DhcVS_87"
FT                   /product="reductive dehalogenase anchoring protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_87"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61260"
FT                   /db_xref="GOA:D2BG10"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG10"
FT                   /protein_id="ACZ61260.1"
FT                   /translation="MANLLVGILLGAVILMVFYWIRSKHYKLTWYEWVIGILGALLLLF
FT                   TIQNFLGSFAELQTLAAYLFLLVTGLPSLIMLAVVWQLVVRRAKKT"
FT   gene            complement(81035..82573)
FT                   /gene="rdhA"
FT                   /locus_tag="DhcVS_88"
FT   CDS_pept        complement(81035..82573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhA"
FT                   /locus_tag="DhcVS_88"
FT                   /product="reductive dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_88"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61261"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012832"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR028894"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG11"
FT                   /protein_id="ACZ61261.1"
FT                   /translation="MEMNIYHSTISRRNFMKGLGLSGAALGAATASAPVFHDLDEMITS
FT                   VPKSTTQHAWWVKERDYEDITTPVDWTVWSRREALKNPMPPGFAGNYVPKEQARLQSFR
FT                   DEIKRGITEKIPGATLRDWALSEAGRSNTTSSSWMGLDVKPPWLWGEASALPVEPWPEG
FT                   APKWESTPEDNLRTVQAAGHYFGTPQVGAMEINEHMIRMFDKDGFEHNYSESYEKPMMR
FT                   FRSEWFEDIPVGFQDANQVKHIPKSCKWAVTYIAAKENALQMTYGMRTGDPQDPWYKRI
FT                   FPLGYTTGEAYSKADYVKVQFMKFIKMLGYQTYYMGLAGGTSSNSPAGVFSGLAEEARP
FT                   ALACSPYYGNAVRHIGIIVTDMPLSPTKPIDAGIVNFCKVCKKCAETCPSGAISMETEQ
FT                   QWEPACTGNNPGRKTWYLDWFKCRPWGSPYYCPNCQTVCPFNNPNKAIIHNAVRMTAAT
FT                   TPIFNSFFSSLDKSFGYAHQRSDEERLNWWYRDLNTWQYDDVFGMGTKDPKSWL"
FT   gene            82911..83189
FT                   /locus_tag="DhcVS_89"
FT   CDS_pept        82911..83189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_89"
FT                   /product="transposase IS3/IS911-family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_89"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61262"
FT                   /db_xref="GOA:D2BFY7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D2BFY7"
FT                   /protein_id="ACZ61262.1"
FT                   /translation="MPRKAFTAEQIINKLREAELILNQGTTVPEACRKIGVTDQTYYRW
FT                   RKEYGGLNVDQAKRLKDLEKENVQLKRLVADLSLDKAILKEASRGNS"
FT   gene            83222..84025
FT                   /locus_tag="DhcVS_90"
FT   CDS_pept        83222..84025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_90"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_90"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61263"
FT                   /db_xref="GOA:D2BG13"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG13"
FT                   /protein_id="ACZ61263.1"
FT                   /translation="MRIRLGISERRACQVLGQARSTQRRKESITDDEAKLTLRIIELAS
FT                   KYGRYGYRRITAILQIAGWRVNHKRVERIWRKEGLKVPQKQSKRGRLWLNDGSCIRLRP
FT                   EHKDHVWSYDFVAERTINGRAFRILNIIDEYTRECLAMKIGRRITSQEVIDKLFELFLL
FT                   RGIPKNIRSDNGPEFTAKQIRNWLNRIGVNTLFIEPGSPWENGYIESFNGKLRDELLNR
FT                   EIFFTLTEAKVLIEEWRKDYNQIRPHSALGYRPPAPEAVMSAVLT"
FT   gene            complement(84052..84783)
FT                   /locus_tag="DhcVS_91"
FT   CDS_pept        complement(84052..84783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_91"
FT                   /product="DNA-binding response regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_91"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61264"
FT                   /db_xref="GOA:D2BG14"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG14"
FT                   /protein_id="ACZ61264.1"
FT                   /translation="MVNNQQYQSIKHSNHIEHKIRVILVDDHEIARQGLRNILSSASDI
FT                   QVIGEAANFEQMMDLLNDTIADVALIDIQIPGKNGIELAKELQIYFPQMATLLITGYQS
FT                   NLYVAEALNCGIPGLITKDSRQGLIINAVRVAANGGSVWENAVLSETIKSMTRLCEAQY
FT                   SMRTYSGNSQFQQEKKVLLSSKQLELIKLVACGLTNKQIGSKMGYSEATVKKYLSVLMY
FT                   LLGVSKRTQVGIMATHFDINQ"
FT   gene            complement(84784..85875)
FT                   /gene="rdhC"
FT                   /locus_tag="DhcVS_92"
FT   CDS_pept        complement(84784..85875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhC"
FT                   /locus_tag="DhcVS_92"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_92"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61265"
FT                   /db_xref="GOA:D2BG15"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG15"
FT                   /protein_id="ACZ61265.1"
FT                   /translation="MESDWIRLMNITRQEKLLLTQFAVDRANDGIIWLKPDGCIVYANE
FT                   TLCKMVGYNAEELYKMNIDDLHSSHEKYCTRFERLKKLGGRAILEGSYRNKLGYFIPVE
FT                   ISGNYLLFDGKEYNCGIVRDITNRKIIEEELRYKNIQLEKKGKRIKALSKAYVQAQEQE
FT                   REWISIEIHDRIIQPLTSLFQQMQTVFSVDPTSERIVDGKLLVLVKSAIKETRNIMNDL
FT                   YPSDLGRHGLVKVMNEQLLELENRTGIKTQLSMGFCVTIPHSIEVTLYRIFHEALLNIE
FT                   RHSHANNVLVYLTLSDDRKLIELLVKDDGQGFDLETILNNSKSKGIQSMKRRAEVVGGE
FT                   LFLDSRRGKGTAIEVHLPVKEMN"
FT   gene            86454..88733
FT                   /gene="rdhC"
FT                   /locus_tag="DhcVS_93"
FT   CDS_pept        86454..88733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhC"
FT                   /locus_tag="DhcVS_93"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_93"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61266"
FT                   /db_xref="GOA:D2BG16"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG16"
FT                   /protein_id="ACZ61266.1"
FT                   /translation="MNMDKDPVNNIPELFDMFFNESRDGLILLDAPTGIIKLVNPEFQN
FT                   QIGLPLEKIIGKPIWNLRPPQDRSLGKALYQQRFNSNVKLSTHEVIYQRGDKTKIVVEL
FT                   LSKLLEYDGKKHLIIITRDVTASKQIGRISRITQFAVDNAGDVIIWLDSLGNIVYANKS
FT                   TTKLLGYSKEALLSMAIWDLDMNITPSIWEKYSAASGETFSDMKETLFKAKNNLLIPIS
FT                   IAVNRLVYEGVTYNCIFARDLSESKRTEEALLRTQFAFDHAADAIFWLDDQGQFIYSNN
FT                   ATTELLGYSKRELYHMRIDYIDINFPRSSWESEFQQLKKDNYGYIETLYRTKKCNFIPV
FT                   SVMGNYLNYAGKDFNCCFVRDLSEIKQVDKAYRMAQFAIDTSGDAIFWLDRNGKILYSN
FT                   RATTELLGYSSTQLSNMTINELDPTVVLEEWPSRFDALKSLGSDVVESVLKTKDGTILP
FT                   VSIMGNYLNYDGKEYNFVFVRDISERLKIEEALRQQQALLEKTVLERTSELTNTNSLLQ
FT                   VEITERKNAEKKLEKLLKEEALLRQEIENQMAQRIEFSRALVHELKTPLTPILGASAIL
FT                   AKNFTEEPWHSVALNIENGAQNLNKRVDELLDVARGEIGILSIKPNWFDPLKLLNELSN
FT                   YVAPEASLNKQVFVTELPDKLPLVWADKERLQQIVLNFLDNAFKYTPRNGQVTLRAYTC
FT                   SNNLVIEVQDTGPGILEEEKARIFKAYARFKKQCRRESGLGLGLALAAMIVELHKGKIW
FT                   CDSIGN"
FT   gene            88807..89493
FT                   /gene="rdhD"
FT                   /locus_tag="DhcVS_94"
FT   CDS_pept        88807..89493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhD"
FT                   /locus_tag="DhcVS_94"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_94"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61267"
FT                   /db_xref="GOA:D2BG17"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG17"
FT                   /protein_id="ACZ61267.1"
FT                   /translation="MKILVIEDNKDIIDFISLAFQVGWPGIKLEIARRGEDGLELIEKE
FT                   APDAVILDLGLPDIDGFEVLKRMRLFSQIPVIILTVRKEELDIVRGLELGADEYMTKPF
FT                   GQMELLARLRAILRRQNVMTEEPSIIAGPFRFSCYMHKLHYNNREIPLTTTEGMILHHL
FT                   AVNSGNVISHTSLAETVWGEEYDGASDSLKVYIHRLREKIEEDPSNPKIIITKSGVGYM
FT                   LMKNKV"
FT   gene            89681..90409
FT                   /gene="rdhH"
FT                   /locus_tag="DhcVS_95"
FT   CDS_pept        89681..90409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhH"
FT                   /locus_tag="DhcVS_95"
FT                   /product="PP-loop ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_95"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61268"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR030662"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG18"
FT                   /protein_id="ACZ61268.1"
FT                   /translation="MADVFVSWSGGKDCCLSAYRAIRNGHNVRYLASIITNNTGRLWPH
FT                   LLTPEILNLQAQAMGIPLLEWVTDISNYDSEYIKMLRYLKGQGVNHGVFGDVSIGNAQA
FT                   IEHKAWIDSVCVPNGIVSHLPLWDETRESLWRDLLESGFEAIIIAVDNDKLGKDYLGQR
FT                   LDKDLLSELKVRHQLSPTGEVGYYHTFVVDGPIFNHKLKLIKAEPIQYTVPKDVWYLDI
FT                   QECKLEKKEACSPPLKISPY"
FT   gene            90484..91974
FT                   /gene="rdhA"
FT                   /locus_tag="DhcVS_96"
FT   CDS_pept        90484..91974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhA"
FT                   /locus_tag="DhcVS_96"
FT                   /product="reductive dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_96"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61269"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012832"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR028894"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG19"
FT                   /protein_id="ACZ61269.1"
FT                   /translation="MSIFHSTLNRRDFMKALGLTGAGMGTIAASAPVMHDVDELLASAE
FT                   DTEIKHQNPWWVKERDYFNPTVPIDWDLKWRVDGRNARLYNVQDSKWYFNAYSETQAKI
FT                   YAEYAENEDPEFKWGDPRRMALEAGCSFAQFGSLTLSSGTYSLHSYLGNPPTKTPETNG
FT                   YAKWVGTPEENLLLLRGAVRFFGGDDVGVMEHDTHLDRVLCTYDMNGYKNSFEDIDEPY
FT                   QTQSPKVTGIPNSYKWCFTWTLRQPMDVTRRQQGGIMRAYPNYNKYGEAESVGVWRAYS
FT                   ELAIVENRLQLFLRGLGYRGIAGGMSAITSGNAIATVAGCMEHARMGQVAVHPKFGSTV
FT                   RGTYKMMTNFPLAPTKPIDAGIYEFCKSCQICAEHCPTGIIQKSDPTWTTGRNPEDGND
FT                   NGTFGEPLPYQAQGFEGWRTDIGKCPHCPVCQGTCPFNELPNASWIHTLVKATAANTTL
FT                   FNSFFAQMDRNFKYGRKPYIGFWDDFGTRPTYDMDTTR"
FT   gene            91998..92264
FT                   /gene="rdhB"
FT                   /locus_tag="DhcVS_97"
FT   CDS_pept        91998..92264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhB"
FT                   /locus_tag="DhcVS_97"
FT                   /product="reductive dehalogenase anchoring protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_97"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61270"
FT                   /db_xref="GOA:D2BG20"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG20"
FT                   /protein_id="ACZ61270.1"
FT                   /translation="MWLGLLLGLIFGIGAMLLLKKGFIIRWYIWLLSALAFLSLYGGIT
FT                   HYVGSIHEYEPTAGLYGLLVFVCIFVILAALAFQLAWRQNKPR"
FT   gene            92419..92694
FT                   /gene="rdhB"
FT                   /locus_tag="DhcVS_98"
FT   CDS_pept        92419..92694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhB"
FT                   /locus_tag="DhcVS_98"
FT                   /product="reductive dehalogenase anchoring protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_98"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61271"
FT                   /db_xref="GOA:D2BG21"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG21"
FT                   /protein_id="ACZ61271.1"
FT                   /translation="MWFLIGIAIGAAVLGIVALLRTKKIALTWYEWVLGIIGMGLLLFT
FT                   LQNFFGSFAELESKAAYVFLIIPGIPAVIMLALAWQLAARRQSKSA"
FT   gene            92719..94131
FT                   /gene="rdhA"
FT                   /locus_tag="DhcVS_99"
FT   CDS_pept        92719..94131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhA"
FT                   /locus_tag="DhcVS_99"
FT                   /product="reductive dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_99"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61272"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012832"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR028894"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG22"
FT                   /protein_id="ACZ61272.1"
FT                   /translation="MTNYHSSVSRRDFMKAMGLVGAGMGAATAVTPAFRDLDELTASTD
FT                   LSVYKKWWIKENDFGQLTTEVDWKVFNSFDTAKHPMPVMFGPTANGAMSAKNLANRKKR
FT                   QTDGMLNKWPGSTLRDLALDGATGGNYPSIPWNGPNVSTPEGRGVPRWEGTPEDNTIMC
FT                   KAASHFYGAPRCGAIEVDDKVKKFFNTSVVWEDTDTAYTTSDGKQHVPNKCKWILTWLT
FT                   KQNHAMNKYTLRNNPDDPWYNTVFRQGKAGENQAYSHAPQIQYQVMGFLKGLGYQAIKA
FT                   TASGNTQFGVWSGLCESGRTTYALSPDYGLMVRYIDFCITDLPLAPTKPINAGLSVFCK
FT                   NCMTCAKVCPSNTISLEKEPSWDTKDPGNNPGLKTWYLNWTTCAEYGGPFDCVNCQTVC
FT                   PFSHDNDKSAIHNIIRGTVGTTHLFDGFFANMEKFWGYNTQLSDQVHTDWWYRDLETWE
FT                   HDTLLGFGTKGW"
FT   gene            94198..94947
FT                   /gene="rdhI"
FT                   /locus_tag="DhcVS_100"
FT   CDS_pept        94198..94947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhI"
FT                   /locus_tag="DhcVS_100"
FT                   /product="radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_100"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61273"
FT                   /db_xref="GOA:D2BG23"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG23"
FT                   /protein_id="ACZ61273.1"
FT                   /translation="MKVYHLIYEPSYRSAVFHHWTECNLGCKGCFCKAEKLDFGLFPDA
FT                   LERLKDRPPETAPERFIESAEEALGILSGYPVERAVFIGTEPTLDPDLPALAKALHRKY
FT                   GSYNILLTNGVKQCDLSDIDEIIFSLKAVTDDIYKAYTGRSNEKTLENFKKVHASGKKL
FT                   QAECLLIPGLIEADEVEKIAVFIAKADKDITLRIDGYFPIPGCPWRGASTEEVAEAAKR
FT                   ALKHLSKVNYLTADLPRQGETPVRLFG"
FT   gene            94970..96454
FT                   /gene="rdhI"
FT                   /locus_tag="DhcVS_101"
FT   CDS_pept        94970..96454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhI"
FT                   /locus_tag="DhcVS_101"
FT                   /product="radical SAM/B12 binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_101"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61274"
FT                   /db_xref="GOA:D2BG24"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG24"
FT                   /protein_id="ACZ61274.1"
FT                   /translation="MKILLVNPGTEYKPRFRTYAVFPNGLLYMASVLEGAGHEVKVFDN
FT                   VVSELTPPDYARDFAPDVIGFSVLTGPCIGNALIQSKEFKALLPGVKVVWGNVHATCTT
FT                   EQTLKEEAIDFVVRGDGEYTLLELVNRLEKGDGDYAGILGLAWKDKEGRITINQPRPFI
FT                   HNLDELPDPAWHLIDVPKYWDITLNTSRGCPFKCSFCYNIPFHQGHRADLSVERIVSQI
FT                   EHLQKNYKVKFIRFFEDNFTFNRRRMREFCRTIIERRIKIKWDTESRADMSEEDVALMA
FT                   KAGCTSVGIGVETGSKRMLEYLNKGIDLDEMGHTFWRFVRHGIMPRLYIMLAVPSETPA
FT                   DFKETQDMLRKMEDPPFMYMRFVPYPGTPLYEELVDNKRIKPPESLEEWAKFSVYFATR
FT                   GNLSELSDEQITQALSHWAHTYASRRVMFTLRHNPRYLLGAVKNPSEFFKALGSLIKNS
FT                   LPVAFNKNTNIKPLVLEAVPNKMSGKQEPRLISNYD"
FT   gene            96493..96957
FT                   /locus_tag="DhcVS_102"
FT   CDS_pept        96493..96957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_102"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61275"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG25"
FT                   /protein_id="ACZ61275.1"
FT                   /translation="MIHKNVAKFSWRIFPCFLIVYLALITGCEQNQFQVISPEIPTVCL
FT                   DSLVEIDRLILSESPLESEETTESLTVFNSGIRQIYCTFWLTDDLCCTVITLRLKDNAQ
FT                   VLFEWKMNGNQIGFPQTVIMEFETGLGTGQYLLEIYMDTKMRVNFELVIV"
FT   gene            complement(97127..97399)
FT                   /gene="rdhB"
FT                   /locus_tag="DhcVS_103"
FT   CDS_pept        complement(97127..97399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhB"
FT                   /locus_tag="DhcVS_103"
FT                   /product="reductive dehalogenase anchoring protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_103"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61276"
FT                   /db_xref="GOA:D2BG26"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG26"
FT                   /protein_id="ACZ61276.1"
FT                   /translation="MWMIIGILVGLAIWGVVQFAKNKGLNLTWYDWVIGLLGLGLLLFT
FT                   FQNFIGAFAEAEDKAAYLFLLVTGLPSLILLAVAWQLAIRRAKKA"
FT   gene            complement(97423..98994)
FT                   /gene="rdhA"
FT                   /locus_tag="DhcVS_104"
FT   CDS_pept        complement(97423..98994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhA"
FT                   /locus_tag="DhcVS_104"
FT                   /product="reductive dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_104"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61277"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012832"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR028894"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG27"
FT                   /protein_id="ACZ61277.1"
FT                   /translation="MANFHSVINRRDFMKALGLVGAGAGAAAAVAPVFRDLDDVVASPT
FT                   ATFPRAWWIKERDLWNITTEYDWKAMSRHDTCETMWIKHSWAKYVGVDKVKEAAASAAA
FT                   IKKEALETGKPGMDLRASALGSTSGLYNAPQPYFSYVKTAQGWGGGKSLTGQSTIKGPD
FT                   VLGVPKWQGDPDSNLRMLRAALRFYGAAQIGVVPYDTNVKNKLTCVREGGMASMSDKYI
FT                   EKWPIPAVDARPWVFEDVEKGYETAEKLVIPDKKELFVVSVIQPMSREMWRQGSGNLRV
FT                   ATNGHRYSLASVWQTKIQGFLTTLGYQGLGYPTRAYGPMPTIPGFLFSGLGELGRSNNV
FT                   CLSPEYGSTHGSFHFLTDLPLTPTKPIDAGMWRFCKTCAICAENCPSQSISYDKEPSWE
FT                   ITPSKYAPNVPVEYSVPGKKVFWRDEPSCKQWTESCGYSCGICMGSCVFNVDNASMIHQ
FT                   VVKGTIATTSLFNGFMKQADKFFGYGLTPESEWNNWWDMNLPAYAFDTTVGVTDGGYKS
FT                   KGLLQQ"
FT   gene            99210..102422
FT                   /gene="rdhE"
FT                   /locus_tag="DhcVS_105"
FT   CDS_pept        99210..102422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhE"
FT                   /locus_tag="DhcVS_105"
FT                   /product="histidine kinase CheY-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_105"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61278"
FT                   /db_xref="GOA:D2BG28"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011110"
FT                   /db_xref="InterPro:IPR011123"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG28"
FT                   /protein_id="ACZ61278.1"
FT                   /translation="MKHILVFIAVICLIVLPICSNPVKAQEFTRFEHISIDDGLSQSSV
FT                   TAIIQDREGFIWFGTRDGLNRFDGYTMYTFSSNPEDPRALSDSYINCIFEDSRGIIWIG
FT                   TLSGGLNKFDKMTETFSTFRHSEGDNQTLANDSVRMIREDPAGFLWLATPNGLDRFNPQ
FT                   SGTFEHFNLQNGLSNNSVWSILITEEGTVWIGTEDGIDQFQAENGVYKHSNRLTSDLSG
FT                   NTIRYLFEDKTGNIWISTYNGLDCLNPLSGIITHFENIPGNPSSLSNNRIRTICQDNVG
FT                   NLWFGTTDGLDKLEQGTNKFIHYKNDPGNPDSISNNIIWSLMVDRSGVLWIGTLNGGVN
FT                   RLSLTKQVFICYRNNPGNVNSLSNNIVKSVYQDQNGFIWIGTLGGLNKFDPLANTFSLF
FT                   SHNSYDPQSIAGDTIKAIIGDNNGNLWVGTTSGLDKYSEQSNQFTHFSHNQSDTKSISD
FT                   DVIWSLFFDSHGQFWVATNRGLDKFDPISSEFTHFGAAYGLPETTIYTIFEYEPGVLLL
FT                   GTDYGLYRFDTISGTSVSFRFDAANPTTINNNVVRCIYQATNSTILVGTHAGLNEFNVA
FT                   EGTFKRFTQLNGVTYGILEDNFGYVWISGNNGLTRLSLANETTKTFNKTDGLQSDEFSE
FT                   GAFFRDSSGLLYFGGINGLNVFDPSKLQIETAKSNIIITSLDLIGGDTSFKLPEQIFGG
FT                   VTLEYENNSFTINFAALEFEACQKVRYYFQLVGFDKDLRIANYNQRDISYTNIDNGKYT
FT                   FKIYAADQDESWVSDTAYLSIRITTPFWESWWFYSVCGILSLAVIYFIIKLRIWAIQKQ
FT                   NDRLESLVEIRTDQLKTEIEKQQITENKLKNEIENRAKFTRALVHELKTPLTSLSISSE
FT                   LFAGEATDEPFISLSRSIERSVMNLSKRCDEMLDLARGETGLLKINKQMLDLDSFIEGI
FT                   KTDLLSIAFSKGILLTFEYKKSTRKAYIDPDRINEVINNLTDNAFKFTPPNGTITIKTD
FT                   ISDEQFMFEISDTGCGINKEYQKRIFSPGYKGETNPRLDGLGIGLILAKMFIELHKGKI
FT                   WVKSKPKSGSIFGFSIPIGEKD"
FT   gene            102422..103099
FT                   /gene="rdhD"
FT                   /locus_tag="DhcVS_106"
FT   CDS_pept        102422..103099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhD"
FT                   /locus_tag="DhcVS_106"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_106"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61279"
FT                   /db_xref="GOA:D2BG29"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG29"
FT                   /protein_id="ACZ61279.1"
FT                   /translation="MNVVIIEDDDVIIESLTLLFRMRWPETKLVSSKLGDKGLELIVDW
FT                   NPNLVILDLGLPDLDGLEVLKRIRLFSNVPVIILTVRGDEAEIVKGLEYGADDYITKPF
FT                   KQLEFLARVKALTRRQEVPAIATCYQKGPFRLVSATHRLYLKDKEIALTHTEYLIFYKL
FT                   LENANVVISHNTLSKMLWGEDYPDSVDAIRVYISRIRQKIHDDSSEPSIILTKTGLGYM
FT                   LSA"
FT   gene            103315..103737
FT                   /gene="xerC"
FT                   /locus_tag="DhcVS_107"
FT   CDS_pept        103315..103737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="DhcVS_107"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_107"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61280"
FT                   /db_xref="GOA:D2BG30"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG30"
FT                   /protein_id="ACZ61280.1"
FT                   /translation="MSYRLSTQKSHDCSNIASYLLTAENNLEKSLASFLLVCKVGQLSP
FT                   ATIHNYSYMVGKFIAFCSRNGVIKPPQITQLVVCLFIQELQETNSAQSVLDYFKQVRRF
FT                   INWLIENDQITTYPLKNIRLPKVPRKIIQPFNKEQC"
FT   gene            complement(104048..104356)
FT                   /locus_tag="DhcVS_108"
FT   CDS_pept        complement(104048..104356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_108"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61281"
FT                   /db_xref="GOA:D2BG31"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG31"
FT                   /protein_id="ACZ61281.1"
FT                   /translation="MPEFGSPFSGMAKSQPLSNEELIRAIRFMVAAEYEAIQLYMQLAE
FT                   STTNRLAIEVLRDIANEEKVHAGEFLRLLKELAPDEESFYADGAKEVEEEIEKRKNK"
FT   gene            complement(104542..105678)
FT                   /locus_tag="DhcVS_109"
FT   CDS_pept        complement(104542..105678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_109"
FT                   /product="MobA protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_109"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61282"
FT                   /db_xref="GOA:D2BG32"
FT                   /db_xref="InterPro:IPR004948"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG32"
FT                   /protein_id="ACZ61282.1"
FT                   /translation="MNLIITGEVGSGKSSHCQRYARHLQECGFKTGGVICRPVFQGGIK
FT                   VGYSAVDIRTSAEAVFSLTDPQADFQGEKVGKYSILQSGLAFACNTIREALKTGCEVIF
FT                   LDEIGHLEIAGKGLSEQARLAYQKAPHTISVVRKSLLPKFLTTFAPEESSNIFIIHDID
FT                   TDADIHPAFFKNKPDQADISCIILAGGKSTRLGSNKVTATLNSQTLLERAISNLSGYGH
FT                   EILVVTAYGQADEKIKPPPGVRIIQDILPEKGPLAGIYSGLTASKFPFNLVIACDMPFI
FT                   NRPLLEYMKDQMTGFEAVVPRLGQKPEPLHAIYSKSAGEKALRLIKEGKSAVSDLLACL
FT                   KTRYIEEDEINGFDPEHRSFFNINRPEDLEKAREIGYT"
FT   gene            complement(105679..106368)
FT                   /locus_tag="DhcVS_110"
FT   CDS_pept        complement(105679..106368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_110"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61283"
FT                   /db_xref="GOA:D2BG33"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG33"
FT                   /protein_id="ACZ61283.1"
FT                   /translation="MSTYLNPEKNRIPAVLTLAVVGSVWGLLEMALGGFLHAIHFANQG
FT                   AVMGGLAISLMAIFLSITKKPALIPLLGVIAAAFKPFSAFIFGEPVFSAYVINPAIAII
FT                   MEAVAFGAVAFIFKKAMEKHLLAQITTGFLAGGLGIVLYAVIASVFGLGKWPMLDMAGK
FT                   IDTIVSTGLPVALAGTITLAAGYYLGKFGMPKLANFKTSYPRAYYITSAVTVVSCWVIP
FT                   AVFHLGG"
FT   gene            complement(106391..109603)
FT                   /gene="mpxA1"
FT                   /locus_tag="DhcVS_111"
FT   CDS_pept        complement(106391..109603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpxA1"
FT                   /locus_tag="DhcVS_111"
FT                   /product="molybdopterin oxidoreductase, large chain"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_111"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61284"
FT                   /db_xref="GOA:D2BG34"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR037946"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG34"
FT                   /protein_id="ACZ61284.1"
FT                   /translation="MNKERAAKNPSGGITRANFIKVSALLGGTALLSGCELVTQPRKIL
FT                   GNNDYTLSKPEDIIYSTCQQCATQCSIKVKLIDGVIAKVDGNPFSPWNMMPQLDYKTPV
FT                   TTSALTDASICPKGHSGAQTSYDPFRLVKVIKRDGPRGSNKWKSIPFDQAVEEIASGGK
FT                   LFSNVPGEENRTVEGLKDIWALRSPEITKTISTDIKAIWAEKDETKKSALVEAFKEKHR
FT                   DYLDKFIDPDHPDLGTKNNGFCFMFGRTQGGRVDFIKRFTHDAMGSINAHGHTTVCQGS
FT                   LFQASKALSARFDSSTGAFLEGDKFYWMADIGKSEFVIFTGASPFEASFGPTSRAMRIA
FT                   DGLDSGRMKYAVVDPRFSKAASKAWKWLPAKPGTEGALALALIRWIFDNNRYDARYLAN
FT                   ANKAAANADGEPTWSGSTWLVKIDDEGKAERLLRASDIGLEQGSFSFDTPLIMKNGEPT
FT                   RFDPNDTVNAAEGELLVDTVINSVRVKSSLQILRDEASSHTLEEWADICGVKADDLAEI
FT                   AYEFTSHGKKAAADVHRGVSQHTNGFYNALAWWNLNMLIGNYDWQGGMLKGSAYDISGS
FT                   KAGGPFNLGKMKPGALTPSGVNIVRHGNVYEDTTLFKSQGYPAKRNWYPLSEDIYQEVI
FT                   PSAGDAYPYPIKALFLHMGSPVYVVPAGHTALEFLTDTAKLPLLVVTDIVVSETSMYAD
FT                   YIFPDLTNMERWEFAGSQNTIPFKSQPVRQPAIAPLVEIVKVFGQDIPLSMEAMLLGLA
FT                   EKIGLPGFGPDGLGAGIPLSHFDDLYLRMAANLAFGEKADGSDAVPDADEEEIRIFTQA
FT                   RRHMPNNIYNLERWRSLAGENWPKVVYMLNRGGRFQDYEGGYPANQQLGNKYGRLLNVF
FT                   LEKTTEVKNSQTGAPIIGHACYVTAGRDCYGQELNDEKNGYDLNLITYREIARTPTTAS
FT                   NYYLNPLLPENTILINQADADRLGLTETDIVRVVSESNPRGVWNLRNGQEWPMNAKLSI
FT                   MQGIRPGVVAFSLGYGHFAYGGLDITIDGELIPGETKRTKGVNANAAMRVDPYLKNTCL
FT                   IDTIGGSAVFYDTKVRLEKVNI"
FT   gene            complement(109596..110777)
FT                   /gene="mpxC1"
FT                   /locus_tag="DhcVS_112"
FT   CDS_pept        complement(109596..110777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpxC1"
FT                   /locus_tag="DhcVS_112"
FT                   /product="molybdopterin oxidoreductase, membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_112"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61285"
FT                   /db_xref="GOA:D2BG35"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG35"
FT                   /protein_id="ACZ61285.1"
FT                   /translation="MNWKRIALGILILSLAAGVWGFLMLLNNGQQMLGLGSFVVWGLWM
FT                   ALYVFFASTAAGMFFIASLDLLFKVKTFAGTGKIFMLASLTSLGAGLVHILINEGRPER
FT                   VMNVFLHPNFDSVLAWSVWIYTLIALATAAILFVLFMPQKRLPFRKEPVIKWLMILGFP
FT                   VAVIASGAVGFTLSTQSSHSFWSVGLFPVLFPIFGMSAGFALSRIIVALYGDKTSPGYP
FT                   RLAKTMVISTMTLLLAITYIIGSVLFVGIYDATPPTIEAANYIMFGQYWYGFWIVQMGL
FT                   GIVVALGALIKILSKPGLSKKPAWGLTVGVLVLIGAAVARLNFIIPAQIVAGADFLSSP
FT                   IVDGRYIDSYIPSLPEWALSAGITAAVILVFYIVAKMMKLIPIRIGNEEAGDE"
FT   gene            complement(110798..111736)
FT                   /gene="mpxB1"
FT                   /locus_tag="DhcVS_113"
FT   CDS_pept        complement(110798..111736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpxB1"
FT                   /locus_tag="DhcVS_113"
FT                   /product="molybdopterin oxidoreductase, iron-sulfur binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_113"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61286"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG36"
FT                   /protein_id="ACZ61286.1"
FT                   /translation="MTDKGKKGTNRSIPPPTRRDFIKSSGGVLGLAAILKLDERAQKLS
FT                   AAVAPPSTVSFPLEETAFVPGSTKEDPLIRMQADLRRAMQKPAEERHWSMVINLRKCVG
FT                   CHACTEACVSENKLPPGVIYRFVMDEETGQYPNVSRRFTPRPCMHCDNPPCTKVCPVGA
FT                   TFKQPDGIVVIDYQRCIGCRFCIVACPYTARTMDYGDNYLEDEPEDSGLVLGYEQGGVW
FT                   QSTTNFEYGNAHSRTPKRDSPIGNARKCHFCLHRLEKGMLPACVTTCIGRVNYFGDAND
FT                   PDSLVSELIANPGIIQLKSELGTDPSVYYLF"
FT   gene            112211..113197
FT                   /locus_tag="DhcVS_114"
FT   CDS_pept        112211..113197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_114"
FT                   /product="hydrogenase 1 maturation protease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_114"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61287"
FT                   /db_xref="GOA:D2BG37"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG37"
FT                   /protein_id="ACZ61287.1"
FT                   /translation="MSIEPEIREALGKIYVAAAGRILADLNLLRNVEVEPDKIKLSLAG
FT                   AGLSEDSRKVLQQEIGLALKPLLNKQKLEIEHITVPLNELNRVKKVVAVMSGKGGVGKS
FT                   LITGLCAVALNRQGYRVGILDADITGSSIPKMFGANEHLSGNEEAILPAKSPAGISLVS
FT                   TSLLLSNQSDAVIWRGPLISKMINQFWDDVLWGELDYMIVDLPPGTSDAALTVLQSLPI
FT                   SGIVVVFTPQGLVEMVARKAVSMAGKMGKSIIGLVENMAYLKVPELDKKIEVFGAGHGE
FT                   ELAKSIGVPFIGQMPLDPALAALCDNGDIEKYSHPLLDELEKAISRS"
FT   gene            complement(113299..113664)
FT                   /locus_tag="DhcVS_115"
FT   CDS_pept        complement(113299..113664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_115"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61288"
FT                   /db_xref="GOA:D2BG38"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG38"
FT                   /protein_id="ACZ61288.1"
FT                   /translation="MSFAAIFSIIVGALVIFQWRENLNRRAIQDPNKGYKVRWGTYELI
FT                   LRSAAEFATALMLILAGTGLLSEQSWGESIYLLATGMFIYSAVNSPGYFVQQKNWSVVA
FT                   AYAIALELAILGIILFL"
FT   gene            complement(113812..114651)
FT                   /locus_tag="DhcVS_116"
FT   CDS_pept        complement(113812..114651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_116"
FT                   /product="DegV protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_116"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61289"
FT                   /db_xref="GOA:D2BG39"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG39"
FT                   /protein_id="ACZ61289.1"
FT                   /translation="MTIKIVTDSTADLPADIVKNLGITVVPLYVHFGNEVFRDGVDINK
FT                   ETFFDRLINGGIHPKTSQPSPEDFANVYRELAKDNATGIVSIHISSKFSGTYQSAMEGA
FT                   KISGVSCPIEVIDSRLLSMGMGLIIKAAAIASRSGKKLGDIVEDCKNNIPKIKLMGFFD
FT                   TLRYVQVGGRLGKAKILMGSLLGVKPVLTVADGEYQPCGRVRNTAKGLERLVEFAKTGK
FT                   NIVDLSVIHSTTPETAHKLAEMLSDIFPKDQTIIAQLGAVLGTHGGPGTLWVAYKEA"
FT   gene            114846..116150
FT                   /locus_tag="DhcVS_117"
FT   CDS_pept        114846..116150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_117"
FT                   /product="LemA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_117"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61290"
FT                   /db_xref="GOA:D2BG40"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR022170"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG40"
FT                   /protein_id="ACZ61290.1"
FT                   /translation="MELQIWGYPVFALGLTALVLAFRTMRRKRLVDDIPTSRTRGVFIG
FT                   LVELKGTAESEKPFTGFLSAEKCVYYHYKVEERWSRMVTESYTDAKGHVQFRTHQESGW
FT                   TQVASGKEMQPFYLKDETGIILIQPEGADIQPKNLFNKTCGRNDPLYYAKGPQGSVANS
FT                   DHQRRFTEEAIPLHAELYIMGQSRERQDVVAPEIAKDKSAPLYVISTRTEKQISRSYSG
FT                   WFWFWIILGLLISLGSGLLLSQQDKESFNPDWGIVALWSGFYLLSWLLGWLWAGYNSLV
FT                   GLRNRVCQGYAQVDIQLKRRFDLIPNLAKSVEGFSRHERELQEMLAELRTVSKVNGQDT
FT                   MDIKGASAILVFNMEKYPELKADTVFLKLQEELAATESRIALARDYYNSIATFYNTRRE
FT                   IFPDRLLAGIFGFKERVFINASELERAALKVKLAE"
FT   gene            116219..118138
FT                   /gene="elsH"
FT                   /locus_tag="DhcVS_118"
FT   CDS_pept        116219..118138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="elsH"
FT                   /locus_tag="DhcVS_118"
FT                   /product="endonuclease/exonuclease/phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_118"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61291"
FT                   /db_xref="GOA:D2BG41"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG41"
FT                   /protein_id="ACZ61291.1"
FT                   /translation="MKGFLQAKPGAVEFLLPAMVLTLAISLFPLFSSGMTWILGDRFGQ
FT                   GAGVLGLIALVIFGLSFLAKPLRRFLCSYKAIIFSAGGVAIFSLLAQIGFAEPLINFIC
FT                   SALGLSLFAVFLAVYLDSARVRGASSVGHFGAGVIFGLLLNAALSAGFSTYDLVNQPSV
FT                   LPLLISAVIAAFILFLLSVHMPLAEGPAASNNGLGWLVIGPFLFLELVVFGNIARLSAL
FT                   SGFSSPVTSIFVLGALSLGLVGILWVFSLHQRHIRLLSMIASLFLILSLTGISGGVAAI
FT                   SLAQHFLGQLAVILLFGVILRYIGGRKADGVGESLNLPNGLGMILFVILLLGYYAVYQV
FT                   AVPYDNTVLELVAGLMVVVLGLYSGRECLPLLDFKGERFILPAMSILLLTLPLLGLLTY
FT                   KTPPAAPQFSGTLRIMTYNLHNGFNTQGRLDMEALVRVIENSGADVVALQEISRGWVIS
FT                   GRVDMLEWLAQRLNMYSAFGATAGEYWGNAILSKYPILDTHNVSLESDGLPIKRGYLNA
FT                   VLDLGGRYLYLAATHLHHVPEEGDVRLIQAGELADFWDNAPSTVILGDFNAEPNSAEIG
FT                   LLRQAGLSDSLEGQTSVLTYHSADLYQRIDYIWASPDIVYVDSFTIFSLASDHLAVIAD
FT                   IRLS"
FT   gene            complement(118217..118699)
FT                   /locus_tag="DhcVS_119"
FT   CDS_pept        complement(118217..118699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_119"
FT                   /product="Ni/Fe hydrogenase maturation protease"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_119"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61292"
FT                   /db_xref="GOA:D2BG42"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG42"
FT                   /protein_id="ACZ61292.1"
FT                   /translation="MFFNPGDESPKPILVLGTGNILLSDEGAGVRCIERLSRFPIPEDV
FT                   ELYDGGTAAMDLLDVISGREKMFILDAVHGGDEPGMIYRFRPEDIKTEQKIDISFHQMG
FT                   LMEILNLAKYHDAMPKNIIIYGIQPGSMAPGFELTPAVDKAVNRVVEMMKEELGIK"
FT   gene            complement(118702..120282)
FT                   /gene="hupL"
FT                   /locus_tag="DhcVS_120"
FT   CDS_pept        complement(118702..120282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupL"
FT                   /locus_tag="DhcVS_120"
FT                   /product="Ni/Fe hydrogenase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_120"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61293"
FT                   /db_xref="GOA:D2BG43"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG43"
FT                   /protein_id="ACZ61293.1"
FT                   /translation="MQKIVIDPITRIEGHLKIEATVDGGEVKDAKCVGTLFRGFEIFMK
FT                   DRDPRDAVHITQRICGVCPTSHGTTAALNLDSAFGVADKIPNNGRILRNLIQGANYIAS
FT                   HIVHFYHLAALDFVDVTEVADYDGTDPELLKVKDFIARALAAGDMSMLAPFYPRYEGDY
FT                   RLPKKVAQAAVAHYVEALNMRRLAHELSAIYSGRMPHSVAVVAGGVTSHPSIDSISNFM
FT                   SKLNTLRHFIDNVYLPDVIAVAETYPDYFGIGVGCGNLLSYGVFDLEANGTNLATRQRL
FT                   FTQGVVSASDLKLRTFDPNKITESIKYSWFSGETNEYPLNEVTEPEFTKPDGYSWLKAP
FT                   RYENTPYEVGPLARMVVNYVAGDPVVQKMVNNTLAHFGAGPAALFSTLGRHAARALECK
FT                   IVADEMVKWAMELKIGEPVCADYEIPESAEGMGLWEAPRGALGHWIKIENHKISNYQCV
FT                   VPSTWNCSPKDNQGVYGPVEQALVGTKVRDNDNPFELVRIVRSFDPCLACAVHLVSPTG
FT                   NEISRFRVY"
FT   gene            complement(120313..121377)
FT                   /gene="hupS"
FT                   /locus_tag="DhcVS_121"
FT   CDS_pept        complement(120313..121377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupS"
FT                   /locus_tag="DhcVS_121"
FT                   /product="Ni/Fe hydrogenase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_121"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61294"
FT                   /db_xref="GOA:D2BG44"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG44"
FT                   /protein_id="ACZ61294.1"
FT                   /translation="MFNTKLTRRDFVQLAAGSTAALSLGALKLPEFEKMFAEALKEIPV
FT                   IWLQGAGCNGCTISTINVVSPTIQDLLLTSVVPGTHVSMQYHPTIMAAQGDLAMSTITD
FT                   TAAKGPFVLVIEGSVPLKDDGVYAEIGEKDGEGITMLEHVLNLAPKALAVVAAGTCSAF
FT                   GGITASAPNPTGAKAVSEILKEHNITTPVVNLPGCPPHPDWVVGTLATVLMSGLDALDL
FT                   DDMGRPKAYYGKLLHDQCPRRGHYEKGLFATKLSEPYCLFLVGCKGPVTYADCSDRLWN
FT                   NKTRWCVEADSPCIGCAHPGFPDEVSPMFEAPPVINSTDKLAIGIAGTAVVLTAGVAAV
FT                   ELAKKAKRNAAKKG"
FT   gene            complement(121431..122234)
FT                   /locus_tag="DhcVS_122"
FT   CDS_pept        complement(121431..122234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_122"
FT                   /product="Ni/Fe hydrogenase, iron-sulfur cluster-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_122"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61295"
FT                   /db_xref="GOA:D2BG45"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG45"
FT                   /protein_id="ACZ61295.1"
FT                   /translation="MPNGMLIDTTRCTGCRGCQVACKQWNENPAVKTTFSPEVTNPLEQ
FT                   NAFNYNLLECREIEEDGKLQWIFAHKRCLHCYEPACVSVCPVGALHKRPNGAVVWDQDK
FT                   CFGCRYCQNACPFQIPKFEWDDNWAKITKCTMCWNRVDEGMEPACATTCPTGAIKFGER
FT                   ADLLAEAYERLSNNPDRYYPYVYGEKEAGGTHVLYLSSVHPEKLGFDMHEHEFFPSFTR
FT                   EFLGNIPLEISIVASLMVGVWYFRGRRIQAQAHDAEHAENKAGKH"
FT   gene            complement(123023..124096)
FT                   /locus_tag="DhcVS_123"
FT   CDS_pept        complement(123023..124096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_123"
FT                   /product="ABC transporter, type 2, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_123"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61296"
FT                   /db_xref="GOA:D2BG46"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG46"
FT                   /protein_id="ACZ61296.1"
FT                   /translation="MSIKHIITLFNREVIHGPKDVTFIMVVVTPILISLFISLAFGNIF
FT                   SEKPKLGLTDLGNSQLVSLLKDNNTLLIKEYPDEAALKEAATSGAVDMGLVLPADFDTT
FT                   LLQTNTLKSSAYVWGESLAKNRMIIPAVLADTARQITGAEVPVEINSISLGDEQNVPWS
FT                   DRLFPFVVLMAMFFSGLMLPASSLIDEKQKRTLEAVNITPATLGEIFTAKGAIGTLLGL
FT                   IMGLIILGMNSAFGNAPLPLVLMLVLGSLMASLLGLLAGAFIKDMNTLFAVWKFGGLLL
FT                   FGPAFIYLFPQIPQWIGYFFPTYYILKPVVDLSIYDAGWSDIALNAGITMILVAILLAV
FT                   VSNVVKRMSNSALRLYT"
FT   gene            complement(124093..125151)
FT                   /locus_tag="DhcVS_124"
FT   CDS_pept        complement(124093..125151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_124"
FT                   /product="ABC transporter, type 2, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_124"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61297"
FT                   /db_xref="GOA:D2BG47"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG47"
FT                   /protein_id="ACZ61297.1"
FT                   /translation="MNFRIIKALLKKDFSLFLQNRFYMLMTIVGLVFYIVIFFIMPNKV
FT                   DEQLKAGIYAPVMPPAFSVLVADPANSLSSYDSLDEAKTAVENGDIQAVIALPEDIMQV
FT                   WASGGKPEIDIYYSSSAPLELRDAIISLVKELSYIQTGQSLTFDTNEQVMGQDMLGEQI
FT                   PMRNRMVPLLAIFILMMEILSLASLIAEENEQGTARALLVTPMSVPELFAAKGIIGVGM
FT                   ALGQVVLFMLLVGGFSSQPLIALSVLILGSLMVTGLGFLLASLTKSLMSVTAWGMLLFI
FT                   ILAIPGMGIMFPGLISSWAKVIPSYYLTDTVNRVINYGADLSIVGGNLLILLGFTAVIV
FT                   AAGIIVLRRRYQ"
FT   gene            complement(125148..126014)
FT                   /locus_tag="DhcVS_125"
FT   CDS_pept        complement(125148..126014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_125"
FT                   /product="ABC transporter, type 2, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_125"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61298"
FT                   /db_xref="GOA:D2BG48"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG48"
FT                   /protein_id="ACZ61298.1"
FT                   /translation="MSQISISVEKLSYWYGDLKAVNQISFEVGQGEILGFLGPNGAGKT
FT                   TTQKMLTGQLKPKDGRATLLGFDVAKDTEEIHRRIGICFEQTNLYEQMTALENLQLFAD
FT                   LFGVKNFDGYALLKRVGLAGRERDKVAGYSKGMKQRLMIARSLVNTPSILFMDEPTSGL
FT                   DPVSSESIRDIILEERKRGATIFLTTHDMWEADKLCDRVAFINEGSIAALDAPVNLKQQ
FT                   YGKRSLVAKIKTPDGKLENREIALDTGKTSEEVSKLLDSEQVLTLHSEEATLEDIFIKI
FT                   TGRRLTE"
FT   gene            complement(126014..126664)
FT                   /locus_tag="DhcVS_126"
FT   CDS_pept        complement(126014..126664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_126"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_126"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61299"
FT                   /db_xref="GOA:D2BG49"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG49"
FT                   /protein_id="ACZ61299.1"
FT                   /translation="MTRTKQSTASRDKIISAATHLFLNSHDAGKVSIEDIARKAKVSPT
FT                   TIYNNFGGRKALVHGVVEKIIDNSLIQAKDIISRPLPFPGKIQLILSNKNDMAGKMPEE
FT                   ILKKLVHMDDEVAALIQEIYQKEIQPMWQKLIADGKAEGYVDPSLSEEAVFIYLKVVRD
FT                   GFNANAALFEPAKDKINLMMELSRIMMYGFFKNDACLIPDINNRHPKTGLRSN"
FT   gene            complement(126844..127386)
FT                   /locus_tag="DhcVS_127"
FT   CDS_pept        complement(126844..127386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_127"
FT                   /product="DJ-1, 4-methyl-5(b-hydroxyethyl)-thiazole
FT                   monophosphate biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_127"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61300"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG50"
FT                   /protein_id="ACZ61300.1"
FT                   /translation="MSRFAVLLAEGFEEIEFCTITDILRRADLEVKIVGLKNGLTGGSR
FT                   GIRIMPDMYIDDLKTTDYEVLVLPGGNPGFINMGKDQRVLELIRTAHTENKYLAAICAG
FT                   PAVLSRAGVINGKEVAIYPGVKHLLKNCTACDLRVKVEGKLITGRSPQAAMDFALTLMD
FT                   MFAKPQASKVVRDEMLV"
FT   gene            127680..129443
FT                   /gene="oadA"
FT                   /locus_tag="DhcVS_128"
FT   CDS_pept        127680..129443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadA"
FT                   /locus_tag="DhcVS_128"
FT                   /product="oxaloacetate decarboxylase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_128"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61301"
FT                   /db_xref="GOA:D2BG51"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG51"
FT                   /protein_id="ACZ61301.1"
FT                   /translation="MGIKITDTTLRDAHQSLIATRMRTRDMIDIATKLDKVGFYSLEVW
FT                   GGATFDSCIRFLNEDPWERLRLIRQKAPNTPLQMLLRGQNLVGYRHYADDVVREFVRLS
FT                   VKNGIDIFRVFDALNDTRNMEVSIQTAKGLKAHVQGTICYTTSPIHTVEKLAEMAVELE
FT                   KMGCDSICIKDMAGLITPTAAAQLVKSIKAKVKLPVDLHSHCTSGMAPLAYYAAAEAGV
FT                   DIIDTAFSAFAWGTSQPTTESFVAAFQGTKLDTGLNLELMSEIGEEFNKISSTYRCLYT
FT                   CEATQPSIGVLLHQIPGGMISNLVSQLRQQNAFDKLPQVLAEVPKVRADLGYPPLVTPS
FT                   SQIVGTQAILNVLSGVRYKQVTKETKNYLLGYYGKIPGAVNEEIRKAIIGDEKPVSVRP
FT                   GALLEPELPKMKAEGEKLGILKTEEDLLTYAMYPEVAAKFLKGECKEECLLPSTPEAAK
FT                   SAKTEVKAEAKSAPVLSGTAEYSVEVDGEVFIVKVSAKAGAVGETPKAAKPTASHPGAV
FT                   VSPMQGMLLSLKVKEGDKVTEGEVVATIEAMKMENDVTAAVSGVVSEIYAYEGEVVGSK
FT                   DVIMVIEPDAK"
FT   gene            129433..130929
FT                   /locus_tag="DhcVS_129"
FT   CDS_pept        129433..130929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_129"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61302"
FT                   /db_xref="GOA:D2BG52"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG52"
FT                   /protein_id="ACZ61302.1"
FT                   /translation="MLNKILVANRGEIAIRIMRACRELGIKTVAVYSDADKGALFVKYA
FT                   DEAYHIGPAQLSESYLNIKKIVSVAKKAGVDGVHPGYGFLSENPGFALALEKAGIKFVG
FT                   PSSRVIELMGNKIAARREMKKAGVPVLPGTEGCVSGIEQATEAAAAIGYPVIIKPSGGG
FT                   GGIGMRVANGPDELKDAIESSQKVAGNTFGLAEVYIEKYISKPRHIEIQIMGDSQGNVV
FT                   YLGERECSIQRRYQKLIEEAPSPVITPELRKKMGEVAIKAGKWVNYEGAGTIEFIFSNG
FT                   QFYFLEANTRVQVEHPVTEMVTGIDIVKEQIMVASGNELSFKQEDVQMRGWAIECRINA
FT                   EDPLNEFAPSAAKLKGYRSPGGIGVRVDSGVHTRYNIPYLYDPMISKLIVWGRTREEAI
FT                   ARMRRALYEYIIVGVKTNIPFHKAVMVNPNFVAGNLHTHFIEKETTLLDEMKRIMSEEQ
FT                   PLEEKLSEIFDDTRRIAAIAAVTALTQLPAEIDEDEITGV"
FT   gene            complement(130926..131213)
FT                   /gene="accC"
FT                   /locus_tag="DhcVS_130"
FT   CDS_pept        complement(130926..131213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="DhcVS_130"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_130"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61303"
FT                   /db_xref="GOA:D2BG53"
FT                   /db_xref="InterPro:IPR025698"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG53"
FT                   /protein_id="ACZ61303.1"
FT                   /translation="MKQLTDDEIYRIAQKRVKEKKEFYNHLSVYIVINLMLISIWAFTG
FT                   SSYPWFIFPLGGWGIGLIFHFLSVFGFMRDESDWENKEIQKEIGRLKKNL"
FT   gene            complement(131346..133379)
FT                   /locus_tag="DhcVS_131"
FT   CDS_pept        complement(131346..133379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_131"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_131"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61304"
FT                   /db_xref="GOA:D2BG54"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG54"
FT                   /protein_id="ACZ61304.1"
FT                   /translation="MILISYFCFVNPLFETLLSLHTDTGYRVGQRTEGVVELTCLSRQR
FT                   SSRIDNVLYVASIISGTRSFKYRRKYFKKETYMAKTKAPVEKLESAEEIQKDGKVVSTK
FT                   RTKGSEFFWTQSRCTGCNRCASVCPVDAIKLDRDKTPTKRVGTSPCTRACPAGLDIPRY
FT                   VRFVADGNASAATAVMREKIPFPSVCGYVCFHPCELECQRQKFDEPIAIRALKRYAAEN
FT                   DDGSWKNNLKIAPPTGKKVAIIGSGPAGLTSAYFLTLLGHEATIFESMEYAGGKMFYSI
FT                   PEHQLPKDILNKEIKTITDLGVTIHTSCQVQSVQTLFKQGYNSVLLSTGVLGLDEGLLL
FT                   PCDETVESNLIKGSDFLKSIKSTTKESLGDKVVVIGGGSEAYNSAFAAKNLGVSEVHLV
FT                   CSRHTGSKEASPEEVDRAIDAGVTVHPSLDFVKLVKSDDKIEGVELFRIRSYGYDKDNR
FT                   LHYEIINDTRCLIPADTVITTVAPDEKPGADYLTVVQPGVFAAGDGISGARSVIEAMAA
FT                   GRSVAGLIDKYLGGEGNLDETLAPPEKDIKPLSEPKGQNRSQIELNLVKQAGGDKVEIE
FT                   KTLSPEAAKKEARRCLRCDIVHQVHDYSLDTSSCTYCGRCVNACYWDAITSGYGYEAAA
FT                   KKRQAEIAALEEKHSVYNYAIRILPIAIGLMILAAAVAKLFK"
FT   gene            133689..134720
FT                   /gene="adh2"
FT                   /locus_tag="DhcVS_132"
FT   CDS_pept        133689..134720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh2"
FT                   /locus_tag="DhcVS_132"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_132"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61305"
FT                   /db_xref="GOA:D2BG55"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG55"
FT                   /protein_id="ACZ61305.1"
FT                   /translation="MKAVLLEKPGELLLTEVATPSCPKGGVLLKVSCCAICGTDVKMFR
FT                   RGHRDLKYPRVLGHEIAAEVACSEHPDFKAGTRVQVYPGIACGVCPLCLQGRENLCGQV
FT                   KIIGFNYDGGLAEYMALPPESLPGGLNIIPENVSDEEASLAEPIASCIHSQSVCRVGDG
FT                   DRVLVLGAGPLGLLQTMLARYNGAEQVLVAEILPERVCGAELACPDGVIDLGKTSLKQG
FT                   VFEQTGGVGVDVILIASSGVEVGELPFVLSPGGRINFFSGLPKDRSGFTIDANSIHYQE
FT                   LILSGSYGSTAADNAEAVRLIGQGIIPVKRLISRVTGISYIEEAFLGVERLEGLKTVIK
FT                   FYK"
FT   gene            134732..135856
FT                   /gene="trpD2"
FT                   /locus_tag="DhcVS_133"
FT   CDS_pept        134732..135856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD2"
FT                   /locus_tag="DhcVS_133"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_133"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61306"
FT                   /db_xref="GOA:D2BG56"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG56"
FT                   /protein_id="ACZ61306.1"
FT                   /translation="MDENMVKNFGVVISRLISKENLSREEVKDCFSQIMRNEQPDLQQG
FT                   AFMAALTAKGETAAEIAGVWEAIYEQDTIRVRPLVDKPVVDNCGTGMDSLKTFNISTTA
FT                   SIVAAAGGVVLAKHGARALSGSCGTIDMLESLGVDVETDVEIVKRSIETVGIGIFNGMS
FT                   AKVHPQALFRILSQIRFGTTLNIAGSLANPALPHYAVRGVYSAELLQPVAEVMREIGYK
FT                   RALVIYGSAPGGRGMDELSNLGESHIAELCEDGQIIKYSLSPSDFGLTPCLTDEIVTSG
FT                   DKQRETLRLLRILSGNDEGAAFEVVCLNAAPIFYIAGTVKSLQDGYAKAAEIIRSGAAI
FT                   AKLRQWIEAQNTNPEAGIARLESLLGELDGAKIS"
FT   gene            complement(135992..139180)
FT                   /locus_tag="DhcVS_134"
FT   CDS_pept        complement(135992..139180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_134"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_134"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61307"
FT                   /db_xref="GOA:D2BG57"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG57"
FT                   /protein_id="ACZ61307.1"
FT                   /translation="MTKQQFPPLFKDKYFTYVAGLSVLVIVLGLYTVFSPPDLVQNSNW
FT                   QLFTTSVEAATTIIIIAIATWRWGFRVSMFWASGILIPGMLVLVTLNLFKPITFLLVLI
FT                   TLGASSLVSLIINNHRRVISHEENLNQILSMIRDISHHITHIDNEEELMERICERLVYA
FT                   GRYQVAWIGYATPDQQMVEPRYHAVYGQPHLSAETCPAHHCLHLPGEPIQQAIKSRSLI
FT                   VVPDIHSQPIENYATHCQYCRSLLCSPIDFGEELLGILCVCSNKPDVFGREEISLLREV
FT                   SQDISLGVEKIRRRRELARTEIRLKEERDKAQLYLDIAGVIIVVLNEDETVAQINKRGC
FT                   QILGYEYQDILGQNWFENFIPGYRRLIKRSMYKQIISGKTELPERYMDVVLTKDGQEKV
FT                   ILWHSTAIRSKNGQMSSILYSGEDVTELKHTEEALRMSEEKYHTLFETMAQGAIYVDNK
FT                   GIIIETNPAANTIFGRHESELLGVNIADPIWTYVHEDGSIMPPGENPVIAALKTGKAIR
FT                   NVFMGIKNNLSGEIRWVNLFALPLFRINQENSYMVYTTFTDISRLKNARDALTRSENRY
FT                   RSIFETAASIIISFDRNGIINDCNMRIQEILGYTPAEMLGTNFLDIIHESFRDEVRNHI
FT                   ASLNRGDIIYNKDCRMLHKDGQYRDVMVNCSTLLDEHGSVLNAICIISDMTEQKQTHYA
FT                   LIASEEKIRSMFNGVNEGIAVMDTSGYVTEINQTMLKMNNCTSKDQLIGRHALEFVSLK
FT                   DRDMARSYMNQADSLNEIRNLELRCLRPDGTEYFSQISGAVLRGYAGEIKGIIILSVDI
FT                   TERKQIEQQLIMTDRMASVGELASGLAHEINNPLTGIVGFSELLLMNELEESIKEDVQT
FT                   IHREALRAAEVVRNLLTFARQQPPTRKAGDINLSIHKVLELRKHDHRINNIRCITELDP
FT                   DLPRVMLDFFQIQQVLINIIINAEFFLRLKEHPQIIIKTSQHNKHVIISISDNGPGISP
FT                   ENIKRIFDPFFTTKEVGKGTGLGLSICHGIIEEHNGRISVESTPRNGTTFRIELPVADI
FT                   QPLSTAETPNQTAG"
FT   gene            complement(139260..140651)
FT                   /gene="cbiA"
FT                   /locus_tag="DhcVS_135"
FT   CDS_pept        complement(139260..140651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiA"
FT                   /locus_tag="DhcVS_135"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_135"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61308"
FT                   /db_xref="GOA:D2BG58"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG58"
FT                   /protein_id="ACZ61308.1"
FT                   /translation="MNFPRIVIAGVSSSSGKTTISSGITAALTKRGHKVAAYKCGPDYI
FT                   DPGYLTLASHNPCHNLDSWMLDKDAMAEVFFHGLKNREIALVEGVMGLYDGYSGERPGG
FT                   STAEIARLLSSPVILLVNISHMAESAAAIVLGYKNLDPCINIAGVILNQAGSMRHYEIC
FT                   RNAIEKYASTPVIGYLLRNKDLVIPERHLGLKTTSEGGELETFIQNLATHIESTIDIDR
FT                   IWEIAQNAPPLPEKPCPHIFPKTPACPVTRIAVAKDEAFSFYYQANLDMLSDWGAELCY
FT                   FSPLHDTCLPENIGGIYIGGGFPEIMAAELSTNQLMKTALTKAAGSGMPIYAECGGLMY
FT                   LSEAIEDFDGTKYLMLGLLPGISVMQKKLHRLAYTRAAVQNDNILSDKGTELRGHIFHW
FT                   SKLPSPQTKPAYTLLEPAEFVGQSEGFIIGNSTNVLASYLHLHFGTNPNLARHFIRVSK
FT                   KFCTI"
FT   gene            complement(140691..141107)
FT                   /locus_tag="DhcVS_136"
FT   CDS_pept        complement(140691..141107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_136"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61309"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG59"
FT                   /protein_id="ACZ61309.1"
FT                   /translation="MTDATPLYCLEILSRSQTEFIDITSQISLVISQSGVTSGLCHIFV
FT                   PHTTAGLTINENADPDVITDIKAQLERIVPSVTHFLHAEGNSAAHVKTSLTGNSLNLII
FT                   EAGRPLLGTWQGIYLAEFDGPRKRTMNIKILKEK"
FT   gene            complement(141100..141471)
FT                   /locus_tag="DhcVS_137"
FT   CDS_pept        complement(141100..141471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_137"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_137"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61310"
FT                   /db_xref="GOA:D2BG60"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG60"
FT                   /protein_id="ACZ61310.1"
FT                   /translation="MSKIKILVADDEEHIRQLVCSILDKNYQIVQAKNGEEAVKESREQ
FT                   NFDLILMDIMMPKLDGLAACCMLKGDKQTSSTPIIMLTGVGYELNKKLSQQLGADGYIT
FT                   KPFNPQELRNKVSEFIKHD"
FT   gene            complement(141557..141949)
FT                   /locus_tag="DhcVS_138"
FT   CDS_pept        complement(141557..141949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_138"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_138"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61311"
FT                   /db_xref="GOA:D2BG61"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG61"
FT                   /protein_id="ACZ61311.1"
FT                   /translation="MTDKKYRVLVVEDEPSICQVCLRTLEGMGLEVTIAINGQIGQALI
FT                   QQETFDLCLVDIRTPIMNGKNLYAYALNHYPDIAKRIIFTTGDLMDETTQGFLDAAGQP
FT                   FLPKPFTPSDLKKIITETLGKLENCN"
FT   gene            complement(142092..142664)
FT                   /locus_tag="DhcVS_139"
FT   CDS_pept        complement(142092..142664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_139"
FT                   /product="rhomboid"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_139"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61312"
FT                   /db_xref="GOA:D2BG62"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG62"
FT                   /protein_id="ACZ61312.1"
FT                   /translation="MRYTNYRNQPDIILLVIITCVIVFFGVNFAPQIGPYLALQPATAI
FT                   SYPWTIITSLFVHADLWHLFANMITLYFFGNALLQMINQRSWLIIFFGGGLAGSLLFIL
FT                   LNAGSFGYVIGASGAVFALGGTLAVLRPNSKVMVFPLPVPIPLWIAVIGSFIILSFLPS
FT                   VAWQGHLGGLLVGAACGYLIKQGKFRF"
FT   gene            142771..143730
FT                   /gene="arcB"
FT                   /locus_tag="DhcVS_140"
FT   CDS_pept        142771..143730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="DhcVS_140"
FT                   /product="ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_140"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61313"
FT                   /db_xref="GOA:D2BG63"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR028609"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG63"
FT                   /protein_id="ACZ61313.1"
FT                   /translation="MPTLILSRKDISGLISMPPVIQAVEQAFRDWATGLGGMPSKVYLT
FT                   LPKGDFRAMPASLPGAAGIKWVNVHPGNKALQMPTVMGLVIYSDPDTGYPLAVMDGTDI
FT                   TAYRTGAAAAIASKYLARADSATLGIVGAGRQAVTQIMAHRVLFNLKEIRVYDIFPDSV
FT                   LRLIKYFPELNIKRASLAEAAASDIICTLTTSNKPVLLLKDLKPGCHINAVGADAPGKQ
FT                   ELDPRILRQAVVVVDDMEQAIHAGELNVPVRTGVFSKEMVKANLGQIIQGKKSGRGSAD
FT                   DITVFDSTGVAIEDIAVAKMLYQMASELGTFRSLGLVD"
FT   gene            complement(143734..143946)
FT                   /locus_tag="DhcVS_141"
FT   CDS_pept        complement(143734..143946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_141"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61314"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG64"
FT                   /protein_id="ACZ61314.1"
FT                   /translation="MQIPEARCTKCGGHYHGWALLNARHQSCAQCGGKLEITTEDEVIQ
FT                   GYSPFSAEEVNLKAPKEMPSKKPKP"
FT   gene            complement(144032..144451)
FT                   /locus_tag="DhcVS_142"
FT   CDS_pept        complement(144032..144451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_142"
FT                   /product="general secretion pathway protein H"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_142"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61315"
FT                   /db_xref="GOA:D2BG65"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG65"
FT                   /protein_id="ACZ61315.1"
FT                   /translation="MKIPATIFKRENGFTLIEILVVVAILGALAGVIIPSVIKFMHEGK
FT                   VESANTELANVRLAVLSAMVDVETNTLNDGGTVGPGHTSNVTYGSPSADLPVYSFIMGE
FT                   VIGIYTLNEKGLIVSAEMPEGSDWEGLTFVNGAWQ"
FT   gene            144508..145278
FT                   /locus_tag="DhcVS_143"
FT   CDS_pept        144508..145278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_143"
FT                   /product="DNA-binding response regulator, two-component
FT                   system, OmpR family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_143"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61316"
FT                   /db_xref="GOA:D2BG66"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG66"
FT                   /protein_id="ACZ61316.1"
FT                   /translation="MVKGCNTPGYLPSCLAENTLRLYTLAMPEHKILVVEDDATLRELL
FT                   CYNLAKEGYTLECAEDGLKALGTYRLFKPSLVILDVMLPGIDGFELCRLIRTESSVPIL
FT                   MLTARSSESDKVNGLEAGADDYLSKPFGMRELLARMKALLRRSQTQNSQTETTGGLKIG
FT                   DLEIFIERHLVMRNGVALDFSPKEFDLFSFMVQNRCRVFSREQLLEKVWGYDYPGWTRT
FT                   VDVHISWLRQKIEADPSSPRHLITVRGTGYKFEE"
FT   gene            145280..147025
FT                   /locus_tag="DhcVS_144"
FT   CDS_pept        145280..147025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_144"
FT                   /product="sensor kinase, two-component system, OmpR family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_144"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61317"
FT                   /db_xref="GOA:D2BG67"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR031967"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG67"
FT                   /protein_id="ACZ61317.1"
FT                   /translation="MTRSLKWRLITLFCLLIAGCVGILSIFLSNHLEDSYMDNLQSRLI
FT                   QEVTLFSRVVPEHITESADSFDAYIKKLGASLDIRLTVIASDGQVLADSLQSPSEMENH
FT                   STRVEFIDALKDGIGIDMHQSASLGYEMLYVAASVKDRTGVLAVVRVALPVEEVYAAVR
FT                   DVDRTILLGAVVSILAAGLLAVWVAANVSRPVKELTAISRRIAQGQIDTIQIDVSGKGE
FT                   MEELAHAFRLMTERLRDSIKAVSSERDRLSAVLQRMGDGIFLLDREGVISLLNPASERI
FT                   FKLEAEGVIGHSFVEAIRDHEIHSVFEHARSSGKQEMGFVELAAGRRFLGIIATPLVSQ
FT                   SGYLVLVQDLSELRRLEKVRRDFVANISHELRTPISSLKLLTETLQEGAASDPAVAAGF
FT                   IDKIHLEVDKLAQLVTELSDLSAIESGQAVLRLQPGDISTAIKLAAERLRPQAERAGIS
FT                   LGVELPETLPQVKLDENRVEQVLVNLVHNAIKFTPKGGRIKIGARTQGQTLVVYVSDSG
FT                   IGIPEEDLTRVFERFYKVDKARSSGGTGLGLAISKHIVQAHGGTIWAESVYGKGATFSF
FT                   SLPLT"
FT   gene            147237..147671
FT                   /gene="mgsA"
FT                   /locus_tag="DhcVS_145"
FT   CDS_pept        147237..147671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgsA"
FT                   /locus_tag="DhcVS_145"
FT                   /product="methylglyoxal synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_145"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61318"
FT                   /db_xref="GOA:D2BG68"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG68"
FT                   /protein_id="ACZ61318.1"
FT                   /translation="MERITLALVAHDNKKQEMVELVKKHETDLGSLNLVATRTTGKLIQ
FT                   ASTSLNVNLLQSGPLGGDQQIGAMVASGVVTAIIFLRDPLTAQPHEPDISALMRVCDVH
FT                   NVPLATNISTAEAVLHLIFEHPEELKEHRLKSQLLNSLNS"
FT   gene            147714..148571
FT                   /gene="pstS"
FT                   /locus_tag="DhcVS_146"
FT   CDS_pept        147714..148571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="DhcVS_146"
FT                   /product="phosphate ABC transporter, phosphate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_146"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61319"
FT                   /db_xref="GOA:D2BG69"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG69"
FT                   /protein_id="ACZ61319.1"
FT                   /translation="MNKIVNRKKIMLPAIAVMLLALGVAGCSNDTDNTDNPDNTSTLSG
FT                   TINEAGSTTVQPLAEKLAAAFKVLYPNVNVVIGGGGSSVGVKSVTEGTVDIGAASRDLK
FT                   DSETGLTKHLLAKDGIAIVVHPDNTAVNNLTIDQVRDIFAGVITNWSQVGGPDKTIHVM
FT                   AREEGSGTRTAFEELVMGEDVRIVANAVLQNSNGALKTALSGDKDAIGFISFGYIDSNV
FT                   KALSINGIAATSENGKNGTYPIIRPLYFLTKGTPSELVQAFLDYCMSDAVQQIITEEGY
FT                   LSVN"
FT   gene            148644..149504
FT                   /gene="pstC"
FT                   /locus_tag="DhcVS_147"
FT   CDS_pept        148644..149504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="DhcVS_147"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_147"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61320"
FT                   /db_xref="GOA:D2BG70"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG70"
FT                   /protein_id="ACZ61320.1"
FT                   /translation="MLPRYLTDKLAKYGVFITALVSILVLLAIAVFIIKGGLPLFGEVN
FT                   PLDFLFEESWSPTYGEYGILSMIVGSLLVTLGAMLIAVPLGIACAILLAEVAPRKVRNL
FT                   LRPAVELLVGIPSVVYGLVGIMVIVPAVRSLGGTGYSILAAVLVLSIMVLPTIISISED
FT                   SLRAVPRTYREGSLALGASHWQTIWHVLLPAARSGVGASIVLGMGRAIGETMAMIMVIG
FT                   NAVIIPTSPIDPARTLTGNIAVEINYAAGLHENALFATGLVLLILILILNSLATLALKR
FT                   GEQHA"
FT   gene            149497..150348
FT                   /gene="pstA"
FT                   /locus_tag="DhcVS_148"
FT   CDS_pept        149497..150348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="DhcVS_148"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_148"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61321"
FT                   /db_xref="GOA:D2BG71"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG71"
FT                   /protein_id="ACZ61321.1"
FT                   /translation="MLRFTSRSTQKVAFALLWTAGIITLLVLLLIIGYIIIRGLPGFSW
FT                   DFLFTPPAGGLAGEGGISSTIVTTLYLVGLTLLILVPVGIGAAIYLVEYAPDNRLTRFI
FT                   RYGVQTLAGVPSILFGLFGFALFVTVLHFRFSILSGALTLACLLLPVLITATEEALKTV
FT                   PRSYRAGAMALGATKWQAVTHVILPAALPGIATGVILCAGRALGETACLYVTMGGSAAM
FT                   PDSLLSGGRSLALHVFYLSTETNAIDKAMATAAVLIVIIVGLNALTNFISRRFQKRISG
FT                   GV"
FT   gene            150349..151104
FT                   /gene="pstB"
FT                   /locus_tag="DhcVS_149"
FT   CDS_pept        150349..151104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="DhcVS_149"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_149"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61322"
FT                   /db_xref="GOA:D2BG72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG72"
FT                   /protein_id="ACZ61322.1"
FT                   /translation="MEPKIKIRGVNFFYHQHQVLKNINMDFPDRQITAIIGPSGCGKST
FT                   LLRALNRMNDLVSGARLEGEILLDKENIYFPSLDVVNLRKRVGMVFQQPNPFPKSIFDN
FT                   VAFGPRMLGTTAQSRLDEIVEKSLRQAALWDEVKDNLHKSGLALSGGQQQRLCIARVLA
FT                   VEPEVILMDEPCSALDPVSTMRIEELMQELKQNYTIAIVTHNMQQAARASDWTGFLLTG
FT                   DLVEYGRTGEIFSRPKDKRTEDYITGRFG"
FT   gene            151117..151782
FT                   /gene="phoU"
FT                   /locus_tag="DhcVS_150"
FT   CDS_pept        151117..151782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="DhcVS_150"
FT                   /product="phosphate transport system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_150"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61323"
FT                   /db_xref="GOA:D2BG73"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG73"
FT                   /protein_id="ACZ61323.1"
FT                   /translation="MPRMGFDRHLRELEDDMLLLGSMVGKAIDRSMQAMKERDLELAKQ
FT                   VIEEDKYINQKRFEIEEKSIELMATQQPMARDLRIIVAVLNIIVDLERIGDHAEGNAKI
FT                   ALMLGEEPPLKPLIDLPRMSLKTEEMLNRALGAFVRRDSAEALRVIDEDDEVDGLYNQV
FT                   FRELLVFMAEDPHTISRATRLIWAAHNLERSADRVTNICERVLFVITGKSEEFGSSKY"
FT   gene            151784..152200
FT                   /locus_tag="DhcVS_151"
FT   CDS_pept        151784..152200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_151"
FT                   /product="arsenate reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_151"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61324"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG74"
FT                   /protein_id="ACZ61324.1"
FT                   /translation="MKDKNQVLFVCLHNAGRSQAAEAVFNHLAGDKALALSAGTEPSLA
FT                   LNARVVKVLKEGGINTDGLKPKLLNPGMLDSASRVISMGCDVTLSCPGHLYGKEDWGIT
FT                   DPRGKNLAEVRLIVESIRQKVEKLLDELGIKYGV"
FT   gene            complement(152251..152802)
FT                   /gene="rimL"
FT                   /locus_tag="DhcVS_152"
FT   CDS_pept        complement(152251..152802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimL"
FT                   /locus_tag="DhcVS_152"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_152"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61325"
FT                   /db_xref="GOA:D2BG75"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG75"
FT                   /protein_id="ACZ61325.1"
FT                   /translation="MSYKTVLETPRLVLRPFSLADAAAVAGLAGDALIADTTLNIPHPY
FT                   LPEMAEKWISGHAEKLATDTEQHFAITEKGSGTLLGACGLIFCFPHQRSELGYWIGKPY
FT                   WNKGYATETLKALVDYAFLDLNLHRLYAYYFKRNPASGRVMVKAGLKHEGSFPKHLLKN
FT                   GVFEDVEYCGLLRNDYLLSK"
FT   gene            153117..153584
FT                   /gene="hymA1"
FT                   /locus_tag="DhcVS_153"
FT   CDS_pept        153117..153584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hymA1"
FT                   /locus_tag="DhcVS_153"
FT                   /product="[Fe] hydrogenase, HymA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_153"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61326"
FT                   /db_xref="GOA:D2BG76"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG76"
FT                   /protein_id="ACZ61326.1"
FT                   /translation="MESIWKEKVDGVITQSGSSRLSLLPCLEAVQEECGYIPHEAVNYL
FT                   RECLGIPSIDIYGMITFYSLLSTNQKGKYVIRLCNSLPCYLNGTENILDTLVDNLGIEP
FT                   GQTTLDQRFTLELVPCLGLCDQSPAMVINGVVYGKLTAQLVTEVLDELRTY"
FT   gene            153586..154839
FT                   /gene="hymB1"
FT                   /locus_tag="DhcVS_154"
FT   CDS_pept        153586..154839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hymB1"
FT                   /locus_tag="DhcVS_154"
FT                   /product="[Fe] hydrogenase, HymB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_154"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61327"
FT                   /db_xref="GOA:D2BG77"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG77"
FT                   /protein_id="ACZ61327.1"
FT                   /translation="MKDVKIITRHLNTANSADIDVYLADGGYQALKKALSMTPEEVIAE
FT                   VKRSKLVGRGGAAFPTGLKWELTRKEKANPKYIVCNASEGEPGTFKDRLILKNDPHMVL
FT                   EGFIIAAYAVGTSQGFIHAREVYTEEIELFQKAIDQATERGFLGQNIMGSNFSLDIQFY
FT                   KSAGAYICGEETALFESLEGHRGIPAARPPYPVQVGLMDKPTTVNNVETLCNVPAIINN
FT                   GADWFASIGHPDYPGTKLFCLSGNVKEPGVFEMPLGTNLKDLLEAGGGVDGKFKAVLPG
FT                   GISSSLLTETDISLDFKTLAKAGTMLGSGAVIVINSDTSMVNVASNVAHFFDEEGCGKC
FT                   SICREGTRRAAEILSRFSRGQGNRNELEWLLELHEVMKDTASCGLGQVALNVAASAIRN
FT                   FKGEFLAQVRKEEGVWLR"
FT   gene            154827..156548
FT                   /gene="hymC1"
FT                   /locus_tag="DhcVS_155"
FT   CDS_pept        154827..156548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hymC1"
FT                   /locus_tag="DhcVS_155"
FT                   /product="[Fe] hydrogenase, Hym C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_155"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61328"
FT                   /db_xref="GOA:D2BG78"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG78"
FT                   /protein_id="ACZ61328.1"
FT                   /translation="MVTLNIDNKQISVPEGTTIMQAAKQANINIPHLCYFEGLKSYSGC
FT                   RVCVVEIEGEPRLATSCSRKVAEGMKINTHSARVRRARRTILEILLANHPQDCFNCERN
FT                   QNCDLLRLAFECGVKKLRFEESEKRVLPIDSTSPSIIRDPNKCIACGRCVRVCHDIQTV
FT                   NAIGFINKGPDTMVATSMDRGMGNVACANCGQCILVCPVGAIKERSAVDAVWAAIADPT
FT                   KHVVVQEAPSVRVSLGEELGLPAGTLVAKKMYAALRRLGFDAVFDTNFTADLTIMEEGS
FT                   ELVERVKDGGVLPQITSCCPGWVKFMEHYYPELAPNVSSAKSPQQMFGAVCKTYYAEKS
FT                   GIDPKTIINVSVMPCTAKKFECQRPEMNDSGFKDVDYVLTTRELARMIKEAGLDFASLE
FT                   EEPAEDLLGLYTGAATIFGATGGVMEAAIRSAYTLITGRELENLDIEPVRGLEGIKTAS
FT                   VNIDGLEVKVAVAHGLGNARHLLEEIKEGTSPYHFIEIMACPGGCVGGGGQPIRFDSSL
FT                   KKKRGEALYEEDRNMPKRCSHHNTSVEKIYADYLEKPLGKRSHKLLHTEYTSRPVV"
FT   gene            156588..157091
FT                   /gene="hymD1"
FT                   /locus_tag="DhcVS_156"
FT   CDS_pept        156588..157091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hymD1"
FT                   /locus_tag="DhcVS_156"
FT                   /product="[Fe] hydrogenase, HymD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_156"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61329"
FT                   /db_xref="GOA:D2BG79"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG79"
FT                   /protein_id="ACZ61329.1"
FT                   /translation="MFNVQSISLRKELVIAFLVMLGLATAAPLLGNQYLTGSLVNAVLF
FT                   ISAVTLGWKNAVAIGLISSSIALATGLLPVVMAPMVPFIMAANALLVAAFSALRGKSFW
FT                   LGAGVSAILKFAFLWATSSLVLNLFIEQNVANKIAGMMGLTQLLTALMGAVIAYGVLRL
FT                   GKKI"
FT   gene            complement(157267..158100)
FT                   /gene="pldB"
FT                   /locus_tag="DhcVS_157"
FT   CDS_pept        complement(157267..158100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pldB"
FT                   /locus_tag="DhcVS_157"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_157"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61330"
FT                   /db_xref="GOA:D2BG80"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012354"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG80"
FT                   /protein_id="ACZ61330.1"
FT                   /translation="MRFTEGHFKGCQDYNCYYQALLPNGSPKAIVLVVHGLGEHSGRYS
FT                   ELAHYLADRNYAVYAYDHFGHGKTDGKAGYVSSYDVYIYDLISAFSMVQAKHPTFKIFI
FT                   FGHSMGGLVTAAYASKHQYDASGLIFSSIALKPYTGMPGILNQIVKPLSKIAPMLGVRK
FT                   IDASTISHNKDIVKAYNEDPLVLHHRMSAHMAAEFLRICQDLPDFLKKISLPSLVIHGE
FT                   EDHLVNINGSRELVQRISSKDKTLITYPGMYHEVFNEPDCPQVWNDLFFWLENHI"
FT   gene            complement(158107..158367)
FT                   /locus_tag="DhcVS_158"
FT   CDS_pept        complement(158107..158367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_158"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61331"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG81"
FT                   /protein_id="ACZ61331.1"
FT                   /translation="MSKKSFSTDEAKAVAKILGITFNKYNIEQFRMGMDVELEHGTRDP
FT                   HTNVTNDDPVLTGKIALAHLNEIEDYYTRLAEMEAEAGVED"
FT   gene            complement(158507..159229)
FT                   /locus_tag="DhcVS_159"
FT   CDS_pept        complement(158507..159229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_159"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61332"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG82"
FT                   /protein_id="ACZ61332.1"
FT                   /translation="MSPRNIYSRPEVIGKKSIVMEGKEVHYTLRKSHFSDLIRLAIRSA
FT                   TGLVVTVPHHYNMNGLDDILLQRSAWILKHQTKMNANRFILEDGLHDGQKVPYLGKFYT
FT                   LRIREGGERGHVSLAENTIHLLTDSKSAVEVMGKWYRHQAAEAIKVSLEKNAAAMGLTF
FT                   GKLSIRAQKTRWGSCTSKGDLNFNWKLATMPQPLIDYVIIHELSHRVEMNHTDRFWAVV
FT                   EKYCPNWKTLRKQLKTYE"
FT   gene            complement(159226..160119)
FT                   /locus_tag="DhcVS_160"
FT   CDS_pept        complement(159226..160119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_160"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61333"
FT                   /db_xref="GOA:D2BG83"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG83"
FT                   /protein_id="ACZ61333.1"
FT                   /translation="MKAKTYLLLLLGVFGIAAASVFTRLADAPPVIITSLRMLAATLLL
FT                   MPFAAGPVYQAVKRLSRRNLLLIILAGFLVGIDQFFWVSSLEYTSIASSVILVTSHPVL
FT                   VAVMSYIMWRERLSPKAIGGVLAAFGGMALINLATAQVGEQAFLGNILALAATIPTTGY
FT                   LIIGRQMRNRIDFLPYITLLYGSAAFILLAGAFISGEEFSGYPSTTYLMIFLLAVISQL
FT                   VGHSSLNMALRLVPALVVSVAILGEPVGAIILGYIFLGEGLTLNEFLGGMLVLAGILVV
FT                   MLNQPRTEKMEAETPH"
FT   gene            160214..161248
FT                   /gene="gly1"
FT                   /locus_tag="DhcVS_161"
FT   CDS_pept        160214..161248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gly1"
FT                   /locus_tag="DhcVS_161"
FT                   /product="threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_161"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61334"
FT                   /db_xref="GOA:D2BG84"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG84"
FT                   /protein_id="ACZ61334.1"
FT                   /translation="MKIIDLRSDTVTRPTPEMKKAMCDAPLGDDVFGEDPTVNRLEEMA
FT                   AVKTGKEAALFTPSGTMSNLLAVLSQTRPGDEIILGSESHILWYEVGGASAVGGVVIRA
FT                   VPNQPDGTIHLADIKDAIRSSNLHFPPTRLICLENTHNRCGGAVLSPSYTAGVANLAGA
FT                   RGIKVHLDGARLFNACVALGVSAKELCLGMDTVSFCLSKGLSAPAGSLLCSDRETINRA
FT                   RKFRKMLGGGMRQAGVLAACGIVALETMIDRLAQDHAMAKILAEGLFSIDNHTLDKNTV
FT                   PTNIVIFNPPFGLDADKFLVQAKQAGMLFTTGSHGRVRAVCHHDLSESDIQTALSRIAA
FT                   MKGC"
FT   gene            161360..161848
FT                   /locus_tag="DhcVS_162"
FT   CDS_pept        161360..161848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_162"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61335"
FT                   /db_xref="GOA:D2BG85"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG85"
FT                   /protein_id="ACZ61335.1"
FT                   /translation="MKKFPKRTYSNPIQFFSDIGFILKNRRKLKESRISGFPSAAFRER
FT                   LMLAVTGVNACRFCTYAHTKMALESGLSQQEIKALLDGDFGNCPPGELNAVLYAQHWAD
FT                   TVAKPSADMKLKLEADYGAEKSGFIHLYLRLIRVGNLSGNTADKFLYYLSFGKMGLDR"
FT   gene            161904..161979
FT                   /locus_tag="DhcVS_163"
FT   tRNA            161904..161979
FT                   /locus_tag="DhcVS_163"
FT                   /product="tRNA-Val"
FT   gene            162567..162995
FT                   /locus_tag="DhcVS_164"
FT   CDS_pept        162567..162995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_164"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61336"
FT                   /db_xref="GOA:D2BG86"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG86"
FT                   /protein_id="ACZ61336.1"
FT                   /translation="MRNRAKNTAKIFVLVAAVIIITNIILFCVLENPSLNVKGWFNDIL
FT                   FILLYIGGIALLSVSYYIKPRASNDPSKKPILDMYIKKCLIYLCVTLMGFIYSFVETSL
FT                   VHSLFLYFMCSLIFIIDYPSSKNWDKWLKTQLANNEQG"
FT   gene            163046..163747
FT                   /locus_tag="DhcVS_165"
FT   CDS_pept        163046..163747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_165"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61337"
FT                   /db_xref="GOA:D2BG87"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG87"
FT                   /protein_id="ACZ61337.1"
FT                   /translation="MRLDMKTRRKLPVYKMMTFFLSIYPILYVFTGVGSEPYITIRNLS
FT                   ETLYQALVFFPIVIFVLTWVILIRDVFYNKTVAKNQRAFWVFLLIAGHFAVFPFYWYFH
FT                   IYKNSKESVAAVTEKPVKVQRGLFEGKSAGFKIMLLVGGLLPFVLGVIGGIARVFLNNE
FT                   GLFYTCGIASYAVGIAILVLYIIDATRNSLVASNQKGLWIVLLILVNVIVFPVYWYMNV
FT                   WKEPIKEQIFG"
FT   gene            complement(163777..164457)
FT                   /gene="rdhD"
FT                   /locus_tag="DhcVS_166"
FT   CDS_pept        complement(163777..164457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhD"
FT                   /locus_tag="DhcVS_166"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_166"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61338"
FT                   /db_xref="GOA:D2BG88"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG88"
FT                   /protein_id="ACZ61338.1"
FT                   /translation="MNILLVEDNDAAASTISSILRLSYHDAKITICHTGYEALESINSD
FT                   KADLILLDLGLPDMNGLKVLDEIRPITGAPIIVVTACEDEENVLKALEQGADEYIIKPF
FT                   RHLEFLARVKKALSKNTSQNTAIIKCGDLTIDCAKHELTFRNDKALLTRVETMIMSLLL
FT                   QKNGQIVDYRDISDTLWGHAYPGSDESIRVYVSRLRIKIEKNLKTGCIIKNEAGIGYRL
FT                   SFTE"
FT   gene            complement(164461..166230)
FT                   /gene="rdhC"
FT                   /locus_tag="DhcVS_167"
FT   CDS_pept        complement(164461..166230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhC"
FT                   /locus_tag="DhcVS_167"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_167"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61339"
FT                   /db_xref="GOA:D2BG89"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG89"
FT                   /protein_id="ACZ61339.1"
FT                   /translation="MKTENNKVGVVTCVSMSNFVKNWALHRNLDVRIYPITNSCFYSVK
FT                   IEMLSYYIERAILENGYCILNYGMCNESITELKNHYAERLSVVELDNCYEAAIGTAIYH
FT                   ERVEQGHIFRNPTTMSCWHSMPALEVMQPVKAGIYPAPITFILENGEEEKAASYVNNLK
FT                   NNTALEYSVEVLHPQPHFLEDKLDQAYAKIQLASEEEDETSRQLIFPFSFHNSNEYLYI
FT                   LDKHDKIIFSPYVALATPNQICQRLLQLIVNRKADINFQVKDFDSLLKHRGLYLDKCKR
FT                   FANRSSLTTEYEIIQNNKSTWIKETLWVSYDDNCSISNICGRMEDITEVKISEKSIAES
FT                   YTKECLLRQALQDETKKRQAHLKALVHEIRTPLTPLLAASDALVNVSEKGTELYNLASS
FT                   IREGAETLNSRIHDLIELERGKIGMLKLKMANYSIEDIMDELQLRYMPIFLKQHKSLAF
FT                   GNETPNSEIYCDKERLLQILTNLIDNALKYTKQDDSVLVSAWIENGFLRFSVSDSGAGV
FT                   PACLIPDLFTEYGKLSGGHNLSGLGLGLPIAKLYVEAHGGSIIYNPAKPKGSEFSFTIP
FT                   VKGLSQKENHASG"
FT   gene            complement(166214..166813)
FT                   /locus_tag="DhcVS_168"
FT   CDS_pept        complement(166214..166813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_168"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61340"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG90"
FT                   /protein_id="ACZ61340.1"
FT                   /translation="MVHQDLLSETSMITRSQSAELEKAIRVILPSETAKLIDLVDQMFD
FT                   DYRQGLIHHNDIRRLIGIIHNKAEKAQTITHNCAPVAIFNPVSFIPPGISLLEAYLKLN
FT                   GFTPVVLGLDEQTISKIANRIFPTVVVSLTLFHHIDKLAKLKPCFEAAGLNVIAGGVPF
FT                   VYQNQNKQRLSFCSFPESFRELICKLSEDLSNENRK"
FT   gene            167053..168420
FT                   /gene="rdhA"
FT                   /locus_tag="DhcVS_169"
FT   CDS_pept        167053..168420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhA"
FT                   /locus_tag="DhcVS_169"
FT                   /product="reductive dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_169"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61341"
FT                   /db_xref="GOA:D2BG91"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012832"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR028894"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG91"
FT                   /protein_id="ACZ61341.1"
FT                   /translation="MDEKINRRDFVKGAGLASAATVATIMATASTVSAEELVHPGGKAM
FT                   DEMGSASLTRDLPTSFYKRIENKDGYIGTTRVIAPTQRLDAREHGFSQIVRRGSTGDWS
FT                   GEPGDWGPVLLAAVQEKKKHAAEITPLEAADYTWSNAFQIAMDRWHITLEPGRYQQAPI
FT                   AATKVELSPEEMTARIKKICRWFGCEQVGICEVTEDMKPFFYSVGRTKGTYTTGHANYV
FT                   DEGREIPWPYPYKYCIVMADKCDTDTLSAMTGPLVEASAKIACSQSDFAPHYLESIIRS
FT                   LGHDAKANIFSDTDIMDTPFAVKAGLGELGRSGLVISPWGAQMRIMEVFTNLPLVPDKP
FT                   IDFGLQEFCKVCKKCADNCPASAISMDDEPSEVDTVVKSIRWFQDGKKCLSQRLAYGCS
FT                   KCQSVCPWSKPDTLIHEIGRMVGQNPAFAPFLVKLDDFFYNRYPEGHETGEWAPWR"
FT   gene            168470..168757
FT                   /gene="rdhB"
FT                   /locus_tag="DhcVS_170"
FT   CDS_pept        168470..168757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdhB"
FT                   /locus_tag="DhcVS_170"
FT                   /product="reductive dehalogenase anchoring protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_170"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61342"
FT                   /db_xref="GOA:D2BG92"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG92"
FT                   /protein_id="ACZ61342.1"
FT                   /translation="MTAIIFLFGLLVGIFGNWLWHAAKEHNIKLIWVDYLMMALFVLLA
FT                   GSGIVFVNTFNEESVASAARSSGLIFGLLALLVLGITWQLIWRRNRKSGI"
FT   gene            169213..170898
FT                   /locus_tag="DhcVS_172"
FT   CDS_pept        169213..170898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_172"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61343"
FT                   /db_xref="GOA:D2BG93"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG93"
FT                   /protein_id="ACZ61343.1"
FT                   /translation="MSFESFNFAPAVMAGVRACGYQEPTPIQAQAIPPIMEGHDVIGLA
FT                   QTGTGKTAAYALPIIQKMLSTPRGRVRTLVIAPTRELACQISDSFRSLGQRARIRECSI
FT                   YGGVNMDQQIRRLRSGVDVVVACPGRLLDHIWRGTIDVCGVETLIIDEADRMFDMGFQP
FT                   DIQSILKCLVQPHQTLLFSATMPPEVRKLTQESQTNPVTIQVGTQAPASSVSHSVYPVK
FT                   SHQKTPLLIEILKTVETKSVLIFARTKYGAENLADEISKAGFTTASLQGNLSQNRRHAV
FT                   MEGFRRRNFKILVATDIAARGLDIDHISHVINFDMPDTPEDYTHRIGRTGRFDRTGQAL
FT                   SLVTGRDGDMVRDIQRLLSSPIQRLRVDGFDYATTRNDGQHQSQRRDFAPRRGYSSGGY
FT                   NRPEMSVNEALQTDTPAEMPLSPARPYNAGFRPGRPSNSAPRFRREGNFAPRIQRQTSF
FT                   EDSPAPSPRPEARFNDRPSYRKENSFPVSEQVRPAFKKETGFTPREHNPADFENHEQPS
FT                   GRRPARFNGKASFADRPARPGNKVGKPPFFKRSKKPVSENNETY"
FT   gene            171101..172027
FT                   /locus_tag="DhcVS_173"
FT   CDS_pept        171101..172027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_173"
FT                   /product="membrane protein, TerC family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_173"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61344"
FT                   /db_xref="GOA:D2BG94"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG94"
FT                   /protein_id="ACZ61344.1"
FT                   /translation="MVLCMLALDLGVFHRRAHEVKTKEALIWSGVWILLALIFGGLVYF
FT                   SLGNEIGLNYLSGYIIELSLSVDNLFVFIMIFSYFCIKREYQHKVLFWGILGAIIMRAV
FT                   FIVAGITLIENLSWVLYIFGAFLIYTGIRMVKDQNKEIHPDKNPLVNFVCRILPMTNKL
FT                   HGDHFFIKENGRKLATPLILVLVTIEAMDLVFAIDSIPAVMAITLDPFIVFTSNMFAVM
FT                   GLRAMYMALSGVIQKLHYLHYGLAAILSFLGIKMLISDFVHLPVALSLSVVAVILVISI
FT                   AASLLRPPKEIQPVEVPHPECPVDEGK"
FT   gene            complement(172189..173037)
FT                   /gene="mpxE2"
FT                   /locus_tag="DhcVS_174"
FT   CDS_pept        complement(172189..173037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpxE2"
FT                   /locus_tag="DhcVS_174"
FT                   /product="molybdopterin oxidoreductase, formate
FT                   dehydrogenase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_174"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61345"
FT                   /db_xref="GOA:D2BG95"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG95"
FT                   /protein_id="ACZ61345.1"
FT                   /translation="MNTNRLERINSEIERYRATQPELETILALYQKVFAIQESASSQEE
FT                   PAPLISDEDAIAKLASGEYILKDISLTPPAELFHQTGLKLGQAFTQTAGEKFPTPALLK
FT                   LIESHPEGLSGFISAILADNLDYLAEFAKKPSFNPETLLFFVTNLVSPFLAAQAKYYQP
FT                   QVDLLGWDKNTCPFCGSSPRYSRLDKDNGARRLFCSLCHTQWNYRRIKCAYCSNANAEK
FT                   LRHFYSAVFPYQRVDVCEKCKSYIKTTDERRLGRECLPEVEDAVSIHLDNIAQNEGYQP
FT                   G"
FT   gene            complement(173038..174249)
FT                   /gene="mpxC2"
FT                   /locus_tag="DhcVS_175"
FT   CDS_pept        complement(173038..174249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpxC2"
FT                   /locus_tag="DhcVS_175"
FT                   /product="molybdopterin oxidoreductase, formate
FT                   dehydrogenase membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_175"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61346"
FT                   /db_xref="GOA:D2BG96"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG96"
FT                   /protein_id="ACZ61346.1"
FT                   /translation="MFNAIKGWVNKLEQTGNPNVPLFGKWGLLQIILGLGALTVAGLKL
FT                   AYGLGPITNLSDNWPWGLWVAFDVGAYIASAAGGFTMAAIVYIFGFEKFRPLVRPAILI
FT                   GALCYTIGAIGIMIDLARSIRIIHPIWMWNHESIMFEVGWCVMMYLTVLYLEFSNNIFE
FT                   RIGWKKLGNLQHAFIIPLVIFGIMLSFLHQSSLGALFLINPAQQPLWHGPLMGHLFLVS
FT                   AMALGLSVLTYFSIILSRSWKMTLRMDILSKLGLVIGWILLVYLAARGVDYAMTGNLAT
FT                   GLNGDWYTVLWVTEVGIGMLLPMIMLFIKKVRTSRTGLLWATGLIIMGVVLNRINTLVI
FT                   SQAPNREGSYFPHILEFVFTFGLIAGAMYVFRLCAKYLPLYSDHMKGLTPEQVKKAPEV
FT                   IPAN"
FT   gene            complement(174337..177318)
FT                   /gene="mpxA2"
FT                   /locus_tag="DhcVS_176"
FT   CDS_pept        complement(174337..177318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpxA2"
FT                   /locus_tag="DhcVS_176"
FT                   /product="molybdopterin oxidoreductase, formate
FT                   dehydrogenase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_176"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61347"
FT                   /db_xref="GOA:D2BG97"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG97"
FT                   /protein_id="ACZ61347.1"
FT                   /translation="MRSQFSRRDFLKISGGTAGLFATAGLFRGPIKGVEPKMVDTRPRW
FT                   VKETTTICPFDASGCGFICYTDSAGNLTNMEGDPDNPVNRGSACSKGASLIQLHNNKHR
FT                   LEKVLYRAAGANDWEEKSWDWAIGEIAKKVKTSRDSGFVAKNAAGKTVNRTEAIASLGG
FT                   ATLDNEECYLLSKMLRALGIVYLDSQARLSTASGMEALAASFGQNAMNNSWTDVSNANV
FT                   ILDMGGNPAENYPACFSHLGEAMGKGAELISVDCRLTRTAAKAGTFVAARSGSEIAFTG
FT                   GLIKYVIADIEAHPANYNMTYITEYTTAGMVVNSNFKGPADLDGMFTGYNSASHSYDHS
FT                   NWSFAKASNGEPVIDKTLTNPNCVFQLLKKQYARYTPEMVAATCGCSQADFAKVCASFA
FT                   ATGKADKAGAIIYAMSSTQHTSGAQTVRAYAILQMLLANVGVSGGGLFALGGESNVQGA
FT                   ADNGVSWNKLPGYLSAPTEDDTNFAAFAAKSSEQNAASLLKAWYGSNASSSNGFGFSFL
FT                   PKTDTNTDYSYVNAIKQMAAGKIKGAFAWGANPVVESSAAGQAIQALAKLDWLVVTDMF
FT                   ESETAAFWKKDGISSQTEVFLLPAACSYEKEGSVTNADRWVQWRNKAVNAVGEAKSELE
FT                   IISSLLSRLQSLYQGESALNAEAITKLSWTYSTNPSAADVAKEMNGYQVSSMQQIDSPE
FT                   DLKSDGTVACGNNLYIGSFTDSGNKMARREQTGAFHAGWAWSWPMNVRILNNRASVDLS
FT                   GQPFNAAKPVVSWNGMGWTGDAVDGKVGPVNQSGELPFKGTSGNTAQLFAAMVDGPMPE
FT                   HYEPWESPVDNALSGTQNNPTAMVFEGDTKGSAGEYPVICATIRTVEHSLGGQLTRNMP
FT                   FLVELAPAAYVEISEQLASEKGIKAGDIVKLTSARGSVSVAAAVTKRLKPFSIGGKTVH
FT                   QVAIPYHWGFMGIAQGDSANTLAPNTADSNSSTPEFKAFLVKVEKEADGTVPTITGRYT
FT                   VLED"
FT   gene            177698..178276
FT                   /locus_tag="DhcVS_177"
FT   CDS_pept        177698..178276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_177"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_177"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61348"
FT                   /db_xref="GOA:D2BG98"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG98"
FT                   /protein_id="ACZ61348.1"
FT                   /translation="MRIIAGDAKGKNIIVPQRKATRPATELVRGAMMSMLEAIAEDWSE
FT                   VLDIYSGSGSLGLEALSRGAGHVDFVEHERCCCDIIKQNLETIGCASQAHVYCLDVPKA
FT                   IAFLKKQYDVILADPPYRNQQIGEVLEKLGNSGLIGESTVMAVTHSAHLTLAERYGRLK
FT                   MLKEHRHGDSLIAIYRKDSSFDSHLPGPV"
FT   gene            178206..178727
FT                   /gene="coaD"
FT                   /locus_tag="DhcVS_178"
FT   CDS_pept        178206..178727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="DhcVS_178"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_178"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61349"
FT                   /db_xref="GOA:D2BG99"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2BG99"
FT                   /protein_id="ACZ61349.1"
FT                   /translation="MGIALSLYTERIAVLIAIYPGRFDPVTLGHLSVARRASGFCDRLI
FT                   IAVFDNPAKPGLFTAAERVDFIKQSVKDIPNVEVCSFRGLMVSFARKMGASLIIRGLRV
FT                   GADFEREMEMYVMNRRLDEGIELCCLFSEPQYQYLSASLIKEIVMLGGDSSGLISEHVA
FT                   AALKIKLAPA"
FT   gene            178816..179070
FT                   /gene="fdx"
FT                   /locus_tag="DhcVS_179"
FT   CDS_pept        178816..179070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdx"
FT                   /locus_tag="DhcVS_179"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_179"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61350"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGA0"
FT                   /protein_id="ACZ61350.1"
FT                   /translation="MSFKITDDCISCGACEPECPNKAISEGETIYIIDPEKCSECVGAF
FT                   ETPQCVEICPVDSCVKCCNESHEELLAKWQKLHPGESPK"
FT   gene            complement(179179..179667)
FT                   /locus_tag="DhcVS_180"
FT   CDS_pept        complement(179179..179667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_180"
FT                   /product="integral membrane colicin V production protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_180"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61351"
FT                   /db_xref="GOA:D2BGA1"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGA1"
FT                   /protein_id="ACZ61351.1"
FT                   /translation="MNWLDIVLLIALGAQTVSGFFTGLIRNFLHLVGLIIGIILAGRFY
FT                   PTVAEWLSFISSPEWANIIAFLLVLMAIWVTTTIIAKLLDTIIKPTFLNWVNRLGGAIF
FT                   GLLVSGIFTAALLAIWVKFFDSGSVITDSAVAQILLDKFPLILSLLPDEFEVIRDFFN"
FT   gene            complement(179764..180567)
FT                   /gene="proC"
FT                   /locus_tag="DhcVS_181"
FT   CDS_pept        complement(179764..180567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="DhcVS_181"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_181"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61352"
FT                   /db_xref="GOA:D2BGA2"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGA2"
FT                   /protein_id="ACZ61352.1"
FT                   /translation="MKIAFIGGGNMGEAILGALIQKNICPPQDITVSEIKAERRAFLEN
FT                   TYGIKTTPSNPEAIKNTEVVLLAIKPQNLAELSAGLKGKLAETQLVISIIAGATLSKLS
FT                   SGLGHKAVVRVMPNTPAMIGMGMSIWTALPAVNPTQKEQAKSILYAMGKEIYTDKENML
FT                   DAATAISGSGPAYFFLFMESLEKAALEMGFTPEEATVLVSQTAAGSAVYAGKSGLPLAQ
FT                   LRKNVTSPGGTTAEAIKVFEEAGLETTVIKAAKAAFDRSVELGKG"
FT   gene            complement(180569..183010)
FT                   /gene="leuS"
FT                   /locus_tag="DhcVS_182"
FT   CDS_pept        complement(180569..183010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="DhcVS_182"
FT                   /product="leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_182"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61353"
FT                   /db_xref="GOA:D2BGA3"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGA3"
FT                   /protein_id="ACZ61353.1"
FT                   /translation="MAEKYNPQETEKKWQDKWAADRLYHASEDSPKPKWYSLTMFPYTS
FT                   GNLHIGHWYAEVPADCFARYKRLNGFNVMRPVGFDSFGLPAENAAIKHHIHPRIWTLNN
FT                   VENMRRQLKTIGAMFDWDREVITCLPEYYKWTQWFFLKLYEAGLAYRAKAPVNWCPSCQ
FT                   AVLANEQVVDGTCWRCETPTTRRDLEQWFFRITNYADELKDHEGLDWPEKITAMQRNWV
FT                   GKSYGAEVSFALDCPAAPEQEIKVFTTRPDTIYGVTFMVLAPEHSLVEKITTPENKAAV
FT                   DEYIKKSRACTEIERLSTEREKDGVFTGAYVTNRVNGHKVPVWIGDYVLQSYGTGAVMG
FT                   VPAHDERDFVFAQKYHLPVITVIAPPDYDGQPLEAAYINEGVMQNSGPFNGLPNTEGKE
FT                   KVSDYLAEHGWGKKTVNYKLRDWLISRQRYWGAPIPMVYCEKCGIVPVPEKDLPVLLPE
FT                   DVEFRSGGESPLKYNEGFVNTTCPVCGGKAKRETDTMDTFMCSSWYFLRYTSPGYDKGP
FT                   FDPEKLRYWMPVDLYTGGAEHAVMHLFYSRFFTKALRDMGIIDFGEPFKKLFNQGIIVS
FT                   NHQKMSKSKGNVVTPDNLVAEVGTDAVRAYLMFVGPWDQGGEWNDSGLSGMSRWLNRVW
FT                   NLFTEEYTPKTASAEAERELKRTLHQTIKKITMDIERLRFNTVVAALMELSNSLAKFKE
FT                   AAAISAESWQNSLKTFALMLAPIAPHIAEELWANLGMEYSIHNQSWPKWDEELAKDEVI
FT                   TLIIQVNGKLRERLEMPAGISEDEAKETALNSARVKPHLQGKTPASVIYVPGKLVNIVV
FT                   K"
FT   gene            183190..184497
FT                   /locus_tag="DhcVS_183"
FT   CDS_pept        183190..184497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_183"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61354"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGA4"
FT                   /protein_id="ACZ61354.1"
FT                   /translation="MTVKEIVVIGAGAGGLMAAGRAAECGGKVILLEKTEQPGKKMLIS
FT                   GQGRCNISNSRDIAEFITAFGPNGRFLYSAFSRFFRQELVDLLARYGVETKAERGGRLF
FT                   PVSDKAHDVVAALTKYASGAALASGQKVSQILVSEGRVVGVKTEKETFRADAAVIATGG
FT                   ASYPGTGSSGDGFRLAEALGHTIVKLRPALVPLVVKEIDLAKSMQGVALKNIRLTAYRC
FT                   EADKIPADLTLQDWGRGIAGKKSPKVVIESRMGELMITHFGLGGPLTMLMGLPVAEALD
FT                   QGAVSVAIDLKPALSLDKLRLRLQRDFDTFGKRSFQNLLSELLPQKMIRPFVDLTGIDP
FT                   FKCGGQITAAEREVILANLKCLRFNITSTLPLSAAVVTAGGVDLKEINPRTMESKLISG
FT                   LYFCGEVMDIDADTGGYNLQAAFSTGYLAGESAAGA"
FT   gene            184504..185034
FT                   /locus_tag="DhcVS_184"
FT   CDS_pept        184504..185034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_184"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61355"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGA5"
FT                   /protein_id="ACZ61355.1"
FT                   /translation="MVRRVIVEKYNPRWITLYEAEAERLRKLLSDNLLEIHHIGSTAIP
FT                   GLSAKPIIDIMSVVRDILAVDLLQKTFEQAGYLYFGEYDIPGRRFLVRGTAEMRLAQVH
FT                   IFGISSPDIKRHLAFRDYLRVHPEAAAEYSSLKTSLAEKFPLDIDAYIGGKSGFVKDLE
FT                   AKALKWYRQNPQY"
FT   gene            185276..185578
FT                   /locus_tag="DhcVS_185"
FT   CDS_pept        185276..185578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_185"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61356"
FT                   /db_xref="InterPro:IPR020075"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGA6"
FT                   /protein_id="ACZ61356.1"
FT                   /translation="MSIQMPFNQDTINKCVCHKCPVQNQSECVRDQMSVLKSSLNEIPL
FT                   NPQKIPKAYCVSGKSLCKGVNRTKPCICGSCEVYAMYHLSEGEPGGFYCFEGKSA"
FT   gene            185758..186033
FT                   /locus_tag="DhcVS_186"
FT   CDS_pept        185758..186033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_186"
FT                   /product="glutaredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_186"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61357"
FT                   /db_xref="GOA:D2BGA7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGA7"
FT                   /protein_id="ACZ61357.1"
FT                   /translation="MEKITGRNAGEIKLYALSTCGWCRLTRQLLAELGVAYEFEYVDLL
FT                   TGDERAKALKALAALNPSSSFPTMVIRGNKVIIGYKEAEIREVLKA"
FT   gene            186030..186536
FT                   /locus_tag="DhcVS_187"
FT   CDS_pept        186030..186536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_187"
FT                   /product="rubredoxin-type iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_187"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61358"
FT                   /db_xref="GOA:D2BGA8"
FT                   /db_xref="InterPro:IPR004209"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR036644"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGA8"
FT                   /protein_id="ACZ61358.1"
FT                   /translation="MSPKIPEPAEDAVVLQARLKREAEASGYHLNPNGDFVKMLAEGLL
FT                   ANRRRYGYPSCPCRLAEGDKEADRDILCPCDYRDADLIEFGSCYCALYVNSRIAKGEKQ
FT                   PQPVPERRHLPNPAPKAKSAETSFGLTYPVWRCRVCGYLCGCDEAPDECPICRAGKERF
FT                   ELFIH"
FT   gene            186624..187535
FT                   /locus_tag="DhcVS_188"
FT   CDS_pept        186624..187535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_188"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61359"
FT                   /db_xref="GOA:D2BGA9"
FT                   /db_xref="InterPro:IPR011674"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGA9"
FT                   /protein_id="ACZ61359.1"
FT                   /translation="MNFLRRYDFYLLILFIGLGVLAFNGGWVLPLRLLFGLPLVLIVPG
FT                   YALASVLYPSKLSLSRSSRLMVSLALSLSVSMLAGLVLNYTVGLGQESVLCTLCSLSLI
FT                   FCLAAIGRRQRLPPDERPGLILIPPDTKKQVSGNTFQVFLNMLLAVYLLGVGGFAVKQL
FT                   VQVYSPAEFTQFYMLGIDDTAENFPNMFFLDNGQVTEVQYGNRPAVEAVSACLKLVISN
FT                   SGQLDIVYRVEALLNGHLYKFSFGDGTEFDGFIDVPASVVNSLELYFAPIEPGDNQLLE
FT                   IWLYSGDTPVFSQPLKLVFSTD"
FT   gene            complement(187548..188555)
FT                   /locus_tag="DhcVS_189"
FT   CDS_pept        complement(187548..188555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_189"
FT                   /product="glycosyltransferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_189"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61360"
FT                   /db_xref="GOA:D2BGB0"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGB0"
FT                   /protein_id="ACZ61360.1"
FT                   /translation="MIKICLIGDFKVCPDRSIYKMAAQLADFLSKEKDISLLLCHKEHF
FT                   TRPRSLNRIRRFQPDIIHLLGKPDSAELFRLQLAKLSAPRAKTVISAQQPAKTRTVKNM
FT                   LSYIKPDLAICLSQKCAAFFKESGIETVILPNGVDMTVFQPVSPEIKAELRRQYCLPQN
FT                   KLLLLHVGPIRSGRGVDLLRRMQNPDTQVIMAVSNPGIFNRTLLENLRKSGCMILTSFR
FT                   PNIADWYALADCYIYPMLLEEDTNHQIFSSEMPLSVLEAMSTNLPVMTTPFGALPEVFT
FT                   EGEGLYYAKDDFEFLKAFQAHIKNPPPNTRPKVSACNWPLVITSLKEIYAKLLA"
FT   gene            188757..189989
FT                   /locus_tag="DhcVS_190"
FT   CDS_pept        188757..189989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_190"
FT                   /product="histidinol-phosphate phosphatase protein/glycosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_190"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61361"
FT                   /db_xref="GOA:D2BGB1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGB1"
FT                   /protein_id="ACZ61361.1"
FT                   /translation="MNQKAVFIDRDGTIVEDVPYCNSPRKIRLLNGAGKAIKRLNDQGY
FT                   LVILITNQSGVARGYFSEETLGEIHNKLREELDCFGAHLDDIFYCPHHPSEGCTCRKPS
FT                   TGLIERAIEKHGINNNLSYFIGDRLIDMQAANRTGCKAVLVPYAPPETDYFKSDVTPDS
FT                   RPSFLAGDFTAAVDWILADAAGEAAVSVIIPTLNEEHNICCVLPRLRRVPGITEVILVD
FT                   GKSTDRTVENALRLWPEIKVINQPGRGKGNAMRVGFEAACGDIVVTLDADGSLAPEELP
FT                   RYIEPLFDGYQMVKGSRFCRGGGTSDMPLFRRLGNFVFTKMANLVCGCRYIDLVYGYHA
FT                   FRRQILGSLCLKSDGFEIDTEMYIRATRKGLKVKEVPSYEAKRLEGAGKLRSFHDGARI
FT                   LRTILRESVHG"
FT   gene            189982..190950
FT                   /locus_tag="DhcVS_191"
FT   CDS_pept        189982..190950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_191"
FT                   /product="group 2 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_191"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61362"
FT                   /db_xref="GOA:D2BGB2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGB2"
FT                   /protein_id="ACZ61362.1"
FT                   /translation="MAEPFISVVVSAYSMERYSDLLALIDSLKSQAYTNFEVILVIEKS
FT                   SQLFSCLNRCLSQHPHSRNFKLFFNDGLPGLASARNLGVEKSQGEIIAFIDDDAAASPE
FT                   WLACIARCFTEDKKIIGLTGPALPWWEHPGLSWFPAEFNWIISTMPCLPRSRGYIRNAW
FT                   GTNMAFRRDAFDSGQGFDTELGAKGGGKNGKSELVGEDTEFCLRICRQSGLNILYAPEV
FT                   KVMHRVYRYRLKPGFIAKRAYWEGYTKAVFKYRLSEDTKHEGVLTEEWKLLKRIFLRLL
FT                   PLSLLNLPLKPRQSVLTILTTMNILGSAGWGYLRGLSRLNL"
FT   gene            complement(190954..191343)
FT                   /locus_tag="DhcVS_192"
FT   CDS_pept        complement(190954..191343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_192"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_192"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61363"
FT                   /db_xref="GOA:D2BGB3"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGB3"
FT                   /protein_id="ACZ61363.1"
FT                   /translation="MAYIFNKTHLDTSAGMQTGVLKPYRFLEKIRSPLYINAIFLMIAD
FT                   GTGAAFNFVFWILAAHFFTPESVGLAGAVISAMSLLGTISHLGLGFGIIQHSYPKTLLK
FT                   QSICQMAADKTAAAGNQYFRHLPPP"
FT   gene            191503..192300
FT                   /locus_tag="DhcVS_193"
FT   CDS_pept        191503..192300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_193"
FT                   /product="LmbE"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_193"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61364"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGB4"
FT                   /protein_id="ACZ61364.1"
FT                   /translation="MNPIKKNRIGLLFSLIVICLAGVSFFFWAVPEVLGQQYIKLLDCL
FT                   PLPQAGERILVFSPHPDDETIALGGYIASACQAGAEVEIVLVTDGSKYTPRETRYAEFE
FT                   HACHLLGVSEDNLVFLGFKDGSLNSLSLSSLAASFGNLINSFQPDIVFYPHHKDAHADH
FT                   AAVSRAVGQYLKTIPGIQRYEYLVHYRILFPQPRIFNQNLYLLPPLTLVNEDQNWLRFD
FT                   LSEAQLEQKIAAMSAYESQLKNPFLNPLMQSFIRQNELVCLPN"
FT   gene            192548..193522
FT                   /locus_tag="DhcVS_194"
FT   CDS_pept        192548..193522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_194"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_194"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61365"
FT                   /db_xref="GOA:D2BGB5"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGB5"
FT                   /protein_id="ACZ61365.1"
FT                   /translation="MNDILDKKWSYRELGKTGIGLSPIGLGGWQFSRGKGAAIGVWGML
FT                   NQTKVNEIVLNSLTGGINWFDTAEAYGMGQSEESLAEALKQAGIRPGECFIATKWQPTM
FT                   RSASSLKTLLPIREGFLSPYKVDLYQVHFPGLFASIDAQMDNMAALYKEGRIRAIGVSN
FT                   FNASQMRIAQKRLNKHGLSLASNQVKYNLLNRQIETNGVLETARELGVSLIAYSPLAMG
FT                   VLSGKYQRNPEYLEMVPFIRRKAIRRVLEKSIPVIAKLSEIAVRYHADIAQVALAWVIY
FT                   GQGEAVFALAGASTPVQARENLKALDIKLTTAEIAELNSVSRS"
FT   gene            complement(193519..193872)
FT                   /locus_tag="DhcVS_195"
FT   CDS_pept        complement(193519..193872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_195"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_195"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61366"
FT                   /db_xref="GOA:D2BGB6"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGB6"
FT                   /protein_id="ACZ61366.1"
FT                   /translation="MPRPYKCRRISEIPKVAYYKPAGIPLSMLEENQLSTEEAEALRLK
FT                   DLLGLEQAEAAQQMNISRPTFQRMLYSARYKVADALLNGKALRIEGGVFEIDARPCCQR
FT                   QTPPSQTDPPGQT"
FT   gene            194024..194518
FT                   /locus_tag="DhcVS_196"
FT   CDS_pept        194024..194518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_196"
FT                   /product="PBS lyase heat-like repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_196"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61367"
FT                   /db_xref="GOA:D2BGB7"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGB7"
FT                   /protein_id="ACZ61367.1"
FT                   /translation="MTDTKFIAQQLELLKDPNGLVRQSARLALEDLGKASVPYLVAKLD
FT                   ENKGDALWENVKALSRIGDASSAGALVKLLSHEVSDIRWLASLGLIKIGKEGVKPLLRA
FT                   LSLSDARSPFLREEAHHVLTGLRDKELKSNLSGVIKALESNSPRSDAPVAAEAVLLNLK
FT                   L"
FT   gene            194973..197165
FT                   /gene="ablAB"
FT                   /locus_tag="DhcVS_197"
FT   CDS_pept        194973..197165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ablAB"
FT                   /locus_tag="DhcVS_197"
FT                   /product="L-lysine 2,3-aminomutase/beta-lysine
FT                   acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_197"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61368"
FT                   /db_xref="GOA:D2BGB8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022459"
FT                   /db_xref="InterPro:IPR022525"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGB8"
FT                   /protein_id="ACZ61368.1"
FT                   /translation="MVLTHIEEKMPQTSLPEHDYRLMAHKISSDYSEEEWGNWKWHVSH
FT                   TIKDLATVEKLLGVKFSAEKRRSLEDTIRNFPMSITPYYFSLIDPKNFENDPVFIQSVP
FT                   SAAELNFSCHDKEDPLAEDVDSPAPGITHRYPDRVLFHVSNRCAMYCRHCTRKRKVGDV
FT                   DKTLSRDDLVKGLEYIKNTPQVRDVLLSGGDPLLLSDSMLEWLLSELKAIPHVQVIRIG
FT                   TRVPVVLPQRITPHLVKIIKKYHPVWINTHFNHPREITATSIRALRLLADAGIPLGNQT
FT                   VLLAKVNDCPRVMKALVHKLVENRVRPYYLYQCDPAQGLSHFRTSIGKGIEIIENLIGH
FT                   TSGFAVPTYVIDAPNGGGKIPIMPNYLISQSSSKVILRNYEGIITAYYQPEDYHPPKCG
FT                   QDCSACNLELDLNGAAEGSLVGIARLLSNHEDTDYLVPIECDRMNRRKSGYDQIVTLGT
FT                   SLIQHGKNSDRIYLMRLAAEETAILLPEMQALAAENDYTKLFAKVPGDVKTLFEADGFE
FT                   TEAVIPCFYGGSKAGYFLGKFIEKGRKIEENTELLEDVLKVAHSKAGKALSFKLPKGYT
FT                   LRKCTAEDTAAMAEVFSTVFASYPFPIYEPEYISRTMTESITYYGIWHGQKLAALASAE
FT                   QYPLEGHVELTDFATLPDYRRRKLAGILLHTMETEMKQKGFGVSYTSAVAESYGMNISF
FT                   ARQGYEFAGRLKNNTQINGGLKSMNIWYKCLKKQTK"
FT   gene            complement(197241..198521)
FT                   /locus_tag="DhcVS_198"
FT   CDS_pept        complement(197241..198521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_198"
FT                   /product="serine protease inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_198"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61369"
FT                   /db_xref="GOA:D2BGB9"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="InterPro:IPR036186"
FT                   /db_xref="InterPro:IPR042178"
FT                   /db_xref="InterPro:IPR042185"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGB9"
FT                   /protein_id="ACZ61369.1"
FT                   /translation="MKTKIALSLLAVVSLFTFTACAGGVSAEELKSDKDRLVNPNVSQQ
FT                   SLNTQVQANNDLAFKLYRYLKGTEEGNFFYSPFSISIALAMTYAGADTATKTEMQNTLN
FT                   YLLPDADLHAFFNFIDQELYKREAQAKEADEGTFELKLVNAIWGQKDYTFLSDFLDTLA
FT                   QNYGAGLRVLDFAANSEEARKVINDWVSDATKDKITDLIPADGIDATTRLVLTNAIYFN
FT                   AAWAAPFDEENTQSGLFYLQNGTSVNVQMLRQIENHGYYSGDDFQAVELAYAGNGLSMV
FT                   IILPDEGKFAQVEDALSGQMLAKILSSIKSNQINLSLPKFSFESKFTLKDALSSLGMPT
FT                   AFGSQADFSKMDGGYNLMIGDVFHKSFISVSEDGTEAAAATAVSMNLTSAPTELVTLSI
FT                   DRAFIFCIVDMATGTTLFTGRVIDPTA"
FT   gene            198708..199295
FT                   /locus_tag="DhcVS_199"
FT   CDS_pept        198708..199295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_199"
FT                   /product="membrane protein, Hly III family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_199"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61370"
FT                   /db_xref="GOA:D2BGC0"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGC0"
FT                   /protein_id="ACZ61370.1"
FT                   /translation="MGGVLALIVLVILSWGNWDIMAVSVIYALAVISLFSFSTIYHALK
FT                   KQENEINVWRKLDHIAIFIMIAGTYTPMAYIYLDGGWRLGMLIATWAFVLIGVFQKVFF
FT                   LNAPRWLSPVTYLGMGWMAVFPLREFWLNMPSLVFWLIAAGGLAYSIGAVIYGIKKPNP
FT                   VPGVFGFHEIFHALILLGWAFHLAAVILAILG"
FT   gene            complement(199292..201283)
FT                   /locus_tag="DhcVS_200"
FT   CDS_pept        complement(199292..201283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_200"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_200"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61371"
FT                   /db_xref="GOA:D2BGC1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGC1"
FT                   /protein_id="ACZ61371.1"
FT                   /translation="MLNIQNLSKSFGVRSLYTGVNLNIGARDRLALLGPNGSGKTTLFE
FT                   MIAGRLEADEGKIILRRGTTVGYLEQDIKPSSKQPLLKAVSSASDRLSSLSHKISLLQG
FT                   ELAEEKDGSENNRLLSELGELQHSFEALGGYNAEQEAKLILAGLGFKPADFDRPLHEFS
FT                   GGWLMRAELAKLLFLSPDILILDEPTNHLDLESTRWFESYLKQYSGSVLFTSHDRAFLN
FT                   SIATKILSLEDQKARLYSGNYDSYLRERELRLNQLESQARRQQELIDKETKFIERFRYK
FT                   ATKASQVQSRIKKLDKLSAVAIPRQTKKIHFNFPEPERSGHDVIKLRNLTKSYGDLVIY
FT                   QGLELVLARGDKAALVGPNGAGKTTLLKILAGVMPFDSGYRNLGANVNTAYFAQYYVES
FT                   LIPANNLIEELETVLPDAPEQQLRGMLGAFLFSGDDVKKRISVLSGGEKTRLAIAKMLL
FT                   KPANLVLMDEPTNHLDIPAREILADALQAYKGTLCFITHDRTLIREVANKIIEVRNGKI
FT                   RVFEGDYDAYLKFAAANPFEGEAPKSPAPVISHRPAPVPAALSQKQRKTLEGQIRNQHY
FT                   KETGALKKEISDTEAEITNLEQRKQELETLLADPDLYRSGQKAADTSAEYKNCKEQLVT
FT                   LGDKWLKLCQQNDALKQKLEDTLKALYN"
FT   gene            complement(201416..202282)
FT                   /locus_tag="DhcVS_201"
FT   CDS_pept        complement(201416..202282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_201"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61372"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGC2"
FT                   /protein_id="ACZ61372.1"
FT                   /translation="MKPVKAMAPLLSLLVLVSLALGGCSGSTADNDSSNSNTDNSPSSE
FT                   TPATPTGSQLIASILAASPNITRFDMTSMVDMTMQVSGMNIKTVMTANGKEDLGNKRAY
FT                   LTSSVIMSRDLASTMELETYMIGSLQYFRITNSDQDTGMQLNTWYKILIDAQMQSQTWN
FT                   SQSQQNDYLFSKSTITVDGSETINGTSCWKVTITPDLTELIKYLNEQQAIEDSSAITNP
FT                   ADSLKNIKMTAWVAKDTSFVIKMNMTMDIVTEAQTMSLVMSTTITNINQPVTITLPPDA
FT                   VNAIQLG"
FT   gene            complement(202377..203561)
FT                   /locus_tag="DhcVS_202"
FT   CDS_pept        complement(202377..203561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_202"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61373"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGC3"
FT                   /protein_id="ACZ61373.1"
FT                   /translation="MPQTKTLIIGGGAAGMTAAISKARRGEPVIILEKTAQLGKKILAS
FT                   GNGRCNLLNEQLDSSFYNPEARPLVNSIFSRFGRNEILNFFSELGLHYYSQDGRIFPFT
FT                   NQAASVLKVLEMEIQRLGVKVEYSFDCLSIQKTQTGFSLQAADGRLKTGQNLILTGGGC
FT                   TYPAFGSDGSGYKLAASLGHHIIKPVPSTVPLVVKDPLCHLLQGQRIIARAQSRIRGKA
FT                   GTPVDGELLFTKYGLSGSLILDISQEISLAINRLDIKDVSLEIDLIPFIEPKQLETELL
FT                   KRRKTGLSPDEMLTGILPSKLCMAFKQLFEKDNPARAAAKLKNWRFEVSGTRGWNEAEF
FT                   TAGGIDTGEIDPQTLESKLVKGLYLAGEVLDVNGVRGGYNLGWAWASGYIAGLS"
FT   gene            complement(203759..204103)
FT                   /locus_tag="DhcVS_203"
FT   CDS_pept        complement(203759..204103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_203"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61374"
FT                   /db_xref="GOA:D2BGC4"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGC4"
FT                   /protein_id="ACZ61374.1"
FT                   /translation="MVRLILGILLGFWGLPLLVFSAQNLINCLNENESKAALMFFFATG
FT                   LPSLIMLLGSFLLIRNYTKNPSKPAPLAKSCSPHTGLSSTNGRYCTKCGSELAAEAVFC
FT                   PNCGQKISAG"
FT   gene            complement(204454..204777)
FT                   /locus_tag="DhcVS_204"
FT   CDS_pept        complement(204454..204777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_204"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61375"
FT                   /db_xref="GOA:D2BGC5"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGC5"
FT                   /protein_id="ACZ61375.1"
FT                   /translation="MYCSNCGKQVDESVSFCPACGNQIHTGKMTAAEYPERKSRIAAGL
FT                   LGVFLGSIGVHRFYLGFVGIGIAQIIVSIVTLGIGSIWGFIEGILILTGSFEKDAKGIP
FT                   LRD"
FT   gene            205316..207277
FT                   /locus_tag="DhcVS_205"
FT   CDS_pept        205316..207277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_205"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61376"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGC6"
FT                   /protein_id="ACZ61376.1"
FT                   /translation="MRRALSILLSLSILVSLGLFSSVPVSAALVNVSISSGTSTEIVGV
FT                   YNKAGGGSVYVDLSTSPLSAVLAQEPKPYPTGYVTEPPDILGSVWDTGTGLYFQSTNPG
FT                   ADWIWETQRAEGPSSYDVSNPLYDAAAYTNGRVVVFEQHFTLDGTPQAGTLHIAADNCW
FT                   EVFINGVFLARSSTAKVAGWELTNLHESYVATTGWQAVGHIAVPDTMLVTGENTITILA
FT                   ANEYFWSDDGNSPSPALRLSPYYQYNPGALIFKLDVGYEEFVADPGIHVEKAGLPVSTT
FT                   ENTTIDYTYTVTNTGNVPLSSVAVVDNLVSPVTYQSGDENTDGLLDLTEIWIFTGSYLV
FT                   PWFTAGPVDNTATAEGYWDTTKVTDEDTFSVPILHTPNIEVDKTGPANTGYFEQLDADY
FT                   TYTLTNIGNCSLDVDLTDDQIAGLLFTGGDTNGNGYLEPGEIWTFIGSDLIVCEGITEL
FT                   FFTNIATAIGTDATGATDRDTDDWTVTIFQWQPRTIGYWGNWDNHWSIGCITDIVNRVN
FT                   ADSAYFSTLTAEQINILLLSADQKGKMTQDKARILVQKQLLAAWLSVESYIGATDGDSE
FT                   TCGTLDAAMRPGATVYLSKFAGAEALFGASSLTVAQVLAAVDAGMSTWTQNELLIAKDV
FT                   LDMMNNAENNGYFMFMAP"
FT   gene            complement(207345..209036)
FT                   /locus_tag="DhcVS_215"
FT   CDS_pept        complement(207345..209036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_215"
FT                   /product="resolvase domain protein, PinR type"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_215"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61377"
FT                   /db_xref="GOA:D2BGC7"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGC7"
FT                   /protein_id="ACZ61377.1"
FT                   /translation="MSVKRKMPESRRLFLEEWKVFMNGDFKKVAIYARVSSERQDIDLS
FT                   ITAQLKALREYASRNGYYVVKEYKDEAESGRSIDRPGFKEMVVTARQKPPQFGAILVWK
FT                   LSRFARNREDSIIYKSLLRRHGVQVISINEPVEDTPSGRLLEGIIEVIDEFYSANLSQD
FT                   VTRGMRESASRGFYPGGPPPYGYRRVKVQDGGIQRVKLEPDPETAPVVDRIFQECVADK
FT                   GMIEICRGLNGDGLTTRKNKRWSKTSVATVLKNEVYLGTLIWGEVSTNHNPNRLPVIRV
FT                   ENAWTPIMDPETFKKAQLKLAERAPKITHPRVVHSEYILSGLVRCKNCDAALVGHAVKS
FT                   GKFFYYMCGNARKRGRGLCPTPLLPKERIENFMIDRIKRYILTDENLTELIKLTNEELA
FT                   QQCQIESGRLEAINSELEDVEGRLVKLYNALETGEFKGGELAPRIKALFEKKTELEQAK
FT                   CGAEDTLKYKTIEMPNPGVIKDYVQDLRNTIEESNFISKKTFLRSFIERIEVDEKEVKV
FT                   IYTMPVPPESPPAETVGVLPFVHDSPPKVSIWFNLDVAYPLRKPQV"
FT   gene            complement(208970..209947)
FT                   /locus_tag="DhcVS_216"
FT   CDS_pept        complement(208970..209947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_216"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61378"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGC8"
FT                   /protein_id="ACZ61378.1"
FT                   /translation="MTVPGSLGDLCRYILSYEEGQYADNPVRLGAIVREYASIQSTPNL
FT                   LRTIGLVRSLGIKIEAVDYLKTGGTNMLAKGCWYIHYSAKDKPATRKFTIFHELFEIIH
FT                   KNLNSLNPDYALMKEPQISRCADRFAAAVLIPPDFFLNQAGKTGCDLVKLAQNLELSHQ
FT                   CLLIALGQHFAEIPFIGVLFEHRLDGENCTDGEIKDFMATLVVKTPPASRIRSLCGLQT
FT                   VPARNAHPQVGSLVCAAVTSGHPVLWRSAHVEDSPAILVRPLRSVGREPYRVIMLAIPN
FT                   EEFGMISLQAETIEPVPVNGDTLCPSRERCRNPGVCFWKNGRSL"
FT   gene            complement(209969..210367)
FT                   /locus_tag="DhcVS_217"
FT   CDS_pept        complement(209969..210367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_217"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61379"
FT                   /db_xref="GOA:D2BGC9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGC9"
FT                   /protein_id="ACZ61379.1"
FT                   /translation="MEEANLGQFLKSLRDRQRMSLRDAEKESGVSNAYIAQLEKGDRPA
FT                   PSPDILKKLAKAYNVTVRELLMRAGYLDEPEVTATEEQRIEAAFQYVLADPDYKLGTRL
FT                   RGEDFDTKGKRGVVITYETLTGKKILSI"
FT   gene            210730..210990
FT                   /locus_tag="DhcVS_218"
FT   CDS_pept        210730..210990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_218"
FT                   /product="DNA-binding domain protein HTH_XRE"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_218"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61380"
FT                   /db_xref="GOA:D2BGD0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGD0"
FT                   /protein_id="ACZ61380.1"
FT                   /translation="MIREGEMTIRVKLNQGAVLRAIARRNMSQNMLAIRAGISSGYISQ
FT                   IMCGTRNPSPAVRQKLQEVLQPLTFDDIFIIEEDGHDPATR"
FT   gene            211260..212210
FT                   /locus_tag="DhcVS_219"
FT   CDS_pept        211260..212210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_219"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61381"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGD1"
FT                   /protein_id="ACZ61381.1"
FT                   /translation="MSPIKGVSEIVRLPRLGKIRLGIKKENEGVSYPSPTDYFVCPDEV
FT                   KKVFGEKPKELRIMFPTENSEQWASQYLRCYSASRGLICRGDGETALSRFSPKPGETIV
FT                   PGSMEETICNPNACGYNKKGQCRRVMNLQFLLPDCPGFGVYQLDTTSFHSMKNINSALT
FT                   FIRGVCQRVSMIPLSLQLVEQEVQPEGWCKTAHVLNLTCPHSLAEVQRFAQIPPGQALL
FT                   LPPPDSEAPDDLFLNDSETMTPDEKERQRLDLWTRIKSKIWHFDIQNSQIGNWFEKNTA
FT                   LTVGLTDFEPPVPPSRFTLEILSLFCESIDRYAGH"
FT   gene            212238..214421
FT                   /locus_tag="DhcVS_220"
FT   CDS_pept        212238..214421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_220"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61382"
FT                   /db_xref="InterPro:IPR024385"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGD2"
FT                   /protein_id="ACZ61382.1"
FT                   /translation="MQNENAAVPMSSDAVQDLTAEHLCHLQEGSGIKAEVIKERGYRSI
FT                   LNKSELEKHGFLSSQRRAPGILIPLWGVDGGQVGYQYRPDNPRSDSRQRPVKYESPVGS
FT                   SNHLDCPPRCRPLLGDPKTPLWITEGSKKADALASHGACVICLTGVWGFKGKNEFGAVT
FT                   LLADWDRIAIKDRLVYLAFDSDVISKDMVRKALEHLGEHLSRKGANILVVYLPQEGNQK
FT                   CGIDDYLLNHSLEDARKLATDFRPADEQSRERFVPGFVLHDGTIGELIVSPEDERAFII
FT                   IVNGSVRKVFRYETPKAIYLPSDDPLVTEVVHFASTATPYESQARLFSEIKGFIHRYLE
FT                   IPPDFEEISALYVLLTWVYEFAPSIPYLRVIGDWGTGKTRFLQVVGSVCFRPTFASGAT
FT                   TPAPIFRVLEQFRGTLVLDEADFKDSSSWVEMVKLLNNGYRPGMPVLRADKENGKWFPR
FT                   SYQVFGPKLIATRFPFQDEALESRCLTSEMMPLTRDDIPRVLPPAFEKEIDDLRAKLLT
FT                   FRLANLIKLKGKTFGNELLEPNLQPRLQEILIPLKAMLNGDHSMVEAITGFVHRLQENL
FT                   FLRRRESATGRVLAALIELHEEGKELTSDAVAKKANETDDEVEQLSAEKVGRLTKKLGF
FT                   AKERMGKSRQRLICWDETRVTKIVSSYGLQMALPLSPEKPSEPSVLSALASNPADSNKE
FT                   GLKYCPPYCPPKTEADTSVGADSRTERTVTDKE"
FT   gene            214950..215264
FT                   /gene="dnaJ1"
FT                   /locus_tag="DhcVS_221"
FT   CDS_pept        214950..215264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ1"
FT                   /locus_tag="DhcVS_221"
FT                   /product="molecular chaperone, DnaJ-family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_221"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61383"
FT                   /db_xref="GOA:D2BGD3"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR027137"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGD3"
FT                   /protein_id="ACZ61383.1"
FT                   /translation="MTDATAEMMSGWLNQMFEGLRNDPVIGELWSAMKAETQSRHQAVV
FT                   DPYRVIGLDKTSADDQVKKRYRDLMVKLHPDTAGVKGTEFLFQLVMAAYQQISKERGWR
FT                   "
FT   gene            215255..216193
FT                   /locus_tag="DhcVS_222"
FT   CDS_pept        215255..216193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_222"
FT                   /product="Holliday junction DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_222"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61384"
FT                   /db_xref="GOA:D2BGD4"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGD4"
FT                   /protein_id="ACZ61384.1"
FT                   /translation="MALVKEGDTELIMEIARFESSVDLEKDFRIGWSWRHVRIWPATLS
FT                   RLFKDGYLDNVFRSNSFTGYKLTEKAKALVIANQEKDADDSQTAPLLNPSDDLFTDIIG
FT                   HDDVKELLKATLLAEKPVHIMLTGPPALAKTLFLWDIEQTFGEQAIWLVGSATSKAGLW
FT                   DLVAEREPKILLIDEMDKMNAVDMAALLTLMEGGRLVRAKRGRELDINNPLKVVAASNR
FT                   LEKLSPELRSRFAIRKLNPYSRSEFLTVVKGVLVRKENLSEEMAQDIASRLDGISQDVR
FT                   DAIRVARLAPQVGVDKAIGLLLGGETNVRQA"
FT   gene            216362..217174
FT                   /locus_tag="DhcVS_223"
FT   CDS_pept        216362..217174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_223"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61385"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGD5"
FT                   /protein_id="ACZ61385.1"
FT                   /translation="MEDQFIEEIRRRKDEGQSERQMASELNVSRSKVRTALQDIKMSEA
FT                   GSALVPEDKLRAIIREELERVRNGEEEDAKTRGEFPIVRKMGGGMEMIAPEAVLKHYMG
FT                   GTPDGEVELRAIMKFRAAMLMVMDLVNIQKGSAEADARRMEPILRLMKETREEQDAAAA
FT                   RAKASSEEIADRTAQATAGQLFGAISQSNSQVNSTLAQIKQMVGGQANDPFSQVVSMLQ
FT                   SMQQMSQMFGMPLPGMMPGAAPAGGPPGAQPIMEPPPIEKHSAKEWEE"
FT   gene            217176..217454
FT                   /locus_tag="DhcVS_224"
FT   CDS_pept        217176..217454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_224"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61386"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGD6"
FT                   /protein_id="ACZ61386.1"
FT                   /translation="MFDFMQMANSPQAREMLFKMMSKQMGQSPPDVKEAISKVEIAIKR
FT                   NERGFELRIGRSDHPQVEKMLQESTDSWIEMLSRGFQAVGYKVKIYE"
FT   gene            218115..218327
FT                   /locus_tag="DhcVS_225"
FT   CDS_pept        218115..218327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_225"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61387"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGD7"
FT                   /protein_id="ACZ61387.1"
FT                   /translation="MGKYASWNEFEKNVPITYKEKATPEAFRTGMNGIAPTGLKVKEGR
FT                   VNHYRDGVDGKGEVMVSGYKRAMFE"
FT   gene            218457..218669
FT                   /locus_tag="DhcVS_226"
FT   CDS_pept        218457..218669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_226"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61388"
FT                   /db_xref="GOA:D2BGD8"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGD8"
FT                   /protein_id="ACZ61388.1"
FT                   /translation="MFKTQQLTGPVAPGQFNPAQVSGPSAYYPTQTTGTDWTSMFSAMM
FT                   PMIMMIMMMAILMPMLKGVTASAKD"
FT   gene            218713..218910
FT                   /locus_tag="DhcVS_227"
FT   CDS_pept        218713..218910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_227"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61389"
FT                   /db_xref="GOA:D2BGD9"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGD9"
FT                   /protein_id="ACZ61389.1"
FT                   /translation="MFTAQQFAGQQVRPQQYQYGTVSGYYPLQTTDMTSMFSAMMPMIM
FT                   MIMMMAILMPMMKGMTSSSK"
FT   gene            218944..219531
FT                   /locus_tag="DhcVS_228"
FT   CDS_pept        218944..219531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_228"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61390"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGE0"
FT                   /protein_id="ACZ61390.1"
FT                   /translation="MTKKIVTQQYPGYPGTRPPKGWVPPLGQSLTLLGVYDNESGYWMG
FT                   LPLQVLREALLNAEALHTEDRIDERDKIEVTVPNASAQDVVRTTEFEVPAGEVWFLNRL
FT                   NLVTEAEVSGNIRISKFPKVSDIDKKYLGTDQAAGADTDYDLAAAGQLGADLRLVGGDK
FT                   ITVVATVTAVGGTTADRKVTLNPYGRKAKRLV"
FT   gene            219549..220076
FT                   /locus_tag="DhcVS_229"
FT   CDS_pept        219549..220076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_229"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61391"
FT                   /db_xref="GOA:D2BGE1"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGE1"
FT                   /protein_id="ACZ61391.1"
FT                   /translation="MPFTMVPEGYRSVLIGSAASIEDLGTFAPLEESSAEGALFLMRLD
FT                   FAEPPSPEALAQLEQACFDAGVELWPGYSYVVYADVNQPTVYLAWQKGFAWLPIIIGLL
FT                   VTTVLPPLLGSLVWWLMPEDLKNLISGIVNLGIMLLVMLLVTKLMPSFTPEKEKVKKVK
FT                   PAEPEKLEGASA"
FT   gene            220243..220794
FT                   /locus_tag="DhcVS_230"
FT   CDS_pept        220243..220794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_230"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61392"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGE2"
FT                   /protein_id="ACZ61392.1"
FT                   /translation="MTALLSIMSGELGDIFWDLPPVVTYVAGLDLGCSIHVANPTDLAK
FT                   EYALMARLSRGEMVISEEALPVFGFTWFTVDPGDSIKLNGALRFNESDADLTVMLVEKE
FT                   TQEVTDSVSTRLLQLSTSALPPWPGSTSTGTDWSSLLGMVLPVMMLGMVAVVMKPKSEE
FT                   KAGVSQVKEERKLLPEGRQG"
FT   gene            220794..221261
FT                   /locus_tag="DhcVS_231"
FT   CDS_pept        220794..221261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_231"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61393"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGE3"
FT                   /protein_id="ACZ61393.1"
FT                   /translation="MPGEFYIEGKAAKVSLKGLEDVLARIETKVDGVKSQTDKLAGETP
FT                   GEGSTTADWQSVESDVVLIGAAGIRNKIHDLTVSIRNLMGSQITVRLYKAINGIEQEVY
FT                   KQNFDAAIDPPGLPVINGSWAMHGILRVTLQSNDVADNGKAVDYDYMLEAI"
FT   gene            221262..222479
FT                   /locus_tag="DhcVS_232"
FT   CDS_pept        221262..222479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_232"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61394"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGE4"
FT                   /protein_id="ACZ61394.1"
FT                   /translation="MGLLIPIRSLSPDSSNYPAGIHKGHPAGLPAIDPDLLPDNIKWNT
FT                   TIFGVLGSMVIWQAQAKPLLSIPIPIIQSSIIVTASEAKTASPGLVCPVPVIVPATALA
FT                   TVSDPERTVLHDDAPPTDTEVTTEANSDPVIDQSWLQNDDNQEAVTTTTWKAMTFTPAT
FT                   NHTIRGVRLALYGSSVGSITVSIRATSGGLPTGGDLCSGPLDGSQLNGTFDGKVYDISL
FT                   GVGTALTAGTVYAIVVRTGSGTLNWRSSAAGYDRGNKCSSTNSGGSWTTDATRELLFQE
FT                   FGDNSLDVPATPSPTAVGDGLYIGNSTPFDYVDVWVNQAGVGTYTITWKYYNGVSWLPL
FT                   TLSSDGDRSNSWKRPGRHTVFFNRPVDWAITSILTYALYWVKAEVTAYTSQATQPILGR
FT                   VWIGAY"
FT   gene            222491..223228
FT                   /locus_tag="DhcVS_233"
FT   CDS_pept        222491..223228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_233"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61395"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGE5"
FT                   /protein_id="ACZ61395.1"
FT                   /translation="MTCNYTEPKQSEKDYREMAKLGRELGIPVPECFLEMQVILKGKTI
FT                   HHHKQRSHSWTRNAYNCLFTQLTAKNFSGSTFEGGVLTMKYNTGTVYGPNYAGTILSGI
FT                   RNYAPGDSEGLNTSYRADTGNLTSGIIVGSGNNPEDFNGYNLQTPIIEGASAGKLNYSA
FT                   HLANVRAWDAGTKTMSAAIARYMNNNSGGDITIREVGQFTRGMLYSQFPTLMVGRDVLS
FT                   PEVTLPNSGQLKVTYTIALTYPE"
FT   gene            223241..223987
FT                   /locus_tag="DhcVS_234"
FT   CDS_pept        223241..223987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_234"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61396"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGE6"
FT                   /protein_id="ACZ61396.1"
FT                   /translation="MQIIDTPEIEAKYQQLEALGRKLGVPLLCGHLELQVSKNGKLLSH
FT                   RKQRSHSWTRNAYNLIFCQLGSTNPTDATFGSGLLSYKKTDGNIVRYTGDYGAWVTYID
FT                   YYNVETRENESAGRGSRAAANDAGHGIVIGTDGSLESFDHFRLLSPIGSGLGAGQLSMI
FT                   AQEAPVLSYDAGTKTLTDTLVRFMNNNSGGDITAREVGLIVKMQTYTAYSMSLFLFSRD
FT                   VLSPEVVIPNAGQIRIQYSISLVYPS"
FT   gene            224017..225273
FT                   /locus_tag="DhcVS_235"
FT   CDS_pept        224017..225273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_235"
FT                   /product="subtilisin-like serine protease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_235"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61397"
FT                   /db_xref="GOA:D2BGE7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGE7"
FT                   /protein_id="ACZ61397.1"
FT                   /translation="MRYAVISKGISPVQLETEVKKVGAGNIVKTKLVGQLFCELDNDQA
FT                   RILAKVPGLILKEIKEYKTQQVLAQAPAAESISDVFYLLRSYFNPPLTGTGLTVAMLDS
FT                   GIRKTHEALQNKVVFEVNLTDSPSATDVFGHGTQVAFVIAGGLHAMGSKAGVSPGAILM
FT                   NIKVISDEGIGNDEDIVLGIDKVCELAEDARKKGLWPTDDMYPNVINLSLGAEDDGDPD
FT                   NPVRAACRKASTEYGLDVVAAAGNSGPDMTTIMLPACDPEVVAVGALETIGDLVIWEKS
FT                   SRGPTVQGETKPDFVIWGTSLEMASEKADDEYVVKSGTSFAAPMLSGLTGLLWESGRRA
FT                   YGESWLFRWTDARQFGPYFSTKPADAPLNKDNAYGYGLPAMGTMLGEVAQVSTPSQGVN
FT                   DMFPMVMMMAMMSALTGGF"
FT   gene            225458..225787
FT                   /locus_tag="DhcVS_236"
FT   CDS_pept        225458..225787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_236"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61398"
FT                   /db_xref="GOA:D2BGE8"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGE8"
FT                   /protein_id="ACZ61398.1"
FT                   /translation="MERLIIALIALLGGLVAALVGWLDSKEAFDARKFGGSAVRSLIAG
FT                   VVFAVGYHLAGAVSTLDLFYAFLGGAGVDVLGNRIAGKLGNGSFPVSQNTEPPAEEDPQ
FT                   EPKES"
FT   gene            225787..226173
FT                   /locus_tag="DhcVS_237"
FT   CDS_pept        225787..226173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_237"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61399"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGE9"
FT                   /protein_id="ACZ61399.1"
FT                   /translation="MAQYADVIEIIAPSQATPGSRVDITVRIKNTYSGTVSIMVGGALE
FT                   YGITPWPSIDFPENWANVDCGAVHAFSGSFVMPDRKVTIHAYSYWYGADGYWYYDDELT
FT                   RSVDIAAVPDPSISEFRIADFAKV"
FT   gene            226184..226786
FT                   /locus_tag="DhcVS_238"
FT   CDS_pept        226184..226786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_238"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61400"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGF0"
FT                   /protein_id="ACZ61400.1"
FT                   /translation="METKTLALDLGAFKLLQEDPGQQLQDPPVSGWYVDPRTGQKVFYD
FT                   ASVGKFFTLAGGVYIPLGYMNPAPKQVAVAPGDRLKIILSFKYTGPAITAVTGYYCIGV
FT                   YGTFGFNETMVGQTSFNVPLVTTPPSSPNVTNEYTFTIPTSIGTDWNDIYVKIFGGNPS
FT                   IGNSALTSYLFGYENALTIAGIQPSITEFKISDFAKV"
FT   gene            226795..227268
FT                   /locus_tag="DhcVS_239"
FT   CDS_pept        226795..227268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_239"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61401"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGF1"
FT                   /protein_id="ACZ61401.1"
FT                   /translation="MVLDITLEPMALEQKTFNVGDTVRVTVSFKYTVGVNKTVKLSAGP
FT                   YYTNLFGKHLVASCVGDADVQLVPASSPATQSATVDFTLIPKANNGIDNGTYGLRVWVE
FT                   DTNAVAEQDDVIVVTGNPGSTDMFSSMMPMIMMLLMMGMVMPMVQQTGEGVEE"
FT   gene            227265..227960
FT                   /gene="xerD2"
FT                   /locus_tag="DhcVS_240"
FT   CDS_pept        227265..227960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD2"
FT                   /locus_tag="DhcVS_240"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_240"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61402"
FT                   /db_xref="GOA:D2BGF2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGF2"
FT                   /protein_id="ACZ61402.1"
FT                   /translation="MKAYLEPDEVEKLERAADFLRDKLLIRLLWRLGCRVSEVLGITVD
FT                   NIDFKQGTITIEHLKARIKLSCPSCGAGLGKSHKFCPVCGLKVEKAVAQEKEHHRYRCL
FT                   PVDKDTLDLLKEYIKRGGAVSRNGKKIVFNLTRHRAWQIIRKCSDIAGLPQVVNAESGK
FT                   EHGVSPHKLRDAFAVHAVKLDDSGDGLRLLQEHLGHQSIVTTMKYRKVSGEEQKEWYDK
FT                   LWQGGNKNG"
FT   gene            228255..229763
FT                   /locus_tag="DhcVS_241"
FT   CDS_pept        228255..229763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_241"
FT                   /product="LtrC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_241"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61403"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGF3"
FT                   /protein_id="ACZ61403.1"
FT                   /translation="MMAGQATVTIGNRQWSTDLATAPWELTQGLGGIQEIPPDTGMLFD
FT                   LGFEQTITVTTEPMLFPLDITFLSEDLVVTEIYHNVQPGHLVTSMSAARYFLEVNAGEL
FT                   DGLVSGSQALFQLIASESPVEAPDWVTPMISFLGFTLMGFFLVGIVRDFTGSMFVEPER
FT                   KYLLSETKKGKCSFCQGSQEQCEVCEKVSPRDYNLLSWVGAPVPDYSFAVESETKERKI
FT                   DEVLKKLKEGVDGIQQSDKFREFLLTMSKFHNYSIGNLILIMLQKPDATHVAGYSTWKD
FT                   LYRWVKKGEKGIAILAPCMPPKQKKLESPADAEVEGEEGKPDEETEIRPVFFKVVHVFD
FT                   VSQTEGKPLPEFEVPSLTGEANEELFSQVKRLVEAQGVEVSFISRLDQDPDIKGFYSGK
FT                   LIWVRPEESRAQQLKTLLHEVAHYYSEGVFRIPRADAETIAESVAFTIGAHFGFDTGTR
FT                   SFPYVALWAKDKKTLEANLAAIRKVSGKIIDGLEQSAVKMAGVV"
FT   gene            229767..230303
FT                   /locus_tag="DhcVS_242"
FT   CDS_pept        229767..230303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_242"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61404"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGF4"
FT                   /protein_id="ACZ61404.1"
FT                   /translation="MVMRLAPTRGGFLRPFGCGWFIREYLLGNGPEGSKTIDPKIGAAQ
FT                   ADINFEYKEALARATARDRAERILSNMVVKGADVSEEEAEKIYQRELKRVSRKFTHMRY
FT                   HSFLMYFGVLKRLEWVEATNRTEASAIQDNYSSAPERVYYKLTKKGIEANEELWSNPLF
FT                   TLYPEIGPSHMKKPD"
FT   gene            complement(230329..230847)
FT                   /locus_tag="DhcVS_243"
FT   CDS_pept        complement(230329..230847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_243"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61405"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGF5"
FT                   /protein_id="ACZ61405.1"
FT                   /translation="MAIIIRHQYNNQQWEAPCQNPGKDLRCHQCFKKNVAIEPPKWSDE
FT                   ICSGHCWEQYLRKKNRWGYAPKGRFFGERAQIGDDVYFVFRQLDTSPQLYTLWAVSKVV
FT                   SIDETLRRSNDTDENGYSFVYFEPFMPLPEKFWKPNLSSQDLVGEVWGSGNHRYLTVTQ
FT                   ASHIRSLIE"
FT   gene            complement(230881..231714)
FT                   /locus_tag="DhcVS_244"
FT   CDS_pept        complement(230881..231714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_244"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61406"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGF6"
FT                   /protein_id="ACZ61406.1"
FT                   /translation="MSAQPSGSRMWWTNPIRGEFVPVFAEDIIDVLARCYAVVEVGGLS
FT                   GNGADRGRRFEKLFYSLCDRRGVHLSERAGSVTLAEQRSASGFRHEVDGSTRDVKCVTH
FT                   WELKHLTTALEKNELLIFNNKGLDYLQGSSRFYANTPIFRFLLSGNNIRDDCRRFAVLW
FT                   GITVIEPQRLPFPLIYSAAARGAATALTAVDCKAVKDLSIWASRPLQRVVEELAIWGRG
FT                   NDDQVRCGQMGIHAANAALDLQEQIGVTILDYLDEKFPEWIDDTAEDTWREVGGW"
FT   gene            complement(231698..233005)
FT                   /locus_tag="DhcVS_245"
FT   CDS_pept        complement(231698..233005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_245"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61407"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGF7"
FT                   /protein_id="ACZ61407.1"
FT                   /translation="MPIKSYYQKQYGLKGNPFPSRATYNVDSPSVYVPEMFGPQQPEFL
FT                   KKFILAPLQNIQPLIGAVWSVSVGDPEARGFGKSMLMAEESKRIDCDFGKSTLMSLGVS
FT                   EEDAQSSPILAGYVSFNVSGYGSISSIDAAAFNLARFILRVRDDQGVSTHAKLRERAAA
FT                   RLIAEGKATAGNEDAAIVTAIKERFTRLANTVDIRNLLEDYIFHLASDNTDGLEQFLAS
FT                   GVGTWHHDRNGLKYLQILVVFADIAGIEHFTFFIDQVEDFTYVAGPAKIQKNIKIIRDA
FT                   LIEAEPFSSKASFVFQLHPIAWEKLRDAWEHEDLPSLEYDDALTEPRVVVLKGLEEFST
FT                   ARLLVEGIINHPSVVLPNRADSITPFTEEGLKSVWEATKPNPREFLRSVNLLLELGNNQ
FT                   QIPILDEAFIAPKLERLIRSLHTGEAAEEEVDERTA"
FT   gene            complement(233008..234186)
FT                   /locus_tag="DhcVS_246"
FT   CDS_pept        complement(233008..234186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_246"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61408"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGF8"
FT                   /protein_id="ACZ61408.1"
FT                   /translation="MEEINEIKDSIPRVRVDQLLDVLSEVASSTVRCSFDQVRNYLYKT
FT                   AKRKAPPSREASWTVARDVLSDLQRFNFLKSGPLPRKRSEVDRLRETPCEITDSGSELA
FT                   RLYREKRAEAFNKLLIAWMSGHPYFRTMNLRLLRGPMYIPDITGIKQLGKDLTFPPKRD
FT                   MLGDRIKETCSARLKSIEYPEEKITVFLDTVEKRLDRLGEFASEAHLDAKKLVDIIEDN
FT                   VVVPALLESESLFFDSITLQHLIGCAQDFYSASVTSSYPGFTGRVLFSTCDFSPDPTTN
FT                   PAVEITDVIHHGRSLVSDRFADILLSSYKQLASPSMGYVDIYALRALVCVKLKIQPVVF
FT                   ALCLEQAIEEGLKEGTSIYTELPFNPHPTGETYVEIRGKRIGMIKLTFTKGG"
FT   gene            234417..235145
FT                   /locus_tag="DhcVS_247"
FT   CDS_pept        234417..235145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_247"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61409"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGF9"
FT                   /protein_id="ACZ61409.1"
FT                   /translation="MKFYLMYFCYKMKLNTHTKHFNNRIRVKSPDLNACPKGGLSVVTT
FT                   LCCPQDENPLSYDRLDGEWARWFRTAQRFEHKVPAQDRGDIRHSIILELARARAKDGDK
FT                   PFSEAMMCRIASCVVALYWRKQYKLTNGLECGSCSQKQRAKCRSGDLYRQCPKAIKVEY
FT                   LSKPITDENGNVTEFGDTIADDKALDVGAWIDARTFLLSFPERLVAIAHKRLDGIPLTG
FT                   AEMKYLCKWRKREQKTLMAG"
FT   gene            235290..236531
FT                   /locus_tag="DhcVS_248"
FT   CDS_pept        235290..236531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_248"
FT                   /product="DNA polymerase III domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_248"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61410"
FT                   /db_xref="GOA:D2BGG0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGG0"
FT                   /protein_id="ACZ61410.1"
FT                   /translation="MNIEGKRSGEGFCAHKAILVHALSRALAERVMLMDFTIGRKGFLT
FT                   YLKSLGGSNVVKVVPSSNGNASGVRVADKRLKVVCGANTSYLDDMAWVGDKTPMTLCEV
FT                   RVSPTNAVKPNLGALELSEALSRVLPFTTKEDSKPILQCVLFRVKDGKLTMVSADGFRL
FT                   SLVKLDFDGDEGEVLISRDDLWGVVSALRRAYRVRVSFEKSGESLDGMSLVLDTEAIRY
FT                   KWRGADGNFPEYEKLIPADFTTFVSFDTNEAIKAVSSLKVLSDSKNYPIDLTIGNGKLT
FT                   MSSPDEKGQTEIPADTQGEGRIRLDGSFLADALRACGGMVELKLVNSQSPMLFTSPDYE
FT                   LVVMPMFAGESQKPKGETQTAEPVEATAEVKPAETVAEEAEKAQAVAEAEAITKAEKPK
FT                   HKAKRKAREPVAVA"
FT   gene            complement(236554..236829)
FT                   /locus_tag="DhcVS_249"
FT   CDS_pept        complement(236554..236829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_249"
FT                   /product="recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_249"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61411"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGG1"
FT                   /protein_id="ACZ61411.1"
FT                   /translation="MFIWERLLSLVVARTVQLSLGTSKSTQPPVLSLPSRAYVYRGLPL
FT                   PPGVGAPICPFIHKKKGYPFPRTGKRIPLKKAKKRGLPRLSALAVF"
FT   gene            237112..237447
FT                   /locus_tag="DhcVS_250"
FT   CDS_pept        237112..237447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_250"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61412"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGG2"
FT                   /protein_id="ACZ61412.1"
FT                   /translation="MPIKWNALLVSEAMDMVEGYVNQAIEPLEQAKLVATEARKIPNLP
FT                   GYIDQHLVRLISEIERVTGGILPWNQQPHPGNVRAAITSVRESIPSGMVEAEKQKLDNG
FT                   KQLSLVR"
FT   gene            237517..237999
FT                   /locus_tag="DhcVS_251"
FT   CDS_pept        237517..237999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_251"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61413"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGG3"
FT                   /protein_id="ACZ61413.1"
FT                   /translation="MATGQMDLFGGVKLAEPEPTTTVRLGKKTAQFPLRKKRREAVKRL
FT                   TEILEELEGKDIYIGSYDAGGRHYWLNNLKLQRLQLEWHPSRLKSDPNYIPSVIVLWGG
FT                   KSASIRIFTDYLVAVREQDYQGYWHYLLDFRNGFAESPIDNYRSHYACLAITRFKD"
FT   gene            238035..238376
FT                   /locus_tag="DhcVS_252"
FT   CDS_pept        238035..238376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_252"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61414"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGG4"
FT                   /protein_id="ACZ61414.1"
FT                   /translation="MPEKGGRNIDTLFVINPAFSTGQIVATRGVYYLACENPDFAKFIQ
FT                   QSLSRHVKGDWGDVDNEDEQTNDQALKQGTRLLSAYNDDRFPKNGIATIWIITEADRSA
FT                   TTILFPDEY"
FT   gene            238601..239275
FT                   /locus_tag="DhcVS_253"
FT   CDS_pept        238601..239275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_253"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61415"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGG5"
FT                   /protein_id="ACZ61415.1"
FT                   /translation="MGGRSHRRLFWRHRWLAEPAGRETSVGDRDRHQESFRHSGSIVTS
FT                   ENYAWKQEKGGIIVPKNMDSMIGNLVGTLTGPIIVYPGGWGDSLPEWLKSAIVMERLIE
FT                   NMKETKGEQPTGTDAEACAYLNTASLTAPMDGNWSQIYLYVAGKTYWRWHKSELPEDIR
FT                   VDSLTDQQSRDLERLKEWLYRRRTTARQEAEKTEKRQQKEEEIAKRKEEQPALFVFEEA
FT                   HP"
FT   gene            239302..239646
FT                   /locus_tag="DhcVS_254"
FT   CDS_pept        239302..239646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_254"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61416"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGG6"
FT                   /protein_id="ACZ61416.1"
FT                   /translation="MSSIPKPCFATDDRRYTMKPGHTDGMWKAVSEGGKWKVQSSKNEV
FT                   VAVVDNSRQAEANAKLIAASPMMFEALSGLVQLIGEEDLPDNGELSGAAICDLARSALA
FT                   LATGKTWPLT"
FT   gene            complement(239687..240103)
FT                   /locus_tag="DhcVS_255"
FT   CDS_pept        complement(239687..240103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_255"
FT                   /product="Vsr domain protein T:G mismatch repair
FT                   endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_255"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61417"
FT                   /db_xref="GOA:D2BGG7"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGG7"
FT                   /protein_id="ACZ61417.1"
FT                   /translation="MPDNLTPEQRSYCMSRIKGKDTGLEMRVRSALHEQGLRFRKNVKW
FT                   LPGKPDIVFSKAKVAVFVDGDFWHGYRFPLWQNKVSDFWKKKISKNRERDIKNHRKLRR
FT                   MGWTVIRLWQHEIQKNFEASIERILATALSKKRG"
FT   gene            complement(240106..243024)
FT                   /gene="uvrD"
FT                   /locus_tag="DhcVS_256"
FT   CDS_pept        complement(240106..243024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="DhcVS_256"
FT                   /product="UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_256"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61418"
FT                   /db_xref="GOA:D2BGG8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGG8"
FT                   /protein_id="ACZ61418.1"
FT                   /translation="MMNIDQVLRNELTPQQYNAAVDTAREVLCLACAGSGKSRTLAYRI
FT                   ARLLAEGEPPEGIVAFTFTEKASESIKRRVSQALTTAGLDATVMGAMYIGTIHSYCQHI
FT                   LGDIDAKYRQYDVLDDNRLKLYLISRYYQLGLQGFRPRAQNNSYFDTIKQASEAWKTTN
FT                   DELLDFNAVAAEDQDVGDLLIRIRSGLREDQYIDFSLMIRDVVDSIRANVPGLENGIGN
FT                   LRHIMVDEYQDVNPCQEELVRLLHQRSQTLFVVGDDDQSIYAWRGADVSNILGFQGRYR
FT                   NSTVHTLSQNFRSTAPIVQASDSFAAVLLGPSRIAKNPAASTNLIPQDLRVLWFPDRST
FT                   EAGWVAARIRDLLGTAYNDNGNIRGLTPADFAVLMRSTRQAEQDGVPRHTAFTTALENL
FT                   RIPFSLEAGGGPFDRPQTAVLRSTFELLRNVPLDRNAVQQHFNNEVILAYPDADFTALA
FT                   RVLTDWSRRIHRPQGSSRIRLRPQQLVYDLLEAFNIAQTNFGDDIMRDIGLFSRMIMDV
FT                   ETVYMSVDSRQRFSEVLNFLQNAAETGYDVSTDDVLQRPDAVTVSTVHKMKGLEFPCVF
FT                   IVDVEAHRFPKRRSSYSGWLPPGVMTSAINRGAYQSTPDEEIRLFYTAATRAERYLHVS
FT                   GAENLPQARRPARRSPYALQLATHPAVVQNAGGLPPGIVQATPRRRVEDADYPTSFTEI
FT                   KYYLQCPRGYQLRQRYGLNPVIPEMFGYGQTVHTSIQKLHELYPNTPPSQDQVEQVVFD
FT                   TFHLKHVPQSGDPVNRPGAYENSRNRAVEIAEDYVASFGADFERERQVEAVFEIPTSNC
FT                   VISGSIDLLLHEDEHGEILHAEIIDFKTMEGGEAPAENDDLDWTELALQVQLYARAADQ
FT                   VMGQNTRTGSVHLLKDNQRIEVPITQEAVNAALSNIEWAVTGILGSDFPMRPHPEKCGK
FT                   CDFKAICQATPQNFSVQTTVPPELHLPGRREMARAFSLYRGT"
FT   gene            complement(243021..244118)
FT                   /gene="dcm"
FT                   /locus_tag="DhcVS_257"
FT   CDS_pept        complement(243021..244118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcm"
FT                   /locus_tag="DhcVS_257"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_257"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61419"
FT                   /db_xref="GOA:D2BGG9"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGG9"
FT                   /protein_id="ACZ61419.1"
FT                   /translation="MQDKCQRIQGKSLHHELIAIDLFCGCGGLTVGLKRAGFRVIGAVD
FT                   NDPIAITTYRSNHRDVKVWKKDITKLKIDTVKKRLKLRKGELDLVAGCPPCQGFTSLRT
FT                   LNGSKEVEDPRNDLVLEFQRFVKYLRPKAVMMENVPELAEDKRFTDFKAYLKRLGYVGQ
FT                   YRILDAGNYGVPQRRERLIYIASLGEKVRFAKRSKRLKTVRDAIACLPMAGESGDPLHD
FT                   IVEHRTPAVMNKIRRIPHDGGSRTDLPEDDQLPCHVRCGGFKDVYGRMAWDRQAPTITS
FT                   GCFNPSKGRFLHPEEDRAITMREAALLQGLPRKYKFRGTKSKSAIALMIGNVFPPPFTA
FT                   AHARMIRKVLINNGITADNPPRDER"
FT   gene            complement(244217..246247)
FT                   /gene="lonC"
FT                   /locus_tag="DhcVS_258"
FT   CDS_pept        complement(244217..246247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lonC"
FT                   /locus_tag="DhcVS_258"
FT                   /product="ATP-dependent Lon protease"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_258"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61420"
FT                   /db_xref="GOA:D2BGH0"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR013473"
FT                   /db_xref="InterPro:IPR014061"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGH0"
FT                   /protein_id="ACZ61420.1"
FT                   /translation="MQQDDLDKKVTSIFAGKVVRKDLLHQIKGGENVPSYVLEYLLGKY
FT                   CASDNDEEIRIGVDAVKETLTTNYFRHDEANKAQSMVEQKGKHRFIDRIEVRFLPSENK
FT                   YWASMDHFGYARIHIPEEFYRRYERLLEGGIWAIVDVEFRLSEEGKKDSPFHVVDLKPI
FT                   QLARFDLDEYLDGRRDLSRDEWIDLLLRSIGLEPVRMDRRLKILLITRLIPFVEKNYNF
FT                   IELGPRGTGKSYAFSEMSPYCMLLSGGKASTANLFYNNARRQVGLVGHWDVVAFDEVGG
FT                   MKITDPDAIQIMKDYMANGRFSRGVTQVLADASLVFIGNLNNPVESLVQNSATDLFQPL
FT                   PKEFDLAVLDRIHFYLPGWEVPKNSKDMLTVHYGFVTDYLAEAFRALRKQNRFDETERV
FT                   FRFGSHVEGRDATAAKKTVSGLLKILHPGGEWTKEELTEYLELAMEGRRRVKEQLKKRG
FT                   SFEFYKTSFSYINLENDAERSVGVPEQGGAGVISPDPLPAGTVYTASVDSEAKVGLFRI
FT                   EITLTAGTGKLRTPTGLEKSLKESLNRAFSYLQNVKDKLGLTQMLAQKDIYAEAVDLSG
FT                   GRIDCPCGVAFFSAIISAVRGRQVQAGTVVVGDLTIQGNIKGPASITEPLQLCLEAGAA
FT                   RVLVPVSNKAQFAGLPEDVIERLDVVFYGDIDRAVLKTLET"
FT   gene            complement(246258..248783)
FT                   /locus_tag="DhcVS_259"
FT   CDS_pept        complement(246258..248783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_259"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61421"
FT                   /db_xref="InterPro:IPR013973"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGH1"
FT                   /protein_id="ACZ61421.1"
FT                   /translation="MKFTSFLHKKLADLLNDRRIVVWYDAQGDFKEFAASFGAPNCEVL
FT                   SADASVLKIRRRADEVYRLMNESEDSSERERYMLIYIPRGRGVTEDEKMRDPFEVYAIA
FT                   GVAFGDTEDQKIESLARQAMPNKAEEISRLFREGNPDIALLDELENTQKWPVLNEVFHT
FT                   ETPSDIAALALCNTVKAEEVDSRPGCIAELLRLFEDVFGFKTSERRKWKTLRPKAAEYI
FT                   LISEFLFDLPDRFPEALSAVPRASNDAKSTVYAACDRMRADLGLQETYIELAGAIEDSL
FT                   HLSTILPGDLKLGGRDTFPFEERRLLSRAVTHVVFGDATAARIVNERQKHSIWRHDPQR
FT                   SLAWTVIERATVLIELCTLVSHGLSSKKELVGLIKAYTECGWSNLDRASRLFEAALTAC
FT                   PDEDIIEPIIDPCRRRYREAVVQLQDNLLMAVQAEGWPPDGAPRQTRIFDDLVAPLLER
FT                   RKKTAFFMVDSLRYEMGRDLADALAGTGSVEINYAAGTIPTVTGCGMAALMPGADGMLR
FT                   LVAKDGGLVPAVGNRFLKTSADRMRFLSEIYGDRFFETTLDEMLGSPKKIAANIKNAEL
FT                   FVVRTQDPDAVAENLGGWRARRYLSDVVGDIASAVRWLASQGYNHIVISADHGHMMLPE
FT                   IPPGDVVQTPPGGWLENKRRCRLGSGLAGAAGTITLKASNLGIQGDVHDVCLPVGFRVF
FT                   SEGEGYFHGGLSLQEAVVPVVVFQAGAEKQSTAGKPDIDILYRSDKFTSRVIGLKFRLQ
FT                   GDMFGTANRVRIESFDGPGIKAKIIGEAADCEARDEKTHEVSLQAGKETPVPILIDPDF
FT                   DGPEVEIRVSDPETRVVWAKLKLKNAMLD"
FT   gene            complement(248788..252867)
FT                   /locus_tag="DhcVS_260"
FT   CDS_pept        complement(248788..252867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_260"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61422"
FT                   /db_xref="GOA:D2BGH2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGH2"
FT                   /protein_id="ACZ61422.1"
FT                   /translation="MSFDKDTRNLLAKTVVTCRRRLVEDTTDQLRGLFGLHPDGTVLPL
FT                   EQLIHLSPDQNAAARHLRDLLDHYTVGTDGNESDRRKVAYERMVLEISFTALNRLAALR
FT                   LCEERGLVIECVRKGMSSDGFQMFERISVGALGSRYDTYRVFLECMFDELALDLGVLFD
FT                   RTTPQSSVFPSERCMEEILSELNKPELKHLWTEDETIGWIYQYFNPPEERKAMREASQA
FT                   PRNSRELAVRNQFFTPRYVVEFLTDNTLGRIWYEMRKGATALKDECRYLVRRQNEVFLE
FT                   KGDKAPIEPENENDLSQQEVLRRPFHIVHRLKKDPRDIRVLDPACGSGHFLLYAFDLLE
FT                   RIYDEAWAEEEGPKSEVTGCSLRDDFETLDILHREAPKLIVEHNLHGIDIDPRAVQIAA
FT                   LALWLRAQKTWKILGLKAADRPQIVRANIVTAEPMPGEGDMRREFTANLKPRVLGQLVD
FT                   VVFDKMKLAGEAGSLLKIEEEIKDAVSEARNQWMKSPQPEQAVLFTELIKPKPEREQLR
FT                   FDLSGVTNEQFWEQAEERILEALKDYAEQVENGRTVRRRLFAEDAARGFAFIEVCRKKY
FT                   DVVLMNPPFGEPSQLSKQWIGCTYPITKNDILGPFLERAIMVLNVEGTVGTITAKTAFQ
FT                   LSSMAGFRKELILKETTIKVFADLGSEVLDSAMVKTAAYVLGKAREDVHSVFINLTGSQ
FT                   DKAGQLALEVSDGLSSKNVFWVKQTEFNHIPGAPFAYWADSIIRRCFAKYPSLASLNAE
FT                   VKQGLGTTDDFRFVRATWEVSPGSIGVQNRWSFYAKGGESNDFYSDIHLVVNWADKGKE
FT                   VYAFNGIPFGGAGAPIRNPSFYFKPGLTYTSYTNKGFSPRVLPSGCIFTTAGMAIFVSD
FT                   PLTMLSLLNSRVIQLFLLMITDERKWEVGYVSSIPITKLNTVDITRLSDMALRGWREAI
FT                   SSTFWDETQRYFNAIAGAARISSLRTEPERLKLDSQNSLNKLQAIRREIDELTLASYGL
FT                   TSRHIEFVNMRLGIETKENPEESNITASLISLLIGIVFGRWDIRIAMDSSLAPEIPDPF
FT                   DPPPVCPPGMLVSPDGLPAKPDYIASEEWLRARPNADTLPPVTGVKKTTIPDDSYPLRI
FT                   SWDGILVDDSGFNGSQPNRDDIVRRLREVIDLIWKEKAHDIEQEACEILGVSDLRDYFR
FT                   KPAGFFQDHLKRYSKSRRKAPIYWPLTTASGSYTIWLYYHRLTDQTLYAAVNKYVEPKI
FT                   DETERSIARIEEALKSSSGRDLTRLTDQFHDARSFLNELRDLREELLHIATLPFKPNLN
FT                   DGVIINAAPFHKLFRLRSWAKDSEDCWKKLEKGDYDWSHLAYTIWPDRVRNTCKKDRSI
FT                   AIAHGLENLHDGIEGE"
FT   gene            complement(252867..256553)
FT                   /locus_tag="DhcVS_261"
FT   CDS_pept        complement(252867..256553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_261"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61423"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGH3"
FT                   /protein_id="ACZ61423.1"
FT                   /translation="MSETIRQLFSPRRPIDRTIEKVIDYYAQEDDRLAREVAEYEVTDN
FT                   IESCFRKFLDVFSEGVQGGQVTEVGIWVSGFYGSGKSSFTKYLGASLDPTRTVQGKPFF
FT                   ELLCDRFPRNEIPAALRTVSKKHPAAVVFLDLGAEQLAESAAAPVSTVLYWKVLQWAGF
FT                   SKEKKTAQLEFTLDRRGKYDEFKKKYGVRYKGKWEDIHNDPLIGVARASEIVPEVLPDD
FT                   FPTPDSFRGLRFEEARDIRDLTREIIDICRRKTGHENIVLLIDEAGQYVALRGELILNL
FT                   DGLARNLKELGRGKVWIAATGQQTLSEIVEKAAHNSAELTKLRDRFPISIHLDASDIRE
FT                   ITHRRLLDKSEEGRKILDALFKEHGQSAVTHTRLSGTALFKGDPDSQTFTRLYPFLPQH
FT                   FDLLLELIHALARSTGGIGLRSAIRVIQDVLVDKSRVLGADTVKLADREIGTLACVDDF
FT                   YDTLRADIAKVLPHVIVDVDKTIKIFGANSLETRVAKAVAALQPVENFPRTPENIAALL
FT                   YRKIGSPPLLDQVRESLRTLISEKECGLIEDPQAGGYVFLSDAVKPIRDKRNGYVPTSG
FT                   ECARAMIDVLKQGTADHAMFRVQPTARLENIKEVRSSVKLGRTLVVGGSEDVELRLEFV
FT                   DPGLWDGRRSEFLVSTNTQIELKNTVVLLVRNDDTVDELLPEIVRSEKVLGEVDERGAD
FT                   QVVAQYLRAERRAAERSRERVATAMEKAMLGSIFIFRGKPTPVRETGETLDSSVRAVLS
FT                   GAVKEIFPHFHLAPVRPSTDEAANFLGVERMDRITKDLDPLGLVVKSKGAPRVDTEAPV
FT                   LAEVLRVFRSKATESGSGRLQGGYLQDLFSAPPYGWTKDTIRYLFAALLRAGEIEFHVP
FT                   GAGGAVRTAGPQAVEAVKSTVSFNRIGVSSRDAKLPPEALDRAARRLETLFGDEVLPLE
FT                   DHISRSVRSHVPDLLERIGALPDRLRLLGLPGESRSQRLLADAADLLKGDAGGAAAVLG
FT                   GVECVLPAEITWAKAIFDALQSGAEADVRNARSVLDSTSDLEQLFPGSTNELLNPMDRA
FT                   VAEDVLSSDRFHERLPELRGVIRATLDRTENRYATDLAEYRDDLNQALTLLEAEPDWIR
FT                   LLDEDRADIAAKLACDLPTTVENGDCVRQLQTLLVRRRTLPGLVEDLKTEIKHRRPAEP
FT                   EPEPEPGKKGKKSPVDEIVEAGSLMQPAVIASAEELDSWLAGIREKLVALLKSNKRIRI
FT                   KGR"
FT   gene            complement(257103..257903)
FT                   /locus_tag="DhcVS_262"
FT   CDS_pept        complement(257103..257903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_262"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61424"
FT                   /db_xref="InterPro:IPR014948"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGH4"
FT                   /protein_id="ACZ61424.1"
FT                   /translation="MIMENNFQRKYSTAISKGAGLIEETRRLLDHWRPDEPLDDFTHRV
FT                   QVEGLLGNSTAYRTRDVVRRVFAPRLLRPNDKPARILKSVIESGLPARTFTELLFVFAA
FT                   RQDPLVYDFTVREYWPAARRGRSFLDTDPMLSFLSQAHYDGRLDNQWSENVSLRIARCV
FT                   LGILRDVGFLRETVRGRREIVNYRMSDEGAAILARELNESGVTDSSICNHPDWSLFGMT
FT                   PSDVVERLDEIGEQRGLIVQHGGSVVHFTWGVKSIQELINVLAR"
FT   gene            complement(257905..258459)
FT                   /locus_tag="DhcVS_263"
FT   CDS_pept        complement(257905..258459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_263"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61425"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGH5"
FT                   /protein_id="ACZ61425.1"
FT                   /translation="MRTGHQQNALTLSLSLLRLRALVLALGESASPDWWKTGFMSETGL
FT                   RFLERIYPRTFLHAAVRSAGKAASDTHDRAVGRVGVYHLFRLPGYLEAEIGHTPFESER
FT                   DFVSSFRIALGQPNKLLELLAQLSRRSGMDAGPGAKRLGTDKELTDPASYEKIAAVYHH
FT                   AFSEGKPGFPYFTIEHTGSGG"
FT   gene            complement(258456..258686)
FT                   /locus_tag="DhcVS_264"
FT   CDS_pept        complement(258456..258686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_264"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61426"
FT                   /db_xref="GOA:D2BGH6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGH6"
FT                   /protein_id="ACZ61426.1"
FT                   /translation="MGSEGQSSATLLKKIREQLTLSQEDLARQLGVSYATVNRWENGQS
FT                   KPSKLAKARLNAFCEKMSRQGKLVLTEGDNR"
FT   gene            complement(259060..259135)
FT                   /locus_tag="DhcVS_265"
FT   tRNA            complement(259060..259135)
FT                   /locus_tag="DhcVS_265"
FT                   /product="tRNA-Ala"
FT   gene            complement(259171..259998)
FT                   /locus_tag="DhcVS_266"
FT   CDS_pept        complement(259171..259998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_266"
FT                   /product="patatin-like phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_266"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61427"
FT                   /db_xref="GOA:D2BGH7"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGH7"
FT                   /protein_id="ACZ61427.1"
FT                   /translation="MPKSKLPKIGIALGGGAARGIIHIGVLEVLEKEGVPLDLVTGTSM
FT                   GAIIGALYASGHKPQEMKEIVSNLSWKQLMPLFDLAAPRAGFLSSRKIKSYLKELIGDV
FT                   TFSELKKPFACVAADVKTGQEVLFNEGSVIDGVIASMSLPIIFRPVKNKTRFLVDGGII
FT                   TPIPARVVRNMGADFVIAVNAIYHHDYIKPNKDSEPSIFDTAFQIVNIMSIHMAQENLQ
FT                   AADIAIEPDLSGIGPGDFLKAPEIVLRGELGATDAIPHLKHLLLQKYNYSPPI"
FT   gene            complement(259976..260611)
FT                   /locus_tag="DhcVS_267"
FT   CDS_pept        complement(259976..260611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_267"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_267"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61428"
FT                   /db_xref="GOA:D2BGH8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGH8"
FT                   /protein_id="ACZ61428.1"
FT                   /translation="MPNIFEATTGQGFKQAILKSQSLRLRIIQAADAYTAFNLIKDPEI
FT                   IRYLVWDGPKTINELRLAYQEEASDFETGRRYSFAIERVDKPGLIGSLAFRLIGYKEQA
FT                   LIGYWLGRKYWTKGYMTEAVRLSIHFAFKHLNAERVFGGIFKGNEPSRRTLEKNGFQLD
FT                   GTLRRDILVRGTWIDVWFMSLLRQEWEENPERYTPQSEEVIHAQIQTA"
FT   gene            complement(260616..262208)
FT                   /locus_tag="DhcVS_268"
FT   CDS_pept        complement(260616..262208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_268"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61429"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR018538"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGH9"
FT                   /protein_id="ACZ61429.1"
FT                   /translation="MTSENKLGIVIGGSLSGGIDVRLDGEALVEDMAVGRYVTIQGKTK
FT                   RFLGMITDVSLGVTDQRLTLTPPATDEKFLAEILSGTAAYGDLKVIPYLVLGNDEKSLL
FT                   DGPQPVKTIPSHYAPVDIASNEDIEMVFGKEDASHFYVGNPLDMETRLCLNLPELVKRS
FT                   NGIFGKSGTGKTFLTRTLLVGMLQKGSCVNLVFDMHSEYGWEGTSEKKHKVKALKQLFP
FT                   DRVAVFTLDGESSRKRKVSVDFEVKIGYDEIEPEDISLLRQTLNLTEQAVEAVYQLRKH
FT                   FKKNWIKEANNIGDEEDDKKLLDGLSIHESTFQNLKRGLNTLTRLPFIMENAPVKAVDR
FT                   VLEYLNRNINVVLEFGRYTDITAYILVANLLTRRIYTSYRDRMEQAMAEDAAKPTPLVI
FT                   TIEEAHKFLNPEVASRTIFGTIAREMRKYNVTLLIIDQRPSGIDTEVMSQLGTKITALL
FT                   DNEKDIDAVLSGISGKNELKGVLAKLASRQQALIFGAAVPMPVAFVPREYDQSIYNEVS
FT                   RKKVSTEEIEELF"
FT   gene            complement(262205..262804)
FT                   /locus_tag="DhcVS_269"
FT   CDS_pept        complement(262205..262804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_269"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61430"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGI0"
FT                   /protein_id="ACZ61430.1"
FT                   /translation="MENLNTSRIGEVIDTSTTDFTAQSYQLYNTPALGALVKTGEGENT
FT                   IYAAVYHATTSSIEPGRKPIARGQDAVNEEDIYAQSPQLSKLLRSEFSCLILGYRGQGQ
FT                   ICHCLPPRPAHIHSFAETCTPEETAEFSRSFGFLNILVNSELPVPADEVTAACLRQLAA
FT                   AEPDKQVFLVKAGKELARILPGQYQRLKVILERIQL"
FT   gene            complement(262876..264081)
FT                   /locus_tag="DhcVS_270"
FT   CDS_pept        complement(262876..264081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_270"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61431"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGI1"
FT                   /protein_id="ACZ61431.1"
FT                   /translation="MSLNLDKTALQIQSMVSDLKGRDLEHQKHLEAGLDGMKRTPAEYQ
FT                   RLLDKAARSKTTFLLAHPEEIPDATHPPLALPQSYRILATDGSQIDVDRHQLSRCYLIN
FT                   IGRVWLEYGQSPSAGLESLPALYARPEDMVISCGSKEVAVEGTLLGIKRSVEETRHLAE
FT                   MADAASPNLPTLALGDGTLILWSLLSKEFPEYVVEDLLVNGYLKYLGKIQNLNTKDRQV
FT                   ALASYISYPGSTDVVNTLRLLYCPYEPADCTSRCDQLPNGKRPCDILSGVTDSMLFERI
FT                   LKQGERSALFASSSSILEKYYGEHRAYFYYLKTSEEIARVELPGWTARSEELLSLSHSL
FT                   ILEQCRLGHGYPVSLSEAHEQAVVSGQDRRIFNQLVEEMLTESKINPSSSAKSLSKKTR
FT                   WV"
FT   gene            264208..264831
FT                   /locus_tag="DhcVS_271"
FT   CDS_pept        264208..264831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_271"
FT                   /product="transporter, LysE family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_271"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61432"
FT                   /db_xref="GOA:D2BGI2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGI2"
FT                   /protein_id="ACZ61432.1"
FT                   /translation="MIFMLATLLSVTVISFSGVLMPGPMFALTLSRSYHTPWAGAQIVL
FT                   GHVLVELPIILLIYFGFAGFFEIIWVQILLSLAGGIMIIYMGLGMIKARREASQDKANF
FT                   KYNTVVSGAAMSALNPFFLVWWATVGAMLVMKVSDYGLGGLGALAATHWLVDLAWLCLV
FT                   SFIVYRTHRLWGSRVREIVFIGCGLLLAAFGVYFIISGLQLWLS"
FT   gene            264858..265883
FT                   /locus_tag="DhcVS_272"
FT   CDS_pept        264858..265883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_272"
FT                   /product="acetoin utilization protein/histone deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_272"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61433"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGI3"
FT                   /protein_id="ACZ61433.1"
FT                   /translation="MAVGLVYNHIYLNHETGTHVENPDRLLAIMEYINTHGLKDHLVHI
FT                   EPKRVGLRELESFHKRSYISRVEEVGFSGGGWLDQDTVISVDSYEAALYAVGGVIEGVD
FT                   KVLSGELESAFVLCRPPGHHALPEASMGFCVFNNVALGALHALNKHKLKRVAVVDFDVH
FT                   HGNGIQHVCLNDPRVTYISTHQIHHFPFTGDSREDGPFQNILNIPLPEGCGDSHYQKAF
FT                   DEVICPYLRKFAPELILVCAGYDAHFADDMGEMCLSQKGFAGITRSLKKTAEEVCRGKL
FT                   VFSLEGGYHYLGLAEGVGATLSVLLNEAIPPPNTKAPEGAADKPDISGLILELRSICGI
FT                   S"
FT   gene            complement(265857..266792)
FT                   /locus_tag="DhcVS_273"
FT   CDS_pept        complement(265857..266792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_273"
FT                   /product="cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_273"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61434"
FT                   /db_xref="GOA:D2BGI4"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGI4"
FT                   /protein_id="ACZ61434.1"
FT                   /translation="MATRKTRAASFSIASNSTLIVMKTVVGFITGSVSILAEAIHSTLD
FT                   LVAAVIAFFGVRASDKPADINHPYGHGKWENVSGTVEAVLIFIAAIWIIYEAVNRLIEG
FT                   SAPEMLEWGVVIMGISVIANTLVSRYLKKIARETDSVALEADAAHLTTDVITSAGVLLG
FT                   LILVKLTGWSILDPIVALLVALLIIKAAWDILNKSFGALVDARLPKEELDAITSLINEH
FT                   TSKLVEFHNLRTRKAGSYRYVDLHLVMPKTLSVEKSHAICDHLEKDLKDKLKIDYVTIH
FT                   VEPCTEENCPECQMSCKKRPSDLANPANTP"
FT   gene            complement(266811..267719)
FT                   /gene="secF"
FT                   /locus_tag="DhcVS_274"
FT   CDS_pept        complement(266811..267719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="DhcVS_274"
FT                   /product="protein-export membrane protein, preprotein
FT                   translocase SecF subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_274"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61435"
FT                   /db_xref="GOA:D2BGI5"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGI5"
FT                   /protein_id="ACZ61435.1"
FT                   /translation="MNKIIQHRPLFIFISALIILAGLASLLIFGLKPGIDFSSGSILTV
FT                   KFDQTISIDELTQELRSLGHNEAIVQITGDGDYLIRTTELDVSQKVSLETSLEETFGNL
FT                   TERGFENVDPLIAKQTTQMALIAVGAALVGILLYVTWAFRRMPKPFHYGTCAVIALFHD
FT                   ALVVLGIFALLAGIFGWEINLMFVIGIMAVIGYSINNTVVVFDRIRENQLKGIHPSFEV
FT                   IVNQSIMETIVRSINSSFTVIITVVALMLFLGASIQNLSIVMLIGLIAGTYDSLFVAPS
FT                   LLVTWENGDWGKLLKPFKKLN"
FT   gene            complement(267712..269061)
FT                   /gene="secD"
FT                   /locus_tag="DhcVS_275"
FT   CDS_pept        complement(267712..269061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="DhcVS_275"
FT                   /product="protein-export membrane protein, preprotein
FT                   translocase SecD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_275"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61436"
FT                   /db_xref="GOA:D2BGI6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/Swiss-Prot:D2BGI6"
FT                   /protein_id="ACZ61436.1"
FT                   /translation="MRRKNGLVFLAILAAMILAFTIVLPTDKGALLGKGILFGLDLKGG
FT                   LHMVYQADLSNVDESNIDGVMDGVVEVISNRINPLGVTEASIQRQGDDRIVVELPGLDI
FT                   TDEQKARIGRTALLEFGELAADGEDYKWENSLGKWKPATATIDGVEYTLTSAYFKDSTY
FT                   VNRDQYGNILLVFEWDDIGAQLSKEITTRLLNQQLGIFEGDEALSGDNGIPIAPVINNV
FT                   IETSGVIEGLSYNEAEMLSNQLNAGRLPVPLEPIYEQTVSPTLGQNFVDLAVKAGLVGI
FT                   ILVMIFMIAFYRLPGLLASIALVFYGVIVLALFKLVPVTLTLAGIGGFIVSAGMAVDAN
FT                   ILIFARLKEELLTGKTLGAAVEAGFSRAWSAIWDSNVTTFIACGILFWVGGTIAAGAPV
FT                   KGFAVTLFLGVAVSMFTAIFVTRTLLRLFVGTKTGKKLALFTTQTRGKNE"
FT   gene            complement(269075..270580)
FT                   /gene="polyA"
FT                   /locus_tag="DhcVS_276"
FT   CDS_pept        complement(269075..270580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polyA"
FT                   /locus_tag="DhcVS_276"
FT                   /product="polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_276"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61437"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR032810"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGI7"
FT                   /protein_id="ACZ61437.1"
FT                   /translation="MKAVTNKNLLLRIDKKTAALLEDLRRLFSEEASEVYLVGGFLRNL
FT                   VLKKPTADIDLCITGSGQAASAKISGYFKATQVVLDAENDVFRVILPAFQLDISGTADI
FT                   AANLTRRDFKLNAMAAPLSAVHQGSLPVQAIIDPTQGLPDIENRVIRVTSADVFSADPI
FT                   RLLRAIRLSAELGFALDWQTQSLITAHAALISTVAGERVREELLKLLETSQPGIWEKCL
FT                   ELGLLLNIFPELTPCYRHPQPYEHTWDVLEHSIKTIYALDAILGRSVWPYQNPEIITEI
FT                   YRESGFEKYFAQKISGTSSIRTLTKLAALLHDIAKPQTRSTDPDGRIRFTGHPLEGSRL
FT                   SSQILTRLRFSKKEILLVEKMVCYHLRPVQMNPDGQLPSPKAVYRYFRDLSEAAAATLY
FT                   LSLADHLATDGPNLMVANWQEHVNIVAHILSEQKKQQTRLTPKRLVTGTDLIEHFSLRP
FT                   GPRIRTLLGEIAEAQAAGEIKNRQEAFKFISQRLGSKPENNLN"
FT   gene            complement(270726..271127)
FT                   /locus_tag="DhcVS_277"
FT   CDS_pept        complement(270726..271127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_277"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_277"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61438"
FT                   /db_xref="GOA:D2BGI8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGI8"
FT                   /protein_id="ACZ61438.1"
FT                   /translation="MSKATSSNGWADLGEIIRQQRVKIPLTLQELAAKTNVSPSHLGRI
FT                   ERGERFPSARILKRIAHPLGFEEDELFTLAGYLTPQKDSISEIEAEYTSTPRQLDPYVA
FT                   KVLAQEPIELQRAVIAILAMLKSISKSMT"
FT   gene            complement(271385..273832)
FT                   /gene="priA"
FT                   /locus_tag="DhcVS_278"
FT   CDS_pept        complement(271385..273832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="DhcVS_278"
FT                   /product="primosomal protein N, (replication factor Y)
FT                   (superfamily II helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_278"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61439"
FT                   /db_xref="GOA:D2BGI9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGI9"
FT                   /protein_id="ACZ61439.1"
FT                   /translation="MAFAELAVNTPVLRPGSFSYSIPLGLEIKPGQAVWAPFGPKIVQG
FT                   IVLEITDQPAFGQTREICGVISDTPLLSFHQLKLAKWISQTYLCSIYEAVALMLPPSFE
FT                   RQSLAYISLETTPPATTKNPSETLSPNMQKIFDRLKAGDVTPQSELEKIFGKKTTQNAL
FT                   IKLINQGLVKRTYQISPARVQTKFEKHFRLSGQALAFIKNQNLPKLSPRQTDIFECLRK
FT                   NPLGIAKSQLNLLFKNNSAVLKALEQKGLVSTEEHQVFRQPVDYNQITPMLHLELSPPQ
FT                   AKCLQAITHSLNTLPENDPNPRIFLLHGITGSGKTEIYLQSLAETLRLGRKGIVLVPEI
FT                   SLTPQTIARFAGRFPGKIAVLHSRLSPGEQFDEWQRIKNGQADIVIGPRSALFAPLDKP
FT                   GIIIIDEEHEWTYKQQDPQPRYHTRTVANKMAEEYGTVVVLGSATPDIDSYFKAKHGIY
FT                   QLLELPERLTPYRGASLPKTELVDMRTELSEGNRSIFSRNLHASIEKVLANHEQAILFI
FT                   NRRGGASFIQCRDCGYVAMCKSCDAPLTYHPDQENLVCHQCGRQYPNPLTCPKCSSRRI
FT                   KYLGIGTQKLEEETRLAFPQARLLRWDSDVTRGKNNHQQIMDTFSRHQADILIGTQMVA
FT                   KGLDLPAVTLVGVINADISLNLPDFRAGERTFQLLAQVAGRAGRGISGGKVIIQTYTPE
FT                   NYAIQAAVCHDYQGFYAKEITYRRELNNPPFRKLACIVFSHLNHDFCRQQAEVMAETFR
FT                   EKADAGGSGSLEILGPAPAFIQRLRGRYRYQLILRSPNPADFLRNISFGQGWSIDLDPY
FT                   GLC"
FT   gene            complement(273855..274265)
FT                   /gene="rplS"
FT                   /locus_tag="DhcVS_279"
FT   CDS_pept        complement(273855..274265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="DhcVS_279"
FT                   /product="ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_279"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61440"
FT                   /db_xref="GOA:D2BGJ0"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGJ0"
FT                   /protein_id="ACZ61440.1"
FT                   /translation="MEETMNNQETPETNEEETAAEETVAVENTAEGKVLPSFGPGDTIK
FT                   VHARIKEGDKERIQMFQGVVLKIKQAADGGNFTVRRISYGVGVERTFPFLSPNVTKVEI
FT                   MKKGKVRRARLFYLRKLSGKAARIKEVKQTPS"
FT   gene            complement(274389..275135)
FT                   /gene="trmD"
FT                   /locus_tag="DhcVS_280"
FT   CDS_pept        complement(274389..275135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="DhcVS_280"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_280"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61441"
FT                   /db_xref="GOA:D2BGJ1"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGJ1"
FT                   /protein_id="ACZ61441.1"
FT                   /translation="MKIDVLTLFPEMFQSPFEESIFKRAADKNLVRLEIHNFRDFSHDK
FT                   HHAVDDSPYGGGAGMLLKPEPLFEAVEAVMEKDPTPAPVILLSPQGRTFNQSVARELAG
FT                   NQRLIIICGHYEGFDERVREHLATDEISIGDFVLTGGELAAMVVIDTVSRLIPGVLGSE
FT                   DSSEEDSHSNGLLEHPHYTRPPVFRGWGIPEVLLSGNHARIDRWRRKESLRRTLKRRPD
FT                   MLEKITLSKTDRKLMDEILAEENPKD"
FT   gene            275318..275746
FT                   /gene="mraZ"
FT                   /locus_tag="DhcVS_281"
FT   CDS_pept        275318..275746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="DhcVS_281"
FT                   /product="MraZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_281"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61442"
FT                   /db_xref="GOA:D2BGJ2"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGJ2"
FT                   /protein_id="ACZ61442.1"
FT                   /translation="MFFGEFEYKLDEKGRFPLPPAIRPSLKDGLILAPGTGEKCIYAYP
FT                   LCEWKKLAESLKSTTVAPSKMRRLNRALFALAFDVNLDAQGRLTLPAPLKNYAGVNIEV
FT                   IVAGVNNYLEIWDKETWESEKKASQEQAWQIIETLEGN"
FT   gene            275753..276802
FT                   /gene="mraW"
FT                   /locus_tag="DhcVS_282"
FT   CDS_pept        275753..276802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="DhcVS_282"
FT                   /product="S-adenosyl-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_282"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61443"
FT                   /db_xref="GOA:D2BGJ3"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGJ3"
FT                   /protein_id="ACZ61443.1"
FT                   /translation="MTEYPHIPVMLEESIQGLGVIPGGRYVDCTLGAGGHSEAILEHSY
FT                   PGGQLLSIDADPKAIALAAERLKGFGSSVLLVNDNFANLKDICQRYEYMPVHGILFDLG
FT                   LSSMQLDREESGFSFQTEAPLDMRFSPGQELSAADIVNTYGLAGLSDLIWKYGEEPFSR
FT                   RIARAILEKRPFKTTTELASVIEKAVGGRHGRIHPATRTFQALRIAVNEELSHLESALA
FT                   QAQSLLGHGGRLVVISYHSLEDRIVKQYFQREAKGCICPDDIPQCVCDHQPSLRIINRR
FT                   VITPSDEEISRNPRSRSAKMRVAERIIEPGEGRFFSSRADELVNHVSETGSVRHGQAKH
FT                   KGVVQRGGS"
FT   gene            276872..278098
FT                   /gene="ftsA2"
FT                   /locus_tag="DhcVS_283"
FT   CDS_pept        276872..278098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA2"
FT                   /locus_tag="DhcVS_283"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_283"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61444"
FT                   /db_xref="GOA:D2BGJ4"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGJ4"
FT                   /protein_id="ACZ61444.1"
FT                   /translation="MKNRIVTAIDVGTTKICTIIAEVNPVGGVNVVGVGIGPSQGLHKG
FT                   LVVNINDARESIRESIRKAEQASGYKVESAYVGVTGRHVASMNNRGVVAITRNDRLVRS
FT                   DDLKRVMATAQNISVPNDRKLLHVIPRTYAVDGQSGVKNPVGMHGFRLDVETHIITAAA
FT                   TSVQNLVKCIRGLGIDIDDLVLEPIASSEAVLTDDEKQVGVILADIGGGTTDICVFKDG
FT                   SIWHTAIIPVAGYQLTRDVAIGLGLPFDVAEEMKKRYGSVLPVYETKMESPSPICEDGH
FT                   GVSYQDLCDIIRARVEEVLRLIMLEIPNSDYDSLVPAGLVLTGGSSNLAGMETLGRDIL
FT                   RIPVRVGNPDKVYGIIDSLHDPAYATGVGLLIWGAKHQPVKKSWLDNLGFFGRMRNLLK
FT                   GFAGLFGSN"
FT   gene            278139..279269
FT                   /gene="ftsZ2"
FT                   /locus_tag="DhcVS_284"
FT   CDS_pept        278139..279269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ2"
FT                   /locus_tag="DhcVS_284"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_284"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61445"
FT                   /db_xref="GOA:D2BGJ5"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGJ5"
FT                   /protein_id="ACZ61445.1"
FT                   /translation="MAKTSFVPNPARIKVFGCGGGGCNAVTRMVREEIQGVEFIAINTD
FT                   AQALAITEAPIRLQIGERVTRGLGAGGDHNMGQKAAEESRDEIREIVNGADMVFVTAGM
FT                   GGGTGTGSAPIVAEESKKSGALTIAVVTKPFTFEGAHRASTAKEGINRLLGKVDTLIII
FT                   PNDRLLDLCDQKTGVDAAFKMADDVLRHGVQAISEVITVPGLINLDFADVRAVMRDAGP
FT                   AWMSIGYGSGKNRASDAAKSALASPLLDVSITGSKGVLFNIVGGPDLSLMEVNEAADVI
FT                   KQAVDPDANIIFGVASDSSMGSNVKITLIATGFVSKIGMAEEEGDDAITRQLKGIKTED
FT                   ELDVPSFLRRPLFNRARPVAPPVDTRSNKPSSRISW"
FT   gene            279416..279943
FT                   /locus_tag="DhcVS_285"
FT   CDS_pept        279416..279943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_285"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_285"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61446"
FT                   /db_xref="GOA:D2BGJ6"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGJ6"
FT                   /protein_id="ACZ61446.1"
FT                   /translation="MDCPYCSHPDSKVIDSRDVDDGVRRRRECVVCGQRFTTYERFQPA
FT                   GLFVVKKDQRREEFNKEKLLSGLRRACEKRPLPAGAVDKIAGDIEAEIYNMGKAEIPST
FT                   LLGDMVMEKLKALDNIAYVRFASVYREFTDITQLKKVVDNLVNGQDEGIHKGQLSLLPE
FT                   DKISPKTRYQRR"
FT   gene            280260..282545
FT                   /gene="nrdA"
FT                   /locus_tag="DhcVS_286"
FT   CDS_pept        280260..282545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /locus_tag="DhcVS_286"
FT                   /product="ribonucleotide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_286"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61447"
FT                   /db_xref="GOA:D2BGJ7"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR024434"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGJ7"
FT                   /protein_id="ACZ61447.1"
FT                   /translation="MPVKVQVKSEIMADAKAEGLKLTDNAMCVLERRYLKKDKQGKPTE
FT                   TVEDMFRRVARTIAMGELIYNPKADVRSREDEFYNLMTRLEFLPNSPTLMNAGRELGQL
FT                   SACFVLPVDDSIESIFDAVKHTAMIHKSGGGTGFSFSRLRPEQDRVGTTGGVASGPVSF
FT                   MRAFDVATDVIKQGGTRRGANMAILSIDHPDIMKFIHAKDKAGVLTNFNLSVAITDKFM
FT                   QAVKDGADYDLLNPHNGEVVSCLNATEVFNKIVHMAWKTGDPGIVFIDRINAYNPTPQL
FT                   GRIESTNPCGEQPLLPYESCNLGSINLSRMVTVSGGKSTVDYKKLSRVIKSAVRFLDNV
FT                   IDVNKFPLPQIEEMTKKSRKIGLGVMGFADMLLELGIPYNSENSIKLAEEIMCFVNDEA
FT                   HKFSSELAVERGVFPAYRGSIYEKSGRPMRNASCTTIAPTGTLSIIAGCSSGIEPHFAL
FT                   CFTRNILDGTKMIEVNPYFERAAKEGGYYSEELIKSLAEGAHLDEADVPDEAKELFVTA
FT                   HQIVPEWHVRIQAAFQKCTDNAVSKTVNFSRDAGECDVADVYKMAHARNLKGITIYRDG
FT                   SREDQPMSTGKAENKIETPAAVVNPNLMPRKRSKVTQGITERVTTGCGYIYVTVNSDEH
FT                   GICEVFSSLGKAGGCASAQLESTCRLISLALRSGMEVASVVKQLRGIRCPSIAWDESKA
FT                   VLSCADAIASVLEKHVDGYTKPVAGSAKTVSANALVRNIAGQCPECGSILVYQEGCFIC
FT                   PGCGYTKC"
FT   gene            282775..283359
FT                   /locus_tag="DhcVS_287"
FT   CDS_pept        282775..283359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_287"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61448"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGJ8"
FT                   /protein_id="ACZ61448.1"
FT                   /translation="MTDTLERVMIFIDGSNMYHYLKSHFQRTDIDFGCFCSKIAGRRRL
FT                   VRIYYYNAEVGRKEEPERFNDQRKFFTSLEKISYMELRLGRLVYSGWPSTPPYEKGVDV
FT                   LLSTDMLSHGFKNNFDTAILVAGDSDFVSALQAVKDNGKNVEVALFGKERTSMELRKVA
FT                   DKIIAVDGRLLRNCWKQQRNNYGTQRPPQES"
FT   gene            283283..284962
FT                   /locus_tag="DhcVS_288"
FT   CDS_pept        283283..284962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_288"
FT                   /product="radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_288"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61449"
FT                   /db_xref="GOA:D2BGJ9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGJ9"
FT                   /protein_id="ACZ61449.1"
FT                   /translation="MGVCCVTAGNSKETTMARKDRLKNRKELSRTRVSYASSERVAGES
FT                   GVVIKDWGGRLPLAVAYPNSYYVGMSNLGLHTLYRLINNYPQYLAERFFWEGGAAKGRP
FT                   TLSVESRRPFTDYVSILFTLSYELDFLNIPSMLADCGMPLYARERNEAFPLVIGGGACV
FT                   MSNPAPAADFFDVFCIGEAEAILPELLPVLAEMAGEPKRLVLERLAKISGLYVPSLPPE
FT                   KPVERVFPSELTQGVGTAVFSKATELGEMYLMEVERGCGHQCRFCLVAGVFCPLRYRPL
FT                   ELLLKQAKEGMLERKRIGLVGPVVSDHPQVAELISCLRGMGVGLSISSLRIKPLSEKML
FT                   TELALSGVSSLAMAPEAGSERLRRIIRKGITEDDIIRAAALVAEKGFRQLKFYFMLGLP
FT                   GETDEDIEEMIKLAEKAQQVMSAAGRGLRLSLNIAPFVPKPSTPFQWLGMEDAVLVKRR
FT                   LDIIRLRLEGQGIEVRAESPEMSQIQAVLSRGDVSLSKLLVAAGGDSLACWKRAAKSLE
FT                   VDSPSLAKTRFDLADKLPWYMLENPKQRQKLETEYKAAFKEI"
FT   gene            complement(285011..285460)
FT                   /locus_tag="DhcVS_289"
FT   CDS_pept        complement(285011..285460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_289"
FT                   /product="GatB domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_289"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61450"
FT                   /db_xref="GOA:D2BGK0"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGK0"
FT                   /protein_id="ACZ61450.1"
FT                   /translation="MPNLKEKLGEEVKLSLRQGEKLKCNVLRMLVSAISYAEIAKQKTF
FT                   TDEEIIGVIAKEIKQRRESIEAYKQAKRPELVEKEQQEMEILQSYMPEQMDEAELTLII
FT                   KKVISETGASTPQDKGKVMGKLMPLVKGKVDGQMVNAVVTALLNN"
FT   gene            complement(285462..285656)
FT                   /gene="rpsU"
FT                   /locus_tag="DhcVS_290"
FT   CDS_pept        complement(285462..285656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="DhcVS_290"
FT                   /product="ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_290"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61451"
FT                   /db_xref="GOA:D2BGK1"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGK1"
FT                   /protein_id="ACZ61451.1"
FT                   /translation="MADVRPENNESFESMLKRFNRKVQQDGILSEARRRTRFERPPTRR
FT                   KRKDAAKRRLAIKAARKAT"
FT   gene            complement(285831..287603)
FT                   /locus_tag="DhcVS_291"
FT   CDS_pept        complement(285831..287603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_291"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61452"
FT                   /db_xref="GOA:D2BGK2"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGK2"
FT                   /protein_id="ACZ61452.1"
FT                   /translation="MKHKFLLRVLGVFSTLALLIAALPLAPVSAATLTLSPTSGPAGSL
FT                   VSVTGTSVATSGSLVYILFNGANISTATVGSSGVVSGSFTVPTNLTRGTYTVSFLFTGG
FT                   DSAASQTFTITPSITLASGTGYVGDSVAVTGSGFTPSATVSFYLAGITAPFATTSSNSS
FT                   GAISTTITIPAAKKGTLSITANDGGATGSAPVNFIVNPKITLSSANPGVGDTITVTGTG
FT                   FYDGAVQIAIDSGTAVNAGVSVGSNGSFTATYEIPALTRGSHTLKVNDAWNNNAQVTFD
FT                   IAQKITLTPTSGNVGTSVTVKGSGFNTTGTITLTYFGQSVTVTLSSGTFTTTFVIPGVQ
FT                   AGAYTISATDGSVTSTATLTVTTNITMSPTNNASTPGNVGQEITITGSGLKANDTVLVT
FT                   FDSAQITVTPSPVVDSNGDFSLKFKIPAATAGPHTITVISGTTSKTFTFFVEGTAPATP
FT                   APLTPEMGLKAKQPVVFDWEDVTDPSGVTYVLEIAADQNFTTILYQIKDLTESTYTMTD
FT                   AQKLESVSSDSPYWWRVKAVDGAGNSSAYTGAGNFTVGFSLDLPAWATYVLIGIGGLLL
FT                   LALGFWLGRRNADY"
FT   gene            287790..288152
FT                   /locus_tag="DhcVS_292"
FT   CDS_pept        287790..288152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_292"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61453"
FT                   /db_xref="GOA:D2BGK3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGK3"
FT                   /protein_id="ACZ61453.1"
FT                   /translation="MLKRIGEMTLLDNDLKTEETDLLPELTSYPDQGCEFSKTCLDCPL
FT                   PVCVFDQPRGRQRWLKRQRDKEIVSLFQHGQDERELADRFRLSIRTIQRVLKKSLAGVN
FT                   INRKTEVLENSNGTDF"
FT   gene            288136..289500
FT                   /locus_tag="DhcVS_293"
FT   CDS_pept        288136..289500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_293"
FT                   /product="phage domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_293"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61454"
FT                   /db_xref="InterPro:IPR021145"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGK4"
FT                   /protein_id="ACZ61454.1"
FT                   /translation="MVQIFNPNELKSRDLDRLKRYVNLLDFYQGKQWDSRPSRNEKQLT
FT                   FNYARVVVDKLCSYLMSGINFGAEALNEEDIEKAVIARSMLNEVYQQNNLEQLDLETEI
FT                   DCAVLGDGCFKVIWDASSGRVRVSAPDIQGIYAWWSPDDMSRIYRVASRYALNSEEAEV
FT                   SYGLELPSRQSFLTEVWTEETFELWQDEKLLESKPNPYGFIPFVIYPNLREPKRFWGVS
FT                   DLDEIMEPQRELNRALSQLSRILELSGNPIAVLENVEQSEDIAVRPGAVWNLPEDTRAY
FT                   LLDLLQGGGVGLHINYVDLLYRTLHDIAEAPRAAFGGSGRDLSGIALEIELQPLLQRVW
FT                   RKRLIRSAAYRKRSAMILRLLEKYRGQDFSGVDPSISFSPVLPRDLSVVVGNEQTMVQS
FT                   GIHSRRKAMNELGVKDPEAEFERWCQERRQILEMNRDSSLKNGKQRQSERVALEE"
FT   gene            289518..289973
FT                   /locus_tag="DhcVS_294"
FT   CDS_pept        289518..289973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_294"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61455"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGK5"
FT                   /protein_id="ACZ61455.1"
FT                   /translation="MQVKTTEKATEGLASETEAVTPEDSAESMDSLRERLALSQSRAEE
FT                   LLKSSCEASERVTQLETELRLAVESYRRLMVEQNPEVIPELISGQTVEEINSSLDLSRK
FT                   LVARVKQSLEKEAVLARVPLGQASRQKPDFSSLSAREKIKYAVGGTN"
FT   gene            289976..290896
FT                   /locus_tag="DhcVS_295"
FT   CDS_pept        289976..290896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_295"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61456"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGK6"
FT                   /protein_id="ACZ61456.1"
FT                   /translation="MAISLTEASKLSNDILKQGVIETIVRESPVLAAMPFIEVMGNGLT
FT                   YNQEKTLPDISFYDTGDTWDESTPTFEQKTAQLKIMGGDADVDNFLKTTRSNVQDLETA
FT                   IIELKAKALKDKFEEVFIYGDSAVSSKQFDGLRKLINPASASAQVVAAGASGASLTLAK
FT                   LDELVDAVKGGKPDMLLMSRRSRRKLNALLRAGGGMLETDRDKWGNFIQFWDGIPIGVS
FT                   DWILDTHVVAEGLETATSGGGCSAIYALQFGEGGLCGLSSPGFIQVEALGSLEDKDASR
FT                   TRVKWYCSLALFSAVKAAALIGVTD"
FT   gene            290964..291563
FT                   /locus_tag="DhcVS_296"
FT   CDS_pept        290964..291563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_296"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61457"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGK7"
FT                   /protein_id="ACZ61457.1"
FT                   /translation="MNLVEMRTLVRRDLHDEDEANRRWTDAELNRHIGHALEELSRSVP
FT                   FETECLIPVTDGDREFTLSTLEGFIRLQAVEYPIDSYPPVFHRFDCRADKLKLLDEVLP
FT                   EAGYIRLYYSAAHTMTAENTSLPSCLEDLVAIGAEGFASLEWAVFCVNRVNSGGTDTPK
FT                   VFEAIGRERLAYFRNELKRLCSQNKVRVSSFFTPAA"
FT   gene            291610..291849
FT                   /locus_tag="DhcVS_297"
FT   CDS_pept        291610..291849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_297"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61458"
FT                   /db_xref="GOA:D2BGK8"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGK8"
FT                   /protein_id="ACZ61458.1"
FT                   /translation="MNLYRELWSRIGGRPWTYILRDLWHKYEGLCILALVAGGAFLGHW
FT                   LWHSVLWYLLNFTFGYIAGHLFWGKDYIPDQKGD"
FT   gene            291850..293850
FT                   /locus_tag="DhcVS_298"
FT   CDS_pept        291850..293850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_298"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61459"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGK9"
FT                   /protein_id="ACZ61459.1"
FT                   /translation="MYPLSPSLLSAQQSGCASPNIKLTVRNRLGGASKLRWEEIYAGTQ
FT                   AEGYHSIAIAEDGAMIRIRLGDNPDNYKLYFQRVAQPGPGADFGQWTYSGSYFFSRADV
FT                   ASFGSKVYVVAIDYYRNIFIFESTNNGQTWLAPVKIGTSNNSQVYGLSIAFKPSGDMAV
FT                   FYIEFNTLCYKKRVNGNWQSRQQWDKSTGALSGVSAVYDGDWRLVVSGNDTSGCSKVWS
FT                   LSLGDGADFGVGIWSSLYEFASAPAGGLYSYSAVSMDCPDVFRVCYLENYTGNVADKRA
FT                   FLSHLVADNSFSDNICCESVPTSMNSEFGFAMEHDGQYVYLAGVNRIYRAKIAQNSLEI
FT                   GADILKLESVCGSLKGSLAAELDNSSGRYNSAGSGELDMLSPGSEIEFAPGYETVNGAE
FT                   HGPGQLYIIQSLERRISEGKSSLLIRAEDSFCRLKRWRATNQMRWNRSSSQLSVRGILG
FT                   YVLSKAGIRMDVLNASAQLDNFYPDFTIHVGDDGFGLLDKLLSFVPDLVFLQGHCVYSL
FT                   YPQEADSPVYSYGFNHPVYSGIYADTFTEVNRVVLEGMDSSSHLFMVQGFIWDEIYQNH
FT                   DLTLRLYDRNINTLAQAKERLDSCFRKAVLKQQMGQIVVPINCGQQLFDVVNINQLESG
FT                   LETFVRRINGIRMVYEPGKGIYRQELSLGRV"
FT   gene            293861..294073
FT                   /locus_tag="DhcVS_299"
FT   CDS_pept        293861..294073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_299"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61460"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGL0"
FT                   /protein_id="ACZ61460.1"
FT                   /translation="MEIKRAVLKGFNSAAYTASIQLAGDYKSMLEEVKVAKNIPSVEML
FT                   AGRNLGVWFIDDHNTKDILVIAVYL"
FT   gene            complement(294180..295553)
FT                   /locus_tag="DhcVS_300"
FT   CDS_pept        complement(294180..295553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_300"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61461"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGL1"
FT                   /protein_id="ACZ61461.1"
FT                   /translation="MINRLRPYQQDIAKAVLQSIFNRQGQTFSVEIARQGGKNELSSQL
FT                   ELLLMTLFMFEPKNLVKCAPTFKPQLNISMMRLKDRLNEAGFTEIYHTEGGYIIRLNQA
FT                   RAVFLSAEPSANVVGNTAHLLLEVDEAQDVSKEKYTKEFKPMGATTNVTTILYGTTWDN
FT                   ASLLEEIKRQNIEKEQKDGLKRHFRYDWEEVAAHNPAYLAYALSEKDRLGENHPLFLTQ
FT                   YRLLPVSGGGGMFSTEQLDLLKSSHPCQIYPENGKVYVAGLDLAGEDGQIDGDLPATVN
FT                   LRRDSSVLTIAELDYTFAKAPCNLPQLKLVCHYSWQGARHALLYEKLVELLGKVWKCRK
FT                   VAVDATGLGQPVASFLRESLGSRILPFAFQPSSKSRLGFNLLSAVNSGRLKMYASNGSA
FT                   EYALFWQEMELARADYRQSQQMNFYVETTRGHDDYLMSLALCLEAAEAYSPRSAKGSN"
FT   gene            complement(295543..295905)
FT                   /locus_tag="DhcVS_301"
FT   CDS_pept        complement(295543..295905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_301"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61462"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGL2"
FT                   /protein_id="ACZ61462.1"
FT                   /translation="MTQEFVERKKGAPYGNQNARKHGFYSRVLDTNELEDYEQATLTEG
FT                   IDEEIALLRVKIKSILRHDPDNLKLLMQAVTTLSRLLSARYNISRQDKGGLREAIFNVL
FT                   RDVAVPLGIIKATFDK"
FT   gene            296013..296708
FT                   /locus_tag="DhcVS_302"
FT   CDS_pept        296013..296708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_302"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61463"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGL3"
FT                   /protein_id="ACZ61463.1"
FT                   /translation="MQLAKELFQLQELELDLESHLMQASKLRAILQDDSALKQAENVLA
FT                   EAAALLKEQQVALRELESQSADLDAKINEVKKSLYSGRISNPKELSNLSREQEILEAKR
FT                   TQVDDQALEGMDRLEELQTNCNQIMENLVAVRALWQQSQTQNTQALELTLSEIEKLKNE
FT                   LHEFLTRFDQSDLALFQTLRKSKGRAVSKVEQGNCRGCGLKLTAAWIQRARAGTLVQCS
FT                   GCQRILYLD"
FT   gene            296886..297131
FT                   /locus_tag="DhcVS_303"
FT   CDS_pept        296886..297131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_303"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61464"
FT                   /db_xref="GOA:D2BGL4"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGL4"
FT                   /protein_id="ACZ61464.1"
FT                   /translation="MAGLEKAFSLGAKELEIRSDSELLVKQIKGEYRMKNEGLKPLFNK
FT                   AVSLLGRFESYHIKYIPRAQNSEADALANKALDGGN"
FT   gene            297469..297771
FT                   /locus_tag="DhcVS_304"
FT   ncRNA           297469..297771
FT                   /locus_tag="DhcVS_304"
FT                   /product="sRNA"
FT                   /ncRNA_class="other"
FT   gene            complement(298042..298134)
FT                   /locus_tag="DhcVS_306"
FT   CDS_pept        complement(298042..298134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_306"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61465"
FT                   /db_xref="GOA:D2BGL5"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGL5"
FT                   /protein_id="ACZ61465.1"
FT                   /translation="MHLCEEGIDQTIAGLDILLAASFLTGMFYL"
FT   gene            298481..298723
FT                   /locus_tag="DhcVS_307"
FT   CDS_pept        298481..298723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_307"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61466"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGL6"
FT                   /protein_id="ACZ61466.1"
FT                   /translation="MCAVMEDLNVSALEFVSFCHRRCGQEWPELYDEMCRVAGRRLYRG
FT                   MGYYELNNLGIPLDLANLDNTLALVDQYKSNQKCS"
FT   gene            298821..299954
FT                   /locus_tag="DhcVS_308"
FT   CDS_pept        298821..299954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_308"
FT                   /product="carboxyl-terminal protease"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_308"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61467"
FT                   /db_xref="GOA:D2BGL7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGL7"
FT                   /protein_id="ACZ61467.1"
FT                   /translation="MTLRIKVLLGTILAMVGLLSSFVLGYLSGGTAVLNSDENLSSIVT
FT                   AWQIITTEYVEPDIIDQAALAEAAIKGMMDELNDPHSVYLNAEDYQASMEYDDGRYVGI
FT                   GATVQIEDGVIILIPYEGSPAALAGIQAGDILREVDGQSVAGFSLADLSPLVRGEKGTT
FT                   ITLLVERSSSGQPLLFEVTRDEILIPSVTSEMIDDIAYIRINRFSERTDEELEQVLKNL
FT                   GSAAGIVLDLRGNPGGLVSSVINVASRFVNSGVVLTTVDNEENSSEYSVVPKTVTTSLP
FT                   MVVLVDQYSASGSEALSGALQDYGRATIAGKTTYGKGSVNRTFNVTPDTGIYLTIGRWY
FT                   TPNGRMIEGQGITPDIELELTGDEAISWALGFLHGEA"
FT   gene            300071..301111
FT                   /gene="pheS"
FT                   /locus_tag="DhcVS_309"
FT   CDS_pept        300071..301111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="DhcVS_309"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_309"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61468"
FT                   /db_xref="GOA:D2BGL8"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGL8"
FT                   /protein_id="ACZ61468.1"
FT                   /translation="MEEIKNITEITQSALAELEAITELKDLEAWRVRYLGKKSLLTGAL
FT                   RNLASLPIEERKAAGAAANEAKTALEAAFSEKEQLSKEKHFAIRSEGLDITLPGRPWPI
FT                   GRIHPLTQVTNEVTSIFATLGFSVLEGPEIEDDYHNFEALNIPEDHPARENMQTFWIDR
FT                   PNEDGRLDTLLRTHTSPMQIRYMEKNKPPIRIVVPGKVYRYEATDATHIPMFTQVEGLV
FT                   VDEGISMAHLKGTLMEFCRRFFGANRKVRFRCDYFPFVEPGVEVAVSCTCGSKKECSVC
FT                   HGSGWLEILGAGMVHPRVLERVGIDSEKYTGFAFGMGLERLPMLRYGIDDIRLFYSNDT
FT                   RFLRQF"
FT   gene            301113..303542
FT                   /gene="pheT"
FT                   /locus_tag="DhcVS_310"
FT   CDS_pept        301113..303542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="DhcVS_310"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_310"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61469"
FT                   /db_xref="GOA:D2BGL9"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGL9"
FT                   /protein_id="ACZ61469.1"
FT                   /translation="MKIPLKWLKEYLPADMPPAELAERMTMAGTEVTVLNSHKDKWPNV
FT                   YVGLILEVNRHPNADRLVLVKVDWGQGQETVVTGAPNCKAGDKVVFARIGAVLIDGHNG
FT                   KEMVLKPAVLRGVESCGMVCSERELGLSDEHEGILILPADAPVGMLASEYLGAIILDLE
FT                   LTPNRGDLMCVTGVARELGALIDRLPSISTPDFKATGKDIKDKINIEIKNTKLCTRYTA
FT                   SLIEGIKIGESPDWLKERLIACGMRPINNVVDATNYVMLEFGQPLHSFDYDQIKSKRII
FT                   VRPAAEGEVLTTLDGVERKLSPDMLLITEPDKIIALAGVMGGENTEVTEKTTSVLLESA
FT                   TFDKQSIRRTARVLKLQSEASARFEKGLSFELAPIALKRATQLILEIAGGQAASGFIDV
FT                   MPVNKEKKSIVLSLSKVNQVLGYDREQPDTHKIAKRLGFVWIPEYIPGMEEFGYGSTDD
FT                   KVRIYPGYWRMDIETDIDMIEEVARIAGYDTIPSLSLDKAIPKIEIPPLPGMKRFLRQI
FT                   LSGYGFQELISYSFTSREMLSRVSSEAESECLAISNPMSSEQEVMRTSLRPSLYASLAA
FT                   NRRFEKDGLRLYELGRVYLPKENNKQEEPEMLCAVLAGSSSESWWQRNTSNFDFFDVKG
FT                   ILEAIISRLGLSADFVISDEPGLTRGYQASVRVGDMPVGVLGQVNPQITDKFDLTEPVY
FT                   MFEINLSKLVTRATARRKFSPINRFPAVERDLALVIDRSITNLQVINMISEYDLVKNVE
FT                   LFDMYQGKQVAENKKSLAYHLVFQSDTHTLKDAEVDGVMSQILRRLNTETGAVLRS"
FT   gene            303634..304269
FT                   /gene="ppa"
FT                   /locus_tag="DhcVS_311"
FT   CDS_pept        303634..304269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="DhcVS_311"
FT                   /product="inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_311"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61470"
FT                   /db_xref="GOA:D2BGM0"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGM0"
FT                   /protein_id="ACZ61470.1"
FT                   /translation="MLSDSSKKIKKEVEAINSDFKTIVGCGESKCPKLKRLKLASTPDI
FT                   TLTVMIEIPKGSRNKYEYDKERKIIKFDRMLFSAVHYPSDYGFIVDTLAEDGDPLDALV
FT                   LVWEPTFPGCMIETKPVGLFKMYDEKGPDAKLLCVPIGDPHFNFIRDLSDVPPHLLKEI
FT                   FHFFNIYKELESKKTGVEGWEDRESAIKTYWESHQRYLDALKDKKKEK"
FT   gene            complement(304332..306041)
FT                   /gene="proS"
FT                   /locus_tag="DhcVS_312"
FT   CDS_pept        complement(304332..306041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="DhcVS_312"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_312"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61471"
FT                   /db_xref="GOA:D2BGM1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGM1"
FT                   /protein_id="ACZ61471.1"
FT                   /translation="MRYSRLFGKTQREIPSDAETISHQLLLRSGMIAQLTAGVYSFMPL
FT                   AWRSIQKIENIIRQEMNKSGCQELAMPVLQPVEIWQQSGREAPFGQTLFHLKDRKDRNL
FT                   VLGPTHEEVITDLASRYIQSYRDLPQRLYQIQTKFRDEPRPRGGLIRVREFIMKDMYSF
FT                   DASPEGLDESYQTMKQAYESVYRRCGLESMVIDADSGAIGGKASHEFMIVAESGEDSII
FT                   YCPKCNYAANAEKAVFKKKTLPKEPLKDLEEIATPGQKTISEVAAFLSLKPENTLKAVF
FT                   YMADGKFVMTVIRGDLDINEIKLKNLLKCNDLRLAEDSEVKAAGIAAGFASPVGLKNIL
FT                   IVADDSVENGSNFVAGANKDGFHLKHVNSGRDFKADKMADIALAAEGAACPFCDGTFAS
FT                   KRGVEVGHIFKLGTFLSERFGANFTDAEGISHPIIMGCYGMGVGRLLAAAIEQNHDEKG
FT                   IIWPMPIAPYQVYICGLFLDKPAVSQAAEKMYAELEAQGVEVLFDDRELTAGVKFNDAD
FT                   LLGIPLRLTISPRNLDKGGVELKLRRNKEAELVPLDNIVEKVIATIKSESNL"
FT   gene            complement(306131..307177)
FT                   /gene="ispG"
FT                   /locus_tag="DhcVS_313"
FT   CDS_pept        complement(306131..307177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispG"
FT                   /locus_tag="DhcVS_313"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl
FT                   4-diphosphatesynthase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_313"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61472"
FT                   /db_xref="GOA:D2BGM2"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGM2"
FT                   /protein_id="ACZ61472.1"
FT                   /translation="MTMRRKSTEIRLGNITIGGNAPVSVQSMTKTDTRNIPATISQIKE
FT                   LEECGCEIIRLAIPDMEAATALKSIRREVRIPIVADIHFDYRLALAALSAGADGLRLNP
FT                   GNIGDPERVKAVVRAAKERETPIRIGVNAGSLPKDLPPELTTAQKMVKAAMGHVKILEA
FT                   LDFSLIKVSLKAFDVPTTVEAYRQIAPLIPYPLHVGITETGTPKTGLVRSAVGIGNLLY
FT                   MGIGDTIRVSLTSPPQEEVFAAYEILKSLNLRQRGPVLVSCPTCSRTEVDIVGIAARVQ
FT                   EALNKIDKPIRVAVMGCAVNGPGEAKEADLGIACGKGQGLLFRKGEKIASFPEDELVNA
FT                   LLREIASL"
FT   gene            complement(307214..308251)
FT                   /locus_tag="DhcVS_314"
FT   CDS_pept        complement(307214..308251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_314"
FT                   /product="membrane-associated zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_314"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61473"
FT                   /db_xref="GOA:D2BGM3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGM3"
FT                   /protein_id="ACZ61473.1"
FT                   /translation="MLLTIVSFLIIFSIVVISHELGHFFSAKAIGVKVEEFGFGYPPKI
FT                   FGRKFGQTEYTLNWLPLGGFVKVEDDPVNNKGLSSKSSGKRLLFFSAGALVNAVLPIVL
FT                   FAFALIIPHDVLVGRVNVEEVVPDSPAALAGLVAGDTILSVNGNEIRNTAEFSRMSQLN
FT                   LGQTIEITVLHADQTQSTVSLSPRWQPPAGEGPVGISLQTLNYQIISESESVLDSIPLS
FT                   IKQNFETLVLFKNSILGLIMGSVPFDVVGPVGLAQMTGAVARAGVGPLLEFTAFLSLNL
FT                   AIINLLPLPALDGGRIFFVFIEWIRGGRRISPKVENLIHMIGFFLLIGLMLAVTFQDIV
FT                   RIASN"
FT   gene            complement(308252..309385)
FT                   /gene="dxr"
FT                   /locus_tag="DhcVS_315"
FT   CDS_pept        complement(308252..309385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="DhcVS_315"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_315"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61474"
FT                   /db_xref="GOA:D2BGM4"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGM4"
FT                   /protein_id="ACZ61474.1"
FT                   /translation="MVHSIKKIVILGSTGSIGRQTLEVIRSLPDRFKVLGLAGGSNINL
FT                   LKEQASEFRPEYIYCQNCHDTNACTARFIPMEEMASLPEADVIVVAAPGSTGLQPVLAA
FT                   ARAGKVIALANKESLVSAGEIVTATARENKAKILPVDSEHSAIWQCLSGEVTPPARIIL
FT                   TASGGPFRSLTKDEIDKVTPEQALRHPSWKMGVKVTIDSASLMNKGLEIIEARWLFDMP
FT                   VRNIQVVIHPQSIIHSMVEFADGSLKAQLSRPDMRFPIQYALTYPERMTNHTLPRLNWA
FT                   EVGKLDFEMPDMTRFPCLGLAISAGEEGKTYPAALCAADEVAVEMFLKGQISFGQIPEL
FT                   IAKVLDAHQAVTSPSLDDILAADAWARQKVTELAGNL"
FT   gene            complement(309370..310173)
FT                   /gene="cdsA"
FT                   /locus_tag="DhcVS_316"
FT   CDS_pept        complement(309370..310173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="DhcVS_316"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_316"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61475"
FT                   /db_xref="GOA:D2BGM5"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGM5"
FT                   /protein_id="ACZ61475.1"
FT                   /translation="MLKKRVLSGCLLAIIALAVIWIDQPIAWLTLAMAVVVALALNEFY
FT                   NAVTVYLKSQPFKALGIFWGMLIVISPHLQIEGILPFLLGSFSLTSLIYLLTLKDRTDA
FT                   FPRWAWTLSGVIYIGLLSSFWVALRELPMGREWVLWTLILTSATDTMAFFIGSRFGKQK
FT                   MAPSISPNKSWQGAIGGAVFSIIVAPIFADLLGLPISMFISMLIGLLVSVAGQTGDIAE
FT                   SLFKRNMHCKDSGNLIPGHGGIMDRLDSLLFTGIVVYYYVIWFIQ"
FT   gene            complement(310177..310887)
FT                   /gene="uppS"
FT                   /locus_tag="DhcVS_317"
FT   CDS_pept        complement(310177..310887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="DhcVS_317"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_317"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61476"
FT                   /db_xref="GOA:D2BGM6"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGM6"
FT                   /protein_id="ACZ61476.1"
FT                   /translation="MDTTVTINNTPPNHIAIIMDGNGRWAERRGLSRIDGHKAGLENAR
FT                   LVIRHLNSLGIKYVTLYSFSTENWKRPDAEIKGLFGLINDVMSSYIPELVENNVRLRHL
FT                   GHLDKLPAILRHKLEGVLSATSQNTGLTLCLAFDYGGRDEIIQAVKGLVKDGIAVDKIT
FT                   EDVFARYLYTADIPEADLVIRTGGEIRLSNFLIWQSAYSELYFSEVMWPDFGEKEIDKA
FT                   ISAFNQRQRRFGGL"
FT   gene            complement(310953..311510)
FT                   /gene="frr"
FT                   /locus_tag="DhcVS_318"
FT   CDS_pept        complement(310953..311510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="DhcVS_318"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_318"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61477"
FT                   /db_xref="GOA:D2BGM7"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGM7"
FT                   /protein_id="ACZ61477.1"
FT                   /translation="MINEILQKSEKKMTASLDVLSQELSGIRTGRSSPALVEHIRVEYA
FT                   GVPTPINHLAGISAPDPRYITIQPWDKSCLSAIEKAIMKSDLGLMPNNDGNIIRLNIPP
FT                   LSEERRQEMIKMVNKRLEEDKIAMRNVRRDAMDEMKKLEKAKEISQDDLKRGSDQLQKI
FT                   TDSFIAKADKLGADKETELKQV"
FT   gene            complement(311512..312237)
FT                   /gene="pyrH"
FT                   /locus_tag="DhcVS_319"
FT   CDS_pept        complement(311512..312237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="DhcVS_319"
FT                   /product="uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_319"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61478"
FT                   /db_xref="GOA:D2BGM8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGM8"
FT                   /protein_id="ACZ61478.1"
FT                   /translation="MAEIKYKRILLKLSGEAFKGATGYGIDIPTVRSIAQEIKHICLMG
FT                   VEVAIVVGGGNIWRGATAAKEGIDRVSADYAGMLATIINALTLQDALEREGIVTRTQSA
FT                   LAVQQVAEPYIRRRAIRHLEKGRVVIFAGGTGNPYMTTDTAAALRAIEIEASVLLMAKN
FT                   KVDGVYTADPKKHPEATLFQHLTHMEAINKRLQVMDATALSLCLDNKLPIIVFDLQSSE
FT                   SLVSAISGQPIGTLISSEA"
FT   gene            complement(312252..312755)
FT                   /gene="tsf"
FT                   /locus_tag="DhcVS_320"
FT   CDS_pept        complement(312252..312755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="DhcVS_320"
FT                   /product="translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_320"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61479"
FT                   /db_xref="GOA:D2BGM9"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGM9"
FT                   /protein_id="ACZ61479.1"
FT                   /translation="MAINAEQIKELREKCGAGVMECRNALVDANGNVEKAQEILREKGL
FT                   VKAAKKAERETVQGIVESYIHTQGRIGALVELNCETDFVARTDAFKELAHNLAMQVAAM
FT                   CPLYLSEEDRPADCEVEAANACLLLQPYIKDPSKTINGLIIETVAKVGENIRLKRFARF
FT                   ELGG"
FT   gene            complement(312780..313517)
FT                   /gene="rpsB"
FT                   /locus_tag="DhcVS_321"
FT   CDS_pept        complement(312780..313517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="DhcVS_321"
FT                   /product="ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_321"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61480"
FT                   /db_xref="GOA:D2BGN0"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGN0"
FT                   /protein_id="ACZ61480.1"
FT                   /translation="MPTTNIKELLEAGAHFGHQTSRWHPRMKKYIFTKRNGIHIIDLEK
FT                   TVVMLDKACNYINQVVSDGGKVLFVGTKKQAQEILAEEAKRCGMYFINQRWTGGILTNF
FT                   HSIQSRIDYLVRLEDQQARGDFNRLPKKEAQKLAEEIARLNRTMGGFKEMTRLPDVIFV
FT                   VDPTKEKIAMAEAKRMGVPLVAMVDTNCNPDEVDYPIPSNDDAMRAIKLICSKMADSVI
FT                   EAQNALKVTEVETTGEAQAETAG"
FT   gene            complement(313703..314470)
FT                   /gene="purQ"
FT                   /locus_tag="DhcVS_322"
FT   CDS_pept        complement(313703..314470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="DhcVS_322"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_322"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61481"
FT                   /db_xref="GOA:D2BGN1"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGN1"
FT                   /protein_id="ACZ61481.1"
FT                   /translation="MSKVKTLILRTPGTNCDAETSYAFELAGSETEMVHINELLAKPSR
FT                   LAEFQIMAFPGGFGYGDDLGAGRVLANEVRLKLGEKINRFHESGGLIIGICNGFQALVK
FT                   TGILPGPMKDGQKITLTDNNSGRFECRWTYLSVNPFSTCVFTQGIDRLYLPVAHGEGKL
FT                   LGSPEVINKLNSVVYYTDKDGKRNAPYPANPAGTLMDIAGIADESGRIFALMPHPERFI
FT                   RGSQHPRWPAEGLKKEGDGLKIFTNAVKWVRQV"
FT   gene            complement(314477..317338)
FT                   /gene="purL"
FT                   /locus_tag="DhcVS_323"
FT   CDS_pept        complement(314477..317338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="DhcVS_323"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_323"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61482"
FT                   /db_xref="GOA:D2BGN2"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGN2"
FT                   /protein_id="ACZ61482.1"
FT                   /translation="MHRIEVSLKPEWPDPRGNGVCRDIQDLGITSVAEVRVIDVVWLEG
FT                   QLSDSEVMTISEELLSDKIIQTFKYDADCPQAEADGFSAIEVTYNAGVTDPVQETILKA
FT                   ISDLGIKGVTAARTAKRYLLKGEISADELKTIGNKLLINPIVQHVVKSGSNPFPPNPQY
FT                   TFKLRKIDLLAEKLKDNMASLGKEFSLSHQELSAIYEHYLKLGRAPTDAELETLAQTWS
FT                   EHCCHKTFKATLDYDGQIINNLLKQTIAKATAELNKPWCLSVFVDNSGVIEFDDNWGVC
FT                   FKAETHNHPSAVEPYGGAATGIGGVIRDILGTGLAAKPIANTDVFCFGQPDLPENKLPP
FT                   GVLHPRRVFKGVRSGVADYGNRMGIPTVNGAVIFDERYTANPLVYCGTIGLIPKKYALP
FT                   GKQSAGDLVVLIGGRTGRDGIHGVTFASGELNDRSTELSFTAVQIGNPIVEKRMLDTLL
FT                   AARDHELFVRITDCGGGGLSSAIGEMAESTGVKVYLDKVPLKYSGLTYSEIWISESQER
FT                   MLLAVKKEKLGEIMSLFESEGVEASVIGEFSSDRRLKLFYEDNPVADLQMDFLHHGRPQ
FT                   LELSATHHKHHHPEANFDCPKDIETELKNILSHWNVCSREWIIRQYDHEVQGGSVLKAM
FT                   AGAENDGPGDAAVIRPVLGSKKAVVISNGINPSYADVDAYNMAASAIDEALRQIIAVGG
FT                   NLDRVALLDNFSWGNASRPESLGDLVRACQACHDLSLVFETPFISGKDSLNNEFRYEDK
FT                   LITIPHTLLISAIGVMEDGDKAVSMDFKKSGNLIYIVGKTAEELGGSHYFKNHGFIGNR
FT                   APAVNARRAKENMQALSSATAKGLVAACHDLSEGGLGIAAAEMAFSGKLGANIRLADVP
FT                   LSEKIAREDYILFSESNSRFLAEVSPEHKAEFEKLMQASDFGLIGEVTAENRLYITGCN
FT                   GTDILLNTPVSELKEAWQRPMRW"
FT   gene            complement(317342..318223)
FT                   /gene="snz"
FT                   /locus_tag="DhcVS_324"
FT   CDS_pept        complement(317342..318223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="snz"
FT                   /locus_tag="DhcVS_324"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_324"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61483"
FT                   /db_xref="GOA:D2BGN3"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGN3"
FT                   /protein_id="ACZ61483.1"
FT                   /translation="METGTFKVKSGLAQMLKGGVIMDVTTPEQAKIAEEAGACAVMALE
FT                   RVPSDIRAAGGVARMADPTIIEQIMKVVSIPVMAKCRIGHFVEAQILESMGVDYIDESE
FT                   VLTPADENFHVWKHDFKVPFVCGCRDLGEALRRIGEGAAMIRTKGEAGTGNIVEAVRHM
FT                   RSVMGSVRRVQSMSADELSAYAKEINAPLELVIELHKTGKLPVVNFAAGGVATPADAAL
FT                   MMQLGADGVFVGSGIFKSSNPAAMAKAVVKAVTHYKDAKVLAEISKGLGDAMPGLDIKQ
FT                   IEPDKLISQRGW"
FT   gene            318407..318805
FT                   /locus_tag="DhcVS_325"
FT   CDS_pept        318407..318805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_325"
FT                   /product="iron-sulfur cluster-binding protein, Rieske
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_325"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61484"
FT                   /db_xref="GOA:D2BGN4"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGN4"
FT                   /protein_id="ACZ61484.1"
FT                   /translation="MNIFKAIMGKCDTAPLADDVWSLMDSQITLDLAKAPALSEKGGAG
FT                   YMAGKGLAKPVLVVRGQDNNLYAYENACPHGGRKIDPVEGESRLRCCSVNHSTFDYNGK
FT                   VLSGPAQHKHELRRLLTSQADGKLLISL"
FT   gene            318882..318956
FT                   /locus_tag="DhcVS_326"
FT   tRNA            318882..318956
FT                   /locus_tag="DhcVS_326"
FT                   /product="tRNA-Thr"
FT   gene            318985..319749
FT                   /locus_tag="DhcVS_327"
FT   CDS_pept        318985..319749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_327"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61485"
FT                   /db_xref="GOA:D2BGN5"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGN5"
FT                   /protein_id="ACZ61485.1"
FT                   /translation="MSKFIDKLKNVSKGYVRPMGFNAVASVPQPKMLLAAELGLEDLTD
FT                   KEAFGGADVVIVSVGKASAKKLKETADMLGDTIWGVALGDKAADAEKMAKAGADFVVFS
FT                   PDAEVSPLTALEKTGKIIMLENNLTDFMIRAADCLSVGAVIVDNQPDALALSWRKIMLY
FT                   QRFADILSKPFLVRVSSNITLSELQSLWALGIDGVLISGSTGLKELRTLIDGAEWAVKR
FT                   KRGHMSAIVPSLKMPASESVAPEEPEEPDEDD"
FT   gene            complement(319835..320980)
FT                   /locus_tag="DhcVS_328"
FT   CDS_pept        complement(319835..320980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_328"
FT                   /product="IMP dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_328"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61486"
FT                   /db_xref="GOA:D2BGN6"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005992"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGN6"
FT                   /protein_id="ACZ61486.1"
FT                   /translation="MTVPEFKTLRRTYGFDEVAIVPGGLTVNPEQVEVDFKIGNINFAI
FT                   PFIASAMDAVTNVDTAVAMSKMGGLSVLHLEGIYTRYENPQEILDQIISKPIDEVTAFM
FT                   QKIYTAEPIKEHLIAKRVSEIKAKGGICAVSLMPANAKKLAPVAVEAGADIISVASTVT
FT                   SARHVSKSSHGLIFEEFVKMIKVPVLVGNCVSYQACLELMRTGVHGVIIGVGPGAACTS
FT                   REVLGIGVPQITASMDCAAARETYYKETGRYVPIITDGGFKKGGDVCKAICAGADAVML
FT                   GSPFAKAAEAPGRGYHWGMSHPHPSLPRGTRIKVGTTGSLEQILFGPTSVTDGTQNLVG
FT                   ALKTSMGVCGASNIREMQQVEMVIAPAITTEGKSYQLSKCQ"
FT   gene            321181..322005
FT                   /locus_tag="DhcVS_329"
FT   CDS_pept        321181..322005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_329"
FT                   /product="tetrapyrrole methylase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_329"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61487"
FT                   /db_xref="GOA:D2BGN7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGN7"
FT                   /protein_id="ACZ61487.1"
FT                   /translation="MALYVVATPIGNLEDITLRALRVLSEVKLIAAEDTRHTRKLLSAH
FT                   NIKTPLTSYFEHNRLSKLDYILEVLGEGDVALVSDAGMPGISDPGYELIKAAHENGIKV
FT                   VPVPGASAVITAVAVSGLDSANFNYLGFLPRQKTERRKALSEAALLGVSIVILEAPHRL
FT                   HGCLLDIKDVLGDRQIAVCRELTKIYEEIFRGSISQAISHFDQPRGEFVLVVEGCKPPV
FT                   SQPELTDDIIKELGMLKKQGKPAKEAVALVSQKSGLPKKEIYRAWLKINKTL"
FT   gene            322030..322245
FT                   /locus_tag="DhcVS_330"
FT   CDS_pept        322030..322245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_330"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61488"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGN8"
FT                   /protein_id="ACZ61488.1"
FT                   /translation="MRRGCISLGDVVCTGCNNNIPYPERYLAVDEEDGKEVDKGTTVHY
FT                   CVECALKKGYASYKEEKGERILTFLP"
FT   gene            322254..323915
FT                   /gene="metG"
FT                   /locus_tag="DhcVS_331"
FT   CDS_pept        322254..323915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="DhcVS_331"
FT                   /product="methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_331"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61489"
FT                   /db_xref="GOA:D2BGN9"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGN9"
FT                   /protein_id="ACZ61489.1"
FT                   /translation="MSERIFIGVAWPYANSQLHLGHVAGAYLPADIFARYHRTRGDEVL
FT                   MVSGSDMHGTPITIRAEQEGITAAEVAERYHRLFMASWPKLGISWDCYTSTATANHART
FT                   AQEMFLSLYEKGYIYKDTVCQPFCPHCNRFLPDRYVEGTCPHCKYEGARGDQCDNCGKP
FT                   LNAAELLNFRCKNCGNPPEFKETEHFFLKLSAFEEELLRWVENKTHWRTNVLNFTLRYL
FT                   KEGLKDRAITRDLDWGVPLPLPGYEGKRLYVWFEAVIGYLSASIEWAVAKGQPGEWQKY
FT                   WGGDTKSYYFIGKDNIPFHTIIWPAMLMGKSGLNLPYDVPSNEYLTIEAQKFSKSRNKA
FT                   VWVDDVLSRYSVDTLRYLLSANMPESSDMDFSWREFVRRNNDELVATYGNLAQRVLTMV
FT                   CRNFGNKVPEYGELDERSLNLIEKTGAMLSETDKALHGCNFREAVKLAMSLAQEANRYL
FT                   DEKAPWKEIKVDKAAAARSLYVAMAALSGLRVAFYPFLPESSSRLSTYLGFGSEIEKDG
FT                   WVLKMPVVGQEMTPPEPLFKKLEDSVVEEETARMGL"
FT   gene            323937..324911
FT                   /gene="hepT"
FT                   /locus_tag="DhcVS_332"
FT   CDS_pept        323937..324911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepT"
FT                   /locus_tag="DhcVS_332"
FT                   /product="heptaprenyl diphosphate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_332"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61490"
FT                   /db_xref="GOA:D2BGP0"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGP0"
FT                   /protein_id="ACZ61490.1"
FT                   /translation="MLKLSSIYAPINEGLKGVEDEFKLVSERRKQSFPEMAEMLDYILV
FT                   GGKVLRPALSMLSAMCFGAGIKKVLSLATSSEMLHIATLVHDDAIDKADTRRGRRTVNS
FT                   VWGLEKAILLGDFLFAHAAETAADTGNMRIVTLFAQTLQIIASGELKQAYASFNPDQSY
FT                   ENYLERISGKTAALFVMATKGGAILADASPADEEIMRSYGYNLGLSFQIVDDILDFVGN
FT                   AKDMGKPVGSDLNNGTVTLPALILMDRYPESNPIKDMLGATDRSAHVAKAVEMINSSDI
FT                   IDLSYKEAKRYADLACKDLSKLPKTAARKSLYQLAEFIVERKN"
FT   gene            complement(325106..326605)
FT                   /gene="ftsH"
FT                   /locus_tag="DhcVS_333"
FT   CDS_pept        complement(325106..326605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="DhcVS_333"
FT                   /product="ATP-dependent metalloprotease, cell division
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_333"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61491"
FT                   /db_xref="GOA:D2BGP1"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGP1"
FT                   /protein_id="ACZ61491.1"
FT                   /translation="MILTYLPFLIFGGLLIFIFTQARGANNQAVSFGRSKAKLFNMDKP
FT                   TITFANVAGVDEAKQEVGEVVEFLKSREKFQALGARIPKGILLIGPPGTGKTLLAKAIA
FT                   GEAGVPFFSISGSEFVEMFVGVGASRVRDLFDQAKKNAPCIIFIDEIDAVGRQRGAGLG
FT                   GGHDEREQTLNQILVEMDGFDTDTSVIVIAATNRPDILDPALLRPGRFDRRVVLDKPDI
FT                   TGREAILKIHAKGKPLADTVNLENLAKQTVGFSGADLANLLNEAAILAARKNRKVVETE
FT                   DLEESIDRVIAGPERKSRRISTQEKEVTAYHETGHGLVLRLVQGADPVHKISIVARGMT
FT                   LGHTRQLPNEDRYLMTRSQFKAMMAGLLAGYVAEELTFKELSTGASDDLRRATDIAHKM
FT                   VTSYGMSDKLGPRTFGNKEEMVFLGREISEQKDYGEKVADMIDEEVRGLIEEAHQKAKT
FT                   ILTENKNRLKFIAEKLVEKETLEGVDLENLFVGELPISESA"
FT   gene            complement(326992..327744)
FT                   /locus_tag="DhcVS_334"
FT   CDS_pept        complement(326992..327744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_334"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61492"
FT                   /db_xref="GOA:D2BGP2"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGP2"
FT                   /protein_id="ACZ61492.1"
FT                   /translation="MAELGLDGMEIEFVRGVYMKAPDTNPVRILSDLLRIKLSAHAPYY
FT                   LNFNAVEENKVKMSQHLLYQSAKMASLCGAGSLVFHPGFYLTDSPSAAYEAIRDNIRPV
FT                   ALRLREEGFPISLRPEVSGKVTQFGDLKETMALCSEIPGLLPTIDFSHYHARTGKFNSY
FT                   SEFSFMLNTMADYLGEKTLKNMHIHISGIDYSPRGEKQHLNLAESDFNYKELLLCLRDT
FT                   GCAGLVICESPNIEEDALLLKETYFSLA"
FT   gene            327936..328286
FT                   /locus_tag="DhcVS_335"
FT   CDS_pept        327936..328286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_335"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61493"
FT                   /db_xref="GOA:D2BGP3"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGP3"
FT                   /protein_id="ACZ61493.1"
FT                   /translation="MHLESIDIARQMVSIASEKQAEDIVLLDVRELVSYCNYFVLMSGA
FT                   SGRQLSAIADTVEKTFKPLKIGPRHREGDADSGWILLDFGGVIAHIFTPEIRSYYKLDR
FT                   LWENAPKLVAMQ"
FT   gene            complement(328287..328715)
FT                   /gene="ndk"
FT                   /locus_tag="DhcVS_336"
FT   CDS_pept        complement(328287..328715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="DhcVS_336"
FT                   /product="nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_336"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61494"
FT                   /db_xref="GOA:D2BGP4"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGP4"
FT                   /protein_id="ACZ61494.1"
FT                   /translation="MERTLLLVKPDGVNRGLSGEILGRMEKLGLKMIGLRMLQMDAVLA
FT                   DKHYAPHRERPFFKDLVTYITSGPIVAAVFEGENAVEKMRKAMGATDPAKSEKGTVRGD
FT                   LGINIEQNTVHGSDSAENAKHEISLFFSESELVNYNRR"
FT   gene            complement(328725..330095)
FT                   /locus_tag="DhcVS_338"
FT   CDS_pept        complement(328725..330095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_338"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61495"
FT                   /db_xref="GOA:D2BGP5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGP5"
FT                   /protein_id="ACZ61495.1"
FT                   /translation="MPVLIAIDTATPDTGLAILKDNEIVAQYNWLSHQNQTVELLPRLE
FT                   WLLESAGLSLKDASAIAVSIGPGSFNGLRVGLSTAKSLAFALDIPLCGIGTLELAAYPY
FT                   LASGLKVWALLPSGQQEYAAGAYVKDGEGLKETAKPYITNLADLAAEISEPCVICGPIS
FT                   QTTQDELKTLLGGKKIVFAPADIRPSRAASLARLAKKRIEDGLTDSPAGLQPLYLRRPQ
FT                   ISPRKHRTGLPLSQNKAVIWDMDGVIADSAPFHMRAWQTTFAEIGYTFSAADFYRTFGL
FT                   RNDMIIYSVLGEKSDADTIHTLADRKEHLFREYAGQEIRLFPGVIELLKSLKPAGYRMA
FT                   IASSAPLANIKLVMAKLGIGDYFLATVSEKDVTKGKPNPQVFLLAAARLCASPEECLVI
FT                   EDAPAGVEAAKKAGMKCIAVTNSQQPQALSEADMIVDTLGKISVEDIAGFIGLAGTK"
FT   gene            complement(330073..330564)
FT                   /locus_tag="DhcVS_339"
FT   CDS_pept        complement(330073..330564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_339"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61496"
FT                   /db_xref="GOA:D2BGP6"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGP6"
FT                   /protein_id="ACZ61496.1"
FT                   /translation="MNQLELVSHSTQQTQDLGKIIGELASAGDIIFLVGNLGAGKTNLT
FT                   QGLAKGLDITENALSPSFVLVREMYGRLPLYHIDLYRLDLSEEIEELGLDDYLYGSGVT
FT                   VVEWADKADELLPSENLRIEIAYLDDDKRELTLYAWGIRYEELLNEISQRVKDAGFNSH
FT                   "
FT   gene            complement(330561..331571)
FT                   /gene="thiL"
FT                   /locus_tag="DhcVS_340"
FT   CDS_pept        complement(330561..331571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="DhcVS_340"
FT                   /product="thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_340"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61497"
FT                   /db_xref="GOA:D2BGP7"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGP7"
FT                   /protein_id="ACZ61497.1"
FT                   /translation="MKVSDIGECQLIDKLNNLLHQKSAVNTPARENLIIDIGDDAAVFR
FT                   PQGYQLVTVDSLIENVHFNRNMLCWADLGYKAMAINMSDIAAMGGVPQYAVVNIDLPPD
FT                   TLVSSVTDCYNAMYSLAEKYQTAIIAGDTNQSSIINLAVTLLGSAENPNRLLTRNAAQA
FT                   GQKIAVTGYLGSAAAGLDMLLNQTKVPDENREIFYRSFYRPEPRINEARLLVKEGVRCC
FT                   IDISDGLVIDLGHVLRQSRVSARIDLGKLPLHPSLRLCYPLQAQNMALYGGEDYELLFT
FT                   ASAEVIEQISVQSPIPVTVIGEIIPGKPEELRLMDKDGRALQPGKNGWEHFKKPK"
FT   gene            331862..332638
FT                   /locus_tag="DhcVS_341"
FT   CDS_pept        331862..332638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_341"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methlytransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_341"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61498"
FT                   /db_xref="GOA:D2BGP8"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGP8"
FT                   /protein_id="ACZ61498.1"
FT                   /translation="MSSLAEAPIQDPGFDSEEAHKRKQYMVDLFVVQAKNYDFHDDVFG
FT                   LYAHRFWMRTVLKIVGKFVKGRTSTKMLDLACGTGFVTFNTARNFENIDIDSFDISPDM
FT                   LAVAKERYEKYFKGRSIKFWQGDAEVPFGEEKYNLITTSFAYRNFANKGLATENVFRAL
FT                   KPGGLFIIQDLTKPEHHPMRGLYIFYMKYILPLFTSILGTEKSAARWLYKSAMMMPTNG
FT                   QIVKLMESKGFEKCQYKSLSLGIACVIWGYKPEKSE"
FT   gene            332640..333407
FT                   /locus_tag="DhcVS_342"
FT   CDS_pept        332640..333407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_342"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methlytransferase, methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_342"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61499"
FT                   /db_xref="GOA:D2BGP9"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGP9"
FT                   /protein_id="ACZ61499.1"
FT                   /translation="MSSVDVNVKDPGFESEEAQARKRYMLQLFGFQAKHYDLHDDIMGL
FT                   GIHRRWGKEMVLEILTYTRNMPQVKMLDLACGTGFVTFNTLRYMKNVDIDAFDITPEMV
FT                   EVAKVRLKKNYPDRNVKFWVGDAEISYGDAKYDVIGTCFAFRNFANKNLAASNIFKALK
FT                   PGGLLVLQDMTKPEKQPFRGIYLFALKNLMPIMARIIGTEKKSARYLANSVLAMPSNAE
FT                   IMAILQNQGFINIKSHYQSGGMGTLTVAYKPEN"
FT   gene            333410..334504
FT                   /locus_tag="DhcVS_343"
FT   CDS_pept        333410..334504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_343"
FT                   /product="3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_343"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61500"
FT                   /db_xref="GOA:D2BGQ0"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGQ0"
FT                   /protein_id="ACZ61500.1"
FT                   /translation="MGKVDTLAYDIGNNRTRHVYIGNDILNSLPEYARELNADKFFIIT
FT                   DSNLENILKDKIKDLLSGVTETHLLAFPAGEASKTLSTLEDIGSKILDLRATKSSVVVC
FT                   LGGGVVGNLGGLTAALLFRGLRFFHIPTTMVAQIDSAIGQKQAVNYKMGKNLFGQYYAP
FT                   EFVFIDFDFLRTLPERQIRAGLAESVKHGLCQESSFFDYIEEHAGDYSPKVIDYISRHT
FT                   IELKLELLKIDPFEGKLDPQLELGHTIGHAVEIIKNGQLLHGESIAIGMVAEAALSCEM
FT                   GYMKPELAAKIERIFKKLGLPTRIPADVPLEGVLEALRYDNKRRTARTDFFLLEDFTRF
FT                   HKENGKIGTKVSEEVLKKVLESAY"
FT   gene            334488..335408
FT                   /gene="menA"
FT                   /locus_tag="DhcVS_344"
FT   CDS_pept        334488..335408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="DhcVS_344"
FT                   /product="1,4-dihydroxy-2-naphthoateoctaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_344"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61501"
FT                   /db_xref="GOA:D2BGQ1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGQ1"
FT                   /protein_id="ACZ61501.1"
FT                   /translation="MKALTSERPDFQDWIQAARLKFLPQGVMPVVIAGALAFSEGTFDI
FT                   ANFVVAFSAAAAVQIGLTMFNDTLDYVYGTDCKPIDAKNPFSGGSGVFTCGIIKPRQSL
FT                   MVIFALYFFALLCAVYMALDMGWGVMWIAIIGAAISILYSAKPLRLAYHGLGELMMLIG
FT                   YGPVLTAWGYFVHTGMVSLDILLIGVIPGLCMWAMILINEIPDYLEDRAAGKRNLTYRL
FT                   GPKNAKNLFFISLLVLYAYILALVFNGIMPPLSAISLGGIPLAVMAVRIAHRYYNDPIK
FT                   VAMANKLMVIIYSVTTATVAIGMLT"
FT   gene            335408..336010
FT                   /locus_tag="DhcVS_345"
FT   CDS_pept        335408..336010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_345"
FT                   /product="methyltransferase, UbiE/COQ5 family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_345"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61502"
FT                   /db_xref="GOA:D2BGQ2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGQ2"
FT                   /protein_id="ACZ61502.1"
FT                   /translation="MVAPSFFEKVAPVYEFLTRMFMLGTFESARDRMLNEDTSSFSVLD
FT                   LCTGTGYIANKIEAKRIVGLDQSVQMMALNDRTKRPNKTLVRGNAYHLPFEDGEFERIY
FT                   CSSASHEFKLFGKVLAECFRTLKPGGKVAVYDIYQPKNKFYSLIVNTIYRYPVEHNIMW
FT                   VHTLEGWRKLLTEAGFEVEELEAVRGVFVFVRARKPA"
FT   gene            335979..336872
FT                   /locus_tag="DhcVS_346"
FT   CDS_pept        335979..336872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_346"
FT                   /product="serine/threonine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_346"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61503"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGQ3"
FT                   /protein_id="ACZ61503.1"
FT                   /translation="MFLFGLESPLKQLEVRYILQTGLLKRPVLFFYNRYCQKRTVSHLT
FT                   NYTLMVSLGMRYAVIADIHANLEALNAVLEDAYKRGVAEIWCLGDIVNYGPDPMACLEI
FT                   LRNRKHMAVAGNHDLAVAGKINHSLFELEAARCLVWTRNQLSSDMIDYLACLPKVTSDG
FT                   DFTLVHGSLKRPEWDYITTPQIAAENFSLMNTPYCLVGHTHMPYVFTPGQNGICRGIPL
FT                   MAGSMQPLRQTSLIINPGSVGQPRDGNPQASYGIYNDESRTFCLYRVPYNISATQKKMQ
FT                   KAKLPPFLSARLSKGR"
FT   gene            336892..337767
FT                   /gene="ksgA"
FT                   /locus_tag="DhcVS_347"
FT   CDS_pept        336892..337767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="DhcVS_347"
FT                   /product="dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_347"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61504"
FT                   /db_xref="GOA:D2BGQ4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGQ4"
FT                   /protein_id="ACZ61504.1"
FT                   /translation="MEKDAPLLAAGVPSLMAQAKEMMEGYTLKARKGLGQHFLISQGVL
FT                   NKILLAADLKPTDTVIEVGPGLGVLTEELLERAGQVIAVELDDKLVNALTEKFKAYPNF
FT                   KIIHSDILKISPEEILGQNIPYKLVANLPYYITSAVLRQFLEAEIKPELMVVMVQKEVA
FT                   KNMVAKTGDMGLLTLSVRFYGNPALVATVPAGAFYPPPEVDSAIVKVVIPQTTIMDGVS
FT                   AVDFFKLARAGFGTRRKTLLNALAQGLGISKQDILLLLERSGIDPARRAETLSMEEWKR
FT                   LCLEYTVNPC"
FT   gene            337737..338615
FT                   /gene="ispE"
FT                   /locus_tag="DhcVS_348"
FT   CDS_pept        337737..338615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="DhcVS_348"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase,
FT                   homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_348"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61505"
FT                   /db_xref="GOA:D2BGQ5"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGQ5"
FT                   /protein_id="ACZ61505.1"
FT                   /translation="MPGIYGEPMLTLLAPAKVNLSLEVLYRRNDGYHELRSIVQSLSLC
FT                   DRLSFSPAKMVQISSDSPDWQPEHSLVSKAVTLFSEKCGQNSGVNLKIAKRIPLVSGLG
FT                   GDSSCAAAVLKGLNKLWGCGYPCWRLMEIGAELGSDVPFFIMGGTAMMEGRGETVTPLP
FT                   TLNQMWAVLLVPPISMPSDKTAVLYRNLHPDSFTSGEIGDKLLEDICHGKLSPSLCFNV
FT                   FEKVAFTLFPELVKYRWQFLEAGAYQISLAGAGPTLFTLLKDKNTAEKIYHNLCQKGHQ
FT                   AYLVSTLGPLD"
FT   gene            338670..339167
FT                   /locus_tag="DhcVS_349"
FT   CDS_pept        338670..339167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_349"
FT                   /product="rubrerythrin/rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_349"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61506"
FT                   /db_xref="GOA:D2BGQ6"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGQ6"
FT                   /protein_id="ACZ61506.1"
FT                   /translation="MSSSENLKAAFAGESQANRKYLFFADKAEKEGFAHVARLFRAAAE
FT                   AETVHARNHLNVLKGVGATAANLEAAVEGESYEFNSMYPAFIKEAEAEGNSSALLSFNH
FT                   ANKVEKIHHGLFEAALKEVKSGIKAPDQVYYVCQVCGNTVLGTAPARCPICGAPASSFR
FT                   AV"
FT   gene            complement(339243..339509)
FT                   /locus_tag="DhcVS_350"
FT   CDS_pept        complement(339243..339509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_350"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61507"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGQ7"
FT                   /protein_id="ACZ61507.1"
FT                   /translation="MINKKTELTLQIKKDLALTNKLLSQGMVSTRDPETGFRYILCATC
FT                   PKDGGDGTLSRIDRKDNVVERVLFCCTTCGKEFAAKPEDIFLT"
FT   gene            complement(339567..340376)
FT                   /locus_tag="DhcVS_351"
FT   CDS_pept        complement(339567..340376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_351"
FT                   /product="cation channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_351"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61508"
FT                   /db_xref="GOA:D2BGQ8"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGQ8"
FT                   /protein_id="ACZ61508.1"
FT                   /translation="MTKHNPMKSVHDLLTFGFDSPSRKFVSWFIISLICLNVLAVILGS
FT                   VDSIARDYHTLLHSFEIFSVAVFSLEYILRVWSCTVEPKYSHSFSGRIRFEVSPLALMD
FT                   LLSILPFYLPFLIHIDLRFLRSLRLLRLFRLGHLKRFNETSRMILNVLRERKEALIISF
FT                   AIILLLIIVTSSLMYFVENPAQPDVFKNIPDAMWWSVMTMTTVGYGDIYPITSLEKFLA
FT                   SIISILGLATFALPTAILSAGLLEEFRKKKETHEHACPVCGQNMPKY"
FT   gene            complement(340363..341619)
FT                   /locus_tag="DhcVS_352"
FT   CDS_pept        complement(340363..341619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_352"
FT                   /product="polyA polymerase, tRNA nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_352"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61509"
FT                   /db_xref="GOA:D2BGQ9"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGQ9"
FT                   /protein_id="ACZ61509.1"
FT                   /translation="MNAEKLRSFLKNRLPPEINRLILHAAERAASQNLYLYLAGGMVRD
FT                   FLLDKTPKDADLVLTANAILFGQNLFEKTPYKVTLHHRFNNLSADINGFKLDITSARSE
FT                   IYPVPGKLPEVLEGDIRADLFRRDFKINAMAISLSPQDFGHLADPYNGLTDLKQGKLSV
FT                   LHPKSFQDDPSRIWRALRYSERLGFSISGDTLPLLLRDAHLIPLIGADRLWYEIECVFK
FT                   EAKPENILLKAEETGVLRNSLPFAKADKWLADKFTEAREIYGENVSPEIYLCLLTAHMD
FT                   SPQADSLITRLHLGKHLSACLKDCQYLAEHREELDMAALSPSRLYSLLAKCKKEALQAF
FT                   YVSADNPLVRKNLLLFHERLSAVKPYLKGADLIALGFAPGPNIKTILTELLNLKLDGKV
FT                   SSRIDEIDYVKRRLADDQT"
FT   gene            341700..342617
FT                   /locus_tag="DhcVS_353"
FT   CDS_pept        341700..342617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_353"
FT                   /product="ABC-2 type transport system, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_353"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61510"
FT                   /db_xref="GOA:D2BGR0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015851"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGR0"
FT                   /protein_id="ACZ61510.1"
FT                   /translation="MNTHAIKVSNLVKRYKDCTALDGLSLEIKQGECFGLLGPNGAGKT
FT                   TLVRILTSLTPSDSGTVEVMGLDLAHHLRQIKAMFGVIPQLDNLDSELSVTENLVTFAR
FT                   FFDIKPADARRKASEILHLFKLEQKANSEVKALSGGMRRRLLLARGLMNNPSIIILDEP
FT                   SVGLDPQSKYLVWQKLKEFKACGITQLLTTQNMDEAAVLCDRIAIMHQGKVLDMDTPKG
FT                   LVDRHVGQCLIEIEVRQGEHEAITAECIRRGLDFEDSGLIIQVFRCGEDNLLDELKAFG
FT                   WNVWQRIGTLEDVFLRLTGKGLVE"
FT   gene            342614..343381
FT                   /locus_tag="DhcVS_354"
FT   CDS_pept        342614..343381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_354"
FT                   /product="ABC-2 type transport system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_354"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61511"
FT                   /db_xref="GOA:D2BGR1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGR1"
FT                   /protein_id="ACZ61511.1"
FT                   /translation="MNWPTYRAFYMWLRNYNVFIRLFWSIAPGFVIEPVVLLVALGFGF
FT                   GSFIGDINGQPYMEFIIPGVIASYAMTSATFECTYNVFFRMDFRKTYDSILATPMNISD
FT                   VVTGEVLWGATRSIITACIILLVAALFGVIHSPLALLAPVFAVLEGIMFASMGVFFASI
FT                   VPSVYSFNYYFTLFIGPMTFFSGAFFPVSSFPETVQVISNIVPLTPAVSLIRGAVSGDF
FT                   AGVNVVISLLAVIGVSAAFYIATLFSMKRRVME"
FT   gene            343429..343980
FT                   /locus_tag="DhcVS_355"
FT   CDS_pept        343429..343980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_355"
FT                   /product="dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_355"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61512"
FT                   /db_xref="GOA:D2BGR2"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGR2"
FT                   /protein_id="ACZ61512.1"
FT                   /translation="MKVIALVGMPGAGKTEASRMFSKNGFIRIRFGDVTDGKLRELGLP
FT                   LNEENERKVRESLRKQYGMEAYAVLNLSRIDENLKKDNVVVDGLYSWEEYKFLKSYYKE
FT                   QLVVVAISSAPATRYSRLCERADRPLNYDNAVSRDYSEIENINKAGPIVMADITLLNEL
FT                   DLKDMEKQVKKLSLELRADV"
FT   gene            343977..344450
FT                   /gene="comEB"
FT                   /locus_tag="DhcVS_356"
FT   CDS_pept        343977..344450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comEB"
FT                   /locus_tag="DhcVS_356"
FT                   /product="cytidine/deoxycytidylate deaminase, Zn-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_356"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61513"
FT                   /db_xref="GOA:D2BGR3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGR3"
FT                   /protein_id="ACZ61513.1"
FT                   /translation="MSRPNADEYFLKIAAVVAERSTCVRHHVGAVAVKDKHILSTGYNG
FT                   APAGLTDCLELGCLRNQNGIPSGTRHEICRAVHAEQNVIIQAALHGTSLEGATVYATHT
FT                   PCVLCAKMLTNARIKRYVSYGKYADDSFIDMFKQAGIEVVIKDRPPGIVEYLD"
FT   gene            344538..345443
FT                   /locus_tag="DhcVS_357"
FT   CDS_pept        344538..345443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_357"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61514"
FT                   /db_xref="GOA:D2BGR4"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGR4"
FT                   /protein_id="ACZ61514.1"
FT                   /translation="MVAKVIVNPVAGAKSTEQKWPHISRLMRDMGFSYDFQYTESQGHA
FT                   IEIARNAALNGYPYLVAVGGDGTINEVVNGILTASHDQKTLMGVVDTGTGNDFVRSLGL
FT                   DGNYLHSCQHLLSPKHTLVDAGLVTFQKEGRQVSRFFVNGAGVGFDAEVAAATEHMPKA
FT                   LGGTIPFVMALAKTLLGYRNKTIDIGLDKYNYTRRVLSVIVANGSYFGGGMKIAPSALI
FT                   TDSRFDVITLGDVNKLEILQTFPKIYKGTHITHPKVKTEHARFVSITSEEGLYLQADGE
FT                   LLGKTPATFEVLPQALTMVF"
FT   gene            complement(345495..346007)
FT                   /gene="dut"
FT                   /locus_tag="DhcVS_358"
FT   CDS_pept        complement(345495..346007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="DhcVS_358"
FT                   /product="deoxyuridine 5-prime-triphosphate
FT                   nucleotidohydrolase, dUTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_358"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61515"
FT                   /db_xref="GOA:D2BGR5"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGR5"
FT                   /protein_id="ACZ61515.1"
FT                   /translation="MSALAKEEILRLIKSAKPLLENYPDLENQLQPNGFDLSLKQVRSL
FT                   EGEGVLPTDNARRKLPSNNPLKFDCNNQIKLMPGIYSVVYNEIVNIPKDVMALATPRSS
FT                   LLRSGCTVNTAVWDAGYSGRSESLLVVYNPAGLILERNTRLIQLVFFKLNAETGGYCGI
FT                   YQNENKG"
FT   gene            346158..346508
FT                   /gene="ndk"
FT                   /locus_tag="DhcVS_359"
FT   CDS_pept        346158..346508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="DhcVS_359"
FT                   /product="nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_359"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61516"
FT                   /db_xref="GOA:D2BGR6"
FT                   /db_xref="InterPro:IPR025306"
FT                   /db_xref="InterPro:IPR026363"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGR6"
FT                   /protein_id="ACZ61516.1"
FT                   /translation="MGICVQRLRWKQSNLYQGGAVMAQDKTLVCRDCGNEFIFTAGEQE
FT                   FYASRGLKNEPKRCPACRSARRSENRSEGGERRTYEVVCAACGVQTTVPFEPTEGRPVY
FT                   CKDCYAKTKESE"
FT   gene            complement(346593..347447)
FT                   /locus_tag="DhcVS_360"
FT   CDS_pept        complement(346593..347447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_360"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_360"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61517"
FT                   /db_xref="GOA:D2BGR7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGR7"
FT                   /protein_id="ACZ61517.1"
FT                   /translation="MEYDCPALPDTYAPIQPSDKLHRKENCIFKIMNKKHTSAEKPIIK
FT                   IENVQKHFGRVQALRGVSLDVNRGEVVVIIGPSGSGKSTLLRCINRLEEYDSGRITVDG
FT                   ITLDSTENINHVRREVGMVFQSFNLFAHLKVIDNITLAQCQVRKRTKEEAAEIAADLLK
FT                   KVGIPDKAHAFPVQLSGGQQQRVAIARALAMNPQIMLFDEPTSALDPEMIKEVLDVMTA
FT                   LAKEGMTMVVVSHEMGFARAAADRVIFMDEGLIVESASPDEFFTNPKHERTKLFLSKIL
FT                   HNS"
FT   gene            complement(347354..348175)
FT                   /locus_tag="DhcVS_361"
FT   CDS_pept        complement(347354..348175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_361"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_361"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61518"
FT                   /db_xref="GOA:D2BGR8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGR8"
FT                   /protein_id="ACZ61518.1"
FT                   /translation="MVEDKIKPPEKINLIPGAEPSSRMDPWWWLVAGVFALAGGLMLFK
FT                   PDPFLDIFKYVWVGIGITVLVAVVSYFLMLIFGLFGALGRLSKNTILRGLATFYVEIVR
FT                   GIPLLVQLIWWYFAFPVIIQSIGQGLNFGPMMNYQANPIVMAIWGMTFCYGAYMSEIYR
FT                   AGIQSIPKGQMEAARSLGMSHTQAMRFVILPQALRVVLPPMGNEFISLLKDTSLVSTVA
FT                   VADMVRLGREFTATNFNPIEVWSMIALLYLILTLLSSRLINYIEKKTAFSR"
FT   gene            complement(348229..349011)
FT                   /locus_tag="DhcVS_362"
FT   CDS_pept        complement(348229..349011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_362"
FT                   /product="amino acid ABC transporter, periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_362"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61519"
FT                   /db_xref="GOA:D2BGR9"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGR9"
FT                   /protein_id="ACZ61519.1"
FT                   /translation="MKRLSTILMSLLLSSALLFSGCQSSNDDTDNTDNSTTKIQVTVVT
FT                   DATWAPFEYVNEQTHAIEGFDIDLMKAIAEKANLEVTFQNVAWDALLAGMATGQYKVAI
FT                   SSITITAERAEKWLFSDPYFNAGQMVCVQKNNTTILSHNDLTGKKVAAQTGTTGFIEAQ
FT                   KIEGATVKSYDEIGLAFQDLMNGQIDAVICDTPVAIDYVNANPDKIKKVGTAFTDEYYG
FT                   ISVAKGQTEILARINQGLAAVIADGTFDQLVAKWNLNP"
FT   gene            complement(349212..350051)
FT                   /locus_tag="DhcVS_363"
FT   CDS_pept        complement(349212..350051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_363"
FT                   /product="DegV"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_363"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61520"
FT                   /db_xref="GOA:D2BGS0"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGS0"
FT                   /protein_id="ACZ61520.1"
FT                   /translation="MTIKIVTDSTADIPPQLAKSLGITIVPLYVRFGEKALKDGVEITQ
FT                   DQFFEKLQTESIHPNTSQPSPQDFIDVYQKLAPDCDGIVSIHISSKLSGTYDSAIQARK
FT                   LLGNDAPPIEVIDSRSVSMGLGLLGLLGAETASSGKNVKEVADTVRSAVEKVQMMGFFD
FT                   TLKYLALGGRIGKSKALLGSLLSVKPVLVVGQGELLPAGQVRSRSKGMEKLTEFTAGVK
FT                   NLAALSVVYTTTPDEAVAMADRLAEFFPRKQIVISRLGAALGVHAGPGTLFVATRSK"
FT   gene            complement(350438..350512)
FT                   /locus_tag="DhcVS_364"
FT   tRNA            complement(350438..350512)
FT                   /locus_tag="DhcVS_364"
FT                   /product="tRNA-Met"
FT   gene            350754..351704
FT                   /gene="corA1"
FT                   /locus_tag="DhcVS_365"
FT   CDS_pept        350754..351704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA1"
FT                   /locus_tag="DhcVS_365"
FT                   /product="magnesium and cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_365"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61521"
FT                   /db_xref="GOA:D2BGS1"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGS1"
FT                   /protein_id="ACZ61521.1"
FT                   /translation="MALTQVKNNTSNIESITFGNLTWINIENPQGVDTEYLAANYPFHP
FT                   LDLDDVLSRRQRPKIDEYKDYLFFVLHFPFYNKELRTTVPAQLSVFIGENYLITLHTGN
FT                   LKPLVKLYREMELEEDARPEYFSHGSGFLMYRIVDRLVDYCLPITVKLLDNLEEVEDTI
FT                   FTGSGSDLNIVKDIALLRRDIIATRRIIWPMRAVIGCLENKLRKFINQDMSVYFGDMTD
FT                   HMDKVWDTLDETKEVIEGLSSTFDSMSSHRTNRAMRILTIVATILLPFTMVASIFGMNI
FT                   PLPFQNSENAIYFVAVITAIIVSLMLYMFRRVRLI"
FT   gene            351726..352385
FT                   /locus_tag="DhcVS_366"
FT   CDS_pept        351726..352385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_366"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61522"
FT                   /db_xref="GOA:D2BGS2"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGS2"
FT                   /protein_id="ACZ61522.1"
FT                   /translation="MNVSSRLLIVSGLYITCLITANLIAVKIIALGDVFLPAAVIVFPF
FT                   SYIFGDVLTEVYGFHWARRIIWLGFICNLIFVVFVALGQVLPGAPFWEGQAAYETILGY
FT                   TPRILLASFMGYLVGEFINSFIMAKLKLRTKGRYLWLRTIGSTLAGQGLDTSIFILVAF
FT                   LGTPAFVPLMILYHWGSKVLIEAAATPLTYKLVNYLKKAENSDHFDTATNFSPFRL"
FT   gene            352406..353182
FT                   /locus_tag="DhcVS_367"
FT   CDS_pept        352406..353182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_367"
FT                   /product="metallo-beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_367"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61523"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGS3"
FT                   /protein_id="ACZ61523.1"
FT                   /translation="MEIVFLGAHNCETKTTRPSCLMLSGGVVLDAGAITSSLTLEELYN
FT                   LKAVILSHAHYDHIKDVPLLAMNLAYGLKSVDIYGSEAVQEVVTQPPFSGGFYPDFFTR
FT                   PPSAPALRFHEITPGLEFSCENYQILPLSVPHSRDTTGFLVKDAGGHSFFYTSDTGAGL
FT                   GDVWKQISPELLIIELTMPNKLTELALSSKHLSPALLETELRLLREIKGYLPRIVTIHT
FT                   TPLFEAEIKTEIQAVAERLHTDIDMASEGLKLRLGE"
FT   gene            353185..353688
FT                   /locus_tag="DhcVS_368"
FT   CDS_pept        353185..353688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_368"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61524"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGS4"
FT                   /protein_id="ACZ61524.1"
FT                   /translation="MFAASESPRFLVDQNVGKLAVYLRMLGFDARRFGSGPDKQLVSEA
FT                   LNEGRIILTRDHLLAERRLVKKGSLKVTLFKTEVAEDQLRQLLSDIVFSSFICPFSRCI
FT                   ECNYPLYPVMKDTLSERVPPYVYQNQTEFKECHHCGRIFWKGSHWQAMQELLRRVGVDN
FT                   NTSC"
FT   gene            353725..355263
FT                   /locus_tag="DhcVS_369"
FT   CDS_pept        353725..355263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_369"
FT                   /product="carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_369"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61525"
FT                   /db_xref="GOA:D2BGS5"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGS5"
FT                   /protein_id="ACZ61525.1"
FT                   /translation="MEITTSIRMRQIEDDCQKRGISTETLMENAGRAVAVFTRHLLEQK
FT                   NGSRVLILAGAGNNGGDGLVAGRYLQSWGEDVSIFKPFRDTQKNKTISDGLKLPENIFT
FT                   DLTKLEERLADADIVIDALLGTGASRPLEGIYKQALQMAAAVKSTRTEMQVLAVDLPSG
FT                   LNADTGQADAACLKADFTLSLGVAKQGLFTHCGLELSGVVSVVDIGIPPGLTSDIHTHL
FT                   IEKDWVRGILPVRSAHANKGSFGRVMIVAGSKRYIGAAMLAGSAAMRTGAGLVTLALPQ
FT                   SLTGTVSAKIPEAIYLLLPEVSCGIPDSSASRLILSELGKYDVLLIGPGLGQSAYSARL
FT                   VSEVLSNLPAGIKVVIDADALNILAAIPDWWLEYKFDAILTPHPGEMGRLTKTTAESVQ
FT                   SDRFGICRESARKWGKTIILKGAGTIISSPQGETLCNPAANPVLASAGTGDVLAGIISG
FT                   LLGQGLNLFEAAGLGVNLHSAAAEALRNEMGDAGVLASDLLLKLPVIIKELKQG"
FT   gene            355267..356058
FT                   /locus_tag="DhcVS_370"
FT   CDS_pept        355267..356058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_370"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_370"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61526"
FT                   /db_xref="GOA:D2BGS6"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGS6"
FT                   /protein_id="ACZ61526.1"
FT                   /translation="MNKQTAAERLVAVDIGNTSVNIGIFEGEKLLANWHLGSVAQRMAD
FT                   EYASLLLGLLQHSGIRPEELNRVIMCSVVPPLTTTFEEVFKTYFKAVPLVVGAGIKSGV
FT                   KIRMDNPREVGADRIVNAAAARVLYPGACIIVDMGTATTFDTLSESGEYIGGAIAPGIA
FT                   TSAQAIVERTSKLPKIEIIHPARAIGSNTVSAMQSGVYFGYIGLVEELVRRIQAELGQK
FT                   TRVIATGGYASLIAEGSRMFDIVRPDLTLQGLRLIYQMNQV"
FT   gene            356160..357341
FT                   /gene="coaBC"
FT                   /locus_tag="DhcVS_371"
FT   CDS_pept        356160..357341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="DhcVS_371"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate-cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_371"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61527"
FT                   /db_xref="GOA:D2BGS7"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGS7"
FT                   /protein_id="ACZ61527.1"
FT                   /translation="MKKKQTIVLGITGSISAYKAADITSKLVGEGYTVKAVMTEDACRF
FT                   ISPLTIRTLSHQPVVTSMWDMNSEYSVEHVSLAEEADIILVAPATANIIAKLACGMAND
FT                   MLSATILACKSPVIIAPAMNDNMYSNPVTQQNISKLKERGFVFVEPEYGRLASGKTGQG
FT                   RLASLDKVLGSVTQVLGKSGPLAGKKLVISAGGTREPVDPVRYLGNHSSGKMGYALAEE
FT                   AVRRGASVRLISGTVDKPAPFGVDIKYTETAMEMFISLREAVKGADALIMTAAVADYRP
FT                   EKPAADKIKKGDGGLDLHLVANPDILTALQGDFVKVGFAAESRDLMINAVKKMADKNLD
FT                   IIAANDISQPDSTFGSDTTQLTLFFKNGRIEEMPLMSKKEAAVRLLDELSALL"
FT   gene            357431..360073
FT                   /gene="valS"
FT                   /locus_tag="DhcVS_372"
FT   CDS_pept        357431..360073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="DhcVS_372"
FT                   /product="valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_372"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61528"
FT                   /db_xref="GOA:D2BGS8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGS8"
FT                   /protein_id="ACZ61528.1"
FT                   /translation="MAQCSDLPEMAKAYEAAEVEKKWYQYWMGKGYFKPNPDSDKKPFV
FT                   IIMPPPNVTGELHLGHALTATLEDIMIRWHRMLGEPALWLPGADHAGIAAQVVVERELA
FT                   KQGKTRQELGRELFLEKMWEWVNPCRERIRHQHMRLGASCDWDRETFTLDEGPVKAVRE
FT                   IFTNLYEKGLIYRGERIINWCPRCATAVSDLEVDHKDLAGHIWHLRYPLEDGSGFVTVA
FT                   TTRPETMLGDTAVAVHPDDARYTGMVGKNVLLPIMNRRIPIIADEAVDMAFGTGAVKVT
FT                   PAHDPNDFEMGLRHSLPMITIQNRDTTMNENAGPCSGMTAKACREYVVSEMKSLGLLLK
FT                   IEDYTHSVGHCQRCSAVIEPMVSKQWFVKMEPLAKPALEAVNSGRIQILPERFTKVYQN
FT                   WMENIRDWCISRQLWWGHRIPVWYCPCGEMIVSKEDPTACPKCGCTQLEQDPDVLDTWF
FT                   SSGLWPHSTLGWPDQTEDLKRFYPGSVLETAYDIIFFWVARMIVMGIEDMKEVPFRTVY
FT                   LHGLIRDDKGEKMSKTKGNVIDPLKVIDQYGTDALRFAVTFGTSPGNDSKLGQTKLEAA
FT                   RNFANKLWNASRFVIMNLGEGKELLPEAELPLEDRWILSRMNRVTADVTRLMEEFQFGE
FT                   AQRILQDFIWGEFCDWYIELAKVRLRDEASVSPRPVLVKVLSTILRLLHPYMPFITEEL
FT                   WSYLRPYLPKLLCETDIIVAPFPQADETCFDEQAESVMGSLVEIVRSLRNLRAEHNVEI
FT                   SRYIQANIYAGDMAEVLSNYLGAVETLSRSRPVNILPGHYSGASTATEVVLVLNGIEVV
FT                   VPMSTMVDLEAEAKRVKAEIAELETQIERLSARLQDAQFLAKAPQAVVDKERIKLEGYI
FT                   ERVSRLKAA"
FT   gene            complement(360070..361143)
FT                   /locus_tag="DhcVS_373"
FT   CDS_pept        complement(360070..361143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_373"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_373"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61529"
FT                   /db_xref="GOA:D2BGS9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGS9"
FT                   /protein_id="ACZ61529.1"
FT                   /translation="MTETRFKPPALCHRCLFENASDAIWFYDRKGHIVYANRASADLTG
FT                   YTRTELKQKNLKDLLTTASEYDQIMDMNARMAAGAEVKMPYEQKIRRHDGSVAVLRMAT
FT                   TLVKSADEVLGFQNIARDITEELRRQQSMKSFVQDVIRAQEAERKRISRELHDEVAPLL
FT                   LLLMQKIDNLGKQSERDIADCKPQLDALRSQSEEALESLRRIAQDLRPRILDDLGLIPA
FT                   LEWLTEKLAQDGQIHTESNIKGREVELTAEIQLLIFRIAQEAFNNIRKHSLATWVRLEL
FT                   EFKPKAILLTIQDNGKGFNLSEQTDNLAQNGKLGLAGMHERAQLIGGHIHILTHPGQGT
FT                   TVIAEVPTINPDANQAS"
FT   gene            complement(361124..361822)
FT                   /locus_tag="DhcVS_374"
FT   CDS_pept        complement(361124..361822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_374"
FT                   /product="DNA-binding response regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_374"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61530"
FT                   /db_xref="GOA:D2BGT0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGT0"
FT                   /protein_id="ACZ61530.1"
FT                   /translation="MAKTKVLIADDHAVLREGMSRLLSQEKDIEVVGEAGDGQEAVDMV
FT                   AQFKPDVVLMDIVMPRLTGVEATKLIKKNNPSTCILILTAYSDIRYILGLLEAGASGYL
FT                   LKSAKSDEIVGAIRAIKAGESVLDSIATRKLLERVVNVSKESDEDKVRGQLSPREVEIL
FT                   QLASKGLSNREIADKLTLSMRTVKAHLSNIFNKMRCSCRTEAIVKGFREGYVMLEDVPQ
FT                   GIEGYDRNTL"
FT   gene            complement(361925..362608)
FT                   /locus_tag="DhcVS_375"
FT   CDS_pept        complement(361925..362608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_375"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61531"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGT1"
FT                   /protein_id="ACZ61531.1"
FT                   /translation="MTEILNGQTPELVIARLRAAIEKGLTWYPAMLEAAAAWPLESEEY
FT                   AGRHYQYLIGGEALDLILLFERFSRELEDLIPAQERDNLLFKGIAPQELTSDELMAFLG
FT                   EVRYRQYLNYFYGITVEEALLVVTQSEVRKEHRSLGVRREGTVIDEAFVQLYERTHDEM
FT                   LDQFRREKRYSKTSTIKIHQLKEFTYWLFKYRLLHSEKARVASDTNKSLNYLKKYARRL
FT                   QQKSG"
FT   gene            complement(362633..365491)
FT                   /gene="secA"
FT                   /locus_tag="DhcVS_376"
FT   CDS_pept        complement(362633..365491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="DhcVS_376"
FT                   /product="preprotein translocase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_376"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61532"
FT                   /db_xref="GOA:D2BGT2"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGT2"
FT                   /protein_id="ACZ61532.1"
FT                   /translation="MFKFFSGFGDSNEKEIRALEPLVDKINQLESSFTTLSDEALKAKT
FT                   DEFKERLKDTFETTASAILKDIAGTTAELEEAQKTADNSKQSRLKAKLESLNKDLSVKE
FT                   NAALNAILPEAFAAVREASRRTIGLRHYDVQLIGGMVLHHGKIAEMRTGEGKTLVATLP
FT                   LYLNSLLGKGVHLVTVNDYLARRDAYWMGPVYHALGVSVSSIYPMQTPTEELPSRLFDP
FT                   SYTSETPNDPWAHFRPVSRQEAYKADITYGTSTEFGFDYLRDNLRPDLAQCVQREMNYA
FT                   IVDEIDNLLIDEARTPLIISAPDTEAGKLYDIFARLSPRLVAGKDYEINEKDRNAELTE
FT                   DGWANVEKLLSREGVMKGSSLYDPQNAPLIRHLRNALSAKEFYKKDHQYVVKENEVIII
FT                   DEFTGRMMLGRRYSEGLHQAIEAKEHVKIQQESKTYATVTIQNLFRMYRKLCGMTGTAA
FT                   TEAEEFSKIYKLEVVIIPTNKPAIREDYGDQIYKDQSAKFKAVVNEINEMRNLGRPVLV
FT                   GTVSIENSEMLSNMLKRQGIEHKVLNAKQHEKEAQVVAEAGKPGAVTVATNMAGRGVDI
FT                   LLGGKEPPKDDDKAYSQWQTHHQQVLEAGGLHVIGTERHESRRIDNQLRGRSGRQGDPG
FT                   SSRFYVALDDDIMRRFGSERIQGIMEWAGMDENTPIENGLVSRTLENAQKRVEGYHFDV
FT                   RKHLVEYDDVVNKHREVIYAERRKILLGADLKSNILDMIREEIMTQTTEHTQGYDSSEW
FT                   NLEGLVTHIGGIFALPAEINAEALAKLSQEEITELLTRTAEELYQKKEAEIGAGSMRLL
FT                   ERIIMLHTLDSLWVEHLTIMENLRREIGLQAFAQRDPLIAYKNEGHVRFQELLETIKHD
FT                   VVHNIYRVNIQIQHQTESATAKAASRPVQQQKPLPAAPAAAIPGVSAKAATQPAAPAAK
FT                   EVGRNDPCPCGSGKKYKKCCGK"
FT   gene            complement(365495..366469)
FT                   /gene="prs"
FT                   /locus_tag="DhcVS_377"
FT   CDS_pept        complement(365495..366469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="DhcVS_377"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_377"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61533"
FT                   /db_xref="GOA:D2BGT3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGT3"
FT                   /protein_id="ACZ61533.1"
FT                   /translation="MLVNGNLTEELKIFTGNANPDLAKAVADYLKVQMGKCEVFQFSNE
FT                   NIFVRIQESVRQKDVYVIQPTCSPVNQSIMELLIMMDALKRASSERITAVLPYYGYGRT
FT                   DKKDQPRVPITARLIADLLTTAGASRILTVDLHAPQIQGFFDMPVDELTAENLLANYFK
FT                   KKKIEDLVVVATDVGISKKARDFAAKLDAPLAIIEKRRMGNNDITRTINIIGDVEGKNA
FT                   LTFDDEIDTAGSLVGNVNILISKGVKEVYSCATHPVLSGPAIQRIAASPIKELVVTDSI
FT                   PLTPPKKIDKITILSIAPLIGEAIYRIHTGNSIGEMYDQMQME"
FT   gene            complement(366485..367732)
FT                   /gene="glyA"
FT                   /locus_tag="DhcVS_378"
FT   CDS_pept        complement(366485..367732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="DhcVS_378"
FT                   /product="serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_378"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61534"
FT                   /db_xref="GOA:D2BGT4"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGT4"
FT                   /protein_id="ACZ61534.1"
FT                   /translation="MSFLKTSDPAVYNAIMQETTRLKETIDLIASENYTSKAVLEAQGS
FT                   VFTNKYAEGYPGKRYYAGCEYADAIEELAIDRAKTLFHAEHANVQPHSGAQANMAAYFA
FT                   MVKPGDTIMGLTLSHGGHLTHGSKVNFTGKLYHVIEYGLNAETERIDYDNLEKLAMEHR
FT                   PRMIVTGASAYPRILDFERFRAICDKVDAKLMVDIAHIAGLVAAGLHPSPVPYADVVTS
FT                   TSHKTLRGPRGGFILCKEQYAKAIDQAVFPVMQGGPLMQVVAAKAVSFQEAMQPGFVTY
FT                   QKKTLENTQVMAEELRKLGLRLVSGGTDNHLVLVDLSPIGVNGYDAQLALRRAGIVINR
FT                   NTVPFAENQTANVPAGIRLGCPAATSRGFGPAEIRQTVSWIGKVLKNIGNEDVEKQVLA
FT                   EVIHLCRKFPVPGIDA"
FT   gene            367866..368486
FT                   /locus_tag="DhcVS_379"
FT   CDS_pept        367866..368486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_379"
FT                   /product="uracil DNA glycosylase superfamily, DNA
FT                   polymerase bacteriophage-type"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_379"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61535"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGT5"
FT                   /protein_id="ACZ61535.1"
FT                   /translation="MHDKEELLKGVYSEITRCVRCKLHTTRTRSVPGEGNADAKIMFIG
FT                   EAPGFNEDQQGRPFVGAAGKFLTELIHSIGLTREDVYITNVVKDRPPGNRDPLPDEISA
FT                   CRNFLDRQIEIIKPKIIVTLGRYSMARYFTGITISKIHGQPMRRDGIIYYPMYHPAAAL
FT                   HQGGLRKEIEQDMLRIPGLVAELEHAEALSVPKEPPARQLDLF"
FT   gene            368493..370148
FT                   /locus_tag="DhcVS_380"
FT   CDS_pept        368493..370148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_380"
FT                   /product="metallo-beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_380"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61536"
FT                   /db_xref="GOA:D2BGT6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGT6"
FT                   /protein_id="ACZ61536.1"
FT                   /translation="MAKPKLKIVPLGGLGEIGKNMMSVEYGEDIILIDCGLMFPEEEML
FT                   GIDLVIPDISYVLENREKVRGIVITHGHEDHIGALPYILPQINVPIYCTKLTQGLISVK
FT                   LKEAKLLHQTKINVIPSDGTFKLGKLKVDFYPVCHSLPDSVGLVIQTPIGAVVHSGDFK
FT                   LDYTPVDGKPTNLSRLAMLGSRGVLLLMSDSTHVELPGYTPSETVVGENIDRIIGAATG
FT                   RVLVTTFASLISRQQQVIDAAAKYGRKLFFAGRSMTEIHKMAAELGYLKVPEGLVCNID
FT                   QLQRVPPEKVVLMTTGSQGEPTSALVRIANRDFRHVHIMKGDTVIISASPIPGNESLVS
FT                   RTIDSLFRQGAKVFYDRIAKVHVHGHASQEELKLVLNLVKPKYFVPVHGEYRHLTMHAE
FT                   LARTMGVAPENTFIMEDGDILELNTKSGRITGKVPSGNVYVDGLSVGDVGGVVLRNRRM
FT                   LSQDGIVVAIVAINKQTGMLVGRPDIVSRGFVDPDESKAMLDASRDLIIKLLDHDGKDI
FT                   PEGAMYNDVKETLNKFYYEQTKRRPMVIPVMVKV"
FT   gene            370168..372612
FT                   /locus_tag="DhcVS_381"
FT   CDS_pept        370168..372612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_381"
FT                   /product="DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_381"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61537"
FT                   /db_xref="GOA:D2BGT7"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGT7"
FT                   /protein_id="ACZ61537.1"
FT                   /translation="MPKKEDPRDTLRNAKPRAKSAAKVAVRKSKKPAPVRSKAKKPAAK
FT                   KTFSNTPVRGGASWLWVMLIASAMAFVVWQWEGVMDFFANFGSGTAGLFGWGLLLILLG
FT                   IVIAIVALRFDQMSEWANRYRLNLWNKWLGGVVLILAAWGMLGMMDAGGDIGLSILGGN
FT                   ADINGFMRVLALIVLGIILIAPGAVWQGLSGLFKGIFSSPRRSSMPEVARLDRTVVSRP
FT                   VFGGDEDRIDMGEDARRPLPEKAAPKIELPSIKLPSFGKTESRVVEVKNPLAAKTAPQT
FT                   ELPNMPPEAAAKEPKPTDERTDADRKQIASEVWKKYGEAEGIAEVDGWKLPPIEMLDKT
FT                   TEIGFSEADNLQRARAIEEALASYGVEGKVIQINAGPTVTQFGVEPGWDRKFKEVKERD
FT                   KDGETVSRQVEVSKTRVKVDRIASLANDLALALAAPSLRIEAPVPGKSIVGIEVPNTSF
FT                   GVVSMRSVMETNTFQKILARSPLALALGKGAGGEAVSGDLTKMPHLLIAGATGSGKTVC
FT                   LNSIICCMLLNNTPSSVKFIMIDPKRVELTPFNGLPHLATPVIVDVEKALSALRWLAAE
FT                   MDRRYQTLAAAGSRNIEGYNKTRMGADRMAFIVLIIDELADLMMAGFDEVEHILCRLAQ
FT                   MARAVGIHLVVATQRPSVDVITGLIKANFPTRISFAVTSQVDSRTILDMVGAEKLLGRG
FT                   DMLYMPTEAAKPKRLQGCYVSDAESERLIYFWTNQKDISPSEALKVEEITAPPPAQKSK
FT                   SKDPLFDEAMALISEHNNIISASFLQRKMHIGYPRAARLADELREAIEGNDGKAEVPKD
FT                   EY"
FT   gene            complement(372653..372802)
FT                   /locus_tag="DhcVS_382"
FT   CDS_pept        complement(372653..372802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_382"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61538"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGT8"
FT                   /protein_id="ACZ61538.1"
FT                   /translation="MKEPSKNPLTRQERREEKLESRRRKMTQHGKGLARVYKDAVEKKT
FT                   KQKP"
FT   gene            complement(372786..374792)
FT                   /gene="uvrB"
FT                   /locus_tag="DhcVS_383"
FT   CDS_pept        complement(372786..374792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="DhcVS_383"
FT                   /product="excinuclease ABC, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_383"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61539"
FT                   /db_xref="GOA:D2BGT9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGT9"
FT                   /protein_id="ACZ61539.1"
FT                   /translation="MPDFKIVSDFALTGDQPQAVEKLSEGLAHGLTDQTLLGVTGSGKT
FT                   FTMANVIARVNRPTLIISHNKTLAAQLYSEMKEFLPENSVEYFVSYYDYYQPEAYVPQK
FT                   DMYIEKDADINEEIDKLRHAATRALFERRDVVIVASVSCIYGLGEPEEYRSFVLPLKKG
FT                   QSLRRDLLLRRLVDMQYERNDIDFSRGKFRLRGDTLEIQPAYEELALRVEFFGDEIERI
FT                   VSLDPVSGELLADIDEINIYPAKHFVTSAEKMAEAIKGIQAELEDRLKELEAEGKMLET
FT                   ARLKQRTNYDLEMMQQAGYCSGVENYSRHLAGRKAGSAPWTLLDYFPEDFLLIVDESHM
FT                   SLPQIRGMYAGDAARKKTLVDYGFRLPSAMDNRPLSFDEFKARVKQSIYVSATPGPYEK
FT                   EHSQQVVEQLVRPTGLLEPVITVKPTGGQIDDLLEEVKKRVDKKERVLITTLTKKMSEK
FT                   LADYLVEMGIKTHYLHSEVDTLERVEILRDLRLGVYDVIVGINLLREGLDLPEVSLVAI
FT                   LDADKEGYLRSEQALIQTMGRAARHVDGQVIMYADKITGSMQRAMDEISRRRKIQEDYN
FT                   RLHNITPQGIRKAIKDINERIRSVTAEVSGPEFRPAPTLREDIVRLIKELESQMKKAAK
FT                   NLEFERAALIRDRVVELRAALETDPVNKNERTK"
FT   gene            complement(374838..375422)
FT                   /gene="ruvA"
FT                   /locus_tag="DhcVS_384"
FT   CDS_pept        complement(374838..375422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="DhcVS_384"
FT                   /product="Holliday junction DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_384"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61540"
FT                   /db_xref="GOA:D2BGU0"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGU0"
FT                   /protein_id="ACZ61540.1"
FT                   /translation="MISSLSGILEASGKDWAVINVSGVGFRTYMPASSPALIGELGQRV
FT                   RVFTHLHVREDALNLFGFGTAEELSLFETLIDVSGIGPKLGLAMLSAMNAEALASAIIS
FT                   GNTELLSTIPGIGKKTASRIVLELKDKIAKSWEAGVLSQVTEANSDILATLTALGYSAG
FT                   EAAKAIASLEDITGLPLEERIKLALNYFNNK"
FT   gene            complement(375424..375921)
FT                   /gene="ruvC"
FT                   /locus_tag="DhcVS_385"
FT   CDS_pept        complement(375424..375921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="DhcVS_385"
FT                   /product="crossover junction endodeoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_385"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61541"
FT                   /db_xref="GOA:D2BGU1"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGU1"
FT                   /protein_id="ACZ61541.1"
FT                   /translation="MRILGIDPGTMVVGYGVIEAADDELSLIGFSSLTPPASAPIPQRL
FT                   AYIYKGLVEAIELYQPDEVAVESPFADKNIKSALAIGKAQAVALLAAANHSLSVTEYSP
FT                   ACIKSRVSGSGNASKEQIQEMVRLLLNLAEIPQPNDAADALAVAICHHSHRAFANITSQ
FT                   GD"
FT   gene            complement(375925..376680)
FT                   /locus_tag="DhcVS_386"
FT   CDS_pept        complement(375925..376680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_386"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61542"
FT                   /db_xref="GOA:D2BGU2"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGU2"
FT                   /protein_id="ACZ61542.1"
FT                   /translation="MSGHSKWATIKHAKGAADAKRGQLFTKLSREIIFAAKQGGPSPEG
FT                   NARLRLAIQKAKDNRMPSDNIERAIKKGSGELEGATVIEMILEGYGPGGVAVLVNGMSD
FT                   NRNRTVSDVRHMFSRSGGSLAESGAVSWIFEAKGVIGVETVGLDTDDLSLKAIDMGAED
FT                   VNIEEDYIEIYTAMPDMEKVRQQLEAQGVTVDSAEINMIPKNTVKLDEETSLQVLKLLD
FT                   KLEELDDVQTVSSNADFDPEVVEKYHSQA"
FT   gene            complement(376796..377155)
FT                   /gene="acpS"
FT                   /locus_tag="DhcVS_387"
FT   CDS_pept        complement(376796..377155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="DhcVS_387"
FT                   /product="holo-(acyl-carrier protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_387"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61543"
FT                   /db_xref="GOA:D2BGU3"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGU3"
FT                   /protein_id="ACZ61543.1"
FT                   /translation="MLYTGTDIIEIRRIKAAQARWEERFLNRIFTPAELSLCKYRLPSL
FT                   AARFAAKEAVIKALSLPKNQSYSEIETLNLPDGQPSVNLYGQALAKAGTLGIKQISVSL
FT                   SHCREYAIAMVVAQD"
FT   gene            complement(377197..377661)
FT                   /locus_tag="DhcVS_388"
FT   CDS_pept        complement(377197..377661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_388"
FT                   /product="HymA and NuoE type iron-sulfur cluster protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_388"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61544"
FT                   /db_xref="GOA:D2BGU4"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGU4"
FT                   /protein_id="ACZ61544.1"
FT                   /translation="MDKPVNKAYTPVLSLYEAKRENLIPILLAFQRKFSYLSRDMMQSV
FT                   AVYIGVPESSVYNIATFYSQFRLEPPGIHKVHVCRGTACHVMGAERLLRNIEKRLGIKA
FT                   GETTLDNEISLDTINCAGICGLAPTLEVDGKLYTRLDGSSLNRILGKKKK"
FT   gene            377898..379448
FT                   /locus_tag="DhcVS_389"
FT   CDS_pept        377898..379448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_389"
FT                   /product="acyl-CoA biotin-dependant carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_389"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61545"
FT                   /db_xref="GOA:D2BGU5"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGU5"
FT                   /protein_id="ACZ61545.1"
FT                   /translation="MAVQDQLDNLNRLKKQAEMGGGEAKIDAQHKRGKLTARERIELLF
FT                   DKGTFNELGAFAAHRCRDFGLEKQRNAGDAVVTGSGLVNGRLVFTYSQDFTVLGGSISE
FT                   VVGQKVAQVIDMAIRAGAPLIAINDSGGARIQEGVASLSGVGDILLRNTIASGVIPQIS
FT                   VVVGPSAGGAVYAPALTDFIFAVKGISQMYITGPDVIKAVTGEDISHEALGGAEIHAKK
FT                   SGVAHFLCENEKECFEQIRELMGFLPQSNRNKPPRGKNKDNEERKTRDLRDIIPDNPKR
FT                   AYDMKKVITEVADEKEFFEVHKHFAQNIIVGFVRMGGQPAGIVAQQPSHMAGVIDINAS
FT                   LKAARFIRFCDAFEIPLVSFVDVPGFMPGTDQEHSGIIKHGAKLIYAYAEATVPKITVI
FT                   TRKAYGGAYIVMSSKHLRGDINYAWPASEVAVMGAEGAVNIISRKAIAEAANPEETRQK
FT                   LLDEYREHFANPYQAAQLGYIDDVIDPADTRSKIIKALRSLENKVLANPPKKHGNIPL"
FT   gene            379471..380724
FT                   /locus_tag="DhcVS_390"
FT   CDS_pept        379471..380724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_390"
FT                   /product="aconitase/homoaconitase/3-isopropylmalate
FT                   dehydratase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_390"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61546"
FT                   /db_xref="GOA:D2BGU6"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGU6"
FT                   /protein_id="ACZ61546.1"
FT                   /translation="MGKTLAEKILSLKSGSDASAGDIVVSKVDLAFVQDTTGPLTVREF
FT                   WDNGFTKLANPSRTALFLDHAAPSPQRQLSTDHILLRKFAQDTGALIFDVGEGVCHQLV
FT                   AEKLARPGDVIVGADSHTVTAGGLGAFSTGMGSSDIAVAFALGKTWFRVPETIKVVVNG
FT                   RFKHGIYAKDLILHLIGLIGADGATYKALEFSGNVVNNMMIAERLTIANMAVEAGAKVG
FT                   LFPSDRQTLEYLRSVGREADYQPLAADENAVYERVIEIDATALEPTVSKPHTVDNTATA
FT                   RELKGTKLDQVFIGTCTGGRLDDLAVAAAIFKNRRHHPQTRLIVTPASQKVYLEAIRLG
FT                   YIEILVQAGANIMPPGCGACLGVHQGVLGDGEVCLSTANRNFKGRMGNPEGFIYLASAA
FT                   TAAASAIKGEISDPREVM"
FT   gene            380724..381227
FT                   /locus_tag="DhcVS_391"
FT   CDS_pept        380724..381227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_391"
FT                   /product="aconitase/homoaconitase C-terminal domain
FT                   protein, 3-isopropylmalate dehydratase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_391"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61547"
FT                   /db_xref="GOA:D2BGU7"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGU7"
FT                   /protein_id="ACZ61547.1"
FT                   /translation="MLKGKVFKFGDSISTDHIAPGRLVHLRSNLPELAKHVLEDADPTF
FT                   AQKVKPGDFVVAGNNFGLGSSREHAPLIIKMSGVSAVLAKSVARIFFRNAINLGLPVLI
FT                   CDTDKIAEGDELEVDLKGGKIYDRTNGAELTFGKIPPAMLKILDEGGVMPYIKKYGDFK
FT                   LNEV"
FT   gene            381242..382321
FT                   /locus_tag="DhcVS_392"
FT   CDS_pept        381242..382321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_392"
FT                   /product="isocitrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_392"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61548"
FT                   /db_xref="GOA:D2BGU8"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGU8"
FT                   /protein_id="ACZ61548.1"
FT                   /translation="MSHNVTLIPGDGIGPEISEATRRVLEATGVKFNWEIVNAGADVVA
FT                   EYGTPLPDMVLESIRKNKVAIKGPVTTPVGSGFRSVNVGMRKALNLYTCLRPCKTYPGV
FT                   PSRYDNVDIVIVRENMEDLYAGIEFEKGSSEALKLIEFIKDNKKVEIRADSGISIKPIS
FT                   VFGTERIFRWAFKYAKENNRKMVTAVHKANIMKYSDGLFLAIGRKVAEEYPEIEFEDRI
FT                   VDNMTMQLVKNPSQFDILVCPNLYGDILSDLCAGLVGGLGVAPGANIGDEYALFEPTHG
FT                   SAPKYKGMNKVNPMAMMLSGVLMLRYLKEEKAADKLENAIAAVIAEGKSVTYDMLSPDK
FT                   QAAAVGTSQVADAIIAKMK"
FT   gene            382398..383324
FT                   /gene="mdh"
FT                   /locus_tag="DhcVS_393"
FT   CDS_pept        382398..383324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="DhcVS_393"
FT                   /product="malate dehydrogenase, NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_393"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61549"
FT                   /db_xref="GOA:D2BGU9"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGU9"
FT                   /protein_id="ACZ61549.1"
FT                   /translation="MPKISVIGAGNVGATLAQRLIEKDFADVVMLDVVEGIPQGKALDI
FT                   SQSANVLGFSHTITGSNDYAETAGSEIVVITAGIARKPGMTREELLAINQKIMTDVVSN
FT                   CLKYSPEATLVVVSNPVDTMTYLAWKLSGLPRKRVVGLSGVLDGGRLATFVARELGVKP
FT                   SAVTPCVMGEHGGSMVVMPRFTLVNGKPLSELVSAEKADELAKRAVNGGAEIVAFLKTG
FT                   SAFYAPSASVATMVEAIFTGSGKVMNCAAVLDGEYGLKNIVLGVPVKLGKGGIQEIITL
FT                   PLDKMENASLLASAEVVKGQIAALSLK"
FT   gene            383344..383715
FT                   /locus_tag="DhcVS_394"
FT   CDS_pept        383344..383715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_394"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61550"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGV0"
FT                   /protein_id="ACZ61550.1"
FT                   /translation="MSNDKEFLDAFLKLKTELDDTVYKLEDVVINGNLEEKVAALKEAE
FT                   ETLLPALERFDTLPEPEADNVKNARDSYKKAMHFYQQACGHYVKLLTEQNREEGKEGAF
FT                   KMKQAGDLFVKASEYLEGK"
FT   gene            383716..384558
FT                   /gene="ttdB"
FT                   /gene_synonym="fumB"
FT                   /locus_tag="DhcVS_395"
FT   CDS_pept        383716..384558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttdB"
FT                   /gene_synonym="fumB"
FT                   /locus_tag="DhcVS_395"
FT                   /product="tartrate/fumarate hydratase family, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_395"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61551"
FT                   /db_xref="GOA:D2BGV1"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGV1"
FT                   /protein_id="ACZ61551.1"
FT                   /translation="MREIDSSQISAALSELIIQTSTELGEDILVALHKAYEAEESPAGR
FT                   DILLSLLENARIAGEKKIPLCQDTGTAIIFAEAGQDVHINGSLTDAINLGVRQGYEQAY
FT                   LRKSIVTQPFSERANTQDNTPAVIHTEIIPGDRLKLSFMAKGSGAENMSRLFMLKPGVG
FT                   REGVIEAVLETVENAGGSPCPPIIIGLGVGATAEKAMFMAKKALLRPLGVPNPEAEVAA
FT                   LEAEVLKRVNGLGIGPLGLGGRVTALGVMAEAAPTHIASLPVAVNLQCHSARHGEVVL"
FT   gene            384555..385121
FT                   /gene="ttdA"
FT                   /gene_synonym="fumA"
FT                   /locus_tag="DhcVS_396"
FT   CDS_pept        384555..385121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttdA"
FT                   /gene_synonym="fumA"
FT                   /locus_tag="DhcVS_396"
FT                   /product="tartrate/fumarate hydratase family, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_396"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61552"
FT                   /db_xref="GOA:D2BGV2"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGV2"
FT                   /protein_id="ACZ61552.1"
FT                   /translation="MISGIKLNSPFNPAELKKLQAGDRVLISGIIYAARDAAHKRLVEA
FT                   LNQGKPLPFDLKGQTVYYMGPSPAKPGEVIGSAGPTTSSRMDRYTPELLDAGLLAIIGK
FT                   GNRSAEVSRAIVSKKAVYFISIGGAGALLSQRIKESRMVAYPELGAEAILALKVEDFPA
FT                   IVAIDSQGNNAFTLGQSIYRTAKEA"
FT   gene            385123..385464
FT                   /locus_tag="DhcVS_397"
FT   CDS_pept        385123..385464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_397"
FT                   /product="HIT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_397"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61553"
FT                   /db_xref="GOA:D2BGV3"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGV3"
FT                   /protein_id="ACZ61553.1"
FT                   /translation="MSCIFCQIVKGEIPAQIVYKDEDLVTFKDINPQSPVHILIIPRRH
FT                   IANLTELDEADTELAGKMILLAGKLAREMDISESGYRLVINSGREGGQVVNHLHLHLLG
FT                   GRQLGGQLG"
FT   gene            complement(385461..385991)
FT                   /locus_tag="DhcVS_398"
FT   CDS_pept        complement(385461..385991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_398"
FT                   /product="MutT/nudix, ADP-ribose pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_398"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61554"
FT                   /db_xref="GOA:D2BGV4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGV4"
FT                   /protein_id="ACZ61554.1"
FT                   /translation="MVEKILSSQYIYCGNLIKVRKAAVELPSGKVAPRELVEHNPCVVV
FT                   IAEDADGKLLMVKQYRLAASQDMLELVAGSMDSGETPEESTRRELREEAGFKPNSVRRL
FT                   GGFYSSPGFLTEYLHVLVARDLEYAPLIAEDTEDIEVFRYTPAEVKSMIANGQITDSKT
FT                   LAGLMLYFSQSPV"
FT   gene            complement(386010..386492)
FT                   /locus_tag="DhcVS_399"
FT   CDS_pept        complement(386010..386492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_399"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_399"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61555"
FT                   /db_xref="GOA:D2BGV5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGV5"
FT                   /protein_id="ACZ61555.1"
FT                   /translation="MKVYMIDKATIKDATTIHKLVNNFADHGQMLARSLAEIYENLRDF
FT                   YVIRGDSGEVIACAALHISWADLAEVKSLAVSEERHRQGLGEMVVKACLEDAKALQIPT
FT                   VFCLTYKPAFFAKCGFHEVEKNALPHKIWGECYRCPKFPNCDETAMMLSLTEANPT"
FT   gene            complement(386470..387324)
FT                   /locus_tag="DhcVS_400"
FT   CDS_pept        complement(386470..387324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_400"
FT                   /product="inorganic polyphosphate/ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_400"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61556"
FT                   /db_xref="GOA:D2BGV6"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGV6"
FT                   /protein_id="ACZ61556.1"
FT                   /translation="MYKKIGIIYHPLNPAACDLAVKLAAKLDSLGIENWSDSAWQADKL
FT                   ATKIQNTQLILTTGGDGTILRTAHAVLPLEIPILSINLGKVGFMTELSPEDAISGLEKV
FT                   LAGNGWIDERSLLEAEYLPHNSTPSRQFFIMNDAVVARGQVARVICVSVDINSQPFTTY
FT                   KADGAIVSTATGSTGYSYAAGGPVLQPNSADIILTPILPHLGRGYSLVLPSDSTIDLKV
FT                   NTWHEATLSIDGFINMPVSSGDILRLRQSAKKIKFIRLRPDNYFYKELDTKLKGNNESV
FT                   YDR"
FT   gene            387295..387759
FT                   /locus_tag="DhcVS_401"
FT   CDS_pept        387295..387759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_401"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61557"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGV7"
FT                   /protein_id="ACZ61557.1"
FT                   /translation="MIYNTNLFVHNRKSLNKDKMSVTTRNAGVKRRKIYRRLEKNSSKR
FT                   PIQAMAAPQTIPYASCFTSRKLTPPRRSPPNITIIPKYCKRYDTWLRGGALGATRTGLG
FT                   LASSVVSDFLPSLPNLLTAQTTAIKPPIKSISIGPILIMLPQVQNQILSI"
FT   gene            complement(387812..388675)
FT                   /gene="tyrA"
FT                   /locus_tag="DhcVS_403"
FT   CDS_pept        complement(387812..388675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="DhcVS_403"
FT                   /product="prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_403"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61558"
FT                   /db_xref="GOA:D2BGV8"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGV8"
FT                   /protein_id="ACZ61558.1"
FT                   /translation="MKIGILGGSGKMGQWFGRFLSENGHQVWLWGRNPSKLTPVASRLG
FT                   SQVITQPDQLTEMDCLVISVPIDAFEDTLKEIAPFTKREQLVFDLCSVKERPVEMMHQY
FT                   LPHCRILGTHPVFGPGAKSLKGYNFILTPTTEAETALAEKVKTWLEKHESTVSLTSPEE
FT                   HDRLMSVVLGLAHFIAIVSADTLLGQNLPGIAGAGGTTFRLLDTLTKSVLTEDPNLYAS
FT                   LQVNMPKLPKLEADFIKRATQWAELVKNGNKAGFAHRMQTLKDNLARTEPGFEKAYQDM
FT                   YHLKQP"
FT   gene            complement(388672..389748)
FT                   /gene="pheA"
FT                   /locus_tag="DhcVS_404"
FT   CDS_pept        complement(388672..389748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="DhcVS_404"
FT                   /product="chorismate mutase / prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_404"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61559"
FT                   /db_xref="GOA:D2BGV9"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGV9"
FT                   /protein_id="ACZ61559.1"
FT                   /translation="MNLSDLRKQIDELDTELVKLMAKRLEVSDQIGKVKEETNSPVQDL
FT                   SRESEVLNRVQSLAQSLGLDPQDIESLYQEILFISKKQQRFTVAFQGAAGAYSEETALK
FT                   IFGPNTLTLPYEQLDATFEAVEKGMARFAVVPVENSLEGSISRTYDLLLDSNLMVAAEH
FT                   ELRVSHCLIANPETTLEGVKTIYSHPQALGQCQSFLKHLRAELIPAYDTAGSVKMIKEK
FT                   HLLNGAAIASERAAVIYNMKVLEREIEDNINNYTRFFVLAKQDSAPSGNDKTSVVFAVK
FT                   HEAGALYDFIKELASRKINMTKLESRPTRLKPWEYNFYLDIEGHRQDENIKQALAKAED
FT                   HVIFMKVLGSYPKMKKHI"
FT   gene            complement(389745..390839)
FT                   /gene="aroC"
FT                   /locus_tag="DhcVS_405"
FT   CDS_pept        complement(389745..390839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="DhcVS_405"
FT                   /product="chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_405"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61560"
FT                   /db_xref="GOA:D2BGW0"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGW0"
FT                   /protein_id="ACZ61560.1"
FT                   /translation="MSNSLGKLFQITSFGESHGDCVGVVIDGVPAGLAINVDEIQVEVD
FT                   KRKSRAKAHATPRREDDRIEIFSGIFNNFTTGAPICLVIWNRNIDSSEYERTRSKIRPG
FT                   HADFTGFVKYGGFNDFRGGGRFSGRITAGHVMAGAIARKLISTIGIEVIGYTAELGGIV
FT                   AKLPKTKDLRQNISESDVNCPDLAASKQMLALIQQAAEEGDSLGGAVECLGFNLPVGLG
FT                   EPVFDTLEGELAKAMFAIPAVKGVEFGAGFEASRLRGSKNNDPFSIQANHIRTTSNNCG
FT                   GVLGGISDGMPLQFRVAVKPTPSISLSQPTVNIDTMTNTSLEIRGRHDTCIVPRAVSVV
FT                   EAMTCIVLADLALRAGMIPRVIKQ"
FT   gene            complement(390832..392094)
FT                   /gene="aroA"
FT                   /locus_tag="DhcVS_406"
FT   CDS_pept        complement(390832..392094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="DhcVS_406"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_406"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61561"
FT                   /db_xref="GOA:D2BGW1"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGW1"
FT                   /protein_id="ACZ61561.1"
FT                   /translation="MKIHLAKSLPGGEIAVPSSKSYTIRGLVAAAQANGQSHIISPLVA
FT                   DDTLATRQVLSGLDIDINTKTEDGSWQITGNTFKKPEGNLFCRESAATLRFMSAVCARL
FT                   LFECHLLAGHSLMRRPMLPLIQALHQLGIEIETRGNTTVIKGGEITRSKVSLPGNISSQ
FT                   YVSALMLMAPACKNGLEIHLATPPASLPYLKMTKQTLESFGIKVFSSINWQEISIPPQP
FT                   YLPARYRVEGDWSSASSFLALGAIAAPVFVSNLDTDSFQADRIMIKYLTEMGAEAESGQ
FT                   NWVKVSPKPLSAINADLTHSIDLLPALAVAAACAKGQSILSGVRQARIKESNRIRAVSQ
FT                   GLVAMGINVTEEDDRLIIDGGYPKGTEIDSFGDHRIAMAFGVLGAVVGETHISDAECVS
FT                   KTYPGFWEQLESLGGKVIKDV"
FT   gene            complement(392075..392605)
FT                   /gene="aroK"
FT                   /locus_tag="DhcVS_407"
FT   CDS_pept        complement(392075..392605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="DhcVS_407"
FT                   /product="shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_407"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61562"
FT                   /db_xref="GOA:D2BGW2"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGW2"
FT                   /protein_id="ACZ61562.1"
FT                   /translation="MKTKNNIALIGFMGAGKTSVSKLLSEKLGKTLVSTDTCIETCEGL
FT                   SISSIFKEKGEEYFRQMESRVLEDVCRQPNQIIDCGGGIVTRPQNLSIMRLNCLVIYLE
FT                   SRPEDLEARLKNHTNRPLYNAERSDKMIKLLESRQPLYRDAADITVSTHNKLCHEVCEE
FT                   IENRLRKYENTSG"
FT   gene            complement(392589..393449)
FT                   /gene="aroE"
FT                   /locus_tag="DhcVS_408"
FT   CDS_pept        complement(392589..393449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="DhcVS_408"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_408"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61563"
FT                   /db_xref="GOA:D2BGW3"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGW3"
FT                   /protein_id="ACZ61563.1"
FT                   /translation="MKTIPDALFGIIGYPVSHSISPAMQNAAFKYCKLNYLYLTIAAKP
FT                   EDLQNVIASMRPLNIRGLNVTIPHKIEVIKYIDVLDPAAKKIGAVNTIVNENGVLKGYN
FT                   TDFGGFVRLLEHNRIAPAKHCFALLGAGGSAHAIALAICTLGGRLTVLARQEEKAKDLA
FT                   SKMCLRFNGKAQGLELNDTNLEEVLAETDIIVNCTPVGMGNLAGQSLVPARFLRPDLTV
FT                   IDAIYNPCKTRLLKEAENKGAKIINGLEMLVWQGAMSFEIWTSQKAPFRVMMKEAELAL
FT                   DENEK"
FT   gene            complement(393433..394101)
FT                   /gene="aroD"
FT                   /locus_tag="DhcVS_409"
FT   CDS_pept        complement(393433..394101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="DhcVS_409"
FT                   /product="3-dehydroquinate dehydratase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_409"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61564"
FT                   /db_xref="GOA:D2BGW4"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGW4"
FT                   /protein_id="ACZ61564.1"
FT                   /translation="MKTPPICCVITRLPETESLKKSEGAAFYELRLDLLGESWREAAAM
FT                   LDKPFMATCRRSAEGGSFSGSEEERIGLLEEASAAGAFMLDIEYSSPNLGEILKRLRPQ
FT                   AKCLLSHHNFTDTPSAAELKTLVKDMLTYPADIYKVITTAASINDNIKLLNLIKEMPGK
FT                   EIVAFAMGEPGILSRILCPLAGSPFTYASLNDGNKSASGQMTLAQMIEIYRSVNYENHT
FT                   "
FT   gene            complement(394098..395177)
FT                   /gene="aroB"
FT                   /locus_tag="DhcVS_410"
FT   CDS_pept        complement(394098..395177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="DhcVS_410"
FT                   /product="3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_410"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61565"
FT                   /db_xref="GOA:D2BGW5"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGW5"
FT                   /protein_id="ACZ61565.1"
FT                   /translation="MKSIGLNLSGREYKILIGSDLLAETASLLKDAVPCDRVIVITNID
FT                   INRLYGKKLKKHLEANGIESLFLELPEGEIHKSLDMAARIYPQLINHFAERNTPILALG
FT                   GGVIGDLSGFVAATYQRGVPLIHLPTSLLSQVDSSIGGKVAVNHNGIKNIIGSFYQPRL
FT                   VISDISCLKTLPEKEFACGMAEIIKSAAIGSSELFKQLETNTQAIKDRSPEIMEDIISQ
FT                   TAAIKAGIVCQDETDRGIRNILNFGHTLGHALESTSSFSQSHGAAVAIGMCFASRLSVK
FT                   LGLCENETVLRLEKLLTDFGLPTKPQDIDPEKIIDAMHHDKKVSDGRIRFILLKRPGEP
FT                   LIAENILRADVISILEEMK"
FT   gene            complement(395197..396252)
FT                   /locus_tag="DhcVS_411"
FT   CDS_pept        complement(395197..396252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_411"
FT                   /product="3-deoxy-D-arabino-heptulosonate 7-phosphate
FT                   (DAHP) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_411"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61566"
FT                   /db_xref="GOA:D2BGW6"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041071"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGW6"
FT                   /protein_id="ACZ61566.1"
FT                   /translation="MIIMKKDATPEELENVIAEVRRCGLKTDVSKGAFRTIIGLIGDEK
FT                   SIPFAYFSSLPGVKEARMVETPYKLISREYSNLWQAEGLTREIKVKNITIGGDEPVFIA
FT                   GPCAVESKEALMKIAEGAKMAGAQILRGGVYKPRSSVHSFQGLGSAGKDEATEALSWLK
FT                   EAGERFEMAVMTEIRGESQADLVAEFVDILQVGSRNMYDQDLLATVARKGKPVMYKRHF
FT                   GASMEEFLSFAEYIAAEGNKDIILCERGIVPVGKGKNFTRYNLDLAAVPVALKETYLPI
FT                   MVDPSHATGRRDLIYSMSCAAMAAGANGLMIEVHTNPAEALVDASQMITPPELKELITT
FT                   CRQINKLVKKH"
FT   gene            396489..396605
FT                   /locus_tag="DhcVS_412"
FT   CDS_pept        396489..396605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_412"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61567"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGW7"
FT                   /protein_id="ACZ61567.1"
FT                   /translation="MGSFSLMVVIGRAADKCPEADGGYPPALNQRVFSDGWS"
FT   gene            396774..397208
FT                   /gene="rpsL"
FT                   /locus_tag="DhcVS_413"
FT   CDS_pept        396774..397208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="DhcVS_413"
FT                   /product="ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_413"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61568"
FT                   /db_xref="GOA:D2BGW8"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGW8"
FT                   /protein_id="ACZ61568.1"
FT                   /translation="MPTVNQLVRKGRSSAAKKYKAPALHYSFNSLRNKVAFGDGSPQKR
FT                   GVCTQVKTTTPKKPNSALRKIARVRLSNHMEVTAYIPGEGHNLQEHSVVLIRGGRVPDL
FT                   PGVRYHIIRGTLDTAGVANRQQGRSRYGAKKGKAAPAKKK"
FT   gene            397222..397692
FT                   /gene="rpsG"
FT                   /locus_tag="DhcVS_414"
FT   CDS_pept        397222..397692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="DhcVS_414"
FT                   /product="ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_414"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61569"
FT                   /db_xref="GOA:D2BGW9"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGW9"
FT                   /protein_id="ACZ61569.1"
FT                   /translation="MPRRARKFKRAVAPDSRYNSLMLSNFINKLMMHGQKATAQRIVYD
FT                   AIDIMGKQENKEGLAVFEQGLKNATPFIEVKPRRVGGATYQVPIEVRPDRAQTMAMRWI
FT                   IKAARKRTGKSMAERLAAEMLEASREQGAAVKKREETHKMAEANRAFAHYRW"
FT   gene            397748..399829
FT                   /gene="fusA1"
FT                   /locus_tag="DhcVS_415"
FT   CDS_pept        397748..399829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA1"
FT                   /locus_tag="DhcVS_415"
FT                   /product="translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_415"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61570"
FT                   /db_xref="GOA:D2BGX0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGX0"
FT                   /protein_id="ACZ61570.1"
FT                   /translation="MSDRKYPLERVRNIGIIAHIDAGKTTTTERILYLTKRTHKIGNID
FT                   DGTTVMDWMEQEKARGITITSAATSAYWNGHHLNVIDTPGHVDFTVEVERSLRVLDGGV
FT                   VVFDGVAGVEAQSETVWRQASRYGVPRICFINKMDRTGANYERTLGMITQRLKAKCLPL
FT                   QIPIGCAETFRGNCDLLDFQCYGMDNSPEEPAETFDLPAADKERAVKYRNMMIERLAEE
FT                   DDEVMEAYLVGEELPIEKLKAAIRRVCLANKAIPIFCGTSLRNKGVKRLLDAVCDYLPS
FT                   PLDIPAIKGTAPKTGEPMERHTSDTEPFSALAFKIVSDPFVGRLVYFRIYSGNVSAGSG
FT                   VYNSTRGERERIGRLIRMHANDREEIEYADAGEIVASLGLRNTFTGDTLCDQNAPILLE
FT                   SIKFPEPVINLAIEPKTRSDQDKMTEGLQKLAEEDPTFKVKFDDETGQTVIYGMGELHL
FT                   DVLVSRLLSEFKVNAGVGKPRVAYREAITAHAKAQGKFVRQSGGRGQYGDVTIEVEPRE
FT                   RGAGYEFVDNVKGGAVPRNFLMAAEAGIRETLETGVYAGYPMVDVKVTAVDGSYHDVDS
FT                   NENAFKMAGSMAIKAAVAKAKPILLEPIMKLEAVTPEEYMGDVIGDLNSRRGQIMSVEP
FT                   NPETTVIIGTVPLAESFGYTTDLRSVTKGRATFSMEFESYREMPGELANQVVEAAGKK"
FT   gene            399854..400162
FT                   /gene="rpsJ"
FT                   /locus_tag="DhcVS_416"
FT   CDS_pept        399854..400162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="DhcVS_416"
FT                   /product="ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_416"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61571"
FT                   /db_xref="GOA:D2BGX1"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGX1"
FT                   /protein_id="ACZ61571.1"
FT                   /translation="MTKQKIRIKLKGFDHKILDQSALQIVEALERTGATISGPVPLPTR
FT                   IQRYSVIRSSFIDKDSQEQFEIRTHKRLIDIVETTSKTIDALTNLNLPAGVSIDIKL"
FT   gene            400171..400788
FT                   /gene="rplC"
FT                   /locus_tag="DhcVS_417"
FT   CDS_pept        400171..400788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="DhcVS_417"
FT                   /product="ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_417"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61572"
FT                   /db_xref="GOA:D2BGX2"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGX2"
FT                   /protein_id="ACZ61572.1"
FT                   /translation="MIQGIIGKKIGMTQIFQEDGKAQPVTLVEAGPCVVVQVKTEKQDG
FT                   YEAVQLGYGKAKHITSAVKGQCRGFGEFKVLREVDVDDIATVNVGDQITVSDFKDGEKI
FT                   DASGVSRGRGFAGVVKRWHFAGGPKTHGQSDRHRAPGSISSTTTPGRIYKGKRMAGHMG
FT                   NDAVTIRNLVVLKTDAEKNLLMVKGAIPGGKNTIILIKKTGK"
FT   gene            400791..401423
FT                   /gene="rplD"
FT                   /locus_tag="DhcVS_418"
FT   CDS_pept        400791..401423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="DhcVS_418"
FT                   /product="ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_418"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61573"
FT                   /db_xref="GOA:D2BGX3"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGX3"
FT                   /protein_id="ACZ61573.1"
FT                   /translation="MEIPVYNASGEIIKNISISEDVFGVPFNEALVHQAFVAQQANARQ
FT                   GTQSTKTRGEVQGSSRKIYRQKGTGNARMGTNRSPVRRHGGVAFGPRPRDFSKDLPKKM
FT                   RRQAIRCVLSFKLESGELKVIDQLSFEEPKTRDMAKILAALQVISPALIAVDNPDTNFI
FT                   KSARNIPSVKTTPANLLNISDMLKNKQLVMTEEAVRQVEELWGQRSG"
FT   gene            401436..401720
FT                   /gene="rplW"
FT                   /locus_tag="DhcVS_419"
FT   CDS_pept        401436..401720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="DhcVS_419"
FT                   /product="ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_419"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61574"
FT                   /db_xref="GOA:D2BGX4"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGX4"
FT                   /protein_id="ACZ61574.1"
FT                   /translation="MNLYEVLRRPLISEKNSVHAMQNKYAFEIAKGANKRMVKLAVEQA
FT                   FNVTVEDVNMLHIPGKQKRMGRNLVQTAGLRKAIITLKEGDKITLFEGV"
FT   gene            401746..402570
FT                   /gene="rplB"
FT                   /locus_tag="DhcVS_420"
FT   CDS_pept        401746..402570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="DhcVS_420"
FT                   /product="ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_420"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61575"
FT                   /db_xref="GOA:D2BGX5"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGX5"
FT                   /protein_id="ACZ61575.1"
FT                   /translation="MAIKIYRPTSPGRRHHSVASFEEITKSRPERALLVSVKNDSGRNN
FT                   QGRVTVRHRGGGSKTQIRVIDFKRNKLDVPGRVAAIEYDPNRTARIALVFYTDGEKRYI
FT                   LAPSDLKVGDVIMAGENAEPKSGNALPLSAIPTGTFIHNIELIKGRGGIMVRSAGAAAQ
FT                   LMAKEGDYALVRLPSGEMRKVRSDCSATVGQIGNIEHGTLEIGKAGRNRHMGWRPTVRG
FT                   SAMSPNNHPHGGGECRCPIGMTGPKTPWGKPALGYRTRKAKYSDKLIVKRRG"
FT   gene            402577..402858
FT                   /gene="rpsS"
FT                   /locus_tag="DhcVS_421"
FT   CDS_pept        402577..402858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="DhcVS_421"
FT                   /product="ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_421"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61576"
FT                   /db_xref="GOA:D2BGX6"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGX6"
FT                   /protein_id="ACZ61576.1"
FT                   /translation="MSRSVKKGPALCPKLMKKVEVASATNQKSIIKTWARWSTITPLMV
FT                   GLNVGVHDGRRHVPIYITENMVGHKLGEFTTTRNFRGHAKAEKVSQVK"
FT   gene            402889..403218
FT                   /gene="rplV"
FT                   /locus_tag="DhcVS_422"
FT   CDS_pept        402889..403218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="DhcVS_422"
FT                   /product="ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_422"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61577"
FT                   /db_xref="GOA:D2BGX7"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGX7"
FT                   /protein_id="ACZ61577.1"
FT                   /translation="MEVKAIVKDTGYSALKVRLCVDMVRGKKVSEAITMLRFMTSPTAK
FT                   VVSKVIKSAAANAENNFQMNPADLKISQIYADEARMLKRMRPQARGRVSPILKRSSHIT
FT                   VVVAD"
FT   gene            403227..404063
FT                   /gene="rpsC"
FT                   /locus_tag="DhcVS_423"
FT   CDS_pept        403227..404063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="DhcVS_423"
FT                   /product="ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_423"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61578"
FT                   /db_xref="GOA:D2BGX8"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGX8"
FT                   /protein_id="ACZ61578.1"
FT                   /translation="MGRKVHPIGFRLGIIKDWSAKWHASDKGFAECLTEDLKLRKAIAK
FT                   KYVDAAISQVDIERQSNKVTVSVRTARPGIVIGRGGQRVDEMRHFLEELIGKKVQLNIV
FT                   EISQAELDAFLVARSVAEQIERRVAYRRAMKQAIFRSMQAGAKGIKVCASGRLGGVEIA
FT                   RREVMHEGRVPLHTLRADIDYGCTRAHTALGDIGIKVWVYRGDILPEAKEKSESEVTEM
FT                   AAVMADAPAAAVSETKVADTVAKPKRVAKKAEAEAPAEEKPKRAAKKAENITKEEE"
FT   gene            404164..404514
FT                   /gene="rplP"
FT                   /locus_tag="DhcVS_424"
FT   CDS_pept        404164..404514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="DhcVS_424"
FT                   /product="ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_424"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61579"
FT                   /db_xref="GOA:D2BGX9"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGX9"
FT                   /protein_id="ACZ61579.1"
FT                   /translation="MQSLEAGWITARQIEATRRAITRYIRRGGQVWIRIFPDKPITKKP
FT                   AETRQGGGKGAPEEWVAVVRRGRIMFEIGGVTPEAAKEAMRLASYKMPVKTRFVARDIP
FT                   VVAEETEVEEAE"
FT   gene            404516..404713
FT                   /gene="rpmC"
FT                   /locus_tag="DhcVS_425"
FT   CDS_pept        404516..404713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="DhcVS_425"
FT                   /product="ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_425"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61580"
FT                   /db_xref="GOA:D2BGY0"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGY0"
FT                   /protein_id="ACZ61580.1"
FT                   /translation="MNISDIRGLSDTEIKKKLEDAHKELFELRLKLSTRQLVNHRELPR
FT                   VKNDIARILTVMRERELQIR"
FT   gene            404721..404990
FT                   /gene="rpsQ"
FT                   /locus_tag="DhcVS_426"
FT   CDS_pept        404721..404990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="DhcVS_426"
FT                   /product="ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_426"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61581"
FT                   /db_xref="GOA:D2BGY1"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGY1"
FT                   /protein_id="ACZ61581.1"
FT                   /translation="MEKNKTRIGHVISDKMEKTIVVGIDVAKRHPLYKKTYRRTMKYLV
FT                   HDEKNEAKIGDMIEIVECRPISKGKYWRLSKIITKGHIVAAQEA"
FT   gene            405006..405374
FT                   /gene="rplN"
FT                   /locus_tag="DhcVS_427"
FT   CDS_pept        405006..405374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="DhcVS_427"
FT                   /product="ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_427"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61582"
FT                   /db_xref="GOA:D2BGY2"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGY2"
FT                   /protein_id="ACZ61582.1"
FT                   /translation="MVQQYTRLNVADNTGAKKIMCINVLGGSRKIQAKVGDVIVAAVKK
FT                   SSPDAQAKSGTVVKAVVVRITKPYARPDGSYIKFDDNAAVILNDKMEPKGTRIFGPVAR
FT                   ELRDKKFTKILSLAPEVL"
FT   gene            405385..405696
FT                   /gene="rplX"
FT                   /locus_tag="DhcVS_428"
FT   CDS_pept        405385..405696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="DhcVS_428"
FT                   /product="ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_428"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61583"
FT                   /db_xref="GOA:D2BGY3"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGY3"
FT                   /protein_id="ACZ61583.1"
FT                   /translation="MRLKKNDNVLVIAGKDKGKTGKVRYAYPRTDRVLVEGVNMIKRHS
FT                   RAKGQAKQAGIIEREAPLHVSNLMLLCSKCNKPARIGSRELADGKSVRYCKSCNEVID"
FT   gene            405696..406235
FT                   /gene="rplE"
FT                   /locus_tag="DhcVS_429"
FT   CDS_pept        405696..406235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="DhcVS_429"
FT                   /product="ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_429"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61584"
FT                   /db_xref="GOA:D2BGY4"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGY4"
FT                   /protein_id="ACZ61584.1"
FT                   /translation="MLKVEERYTNAVPELQKIFKYENIMQVPKLVKVVINTGVGEAVSN
FT                   SKALETAEADIVAIAGQHPVITRAKRSVANFKLRAGMPIGLKVTLRGQRMYDFLNKLFF
FT                   ITLPRVRDFQGVSNTAFDEHGNYTLGFKDHSVFPEIDFNKIEKPRGLEVCIVTTANTPE
FT                   EGKKLLELLGMPFSKD"
FT   gene            406463..406858
FT                   /gene="rpsH"
FT                   /locus_tag="DhcVS_430"
FT   CDS_pept        406463..406858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="DhcVS_430"
FT                   /product="ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_430"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61585"
FT                   /db_xref="GOA:D2BGY5"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGY5"
FT                   /protein_id="ACZ61585.1"
FT                   /translation="MISDPIADMLTRIRNGVMARHEVVIMPASRMKQYLAKVMKQEGFI
FT                   AGYEVIGAKPKRQLKIVLRYDEGGASFVSGLERISKPGLRVYVQRGEIPRVYGGLGIAI
FT                   VSTSKGVMTGSQAWRQGLGGELLCKVW"
FT   gene            406874..407422
FT                   /gene="rplF"
FT                   /locus_tag="DhcVS_431"
FT   CDS_pept        406874..407422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="DhcVS_431"
FT                   /product="ribosomal protein L6P/L9E"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_431"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61586"
FT                   /db_xref="GOA:D2BGY6"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGY6"
FT                   /protein_id="ACZ61586.1"
FT                   /translation="MSRIGKMPIKVPPGVTVDIKGNDVTVKGPKGTLSRTFRPEVTITR
FT                   EGDHLVVAPVGTDKTARSFFGLSRTLLDNMIVGVKDGFDKNLEITGVGMRVDKDGNNIV
FT                   LKVGYSHTVTVAPPAGITLSVDGTTKVKVSGINKEEVGQMAAEIRSVRKPDHYMGKGIR
FT                   YAGEYVRIKPGKAIGKGAK"
FT   gene            407422..407787
FT                   /gene="rplR"
FT                   /locus_tag="DhcVS_432"
FT   CDS_pept        407422..407787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="DhcVS_432"
FT                   /product="ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_432"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61587"
FT                   /db_xref="GOA:D2BGY7"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGY7"
FT                   /protein_id="ACZ61587.1"
FT                   /translation="MAKVNAREARIVRHERLRKKVSGTESRPRLCVFRSIENIYTQVIN
FT                   DNCGSTLVQASTKDAELKAELDGKTKTEQAVVIGNLIAKRSLEAGISEVVFDRGGYKYH
FT                   GRVKALAEAARSGGLKF"
FT   gene            407804..408322
FT                   /gene="rpsE"
FT                   /locus_tag="DhcVS_433"
FT   CDS_pept        407804..408322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="DhcVS_433"
FT                   /product="ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_433"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61588"
FT                   /db_xref="GOA:D2BGY8"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGY8"
FT                   /protein_id="ACZ61588.1"
FT                   /translation="MLAKVERIDPSELELNDKLIFINRVTKVVKGGKRMGFAALVVTGD
FT                   GKNHVGIGVGKAKEVPSAISKASANAKRNLSRILLNGTTVPHEIVFKYGAAQVLLKPAA
FT                   PGTGIIAGGSVRAVLESTGIKDILTKSMGCGNKANVAKATLGGLTAMRDPKTTVTKRRS
FT                   SLKEEAAGG"
FT   gene            408315..408497
FT                   /gene="rpmD"
FT                   /locus_tag="DhcVS_434"
FT   CDS_pept        408315..408497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="DhcVS_434"
FT                   /product="ribosomal protein L30/L7E"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_434"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61589"
FT                   /db_xref="GOA:D2BGY9"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGY9"
FT                   /protein_id="ACZ61589.1"
FT                   /translation="MAKIKITWVKSTIGYKFDQAATIKALGLKKLNQSVIQDDSAAIRG
FT                   MILKVRHLVVLEEVT"
FT   gene            408498..408959
FT                   /gene="rplO"
FT                   /locus_tag="DhcVS_435"
FT   CDS_pept        408498..408959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="DhcVS_435"
FT                   /product="ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_435"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61590"
FT                   /db_xref="GOA:D2BGZ0"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGZ0"
FT                   /protein_id="ACZ61590.1"
FT                   /translation="MRLNELSPAPGSRKDRKRVGRGDAGRGNYSGRGMKGQKARSGGAT
FT                   RPGFEGGQLPIYLRLPRKRGFFNPFRIKYTVVNIEQLNIFEAGTEVTPETMLAAGLIRN
FT                   FIKPVKILSAGHIDRALEVSAHKFSQAAKAQIEAAGGKVQEIDYAAEIE"
FT   gene            408940..410256
FT                   /gene="secY"
FT                   /locus_tag="DhcVS_436"
FT   CDS_pept        408940..410256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="DhcVS_436"
FT                   /product="preprotein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_436"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61591"
FT                   /db_xref="GOA:D2BGZ1"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGZ1"
FT                   /protein_id="ACZ61591.1"
FT                   /translation="MRQKSSRPRLLQAMIDAFSLPDLRRRLLITLGILVAARFIAHVPL
FT                   PGVDSAALQDLFDQNGALGMLDLFSGGAMRYFSVAALGVYPYITASIIMTLLTPVIPKL
FT                   TALSKEGEAGRNKINTITHWLAVPTAALAGYSQLLLLQREGAVAQTEPLAAVAIVLSIV
FT                   AGTMFMVWLGEQITSYGIGNGISLIIFAGIVAGLPDMIGRGLMASDQFAGLAVYAFMAL
FT                   LTTVLIVIFTEAHRRIPVQYAQTVIRSGKMYRRGGESHIPLRVNSAGMIPLIFASALVM
FT                   LPGLVASYFMAGSTEDPNFWNTIYNIFNSGASMPGGLVYWGLYFFMTIIFAFFYTMVTF
FT                   EQQDIPGTLQRQGGFVPGIRPGKMTDQYLSGVIGRITWAGALFLGFVAIMPFIAREVTG
FT                   IQVIQLSSFGMLIVVGVALDTMKQLEAQLVMRRYEGFIK"
FT   gene            410266..410916
FT                   /gene="adk"
FT                   /locus_tag="DhcVS_437"
FT   CDS_pept        410266..410916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="DhcVS_437"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_437"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61592"
FT                   /db_xref="GOA:D2BGZ2"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGZ2"
FT                   /protein_id="ACZ61592.1"
FT                   /translation="MYNVIFLGAPGSGKGTQGEVVAKELKLAHMATGDLFRKAIERGDE
FT                   LGDTVKSYMERGELVPDEITISVVLKHLAGLKDVSGIILDGFPRSLRQAEALDEALVKQ
FT                   GEGIGRVIYINVPEDELVRRLSGRWVCRSCQSPYQCGCAEVAEGKCSRCQGELYQRPDD
FT                   TPETVKERLKVYFSKTAPLIEYYRSKGKLSEIDGMAEITEVTKRIISAIKCGK"
FT   gene            410924..411679
FT                   /gene="map"
FT                   /locus_tag="DhcVS_438"
FT   CDS_pept        410924..411679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="DhcVS_438"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_438"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61593"
FT                   /db_xref="GOA:D2BGZ3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGZ3"
FT                   /protein_id="ACZ61593.1"
FT                   /translation="MTIILKTEKEIAIMRRAGHILAAALEEVKKNVRPGVTTRELDEIA
FT                   ERELRRRGTTPSFKGYQGFPASLCASVNDEIVHGIPGGRVLKEGDIISLDIGNILEGFQ
FT                   ADMAVTVGVGEISPAATRLLSATQASLVAGIAQARAGGHLGDIGAVVEEYAQGRGYGVV
FT                   REYTGHGIGRDMHEDPQIPNFGRRGKGPELKKGMTLAIEPMLNIGTEKTKVASDCWTVY
FT                   TADGSLSAHFEHTVAITDGEPEILTVIEE"
FT   gene            411689..411910
FT                   /gene="infA"
FT                   /locus_tag="DhcVS_440"
FT   CDS_pept        411689..411910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="DhcVS_440"
FT                   /product="translation initiation factor 1 (IF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_440"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61594"
FT                   /db_xref="GOA:D2BGZ4"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGZ4"
FT                   /protein_id="ACZ61594.1"
FT                   /translation="MPKKDAIEVEATVLEALPSAAFRVQLSNGHEVLAHISGKMRVHYI
FT                   RILPGDRVLVELSPYDLTRGRVTYRFKS"
FT   gene            412062..412451
FT                   /gene="rpsM"
FT                   /locus_tag="DhcVS_441"
FT   CDS_pept        412062..412451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="DhcVS_441"
FT                   /product="ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_441"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61595"
FT                   /db_xref="GOA:D2BGZ5"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGZ5"
FT                   /protein_id="ACZ61595.1"
FT                   /translation="MVRIAGTDIPDNKQVYFSLQYIFGIGPARSEKVLAQAGVDKAIRV
FT                   NKLTDEEINRLREIIDKEYRVEGDLRKEITLNIKRLIDIGCYRGIRHKHNLPVRGQRTK
FT                   TNARTRRGPRKTVAGRGQKRGATKK"
FT   gene            412477..412869
FT                   /gene="rpsK"
FT                   /locus_tag="DhcVS_442"
FT   CDS_pept        412477..412869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="DhcVS_442"
FT                   /product="ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_442"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61596"
FT                   /db_xref="GOA:D2BGZ6"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGZ6"
FT                   /protein_id="ACZ61596.1"
FT                   /translation="MAVKKRAGAKKKEKKVIPVGKAFVQATFNNTIVTLTDLQGNVIAW
FT                   ASCGTAGFKGSRKGTPYAAQMAAQAAARKAAESGLRQVEVLVKGPGSGREAAIRSLQAS
FT                   GINVTAIRDVTPIPHNGCRPPKRRRV"
FT   gene            412879..413502
FT                   /gene="rpsD"
FT                   /locus_tag="DhcVS_443"
FT   CDS_pept        412879..413502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="DhcVS_443"
FT                   /product="ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_443"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61597"
FT                   /db_xref="GOA:D2BGZ7"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGZ7"
FT                   /protein_id="ACZ61597.1"
FT                   /translation="MSRETGAVCRMCRRSGDKLFLKGDKCVTKCVFEKRPKAPGPQLGR
FT                   PRRLSDRGQQLRQKQSIRWSYGMTERQFRRFFGLANAQPGVTGDNMMILLERRLDNVLF
FT                   RLGFGTSRAQARQIVMHGHILVNGQKTDIPSYLIKEGQVITVRETSKATAYFKTLAENI
FT                   EAKAIPGWLSLDRKTLSGKVISLPAAGDIDARFDAQTVVEYYSR"
FT   gene            413523..414515
FT                   /gene="rpoA"
FT                   /locus_tag="DhcVS_444"
FT   CDS_pept        413523..414515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="DhcVS_444"
FT                   /product="DNA-directed RNA polymerase alpha subunit/40 kD
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_444"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61598"
FT                   /db_xref="GOA:D2BGZ8"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGZ8"
FT                   /protein_id="ACZ61598.1"
FT                   /translation="MSDLAIPTISCTESDGKYGCFVVEPLEKGFGTTMGNSLRRILLSY
FT                   LDGVAITRVRIDGIQHEFSALPKAKEDTLDFLLNLKNIRVESLSGLEGILYLRASGSKV
FT                   VTAADIEPSNDFAVVNPELYLLTLDSDDAVLNVELEVELGRGYRPPESTENTPIGTIPV
FT                   DAIFTPIRKVNFTTEPMHVGRETSLERLVLEVWTDGTVEPATAVSRSADILVKQFAALV
FT                   SHSKVVAEVEASEPVKYAIPEEKYNMPIEQLDLSVRAVNCLRHAGITTVGEVINRGTKE
FT                   LLTLRNFGLKSLTELEDRLKTIGLSLNPEDELFEDAENTKKKNKGIDEA"
FT   gene            414546..414899
FT                   /gene="rplQ"
FT                   /locus_tag="DhcVS_445"
FT   CDS_pept        414546..414899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="DhcVS_445"
FT                   /product="ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_445"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61599"
FT                   /db_xref="GOA:D2BGZ9"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D2BGZ9"
FT                   /protein_id="ACZ61599.1"
FT                   /translation="MRHNVSGRKFDRPTGQRMALYRNLVTDLLNYEEITISEPRAKEIR
FT                   SMAEKMITLGKKGTLASRRRALAFVYIPGIVDKVFEDLSKRYAERPGGYTRITKLGPRQ
FT                   GDGAEMVKLELIK"
FT   gene            414935..415675
FT                   /gene="truA"
FT                   /locus_tag="DhcVS_446"
FT   CDS_pept        414935..415675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="DhcVS_446"
FT                   /product="pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_446"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61600"
FT                   /db_xref="GOA:D2BH00"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH00"
FT                   /protein_id="ACZ61600.1"
FT                   /translation="MVIEYEGTMYSGFQIQDKGATIQGELETAIQKLTNEKTRVSGSGR
FT                   TDAGVHAAYQVVSYLSESSLGLEKIKGGLNYYLPTDIAVKEVYFVAENFDVRRRAISRE
FT                   YSYHILNSKTRSPLARLQAWQVPYKLDTKLMEQAFKMLEGEHDFVAFASSLGPEIKKTV
FT                   RRVNWTRLDIAEDRLVFRIEANSFLTHQVRNTIGTLVELGRGILSMREFGALFEAKTPG
FT                   LAGPAAPACGLSLVRVNYREPFGS"
FT   gene            415677..416108
FT                   /gene="rplM"
FT                   /locus_tag="DhcVS_447"
FT   CDS_pept        415677..416108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="DhcVS_447"
FT                   /product="ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_447"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61601"
FT                   /db_xref="GOA:D2BH01"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH01"
FT                   /protein_id="ACZ61601.1"
FT                   /translation="MNTYTVKASDIKRDWHVIDASGRVLGEVAAEAAKYLMGKHKPMFC
FT                   RNLDCGDYVVIVNAKKVTVTGNKLDQKIYYRHSGFPGGFRQEKLGDLLKTKPLFVIEHA
FT                   VKGMIPRNTLGAQILAKLKVYEGAEHPHASQTGEVSKES"
FT   gene            416121..416519
FT                   /gene="rpsI"
FT                   /locus_tag="DhcVS_448"
FT   CDS_pept        416121..416519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="DhcVS_448"
FT                   /product="ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_448"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61602"
FT                   /db_xref="GOA:D2BH02"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH02"
FT                   /protein_id="ACZ61602.1"
FT                   /translation="MVEKNTYFIGVGRRKTAVATVKLTSGNGVIVIDGKPIEERFTRIQ
FT                   ERNVILNPMMVTDTMGKFNAVVKVLGGGVTGQSGAIAHGIARALEKTDDKLRATLKSNG
FT                   LLTRDDRTKERKKPGLKRARKAPQYTKR"
FT   gene            complement(416593..416787)
FT                   /locus_tag="DhcVS_449"
FT   CDS_pept        complement(416593..416787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_449"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61603"
FT                   /db_xref="GOA:D2BH03"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH03"
FT                   /protein_id="ACZ61603.1"
FT                   /translation="MKTSLFYLGFGIIMIGIGIFTYLQPTDIDSLSFSQTVLGILSVAM
FT                   GLLTAIIGIVRYFRDERGN"
FT   gene            complement(417078..418145)
FT                   /gene="pgi"
FT                   /locus_tag="DhcVS_450"
FT   CDS_pept        complement(417078..418145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="DhcVS_450"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_450"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61604"
FT                   /db_xref="GOA:D2BH04"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR011857"
FT                   /db_xref="InterPro:IPR019490"
FT                   /db_xref="InterPro:IPR035484"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH04"
FT                   /protein_id="ACZ61604.1"
FT                   /translation="MDIINLDDPNIYEKLDPHHMLDELKRMPSLCKQAWETAEALNLPE
FT                   DYRTVKQVVILGMGTSGVGAQLAERMLRDECKIPIYLHQDYLLPAYVSADTLVIASSSS
FT                   GSTEEVVSCFHQAVNRHAKLLVLTTGGQLKEMTATHNIPGLIYDYTYRPSTAIAYGVLP
FT                   VLSILHKLGFIPNKSTEVSESLIVLSQIAERLSEKYQTLNNPAKQLAAKLEGRAVMAFG
FT                   SGITSPAARRFKTQLNENAKCFSFAEEIPEMNHNSVVGYQLPQSSARYWAAVMFKTTYL
FT                   SKRIHQRMRITTDMLHQAKIPVFSIDGYGFSPLCQVLSLILQGDFVSLYLAFLTGVDPY
FT                   PIDAVDYFKRKLAES"
FT   gene            complement(418170..419399)
FT                   /gene="manB1"
FT                   /locus_tag="DhcVS_451"
FT   CDS_pept        complement(418170..419399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manB1"
FT                   /locus_tag="DhcVS_451"
FT                   /product="phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_451"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61605"
FT                   /db_xref="GOA:D2BH05"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH05"
FT                   /protein_id="ACZ61605.1"
FT                   /translation="MAANGIKTYFSSRPTPTPVISHGVVNLKTAGAVIITASHNPAIWN
FT                   GFKVKSADGASAPIHMINAIEAEIAKLENSPSVSRLDFDTAVSRGLIELTDLTPAYFEQ
FT                   INTLVDTEKLREAGFNIAIDSMYGAGIGYFKQLLEGGCNRLNEINAEPNPNFPDMLQPE
FT                   PIAPNLSKLMRLVKDIRSDVGLATDGDSDRLGVVDEMGNFLNQLQVFSLLALYMLEVKG
FT                   LRGPLVKTITNSSMIDKLGELYDVPVFETKVGFKYVSPVMIEQNALIGGEESGGYGFAG
FT                   HVPERDAILAGAYFLDFMITTGKSPSAMLEYLYSKVGPHYYNRVDYTFDEARRKEIIKH
FT                   LADQKPDNLSETKVISTDNLDGFRYKLEDGSWLLIRFSGTEPLLRIYAESPSQDKTAAL
FT                   LENGRRLSGI"
FT   gene            complement(419581..419784)
FT                   /locus_tag="DhcVS_452"
FT   CDS_pept        complement(419581..419784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_452"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61606"
FT                   /db_xref="GOA:D2BH06"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH06"
FT                   /protein_id="ACZ61606.1"
FT                   /translation="MIKTLLLAFFGAIVLELAVIMLATVMGLAGLTFVIMVLFLPVVLI
FT                   LGSIIFMLSKFFKGDSQNNKPN"
FT   gene            complement(419816..421036)
FT                   /gene="metK"
FT                   /locus_tag="DhcVS_453"
FT   CDS_pept        complement(419816..421036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="DhcVS_453"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_453"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61607"
FT                   /db_xref="GOA:D2BH07"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH07"
FT                   /protein_id="ACZ61607.1"
FT                   /translation="MSQTFGNSSKYLFTSESVTEGHPDKICDQISDAVLDAIIAKDPTA
FT                   HVACETAVTNGLVVVMGEITTSCYVEIPELVRGVIKDIGYTKPEYGFDDRTCGVLTSIN
FT                   RQSPDIALGVNKSQEAKSGKVDELDLTGAGDQGMMFGYACTETPEYMPLPISLAHRLSK
FT                   RLSEVRKNGTLAYLRPDGKSQVTVEYHNGEAKRISSVVIGAQHDPDITTEKIQSDIIRE
FT                   VIKPIIPADLLDTNTEYYVNATGRFVVGGPVSDTGFTGRKILVDTYGGFARHGGGAFSG
FT                   KDPTKVDRSACYMARYIAKNLVAAGLADRLEIQVAYVIGVAHPLSVSIETFNTARMSHE
FT                   DILSIIQKHFDLRPEAIIRNLGLRRPIYRQTAAYGHLGRPELDLPWERLDKVDAIKATM
FT                   ESLSVSK"
FT   gene            complement(421046..422302)
FT                   /gene="ahcY"
FT                   /locus_tag="DhcVS_454"
FT   CDS_pept        complement(421046..422302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="DhcVS_454"
FT                   /product="S-adenosylhomocysteine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_454"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61608"
FT                   /db_xref="GOA:D2BH08"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH08"
FT                   /protein_id="ACZ61608.1"
FT                   /translation="MPNFDVKDISLAALGKKRIDWAGREMKTLALIKERFEQEKPFKGI
FT                   RIAACLHITTETANLGLVLKAGGADLTLCASNPLSTQDETAAALVEHGINTFAIHGEDN
FT                   ESYYRHIAAALDAKPQLTVDDGADLVATLHSQRTELLSGILGGTEETTTGVIRLRALAE
FT                   SGKLCYPIIAVNDAKTKYMFDNRYGTGQSTLDGITRATNFLWASKTVVVVGYGWCGHGV
FT                   AMRAKGLGAHIIVTEVDPVKALEAVMDGFSVMPMAEAAKLGDIFITVTGDKHVIDKDHF
FT                   KVMKDGATLANSGHFNSEINIPALETLACGKETIRPSVEEYKMKDGRRIYLLGEGRLIN
FT                   LAAAEGHPAAVMDMSFANQALSLEYLVKNHTRLENKVYAVPEEIDRAVAATKLSSLDVS
FT                   IDTLTEEQIKYLSSWQEGT"
FT   gene            complement(422310..423872)
FT                   /locus_tag="DhcVS_455"
FT   CDS_pept        complement(422310..423872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_455"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61609"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH09"
FT                   /protein_id="ACZ61609.1"
FT                   /translation="MSDLPLYAQAMLRPDFYPEPTSKVELVQTQMSFVFLTDHFAYKTK
FT                   KAVNLGYLDYSELSERKTLSEKELVLNRRLCDYAYLEVLPVTKNEGGYSLGGCGEVVEY
FT                   TLKMRRLPEDRMLINLLSTGGVSSGMLEKLAEKLAVFHQTARTDAEVQKYGNLEAIKYN
FT                   TEENFEQTGSKVGLTVSPGEYARISSFTRSFISDNQALFNARVNGGKIRDCHGDLHAAH
FT                   ICFMDNICIYDCIEFNDRFRYGDVASEVAFLAMDLDHYGKADLSRLFVNSYIQKSKDTD
FT                   LYKLLRFYKCYRAYIRGKVEGFKLDDPYISEAEKAKYVQKSKNYYHLADFYAKPNPTLF
FT                   ITTGFCGCGKSTLAQSLAEVSGSVVISSDIVRKGLSNIDCHQHCFEDADQGIYSPEMTK
FT                   KTYQAMFDQAGNALKEGYSVILDATFLKEDQRKQAEECASQNNAKFVVLEVKLSPELAK
FT                   KRLEERLDKQSVSDGRWEVYLKQIKSFEPLAVQLNRVIIDSSKPTDKQLSDILEFFKSN
FT                   QGE"
FT   gene            complement(423872..424072)
FT                   /locus_tag="DhcVS_456"
FT   CDS_pept        complement(423872..424072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_456"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61610"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH10"
FT                   /protein_id="ACZ61610.1"
FT                   /translation="MNCATELNKVNCNCTYEPCERKGKCCRCISYHLAMDELPACAFPD
FT                   NIEKTHDRSFKCFARMVSKES"
FT   gene            complement(424069..425097)
FT                   /locus_tag="DhcVS_457"
FT   CDS_pept        complement(424069..425097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_457"
FT                   /product="hypothetical protein, methionine synthase II-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_457"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61611"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH11"
FT                   /protein_id="ACZ61611.1"
FT                   /translation="MTKTDFHLLPTMIGSMPHTDPKAAVDIITHYLQDIPVWPQMPRRS
FT                   CLEGMSAQFSQGLPGVKINQDKVWIEPNPSFESELESLYQAYLDNNFNKFPIGAEYAAG
FT                   LYELASRNLSPLLVKGHITGPLTYCMSIKDPSGKDILYDEVLSDAATKLLKLKATWQEH
FT                   FLSNICRNTIIFVDEPAMSAYGSAYLPLSREQVTGMFDEVFSGISGLKGVHCCGNTDWS
FT                   ILMDTSVDIINFDTYAYANSLSIYTDELKAFIKRGGAVAWGIVPTDEKALKEETAASLK
FT                   DRLEAAMSHFDSRGLPFAELARHSLITPACGLGLKSPEAAERAPQLLAELSALLRRKHG
FT                   TV"
FT   gene            complement(425090..425974)
FT                   /gene="mtaP"
FT                   /locus_tag="DhcVS_458"
FT   CDS_pept        complement(425090..425974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtaP"
FT                   /locus_tag="DhcVS_458"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_458"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61612"
FT                   /db_xref="GOA:D2BH12"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH12"
FT                   /protein_id="ACZ61612.1"
FT                   /translation="MVHYAKIGVIGGTGLYDIEGLTDIREHALDTPFGKPSDTIVTGNL
FT                   DGVGVAFLPRHGRGHRILPSEIPSRANIYALKSLGVEHIIAINSVGSFKKEVKPGHLLI
FT                   PDQLIDRTSQRTNTFFGKGIVAHIAFSQPFCPDLRKLLFECAKEAGADVHNGGTYVVME
FT                   GPAFSTQAESRLHKSWGADVIGMTALPEAKLAREAEICYAIIACATDYDAWHEEEEAVT
FT                   VDKVIATLRGNINLSKNIIKLAVGRIGEARNCECSTALSNAIMTSPEAVPNTRKRELAL
FT                   IIDKYMPAASEND"
FT   gene            complement(426042..427040)
FT                   /gene="mtnA"
FT                   /locus_tag="DhcVS_459"
FT   CDS_pept        complement(426042..427040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnA"
FT                   /locus_tag="DhcVS_459"
FT                   /product="methylthioribose-1-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_459"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61613"
FT                   /db_xref="GOA:D2BH13"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH13"
FT                   /protein_id="ACZ61613.1"
FT                   /translation="MKAIEWRDNRLIILDQTLLPLEEKYLELNDYHAVAEAIKTLRVRG
FT                   APSIGVAAAYGIALGALGIETQYCSEFLPLYQQVSAEIASTRPTAKNLFMAAERMDHVV
FT                   ASGTDVSQVKISLVEEAVKIHHEEEEASRKISAFGAELIQPGWTVLTHCNAGPLATAGY
FT                   GTALGVILAAHQQGKNISAFATETRPLLQGSRLTALELKEAGVPFKLITDSMAGHFMQK
FT                   GVINAVVVGADRIAKNGDTANKIGTYSLAVLALAHGIPFYVAAPSSTFDKSIESGRDIV
FT                   IEERKPEEITQIRGQRIAPENIAVANPAFDVTPANLITAFITENGIIRRGG"
FT   gene            complement(427042..428139)
FT                   /locus_tag="DhcVS_460"
FT   CDS_pept        complement(427042..428139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_460"
FT                   /product="ABC-type transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_460"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61614"
FT                   /db_xref="GOA:D2BH14"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH14"
FT                   /protein_id="ACZ61614.1"
FT                   /translation="MRFWELGIRALKETYRDPMALGFLLGFPLMFMLLFGFAFSGEGSA
FT                   SYQIGLVDKDQTPISIAFADEALSKVPSYEIIYITTPDEALTKLKHSDIRAYVIIPEGF
FT                   GEEISKLWAGENGNIYLDVTYDESDIQAAGEILSQLNAVCRAFAKIEIPLSINAQPVNI
FT                   ENKITNIDFISPGIIVFGLLILIPTSARIIVRDKEKGFMSRMLTTPSRSMDFILGYSLS
FT                   MTLICIIQIIFFMLLGYLFGMDITGNIALAFLIFFLTGLSSIGVGMVIAGFSKSENQSE
FT                   SISWFFSMPLAIISGTWFSIQFMPDVLKWLGYAFPYSHAIEASRLVILRGADFSAVSGE
FT                   VGILAIWTIAIFALGTIIFGRTMRS"
FT   gene            complement(428136..429086)
FT                   /locus_tag="DhcVS_461"
FT   CDS_pept        complement(428136..429086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_461"
FT                   /product="ABC-type transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_461"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61615"
FT                   /db_xref="GOA:D2BH15"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH15"
FT                   /protein_id="ACZ61615.1"
FT                   /translation="MAATSKAPPEIPAIETLDLSRSYGQLLAVDKLNLNIRNGELFALL
FT                   GPNGAGKSTTINMLCCLLKPTSGTALIMGFDINTQSYQIKSTIGSSPQETAISDHLTPV
FT                   ENLELFGRLNRVDPVKLKEWIPRFLEIMGLEDRAKSQVRTFSGGMKRRLSIMMALIHNP
FT                   DVVFLDEPTLGLDPQVRHAMWEYIKSMKGQKTILLTTHYMEEADHLADRIGIMDQGKIV
FT                   ALGTPVELKQSLIKEPTMKIQAFNISQKIVADLKTFYPKVEFSGGTLSVSAEHLEFNEI
FT                   VNRLQNAGAVIRSAQIKDPSLEDVYLKLTGKELRQ"
FT   gene            429179..429601
FT                   /locus_tag="DhcVS_462"
FT   CDS_pept        429179..429601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_462"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61616"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH16"
FT                   /protein_id="ACZ61616.1"
FT                   /translation="MLNTKYTLEDLRANPGLKLLPLRLVIERGMVERFCRATGDDVENW
FT                   QAEAPPSLALTLGFGQMLEAISADNITVLHGSSELESLKPLEIGQEVVVETSLLSLRER
FT                   PGKMGLSSFLNFEMQVSNNKGELLAKVCQLAIVYSA"
FT   gene            429598..430011
FT                   /locus_tag="DhcVS_463"
FT   CDS_pept        429598..430011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_463"
FT                   /product="acyl dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_463"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61617"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH17"
FT                   /protein_id="ACZ61617.1"
FT                   /translation="MTSGFENITEGQEIACQMLALSSRDLVIWAGASGDYNPIHYDKDI
FT                   ALKRGLNGVVVPGQLVGAMLGSLASRFARPSGRLAKLSVSYKKMMPLGENLVLKGVVSS
FT                   KADTPESKSLNLKLWAEDTVGDKTVTAAAVILY"
FT   gene            complement(429998..430558)
FT                   /locus_tag="DhcVS_464"
FT   CDS_pept        complement(429998..430558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_464"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_464"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61618"
FT                   /db_xref="GOA:D2BH18"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH18"
FT                   /protein_id="ACZ61618.1"
FT                   /translation="MIHAQGKLTRLRDKRLEDASLDYVWQTDPELSRLDAAEPLTIPFR
FT                   TFLGEYLFVLENSLALRVQFGIETIRGEYIGYCACYNWDRAAGEAEAGIMIGQKEYWGK
FT                   GYGSDALGLMVGYVFENTSLKRLYLKTLSDNTRAQCAFKKCGFKPFGERESGQHRFILM
FT                   ELLKANWLKNKDLLAEEHQSNKV"
FT   gene            complement(430562..431512)
FT                   /locus_tag="DhcVS_465"
FT   CDS_pept        complement(430562..431512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_465"
FT                   /product="PBS lyase heat-like repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_465"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61619"
FT                   /db_xref="GOA:D2BH19"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH19"
FT                   /protein_id="ACZ61619.1"
FT                   /translation="MSQNNTEITELFERLTDENTSLKHTDLALLSDLNNQEVTAFKDFW
FT                   IRMSPKRRLDIVSRLGELAEDDVSLDFESIFIRTMHDPNAEVRAKSIDGLWECNRPSLI
FT                   DHLLSLSNEDPSMEVRIAATASLGRYSLMGEFGQLPEKTSQTLQTSLLTIFRNTELPVE
FT                   LRRRALESVSPFGQPQVIMAISQAYNNPEHLLKIGAVYAMGQNASDQWESVITSELNND
FT                   NNDLRYEAAVAAGELGLESFVPKLVSLIEDPDIEVQLASIQALAKIGGKDAKKGLTENL
FT                   ESTSSQAVRDMITTALADIEADESAAGMPAISPEE"
FT   gene            complement(431512..432342)
FT                   /locus_tag="DhcVS_466"
FT   CDS_pept        complement(431512..432342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_466"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61620"
FT                   /db_xref="GOA:D2BH20"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH20"
FT                   /protein_id="ACZ61620.1"
FT                   /translation="MDKKYKLNSRPKLKSPCLLAAWPGISNVALIVATYLARKLEFKEL
FT                   AEIDSPSFFDPIGVLVKDGVVEEPQFPQNRFYYLKNKQDNDIILFIGEDQPSTKSYELA
FT                   NLILDVGQRFGVKRIYTFAAALTRIHHSEQPRAWAVGTNTQVANELVERGLSGSGNLQI
FT                   SGLNGLLLGVAKERNMDGVCLLGEVPSYASRLQNPMAALVIVQILSKLLHLEVDITELE
FT                   QIASDAKQHVSQIAAEAMEDYIDYFTEPIWESGEDDDDDLDNDEDDDNEEASNN"
FT   gene            complement(432356..433657)
FT                   /locus_tag="DhcVS_467"
FT   CDS_pept        complement(432356..433657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_467"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_467"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61621"
FT                   /db_xref="GOA:D2BH21"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH21"
FT                   /protein_id="ACZ61621.1"
FT                   /translation="MLEKIIEQAKKVAEQAECFMVESESAPIHFEANQLKNIESKQSLS
FT                   LALRIIKDGKIGYAASSNPANWLKLADMAVETAAYGQTAHFQFPAAQICPEIKIFDPET
FT                   EAVSLEEMVKLGKDMVTGLLEINPDLVCSASLSKSTLNIRLLNTSGADISYKKSNFSMG
FT                   LEGTLVRGTDMLFVGDGLSSCRPIRSGREVVRLVGKQLERARQNVTLQSREMPVIFTPH
FT                   GVGSTIIPALSAALNGKLVQEKASPLAGKLGEQMFDPALNLVDDPTQSFSPNSRPFDDE
FT                   GTASQITPLVKNGIIKNFIYDLRTAALAKAKSTGNAERHGGQPAPGFSALMIKPGTVSF
FT                   EEMVSGIKEGLIVEFMMGAEQGNVLGGDFSGNVLLGYKIENGQITGRVKDTMLSGNIYN
FT                   ALKTINAIGSDGRWLDGELFTPSMYFPKLSVATK"
FT   gene            complement(433659..435044)
FT                   /locus_tag="DhcVS_468"
FT   CDS_pept        complement(433659..435044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_468"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_468"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61622"
FT                   /db_xref="GOA:D2BH22"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH22"
FT                   /protein_id="ACZ61622.1"
FT                   /translation="MTTLTELRNIAHELSQQLYHYRADYLEIHLEESTSSYISYRGQNL
FT                   DTAGRGSDLGGNVRALVNGGWGFVSFNNLDDIRKRIDQAIHQAALAGSAQSQFASAPSV
FT                   TYAQPDELSQSSVERPLEDKKRVLDEYKDLIWQTKGIKTSFIRFSDGYRRRFYVNSRGS
FT                   VIEQSRADINFNATAIASADGELQQSNISVGSRGNYSAITELHSQIKDMTEHAVKLLSA
FT                   QKVKGGEYTVILDPILAGVFVHEAFGHLSEADHIYENPQMREIMVLGKKFGSKILNIVD
FT                   NPTMPDLRGSYKYDDEGVAATKNYLIREGKLSGRLHSRETAAKMNEPLSGNARAISYRY
FT                   APIVRMSNTYIEPGTSTLEGMLDGVKEGIYVKNWYGGTTSMEMFTFSSGEAYMIRDGKI
FT                   AEALRPVVLSGNVFDTLHNIDMIGNDLDMNQGGGCGKSGQSPLPVSNGSPHIRIQKCLV
FT                   GGA"
FT   gene            435175..436467
FT                   /gene="manB2"
FT                   /locus_tag="DhcVS_469"
FT   CDS_pept        435175..436467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manB2"
FT                   /locus_tag="DhcVS_469"
FT                   /product="phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_469"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61623"
FT                   /db_xref="GOA:D2BH23"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH23"
FT                   /protein_id="ACZ61623.1"
FT                   /translation="MGLFGTSGIRRLVDDRLMETALKVGFSVGKRYRRVVLAGDSRTST
FT                   PAIKRILSGALISVGADVLDVGLVPTPTLAFMARDFDAGLMVTASHNTAEYNGIKFLNP
FT                   DGSAFSYLQQQEITKDVESSRSPSIKWDNFGQINAFPCTVEKHMEHILGYLPDKCRLKV
FT                   VVDCGGGAASVITPWLLQRMGSRVISLNDTTHGFFPHPPEPLAENLTGLIQTVKESDAD
FT                   LGIAHDGDADRMVAVDKHGNFISGDKMLVLFARAARADKVVTTLDASMVVDEMGFKVIR
FT                   TAVGDNYVSEELKRQGNFGGEPCGAWVFPESSLCPDGIYAAARLLNLVARQPLAELTSD
FT                   IPEYSMKRGSVAGSGLNLALVEESLQCLNPLSSSLLDGIKLNLKDGWLLIRPSGTEPKI
FT                   RLTAEAKTPEQCETIYQTGLKCLKSCLSREK"
FT   gene            436469..437671
FT                   /locus_tag="DhcVS_470"
FT   CDS_pept        436469..437671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_470"
FT                   /product="nucleoside-diphosphate-sugar pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_470"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61624"
FT                   /db_xref="GOA:D2BH24"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023915"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH24"
FT                   /protein_id="ACZ61624.1"
FT                   /translation="MKAVILAAGEGSRMRPLTFTRPKVMLPIAGKPILEHLLLEVSAAG
FT                   ITEFILVVGYRDEQVRSYFADGAKWGLKISYCQQNRQLGTAHALKQLEDQLQAEFLVMN
FT                   GDILAKSADIAALVASAKTTLGVFEASDPSRLGVLETDGRHVKRIHEKFANPPTNLANA
FT                   GLYLFTPPIFKAIDDTPLSPRGEYEITSSIQLLIDRGLAVGYHPLTYWQDVSYPWDLLD
FT                   LNASMLKSLGPHMCGTVEENVVIKGAVEIGEGSLIRSGVYIEGPVIIGKNCDIGPNCYI
FT                   RPSTSIGDNCRVGASVEIKNSIIMDNTKIPHLNYVGDSVIGQNCNLGAGTKLANLRFDG
FT                   ADISAGGVNTRRRKLGAVLGDGVEIGINVSLNPGVLVGSGSRIGPGAVVSGLIEPNSYI
FT                   G"
FT   gene            437687..438868
FT                   /locus_tag="DhcVS_471"
FT   CDS_pept        437687..438868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_471"
FT                   /product="nucleoside-diphosphate-sugar pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_471"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61625"
FT                   /db_xref="GOA:D2BH25"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023915"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH25"
FT                   /protein_id="ACZ61625.1"
FT                   /translation="MKQAVILAAGEGQRLRPFTASKSKVMLSIAGKPLLEYVIESLALN
FT                   GIRDIILVVGYQRERIFDYFGQGGHLGVQITYVHQPNQLGTAHALKQANDKIKGDFLVL
FT                   NGDQLIKPSTISEFTKQPPQAVMVKAVNDEDPRRYGVITSSGGLLTSIEEKPSIAKSSF
FT                   INTGIYSFSMKVFDYIGEHLDIPVVLQSMIKDKLDIQVAESHGLWLDIVYPWDMLSLNA
FT                   AVSAELKPGVAGTIESGVVIKGPVLIGKNTVIRSNSYITGPVIIGEGCDIGPSVCIYPS
FT                   SSIADNVTVAPFCQIKNSLIYSGNSIGVASVIEDSVIDRGCVLRGQFNAPSSEVETRIN
FT                   DELHKIKVGTMMGEGCIVGNSVVSQSGTVVGNSSRIAPLKTLSGSIPDGSLVV"
FT   gene            438869..440650
FT                   /gene="glmS"
FT                   /locus_tag="DhcVS_472"
FT   CDS_pept        438869..440650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="DhcVS_472"
FT                   /product="glucosamine-fructose-6-phosphateaminotransferase,
FT                   isomerizing"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_472"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61626"
FT                   /db_xref="GOA:D2BH26"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH26"
FT                   /protein_id="ACZ61626.1"
FT                   /translation="MCGIVGYTGKRQAQAVLYDCLCRLEYRGYDSCGIAVNSPEIRLFK
FT                   DAGKVHDILQNAPRFEGTAGLGHTRWATCGEPTQINAHPHTDCTGKICLVHNGVINNYS
FT                   QLLKRLEANGHKIVSDTDTELIAHLIEEYDKGNLEEAVRQAVKEIEGSYALVVMRSGEN
FT                   TLVAVRQDSPLVIGVGDGEYLVASDVPAILGYTNRVIYLDEGDIGIINPDNLKIRRNGE
FT                   YIVPLVEKINWTQDESQKGGYSHYMLKEIHEQPRVIQNTLINMLLPESFNKSPLLEQSR
FT                   KTGILFLACGSSYHAALTVRYLVEEHLNIPVRLEMASEFNYMHRLPPCKLAVVLSQSGE
FT                   TADVLRAMRRLKQAGCMVVAITNVAGSTAARLADHTIYTQAGPEIGVAATKSFVAQLTV
FT                   LYFLCFACASAANPRYQDYLSTMRLLPSVVQRVFGSQQNIKDAALEIAKANSVFFIGRG
FT                   INYPIALEGALKLKEISYIHAEGYAAGELKHGPFALLSPETPVLALVSHDQTYEAMLTG
FT                   LREIKVRRAPLIVIGEAGDEQLGQLADRVISLPSFSRLFSPILFTVVLQLLAYYVACEL
FT                   GCSIDAPRNLAKSVTVE"
FT   gene            complement(440657..441109)
FT                   /locus_tag="DhcVS_473"
FT   CDS_pept        complement(440657..441109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_473"
FT                   /product="phosphatidylethanolamine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_473"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61627"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH27"
FT                   /protein_id="ACZ61627.1"
FT                   /translation="MLLGSSAFACGEYIPRRFSGLGGNISPPLHWMKLPQGTNSLALIL
FT                   EDPDASKAFTHWLIYNIPSNRNSLPEAVPTEPNLPDGIRQGLNSAGEIGYTGPYPPPNR
FT                   VHHYHFRLFALDTTLKLKAGCHQTDLLRAMEGHIIDQTDLTGLFVI"
FT   gene            complement(441121..441825)
FT                   /locus_tag="DhcVS_474"
FT   CDS_pept        complement(441121..441825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_474"
FT                   /product="HAD-superfamily hydrolase, subfamily IA"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_474"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61628"
FT                   /db_xref="GOA:D2BH28"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH28"
FT                   /protein_id="ACZ61628.1"
FT                   /translation="MIKGVFFDLYNTLIGYQPSREEMTQKLLSEMGYTTIEDNLYLPMN
FT                   KADEYFYQQNAQSPISLREKAEQMAVWSHYYRIILEAIDIEASPELITNLIGRWKNLKW
FT                   EMTLYQDVIPCLKNLKNRSLKIGLISNADKDMSELFNKTGLDAYLETVVISQDVGVTKP
FT                   NPLIFQAALEKSGLAAKEVLYIGDQYQVDYIGAMNVGLNPILLDRRNCYIDLSDCRRIT
FT                   GLDELEYCIDNT"
FT   gene            441963..443267
FT                   /gene="lysA"
FT                   /locus_tag="DhcVS_475"
FT   CDS_pept        441963..443267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="DhcVS_475"
FT                   /product="diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_475"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61629"
FT                   /db_xref="GOA:D2BH29"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH29"
FT                   /protein_id="ACZ61629.1"
FT                   /translation="MEPRIQVFPKNTEVKNNHLVIGGADVTGLCAKHGTPLYIFDESTI
FT                   RQNCRDFKREFSRRYADSSVSYASKAFLHPALLKILAEEGMSLDVVSGGELSIANNAGF
FT                   PMDMVYFHGNNKSAEELRLALRLHVGRIVVDSFDEIKLLSKLADESGHIPDILLRLTPG
FT                   VDAHTHHHITTGKLDSKFGFPLFQAAEAVGLAMAQASLNLVGFHFHIGSQIFETQPFLD
FT                   AIDLVLDFAAQVQERYGFDIEELDIGGGYGVQYEIDKPAPAVSVYAEAIGAKIVAKCHS
FT                   LKLAPPSLNIEPGRAIIAQAGVALYTVGVIKDIPGIRQYASVDGGMGDNIRPALYEAKY
FT                   EAVVASNVQSAEKQKVTIAGKFCESGDILITDIELPSLRAGDILAVPCCGAYCLPMSSN
FT                   YNGYQRPAVVILKNGEDRLIRRRETVEDLSRLDSV"
FT   gene            443281..444300
FT                   /gene="dnaX"
FT                   /locus_tag="DhcVS_476"
FT   CDS_pept        443281..444300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="DhcVS_476"
FT                   /product="DNA-directed DNA polymerase, delta prime subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_476"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61630"
FT                   /db_xref="GOA:D2BH30"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH30"
FT                   /protein_id="ACZ61630.1"
FT                   /translation="MWRIIGQDKVVSFLGNSLGQDKLCHAYVFYGPSGVGKQRMALTFA
FT                   QALNCQASQPPCQECLVCERILSGNHPDIIHLELLSAEDASDGKAKAEIGVKQVEDIQH
FT                   AASLPPFEGKYKVFIIHHAEKLSQESSNRLLKTLEEPGSQNIFILLTADKSLLLPTVIS
FT                   RCQILELRYVEINLIRDALLEQGLAEEKAELLSHLSHGRIGWAMEAASNPEILEERKAN
FT                   LEKIILVLGQDEEERFDYASDISNLFAQNHMAAEAVLDMWLAVFRDMLLLKADASQNMT
FT                   NIDYKDILYMASDKLGLADIRIAIDNILKARSQLRANANPRLCLEVLMLSLPLVKEGL"
FT   gene            444303..445136
FT                   /locus_tag="DhcVS_477"
FT   CDS_pept        444303..445136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_477"
FT                   /product="PSP1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_477"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61631"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH31"
FT                   /protein_id="ACZ61631.1"
FT                   /translation="MVNIVKIRYKQAGKIYYFDPAGFELYQYDCVVVETSRGEELGWVV
FT                   ASPSQVEESSLEQPLKPVIRLATAEDMARERQLGEKNQSAVTECVELVDKLNLPMKLIR
FT                   AEYSLDENHVTIYFSAEDRVDFRELVREISRKLRVRVELRQIGPRDEAKMVGGYGRCGR
FT                   ELCCCSFLSEFDPVSIKMAKEQNLPLNPQKISGVCGRLLCCLDYEYETYKAAKAKMPKD
FT                   GLKVVTPVGKGEVVGGNPLEEMVFVLLESGANAEVALKDIRPDKEGRRPDASLHR"
FT   gene            complement(445125..445655)
FT                   /gene="mcrA"
FT                   /locus_tag="DhcVS_478"
FT   CDS_pept        complement(445125..445655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcrA"
FT                   /locus_tag="DhcVS_478"
FT                   /product="restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_478"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61632"
FT                   /db_xref="GOA:D2BH32"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH32"
FT                   /protein_id="ACZ61632.1"
FT                   /translation="MDNHQVLVLNQDYQPLNVCHVRRAVLLIYQSKAEMLENGSGFWHS
FT                   EKDHFALPSVIRLSCLIKHPPLRPKLNRAEIFSRDKHTCQYCGRRDLELTIDHVNPKHQ
FT                   GGPHVWENVVTACLHCNRHKAGRTPEQAHMKLMSTPGVPQYRYGYSLPRSNGSIRHEWR
FT                   PYLGLEDEPKLAV"
FT   gene            complement(445727..447139)
FT                   /gene="dnaC"
FT                   /locus_tag="DhcVS_479"
FT   CDS_pept        complement(445727..447139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaC"
FT                   /locus_tag="DhcVS_479"
FT                   /product="DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_479"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61633"
FT                   /db_xref="GOA:D2BH33"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH33"
FT                   /protein_id="ACZ61633.1"
FT                   /translation="MEHIKDILGKQINIKGNSSTTSSKGKADKAAEANTCPLCKGAKFV
FT                   YPVSAEGVTDFSRVIPCQCTQSESGADREKRLLTYSCLGGLQKYTFEKLNSLGKSEEPH
FT                   NQNMFSQAYNAALDFASKPAGWLVFSGPSGAGKTHLAAAIANKRLSMGQPVLYKRASEL
FT                   IDDLKKSFEPDSESGYSQSFDILKNAPLLIIDDLTVQSSSDWSKEKLDQLLTYRFSQEL
FT                   PTIITLSTTITELDPRIQSRLLDKSRSRVYPVAAHPEDNLEYRWDNALALQKKMTFENY
FT                   DHKRANLTAEQRQNIDAAYNLALEFSRNPESWLVFQGETGCGKTHLASAIVNERYRQGK
FT                   PAMFVVVPEFLDHLRSTFSPESKTSYDQMFDAVKNAKLLVLDDFGEQSSTPWAQEKLYQ
FT                   VINYRYNRRLATVITTRCQLSEIEIAISSRFVDPQISMVFNITAPNFRCDSTGQQKQRP
FT                   VSRINRTTRPQR"
FT   gene            complement(447063..447773)
FT                   /gene="dnaD"
FT                   /locus_tag="DhcVS_480"
FT   CDS_pept        complement(447063..447773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaD"
FT                   /locus_tag="DhcVS_480"
FT                   /product="primosome component"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_480"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61634"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="InterPro:IPR034829"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH34"
FT                   /protein_id="ACZ61634.1"
FT                   /translation="MSNPPALPARQEFTPVSRFFIHRVAPQIEDISELKVSLAVFSLIQ
FT                   VKKGYPRYTTLAELAAEETLIKALGKTRDESLQSLDKALSMAVKRGTLLGLEVKSGKHH
FT                   HQLYFINAESEAAVVEKIKNGSLVLPGLKDVTAEVISGQAEQPNIFKLYEQNIGMLTPM
FT                   LADNLKEAEKLYPEEWIAEAIKEAVSLNKRNWRYIERILENWSSQGKSSGTHKGHTGET
FT                   DKYKGQLFDHLVQR"
FT   gene            complement(447770..449146)
FT                   /gene="dnaB"
FT                   /locus_tag="DhcVS_481"
FT   CDS_pept        complement(447770..449146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="DhcVS_481"
FT                   /product="replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_481"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61635"
FT                   /db_xref="GOA:D2BH35"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH35"
FT                   /protein_id="ACZ61635.1"
FT                   /translation="MLDAKMPPYDVDAEESVSGSLLIDGQAIFDIIPILKPQDFFTESN
FT                   RLIFEACMSLYGRSEAINQVTVAQELERLGKLERCGGSAYLSHVVTVVPTSLDIEHYAR
FT                   IVYRLSVMRQLIDAGQKISELGFKADPDVSDSLGKAEDLLFRLRHERSSLGFTHIKNIL
FT                   DKYFEPVPVPGSEGYQAIPHVLTGLTGMDTFLGGLQRSDLIIMAGRPSMGKTSLALNIA
FT                   RNAAVEQRACTAIFSLEMSRESLVQRLLSNEAAVNSRSIRLNESNPEEERKIMDAIGVL
FT                   SEAPIFIDDSPQIRVAEIRSKALRLRYEQNIDLIIVDYLQLIQGEGNTKENRVQEISYI
FT                   SRSLKGIARELNVPVIAISQLSRAPEFRSSHQPQLSDLRESGSIEQDADIVVFIYRDEF
FT                   YYKEEEWANLHPDQEYPREIADIIIAKHRNGPIGTVKCRFRHDLTRFENLGSSTEPSFL
FT                   "
FT   gene            complement(449147..449602)
FT                   /gene="rplI"
FT                   /locus_tag="DhcVS_482"
FT   CDS_pept        complement(449147..449602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="DhcVS_482"
FT                   /product="ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_482"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61636"
FT                   /db_xref="GOA:D2BH36"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH36"
FT                   /protein_id="ACZ61636.1"
FT                   /translation="MKVAFLKDVPGRGKTGDVKEVNDGYARNYLIPNKLAMPASASVTS
FT                   EIAAKQAAEDRRKAKAEAEMVQLAKELDGTNVSIKAKTGAKDKLYGQVTTTVIAAEIEK
FT                   QTGKAIDKRKLEMAEPIRQLGSYEVVIRFNKDLSSKINLIITTEENT"
FT   gene            complement(449672..450592)
FT                   /gene="trxB"
FT                   /locus_tag="DhcVS_483"
FT   CDS_pept        complement(449672..450592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="DhcVS_483"
FT                   /product="thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_483"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61637"
FT                   /db_xref="GOA:D2BH37"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH37"
FT                   /protein_id="ACZ61637.1"
FT                   /translation="MSTPLYDVIIIGGGPAGLTAALYTGRAKLKTLVIERAFIGGQITR
FT                   SEKVDNYPGFPEGITGFDLTQQMQIQAEKYGAEITSAEVTALNKAKDSFEISTEAGKLS
FT                   GRCIIICGGTERNKLGVPGEEEFSGRGVSYCATCDAPFYNDKVVAAVGGGNMAIYEALH
FT                   LSEFAKKVYLIHRRQGFRADAVLIDKAKSKGNIEMALDTVITAINGKDSIQSLSLNNLK
FT                   TQKTSDLPVNGLFVAVGLQPNTAYLKGVVDMDKNGSILVNDQMETSVSGILCAGDIRSG
FT                   SIRQVISAAGDGAVAALSAKRYLDR"
FT   gene            complement(450573..451616)
FT                   /gene="plsX"
FT                   /locus_tag="DhcVS_484"
FT   CDS_pept        complement(450573..451616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="DhcVS_484"
FT                   /product="fatty acid/phospholipid biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_484"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61638"
FT                   /db_xref="GOA:D2BH38"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH38"
FT                   /protein_id="ACZ61638.1"
FT                   /translation="MIIAVDVDGGDYAPKEIIKGALKAAQEYKIGLILLGKKEVIHVHA
FT                   GHYLKKYPIEIVHCPQTITFNEHAVEAIKSKPKSAIVIGTSLVKQGKADAFISAGNTGA
FT                   VLAAAFFILGKIDGVERPALGAIITTRPHIPSLLIDAGANAECRPNHLDEFAHLGNIYA
FT                   KQVLGLEKPRIGLLNNGEEEAKGTKLTLETHQLLKKSQLNFIGNIEGHDISLNKADVIV
FT                   TDGFTGNVVLKTLEGLGDALLKLRKVGHAIDSAAHLRGRALLADVGLGSMVKGMDFEEC
FT                   GGACLLGVKGTVIVAHGRSHARAIKNAIGLAKRTAEKGVDKLIAEDVRLRTLTATEGDQ
FT                   NHVNTPV"
FT   gene            complement(451656..452507)
FT                   /locus_tag="DhcVS_485"
FT   CDS_pept        complement(451656..452507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_485"
FT                   /product="BadF/BadG/BcrA/BcrD ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_485"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61639"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH39"
FT                   /protein_id="ACZ61639.1"
FT                   /translation="MNIFLGIDSGSVSTKIICLSPSAELADWIYLPTAGDPLSTLRTGL
FT                   RQLQHRLPEDTSVLGVAVTGSARELVAEAVGADMVKNEISSQAKAAAHLIPEVKTVIEI
FT                   GGQDSKLILLENGFVSDFAMNTVCAAGTGSFLEHQSRRLNLSLEEMGKLAHFSQNPIEL
FT                   KGRCTVFVESDMIHFQQTGSSRPDIVYGLCKALVRNYLNDLGLHKEIRQPVVFQGGVAR
FT                   NPAMKKAFEEELGFSLIVPPRPEITGALGAALLLCQERETDSPAKPTNFRGFETPFLRE
FT                   KV"
FT   gene            complement(452532..453875)
FT                   /locus_tag="DhcVS_486"
FT   CDS_pept        complement(452532..453875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_486"
FT                   /product="metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_486"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61640"
FT                   /db_xref="GOA:D2BH40"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH40"
FT                   /protein_id="ACZ61640.1"
FT                   /translation="MLNKPRPNPYWRCISLKSKTCISKRKQTVFMPLQQNGKWYLRRVW
FT                   DIIRSMSDNNLANIKSAVIKMIDTEKGSLEELSLKLHANPELGYQEYKAVEWLCEYLSR
FT                   HNFSIERNTGGLKTAFKATFGQGKPVIGFLAEYDALPQLGHACGHNLIATAAAGAAVAA
FT                   RLAAKLYGGTVCLIGTPAEELSGGKIQMVEKGVFKELEAALIAHPGNDDIATTQALACV
FT                   TLNVEYFGKESHAAAHPDKGINALDAIVLAYTSLNSLRQHIEPGARIHGIITDGGKAAN
FT                   IVPGHSAGTFLIRSQTLPYLRELMDRVLDCFKSAAQATGARLEYRFDKSIYAPMNNNMA
FT                   LANLYVTNMDMLGRKTLLEDPEMNFGSTDMGNVSQIVPSLHGYYSITRKEVSGHTEEFA
FT                   SAACSSNGIKGALDAAKAMAMTAADLLGNPANLDKVRTEFQKSTRPSA"
FT   gene            453947..456787
FT                   /gene="uvrA"
FT                   /locus_tag="DhcVS_487"
FT   CDS_pept        453947..456787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="DhcVS_487"
FT                   /product="excinuclease ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_487"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61641"
FT                   /db_xref="GOA:D2BH41"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH41"
FT                   /protein_id="ACZ61641.1"
FT                   /translation="MAQEYIKIKGAREHNLKNIDVQIPRDKLVVVTGLSGSGKSSLAFD
FT                   TVYAEGQRRYMESLSSYARQFLGRMEKPDIDHIEGLSPAIAIDQKGVSHNPRSTVGTVT
FT                   EIYDYLRLLFARTGHPHCPECGKEISAQSVEQITDAVQTLAEGTKILILGPLVRGRKGE
FT                   YAQMFKDLRKSGYARVRVDGQIRDLSEEIELDKNKKHDIEAVVDRLVVGQAGGQGRIAD
FT                   SVETALKLGGGLVIISVVDGQDMLFSEKFSCADCGVSLGEIEPRTFSFNTPHGACPTCM
FT                   GLGAKMELDPDLIIPDKSLSLADGAISPYHTQNWYFGQLEDLARRAGFSVNKPVSTFTP
FT                   AQMQVLLYGEGGDIHKYRNRYGRVREYTSGFEGIIPRLDRLYRDSESQGVRESIEKYML
FT                   TSPCQACGGKRLRKEALSVKIGELNIADVAAMSVDEQLKWANELAGKHTIFNKREQLIA
FT                   AQILKEIRSRLGFLNNVGLEYLTIDRIAGTLSGGEAQRIRLASQIGSGLMGVLYVCDEP
FT                   TIGLHPADDTRLVETLQKLRDLGNTILVVEHDESVMRAADYIIDMGPGAGEHGGRVVAT
FT                   GNITEIMQNPASLTGQYLSGAKVIPVPEKRRNGNGQEIIIQGARQNNLKNIDVHIPLGK
FT                   LVCVSGVSGSGKSTLVTDILFKHLAQVFYGAKDRAGGADAITGTEHIDKIIEINQSPIG
FT                   RTPRSNPATYTGAFTHIRELFASVPEAKVKGYGSGRFSFNIKGGRCETCGGEGYIQIEM
FT                   QFLPDVTVPCEVCHGARYNREVLEIKFKDKTIADVLDMTVDRALEFFENFPKISSKLQT
FT                   LQDVGLGYIRIGQPAPTLSGGEAQRIKLATELSKRATGRTLYILDEPTTGLSFEDVAAL
FT                   LRVLQRLVDSGNTVVVIEHQLDVIKNADWIIDLGPGAGIKGGQIVAEGIPEEIALNKAS
FT                   VTGKYLRRVLPKLKPA"
FT   gene            456854..457405
FT                   /locus_tag="DhcVS_488"
FT   CDS_pept        456854..457405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_488"
FT                   /product="HD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_488"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61642"
FT                   /db_xref="GOA:D2BH42"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH42"
FT                   /protein_id="ACZ61642.1"
FT                   /translation="MDRQLALAEVEKRIENKNLVKHMLAVEAVMKSLAVYFGENEDEWA
FT                   MAGLIHDIDLGEVKDDMSLHSKRSAEIAAVLGANDAIRRAILVHNSAHGILPESRMEKA
FT                   LFCADPITGLITAAALVRPDKKLACVEAKSVSKRFKEKSFAAGANREQIAACSVLGLEL
FT                   DEFIRISLGAMQAVASDLGL"
FT   gene            457515..457718
FT                   /locus_tag="DhcVS_489"
FT   CDS_pept        457515..457718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_489"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_489"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61643"
FT                   /db_xref="GOA:D2BH43"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH43"
FT                   /protein_id="ACZ61643.1"
FT                   /translation="MILRTRIKELRSRYNLTQAELAETVGVSRQTMLYLEKGTYNPSLI
FT                   LAHKVAKALHADIDDVFILRDV"
FT   gene            complement(457715..460294)
FT                   /gene="sbcC"
FT                   /locus_tag="DhcVS_490"
FT   CDS_pept        complement(457715..460294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="DhcVS_490"
FT                   /product="ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_490"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61644"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH44"
FT                   /protein_id="ACZ61644.1"
FT                   /translation="MIPVKLKIKNFMCYRGEIPPFSFNGVHTACICGQNGAGKSALIDA
FT                   ITWALWGKSRAKSDDDVVSLNEQETEVSLDFEISGELYQVIRQRQRPKKTGANGQSLLS
FT                   LFAIKDGKPLNITGDTLTQTEKKIISILHMDYDTFINSAFLRQGHANQFTQQPPGKRKE
FT                   VLSNILGLEIYDQLEDLARQAVREAEAKKLLIERSIADGQEGLKSRPELAKDLELTRLD
FT                   LTDGEEKLKTHIAKLEILRHKKHAFDAKQSACLQIEKDLRDISKDQSLWLQNQQEIKER
FT                   ISTFETLIVQEADILKGYKEYSDCQSLYEKHNRILAKLRQMEKEKKPLEDAVYKEENSL
FT                   KNTLTKYQEHLKMRQETAQTLDKLEQEKIQSDQLHLELENEESALKARQTKLADMQGSL
FT                   AGLETEYAGTAREINSLEEKLKLLTEAGESRCNCPLCETKLGQDKLKLVFGKYRTEQDT
FT                   KEKQQSSLKIKLEQLRLDIQTLTAQIETETKRLNQKRRQYEGQLSVLEKGIADAKDART
FT                   KAAKGRELISDIEKQLNERSYAVSEQARLAVIEKEILELNFDNAEYTQNQQTLAGLTYF
FT                   EEQKRKLNEAQSRLPLEKDRLENTASALVELTFRHDTKLSEQQTLQKELAELPELEQEL
FT                   ETAEAGYKLLSQTQDNLRQQLGSLSQKEEQLNELEKKLKKQEQDKEQTAKEIYYFGKLA
FT                   RAFGKKDGIQTMLIEDTLPELESGADLLLSRMTDGRMHLSIETQRSTKKGDQTETLDIN
FT                   ISDELGTRNYETFSGGEAFRIDFAVRIALSRLLANRLGAPLRTLIIDEGFGTQDSTGIE
FT                   RLKEAINSIQDEFDKILVITHIDDLKDSFPTRIEIDKTPSGSAIRLN"
FT   gene            complement(460468..462030)
FT                   /gene="rpoD"
FT                   /locus_tag="DhcVS_491"
FT   CDS_pept        complement(460468..462030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="DhcVS_491"
FT                   /product="DNA-directed RNA polymerase sigma subunit
FT                   (sigma70/sigma32)"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_491"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61645"
FT                   /db_xref="GOA:D2BH45"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH45"
FT                   /protein_id="ACZ61645.1"
FT                   /translation="MPAEKDKKEFSPDDIDDDKDVEQGLADIHDEQDAEAESDKLVEPD
FT                   LKDIADTDIPAELTEEELAAEADMMPDTDEEIGPLNIDLEIPLEQVDTQGIVDDPVRMY
FT                   LHEIGRVPLLSAEDEKTLAKKMEEGKRIREIRQECLEKRGRYPSAAESFLCMLRELAQA
FT                   TEVLFQLGQELKVDTSASLKTIIHNPKLRAAIDHEIDQQLTKNISDNTGKSMAEIEQAF
FT                   INLAINSSLLPKVVLDAIPEKMTIPEISDHTNDPAFISHLERHEASLKYYLDNLEIDAK
FT                   RAERHLIQANLRLVVSVAKKHIGRGMPLLDLIQEGNIGLIRAVEKFDFHRGFKFSTYAT
FT                   WWIRQAITRAIADQARTIRIPVHMVETINKLLSISRQLSQKLGREPTPDEIALEMDLPP
FT                   EKVREIAKVSQLPVSLESPIGEEEDSHLGDFIEDQNALAPPDAASRQLLKEQIDTVLGS
FT                   LTPRERRVLQLRFGLEDGRSRTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKD
FT                   YLE"
FT   gene            complement(462031..463803)
FT                   /gene="dnaG"
FT                   /locus_tag="DhcVS_492"
FT   CDS_pept        complement(462031..463803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="DhcVS_492"
FT                   /product="DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_492"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61646"
FT                   /db_xref="GOA:D2BH46"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH46"
FT                   /protein_id="ACZ61646.1"
FT                   /translation="MNDAVEEIKQKLDIVSFIGQYTKLTKAGRTMRGICPFHSEKHGSF
FT                   FVYPEAQNWHCFGACNTGGDIFAFVMKKEGLDFKGALELLAEKAGVSLPSQINPQIRDQ
FT                   RERLYEINLAAAQYYHNLLLNSPQAESARSYLKSRGLNGQSLADFQLGYALPEWQKLYD
FT                   YLKERSYTDEELLKAGVIVRSDEGRIHDRFRNNIIYPIANYKGQIAGFGARVMDNSQPK
FT                   YRNSPQTDLFDKSSLLYGLHLASASIREKNQAIIVEGYMDAIMSHQGGFTNTVACMGTA
FT                   LTDRQIALIKRQTKNLVLGLDADSAGEEATLRAIDYENQIESEIRVAVPEGGKDPDEII
FT                   RHAPQTWQEILDNARPLLDYIFKHSQKGLDLSSAAGKAGLTDRLLPIISKMEDGVRQSH
FT                   YLGKLAEIVSTSQNRILERMKKLKNETRITKAIEKETTSTAVSAAKNPALEEYALSLLF
FT                   TSAELTRFAGKLHPEYLEIPQYRELLTVYNQSAEKDTLRAGLDENLREYYDNLMNKNAA
FT                   NDNIEDKFCDLCLRLRERYLRNLAVKLNQALSEINQPETAEYQALNDQCVKVNEELRSV
FT                   FSLKDRRNQKQRRQ"
FT   gene            complement(463805..464842)
FT                   /gene="dgt"
FT                   /locus_tag="DhcVS_493"
FT   CDS_pept        complement(463805..464842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="DhcVS_493"
FT                   /product="dGTP triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_493"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61647"
FT                   /db_xref="GOA:D2BH47"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH47"
FT                   /protein_id="ACZ61647.1"
FT                   /translation="MISELRIRERIEAREENLSPYAVKSRLSRGRQKAEDPDPVRTCFQ
FT                   RDRDRIIHSKAFRRLKHKTQVFIAPLGDHFVTRLTHTLEVTQIARTIARALNLNEDLTE
FT                   AICLGHDLGHTPFGHAGEEVLNELYPKGFHHNEQSLRVVDLLEKNGQGLNLSFEVRDGI
FT                   LNHSKSRSNILGEVHNKAATFEGQICRIADAVAYINHDILDSIRAGIIKANDLPLGAVS
FT                   VLGNSHSQRINTMVCDIIKSSWSCTGLIPGAEPEVTMSNKVLSASNTLRDFLFEQVYQS
FT                   KDRKAEHEREIVRLLYKYLVDHQDLLPMEYIALSDKPEQRVVDYIAGMTDLFALRLAKE
FT                   LNLAE"
FT   gene            complement(464839..467115)
FT                   /gene="ppsA"
FT                   /locus_tag="DhcVS_494"
FT   CDS_pept        complement(464839..467115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppsA"
FT                   /locus_tag="DhcVS_494"
FT                   /product="phosphoenolpyruvate synthase/pyruvate phosphate
FT                   dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_494"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61648"
FT                   /db_xref="GOA:D2BH48"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH48"
FT                   /protein_id="ACZ61648.1"
FT                   /translation="MQKGHEAIVWFNEVTKNDIPLVGGKGANLGEMTGAGIPVPPGYIV
FT                   TANAYFDFINSSNLRPSISKALESLDINDSKQLAVVANIVKEMILSTPLPAELATQIKV
FT                   AYEKMGQGLVAVRSSATAEDLPEASFAGQQSTYLNIEGGDEVVKAVQKCWASLFEARAI
FT                   YYRVQQNFDHLQVGIAVPVQKMVQSQASGVCFTIEPITSDPTKIVIEAIYGLGEGLVSG
FT                   EITPDLYIIDKEGPSVLSRTISHQERRLVRKNGNSASGAEDESGNNYWQPVPSAKQEQQ
FT                   KITEDDIITLAKLAMLIEKHYSGPQDIEWAKEENEIYIVQSRPVTALKDASELEPEIEA
FT                   PILLQGAAASPGLATGEVKVLQDPSEIDLVNQGDILVAEMTTPDFVPAMKRAAAIVTNR
FT                   GGRTSHAAIVSRELGIPCVVGTGEATKLLKNGQMITVDGTHGKVYNGKVTRNVKTSSIA
FT                   SIVREAIRTKTRVYVNLAQPELADKVAARNVDGVGLLRAEFIFSQIGKHPRYMIEMGQQ
FT                   EEYIQQVYEGVLSFAKAFHPRPVVYRTNDFKTNEYRDLLGGDKYEGQEENPMLGYRGVS
FT                   RYIKDIEVFKMEIEAIKRVRKDYPNVYVMLPFVRTVDELKKVKQILEDEGLKRGPDFKL
FT                   WMMVEVPSNIFLIDKFIDAGIDGISIGSNDLTQLILGVDRDSEMLRETFDERNEAVLVA
FT                   LEKAVTTAARRGITASICGQAPSVYPELTEKLVSWGITSVSVSPDMIGTTREIIAKAEA
FT                   KLKIK"
FT   gene            467416..467985
FT                   /locus_tag="DhcVS_495"
FT   CDS_pept        467416..467985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_495"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61649"
FT                   /db_xref="GOA:D2BH49"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH49"
FT                   /protein_id="ACZ61649.1"
FT                   /translation="MIEMTIDSIRVSLMNYQRVVLLKEKTSDRYLPIWIGTAEAEAIAV
FT                   KLQGVAVPRPLTHDLLGTVIDVLGAKVRSIVVDDLKNDTFYAKILLEVDSEQMEIDCRP
FT                   SDALALAVRVNVPIYAADSVLEKASIMLDREQDKRAMDEMDLPEPPAGGKGEKTRKASD
FT                   EEIKRLSAFRDFVDNLDLEDFDKRKS"
FT   gene            468043..468276
FT                   /locus_tag="DhcVS_496"
FT   CDS_pept        468043..468276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_496"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61650"
FT                   /db_xref="GOA:D2BH50"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH50"
FT                   /protein_id="ACZ61650.1"
FT                   /translation="MRFEAVMNKWGTGLQYLGLGWYIALVILLGTLGGRWLDETLDLSP
FT                   LFLLIGLLSGVFLAFYGVYRLLPKITNNGKGN"
FT   gene            468279..469223
FT                   /gene="atpB"
FT                   /locus_tag="DhcVS_497"
FT   CDS_pept        468279..469223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="DhcVS_497"
FT                   /product="ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_497"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61651"
FT                   /db_xref="GOA:D2BH51"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH51"
FT                   /protein_id="ACZ61651.1"
FT                   /translation="MPKKKILGMPKAVFWPVMIVILAMLVVGFLSGPIGVALFGDLGFP
FT                   DWMKITTPKPELPSAEIFSIGPVVITNTILTAWVTILVLVGLSIAATRKMKLIPGRLQG
FT                   ALEMVLSWIYNMCVDAAGEKFGRKFFPLVATIFLFIIVNAWMNLLPGYNTIFIELGNGH
FT                   EAHLLRGANTDINLPLALAAITFIMVEYWGIKTLGGFHYLSKFFNFKPLINAFRHKEGV
FT                   IGIFNGFITIFVGLLEFFLEFVRIISLTFRLFGNMIGGEILILMITFLAPFIIGIPFYG
FT                   LEMLVGFVQALVFCNLALVFSLIAVTPHGEENH"
FT   gene            469264..469494
FT                   /gene="atpE"
FT                   /locus_tag="DhcVS_498"
FT   CDS_pept        469264..469494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="DhcVS_498"
FT                   /product="ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_498"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61652"
FT                   /db_xref="GOA:D2BH52"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH52"
FT                   /protein_id="ACZ61652.1"
FT                   /translation="MEADVIKLLAAGLAMGLGAIGPGIGVGILGFGALQAIGRNPEAKG
FT                   SIFTNMILLVAFAESIAIFALVISIVLIFVA"
FT   gene            469519..470028
FT                   /gene="atpF"
FT                   /locus_tag="DhcVS_499"
FT   CDS_pept        469519..470028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="DhcVS_499"
FT                   /product="ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_499"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61653"
FT                   /db_xref="GOA:D2BH53"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH53"
FT                   /protein_id="ACZ61653.1"
FT                   /translation="MEKLAELGINIPSFIAQVVNFGLLLGLLYLFAYKPILAKLDERSA
FT                   RIKESMERTDQVKEQAQRAEEEFKKKIGEASQQGQLVIERAVKTGDEIRQKAIEEARAE
FT                   AEAMLSRARTEIRQERDEVVDQLRKEFAELTILAAGKVIDQSLDKKAHQALIDSVLESS
FT                   TNLRKN"
FT   gene            470049..470591
FT                   /gene="atpH"
FT                   /locus_tag="DhcVS_500"
FT   CDS_pept        470049..470591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="DhcVS_500"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_500"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61654"
FT                   /db_xref="GOA:D2BH54"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH54"
FT                   /protein_id="ACZ61654.1"
FT                   /translation="MAKRVYAIAMRYAQALYELAKEQKSLDKWQEDLQDLSSLTEDASV
FT                   AEFLSNPKIASARKQKVLAKLSNIDPLMLNLVDMLVATRRLGIMRAVSGEYNRLLNEAR
FT                   GVEDAIVTTAKPSSEADIEIIRQQLSKITGKKINVVTATDPGLIAGLKARIGDKLIDGS
FT                   VSRRLVLLQNEISQGRI"
FT   gene            470614..472125
FT                   /gene="atpA"
FT                   /locus_tag="DhcVS_501"
FT   CDS_pept        470614..472125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="DhcVS_501"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_501"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61655"
FT                   /db_xref="GOA:D2BH55"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH55"
FT                   /protein_id="ACZ61655.1"
FT                   /translation="MSARGQDIVSIIKEQIKEFGAPVSMTSVGSVIEVGDGIARIHGLS
FT                   NAKYNELLEFPGGVMGIALNLEEDSVAAVILGEDSNIKEGDEVKATGRISEITVGKGMI
FT                   GRVVDPLGRPLDGKGPIKAESTRPLERIAPNVVDRKSVNTPVQTGIKAIDAMIPIGRGQ
FT                   RELIIGDRSTGKTAIALDTIINQKGGDLVCIYVAIGQKASKVARTVALLEQYGAMEHTI
FT                   VVAANSSDAVALQYLAPYAGCAIGEEFMEQGQDALVVYDDLTKHAWAYRQLSLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARLNDKLGGGSLTALPIIETQAGDVSAYVPTNVISITDG
FT                   QIYLEPDMFNAGIRPAVNVGISVSRVGSSAQTKAMKKVASKLKMDMGQYRELAAFAQFG
FT                   TSELDKATRMQLERGQRITEVLKQGQYQPLPMANQVAILYAVLNGYLDSIEVEKVRDFE
FT                   SGFYRFLEANYASVLNNITKENAISAETETALKTALDDYKKGLVA"
FT   gene            472150..473007
FT                   /gene="atpG"
FT                   /locus_tag="DhcVS_502"
FT   CDS_pept        472150..473007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="DhcVS_502"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_502"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61656"
FT                   /db_xref="GOA:D2BH56"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH56"
FT                   /protein_id="ACZ61656.1"
FT                   /translation="MANIRIIKRRIRSVRNIAKITRAMEMIAASKMKKAQERGLAGRPY
FT                   SEKITEVIAALAALPQSGEVLHPLLERRPVKKIAVLHITPDRGQCGGLVANINRKTGTF
FT                   IMEQKVPVSAVVVGRKGVDFIRRIKQQMRAEFINLGDKPGYLDTLPISRVIMDDFMSGE
FT                   IDQVFISYTQFVSTALQKPVLEQLLPVVPLELPPGQNLEYIYEPESATVLNSLLPRFVE
FT                   MSVYHAILESIASEQSARMVAMRNATDNAKEVIGELTLIYNKARQESITNELLDIVGGA
FT                   AALA"
FT   gene            473023..474417
FT                   /gene="atpD"
FT                   /locus_tag="DhcVS_503"
FT   CDS_pept        473023..474417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="DhcVS_503"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_503"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61657"
FT                   /db_xref="GOA:D2BH57"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH57"
FT                   /protein_id="ACZ61657.1"
FT                   /translation="MANGKVIQVIGSVVDVEFSADSMPALFNALEIPRDNGKMVLEVQS
FT                   HVGNNRVKCLSFTPTDGLERGAEVIDTKRPLSVPVGRNTLGRIFNVLGEPLDNRGDVKS
FT                   EKTMPIHRSAPAMDELESSAQVLETGLKVIDLIAPFARGGKIGALGGAGVGKTVLIQEL
FT                   IRNIATEHEGFSVFAGVGERSREGNDLWHEMEDSGVLPKTTMVFGQMNELPAVRLRIAL
FT                   TGLTMAEYFRDEERQDVLLFIDNIYRYTLAGMEVSALLGRMPSAVGYQPTLATEMGALQ
FT                   ERIASTKQGSITSFQAVYVPADDYTDPGVVATFGHLDAMIALERSLAEQALYPAVDPLA
FT                   SNSRILDPQVVGEEHYKVARDVQKVLQRYKDLQDVIAILGMEELSEEDKLTVARARRIQ
FT                   RFLTQPMFVSEVFTGRPGQYVSLAETIRGFKEILEGKHDSLPEQAFYMVGTIDDAVAEA
FT                   KKLSAV"
FT   gene            474442..474864
FT                   /gene="atpC"
FT                   /locus_tag="DhcVS_504"
FT   CDS_pept        474442..474864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="DhcVS_504"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_504"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61658"
FT                   /db_xref="GOA:D2BH58"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH58"
FT                   /protein_id="ACZ61658.1"
FT                   /translation="MAKLKLDIVTAERSVFSEEVDVVVAPGIEGEMAILPHHAPLMTAL
FT                   QAGELKAKIGSEEYSMVVSGGFLEVRPDRVIVLADSAERAEEIDIARAAEAKKRAEARM
FT                   ADKYEPGMLAAETEASLRRAMIRLKVAEKRRKHPQV"
FT   gene            complement(474936..475436)
FT                   /gene="rimM"
FT                   /locus_tag="DhcVS_505"
FT   CDS_pept        complement(474936..475436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="DhcVS_505"
FT                   /product="16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_505"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61659"
FT                   /db_xref="GOA:D2BH59"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH59"
FT                   /protein_id="ACZ61659.1"
FT                   /translation="MAQEEYILIGKVLGIWGMNGGLKIGVLTDFPERFDIGNKLLIRRT
FT                   AYTVSQTSWQKAQAVIHLSEITDIDAAEELIGAPVEIPFSALKKLPEGVYYDFQLIGLE
FT                   VVGLSGEKIGQIKEILHMPSNDIYVISYGAKEALIPAVKDVVKEINLQTYKMIIDPIPG
FT                   LLD"
FT   gene            complement(475526..475753)
FT                   /locus_tag="DhcVS_506"
FT   CDS_pept        complement(475526..475753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_506"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61660"
FT                   /db_xref="GOA:D2BH60"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH60"
FT                   /protein_id="ACZ61660.1"
FT                   /translation="MKEPVEYIAKSLADEPNDVVVTEEPEEEGIKLTLKVADVDKGRII
FT                   GKQGRIAQAMRTLIRVKAAKAGKRARLEIL"
FT   gene            complement(475769..476017)
FT                   /gene="rpsP"
FT                   /locus_tag="DhcVS_507"
FT   CDS_pept        complement(475769..476017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="DhcVS_507"
FT                   /product="ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_507"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61661"
FT                   /db_xref="GOA:D2BH61"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH61"
FT                   /protein_id="ACZ61661.1"
FT                   /translation="MLKIRLTRIGAPKKPCYRIIVTEARSPRDATYTDIVGTYNPMTNP
FT                   ETVVINAEKALYWIGKGAQPTDTVARLLKKAGVVNSN"
FT   gene            476163..476834
FT                   /gene="nfi"
FT                   /locus_tag="DhcVS_508"
FT   CDS_pept        476163..476834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfi"
FT                   /locus_tag="DhcVS_508"
FT                   /product="nfi endonuclease V"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_508"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61662"
FT                   /db_xref="GOA:D2BH62"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH62"
FT                   /protein_id="ACZ61662.1"
FT                   /translation="MNVKIKKLHNWDMTPAQAIVLQRELAQKVSACGTISDIHLVAGAD
FT                   VWYSRTSGMGRAAVVVLSYPDMQLMEISRSEGDCHIPYIPGLLSFREMPLLLSAFEGLE
FT                   SIPDLVFMDGQGLAHPRRLGIASHLGLFLNKPVIGCAKSRLVGEYTALADAAGSHSDLY
FT                   HNNQLVGRVVRTRKGVNPLFISVGHKICLEEACSWVVECCRGYRLPEPIRQAHLAAAEL
FT                   I"
FT   gene            476963..478036
FT                   /gene="prfB"
FT                   /locus_tag="DhcVS_509"
FT   CDS_pept        476963..478036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="DhcVS_509"
FT                   /product="peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_509"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61663"
FT                   /db_xref="GOA:D2BH63"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH63"
FT                   /protein_id="ACZ61663.1"
FT                   /translation="MNLRAAFFLIWCDFDVSAKELEITELENASASPDFWQDQQNAQRV
FT                   MKKLAANKRTSELWRGLERRVNDLTELAVLSYEDPSLSNEIEHEISGLTAELNSLEVGL
FT                   AFSGQYDNRNALLTVHAGAGGVESQDWAGMLLRMFMRWAEKKGFGMEILDQSPGEEAGV
FT                   KSATLQIDGEYAYGFLKSEHGVHRLIRLSPFDADHARHTSFALVEIMPEAEDSVDIDIK
FT                   PEDIKIEMFRSSGPGGQNVQKVSTAVRITHIPSGIVVASQTERSQHQNREIAMRILASK
FT                   LLAVEIAKRAEERAKLKGERISAEWGNQIRSYVLHPYKMVKDHRTDYEVGNAETVLEGE
FT                   LDGFINAYLRQNIGREE"
FT   gene            478033..479259
FT                   /locus_tag="DhcVS_510"
FT   CDS_pept        478033..479259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_510"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61664"
FT                   /db_xref="GOA:D2BH64"
FT                   /db_xref="InterPro:IPR039568"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH64"
FT                   /protein_id="ACZ61664.1"
FT                   /translation="MKKQFLALGLILGILLGGLFPADASAQSSITIDKSNVNVTFPSNI
FT                   GFSITASSTSNIIDIRLFYTVDRKSFSEVYSESVLKFTPALTVSTSYYWDMRYTGGMPP
FT                   GARVNYWYRITNEDGDILVSPIQTLVYADARFDWQSISEGMLELYWYNGEQSFADELME
FT                   SAQAALVRLAADTGAELQDKITLYIYASSSDLQSAMVFPSEWTGGVAYPDFNVITIGIA
FT                   PYDIDWGKRAITHELAHQVTNQMTSNPYGDLPVWLNEGISMYAEGNLEAVYVNYLTWAI
FT                   SQDKLISVQSLCSPFSANSADAYLAYAESFTLVNYLITGYGPEKFSDLLQTFSQGAGYD
FT                   EALLAVYGFDIQDLNIQWQAALKGGTVEIQPVRSISLTPGLVVLFTLVGSGSIITAFWL
FT                   WSSRVVSRS"
FT   gene            479243..479929
FT                   /gene="radC1"
FT                   /locus_tag="DhcVS_511"
FT   CDS_pept        479243..479929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC1"
FT                   /locus_tag="DhcVS_511"
FT                   /product="DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_511"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61665"
FT                   /db_xref="GOA:D2BH65"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH65"
FT                   /protein_id="ACZ61665.1"
FT                   /translation="MSLVPSIRDLPLAEKPRERLQSLGAGVFSSAELLAVILGRGVTGE
FT                   PVLQSAQRLLAHFGGPSGIASASVEELSKLKGIGLAKACQLKAAFELAKRARGIKGEYQ
FT                   PCIKTPEDVFQIIYPLVSDEKKEYFFCLMLDVKSRLIKVGHISAGSLDESVVHPREVFK
FT                   EALSASAATVILAHNHPSGDTEPSPDDIGLSARLREAGSIMGIEVLDHIIIGGQSFTSL
FT                   KRQGLL"
FT   gene            479932..481524
FT                   /locus_tag="DhcVS_512"
FT   CDS_pept        479932..481524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_512"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_512"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61666"
FT                   /db_xref="GOA:D2BH66"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH66"
FT                   /protein_id="ACZ61666.1"
FT                   /translation="MKKILFAIFSVCLSFSLLLSGCGYAPGDTAMPTGDNVLTLIGEEP
FT                   YTLDPAKVSDISSVTYIYQIFSGLLKMGDDLTPVADIAESWEVSPDGLTYTFYLKPNVK
FT                   FHNGRVVTAADFKYSWERAASPETASGTVLTFLGDIQGVTEMVQGQATSISGVTVVDDL
FT                   TLRVKLVSPCSFFLSKISYVTAFVVDKNNVSQGSGWWKKPVGTGPFTLTELTQGNYIVL
FT                   NRNPDYYDTPAKIASVIFRLQSGQPMDLYELGGVDVAAVTADYLAKATDPDGVFAADLQ
FT                   VVPQLGFYYFAYVTSKAPFDDPKIRQAFSMAVDKARIIELCYKGSVSVAEGILPPGMPG
FT                   YNPELVGLEYNLERALELIAESSYGSVENLPTITLTTSGWAGLLAPELEAVIDQWRQNL
FT                   GVEVIVRQIDMELFLYDLQTEKDNLYYSGWVADYPHPQDFLAVLFETGASYNSGDYSNP
FT                   EVDALLARAAATLDTHESMQLYAQAEQLLINDAACFSFWFGKNYMLVKPYVKGYKLNAM
FT                   GIPILTEVTVEDH"
FT   gene            complement(481649..481738)
FT                   /locus_tag="DhcVS_513"
FT   tRNA            complement(481649..481738)
FT                   /locus_tag="DhcVS_513"
FT                   /product="tRNA-Ser"
FT   gene            complement(481983..482267)
FT                   /locus_tag="DhcVS_514"
FT   CDS_pept        complement(481983..482267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_514"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61667"
FT                   /db_xref="GOA:D2BH67"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH67"
FT                   /protein_id="ACZ61667.1"
FT                   /translation="MRSRYPALQIIIIVLKILAVLITLTGIVISIGIMVGASIISFDIA
FT                   TSFGVFAGIMGILGSLIIGVLIFASAELIQCFIDIERNTRKTVHILNSK"
FT   gene            complement(482689..483837)
FT                   /locus_tag="DhcVS_515"
FT   CDS_pept        complement(482689..483837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_515"
FT                   /product="aminotransferase, DapL-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_515"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61668"
FT                   /db_xref="GOA:D2BH68"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH68"
FT                   /protein_id="ACZ61668.1"
FT                   /translation="MLSARKRVVLLELKQFKLERYFAKYEFSAKHLMSSSDCEPLALSY
FT                   LLSLADTECRSLWQNLKLGYTYSDGHSLLRNEVAKLYEVTAPSDILTAVPEEGIFISLH
FT                   CLLEKGDHVLCTFPGYQSLYQLAENLGCEVSYWMPEEENGWKFNPDFLTQNIRPNTRLI
FT                   ITNFPHNPTGAMPDREDYARIQEIINSHKLWHFSDEMYRLMEYAPDTRLPAACDQSSRA
FT                   ISLGGLSKSFGLPGLRSGWLACRDKDMLSKMAGYKDYTTICGSATDEILSIIALRNKNT
FT                   IVSDQMKQLNRNLKLLEGFMDRHKTNFSWVKPKAGSVCFPRLNKATSCMDFCHQILEKT
FT                   GIMLLPSEVYDYGQSHFRIGFGRANFPEVLQAFENCLTGNPS"
FT   gene            complement(483824..485065)
FT                   /gene="serS"
FT                   /locus_tag="DhcVS_516"
FT   CDS_pept        complement(483824..485065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="DhcVS_516"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_516"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61669"
FT                   /db_xref="GOA:D2BH69"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH69"
FT                   /protein_id="ACZ61669.1"
FT                   /translation="MLDLKFIRENAELVRKAVADRNTDAPIDEILELDNRRRHLTQELD
FT                   NLRAKRKMMAKQRDDTAIEEGRVLRGQITELEAELSEVDEKLTDRLLRVPNIPDASVPV
FT                   GRDESENVVLYYRGEKRSFSFTPKPHWELGETLDIIDFDRGIKLSGSRFYILKGEGARL
FT                   QRALIAFMLDLHTRKHDYTEIYPPYMIKRECLVASGNLPKFADNLYHDAEEDYWWVPTA
FT                   EAPLTNLHRDEILSVEQLPIHYVAYTACFRREKMSAGKDVRGIKRLHQFDKVELYKYCK
FT                   PEDSFDELEKMVADAEEIADALKIPYRLKQLVTADISFGSAKSYDIEMYSPGVDEWLEV
FT                   SSCSNCTDFQGRRANVRFRRTSEAKPEFVHTLNGSGLALPRVMISVIENYQQPDGSIVV
FT                   PEVLRPFMGVDVIR"
FT   gene            complement(485097..486593)
FT                   /gene="lysU"
FT                   /locus_tag="DhcVS_517"
FT   CDS_pept        complement(485097..486593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysU"
FT                   /locus_tag="DhcVS_517"
FT                   /product="lysyl-tRNA synthetase (class II)"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_517"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61670"
FT                   /db_xref="GOA:D2BH70"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH70"
FT                   /protein_id="ACZ61670.1"
FT                   /translation="MPEEYLNAQKTEKLERIKSRGINPYPATFHPSHTSAQAVALLAEL
FT                   ETQENPPKETLRIAGRIMTRRDMGKISFMDIRDGSGKIQIFCRQNDMDEASIELLKDLD
FT                   LGDFIGAEGSLMRTRTGEPSLAATRITMLSKSLLPLPEKWHGLQDVEKRYRQRYLDLIS
FT                   NADARQTFLTRSRVISAIRCFMSAKEFLEVETPVLQPEAGGALARPFITHHQALDCDFY
FT                   MRIALELHLKRLIVGGFDRVYEIGRIFRNEGVSTRHNPEFTMMESYQAYADYKDVMDFL
FT                   EEMVSSVVKEISGGYTVPFGDITLDFTPPWPRLTIRDAVKQYAGIDFFDFPTKEALAAE
FT                   MTRRKLKVDPAKDWGKLVDELVGEFVEPHLIQPTFLTDHPVAMSPLAKQKPEDPRLTER
FT                   FEAICANMEIANAFSELNDPVEQRARFKEQLEKRNQLRTEEFESIDEDFLAALAYGMPP
FT                   TGGLGVGIDRLVMLLTNHDSIREVILFPALKDREDTKTQE"
FT   gene            486824..487006
FT                   /locus_tag="DhcVS_518"
FT   CDS_pept        486824..487006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_518"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61671"
FT                   /db_xref="GOA:D2BH71"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH71"
FT                   /protein_id="ACZ61671.1"
FT                   /translation="MDVSESIVPIIVGVVEVIFIVILITLGVYSLRSHRSRKQLDATRD
FT                   IQTEESSEGAFFSRD"
FT   gene            complement(486993..487781)
FT                   /gene="recO"
FT                   /locus_tag="DhcVS_519"
FT   CDS_pept        complement(486993..487781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="DhcVS_519"
FT                   /product="recombinational DNA repair protein (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_519"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61672"
FT                   /db_xref="GOA:D2BH72"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH72"
FT                   /protein_id="ACZ61672.1"
FT                   /translation="MTKPHDFKTRAIVVRKTKCGEADRILSLLTPDLGLIQGFAKSVRK
FT                   TKSKLSGHLELLCYSEVSLARGKAIDTITGSQTIQSFLNIRNSLQLSAMAFYVCELAYH
FT                   FSPEESANPSIFQLLLSTLEELDNESQAELCIKYFELHLLENSGYKPELRECANCHKKL
FT                   LATTNYYSSESGGIICPSCRNTQTGIPVSVNAVKVLRYIQENNFASICRLKVNREILSE
FT                   LELAIRANIRFVLEKEPKALFWLDSMRLADICQENSLNHG"
FT   gene            complement(487910..488632)
FT                   /locus_tag="DhcVS_520"
FT   CDS_pept        complement(487910..488632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_520"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61673"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH73"
FT                   /protein_id="ACZ61673.1"
FT                   /translation="MADIETLNKYTGLINSLKALANTDNAAGMNRFGISSTNTLGVSVK
FT                   DIRHLAKEAGHNHTLALLLWDSGIHEARIMASLIAESRKVSQTEMESWVKDIDSWDICD
FT                   LCCNNLWSKTSFAFEQALKWTYRPEEYIKRAGFVLLTTLAVHNKKAPDKKFISFFPRLL
FT                   AEASDERNYVKKAVNWALRQIGKRNLSLNQAAITLGEEILAQNTRSARFIATDALRELK
FT                   SPQVQKRLAIKQEKQPHS"
FT   gene            complement(488634..489698)
FT                   /gene="corA2"
FT                   /locus_tag="DhcVS_521"
FT   CDS_pept        complement(488634..489698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA2"
FT                   /locus_tag="DhcVS_521"
FT                   /product="magnesium and cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_521"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61674"
FT                   /db_xref="GOA:D2BH74"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH74"
FT                   /protein_id="ACZ61674.1"
FT                   /translation="MTRQSKKYSQKAGMLPGSVVFIGEGKTEKASLSLHAYTTDSYQPL
FT                   PLKTLADCSTQIKQSSGIIWVKVTGLQDTAMVEELGKCFSLHPLTLEDVVNTEQRPKLE
FT                   DYGTYLFAVIKALHWDSGLNKTRSEHISLILGKNFLISFQENQSDIFKPIQEHLKSDNG
FT                   RLRKLGADYLLYSILDMVVDGYFGLIEGFGDYLDEIEEQLLSSPSSQTLKQISEAKKEM
FT                   LFIRKSIWPVRETIASIERTENPLIDKSSHIYFRDIYDHLIQLIDTGETYRDMLSNMID
FT                   IYLSSLSNRMNEVMKVLTIFASIFIPLTFIVGIYGMNFDIPELRLSWGYPGILLLMLAV
FT                   ALLLVSFFKRKKWL"
FT   gene            complement(489736..490350)
FT                   /gene="recR"
FT                   /locus_tag="DhcVS_522"
FT   CDS_pept        complement(489736..490350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="DhcVS_522"
FT                   /product="recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_522"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61675"
FT                   /db_xref="GOA:D2BH75"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH75"
FT                   /protein_id="ACZ61675.1"
FT                   /translation="MKDTSLPSTAGAVNKLIDSLGKLPGIGPKSAQRLAFYLMRAPEEQ
FT                   VLALSDTIRSIKNQISQCRICFNVADSELCPICQNTKRETNKICVVEQPQDILALEHVG
FT                   VYRGYYHVLHGAISPTEGITSQNIRISELMSRLDNGQVDEIILATNPTTEGEATAMYLS
FT                   RLITPLGIKVTRLARGLPFGTELEYADDVTLSRAMEGRQNF"
FT   gene            complement(490372..490671)
FT                   /locus_tag="DhcVS_523"
FT   CDS_pept        complement(490372..490671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_523"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61676"
FT                   /db_xref="GOA:D2BH76"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH76"
FT                   /protein_id="ACZ61676.1"
FT                   /translation="MNMIKQAMELKSKLDKAQKELAKVVVETESAKGAIKIKMNGQQKV
FT                   LSLSISPEIINPSKPKDLENALIKAFNDAYEETKKEGSKQMQGLMGDVKIPGLM"
FT   gene            complement(490681..492369)
FT                   /locus_tag="DhcVS_524"
FT   CDS_pept        complement(490681..492369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_524"
FT                   /product="DNA polymerase III, gamma and tau subunits"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_524"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61677"
FT                   /db_xref="GOA:D2BH77"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH77"
FT                   /protein_id="ACZ61677.1"
FT                   /translation="MADMTCQVFYRKWRPQTLADLVGQEHVAHTLKNALSSGRIAQAYL
FT                   FCGPRGTGKTSTGRILAKAVNCTTNQGKGEPCNTCPMCLSITEGSSMDIIEIDAASNTG
FT                   VDDIRELKEKVQYSPSLANYKVYIIDEVHMLSNSASNALLKTLEEPPPRVIFILATTEI
FT                   HKVLPTIMSRCQRFDFHRVSLSDMTRKLDKISKAEDINIEPEALKLIARSAGGSFRDGE
FT                   NLLQQIATTYGAEISLSQVQAALGISGDERIKTLAENILKKDIKNGLKTLNAVVADGLD
FT                   LKQFRRELLDYLRQVMLVNSGAESSLELTTDEKKALQKVSAITNLEGITKAIKAFSQLD
FT                   FSSDTASSLSFELALVDASLNPDTAPATILPQAELPAPKAEKPAVSNEPPQKEAQAETQ
FT                   DKTKDASEPTAASKPHAKESAPKLTRAAIPIDEKLKYTTPAPPKEEEKVLIGAGDVIEQ
FT                   LKVSWKNILDQAPDNLKRSAAVAILRSAGVRPVSIEKNVVTLSFKYKYHKDKIEELENR
FT                   KVTAEIISNFVGKTCTLVCISEAETNHLVKEAQKLGAQIISVEEK"
FT   gene            complement(492530..492721)
FT                   /locus_tag="DhcVS_525"
FT   CDS_pept        complement(492530..492721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_525"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61678"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH78"
FT                   /protein_id="ACZ61678.1"
FT                   /translation="MFEIYSLYNCELNKESRVQAENYRRLHPTRPAKPEYPLILPQGKP
FT                   IASAGKRTISHHYFPTRS"
FT   gene            complement(492754..493176)
FT                   /locus_tag="DhcVS_526"
FT   CDS_pept        complement(492754..493176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_526"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61679"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH79"
FT                   /protein_id="ACZ61679.1"
FT                   /translation="MSENAKKILQMLSEGKITVDQANKLLEALGNEDAKPAPAAAITAK
FT                   GVPKYLRVIINGTDEDSNAKVNVRVPMALLRAGIKLASILPADATNEIDSNLKEKGVNF
FT                   DFKNLREEDIEPLIEAMTEMEVDVDSEGSKVKVFTE"
FT   gene            complement(493192..493476)
FT                   /locus_tag="DhcVS_527"
FT   CDS_pept        complement(493192..493476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_527"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61680"
FT                   /db_xref="GOA:D2BH80"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH80"
FT                   /protein_id="ACZ61680.1"
FT                   /translation="MYWPPMLFWVGIPFGKHSRSFPLILPLFLVYPIVLALMIVFAPFM
FT                   LLAILLTWSSGKGRFLLLVGPYSYRLWCALRGMNADIRDNKTRIKVQFI"
FT   gene            complement(493476..493850)
FT                   /locus_tag="DhcVS_528"
FT   CDS_pept        complement(493476..493850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_528"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61681"
FT                   /db_xref="InterPro:IPR018658"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH81"
FT                   /protein_id="ACZ61681.1"
FT                   /translation="MAKDWQELTKLTQGTAVTVERVKLVSSGIAIEGSFDLPALARLSA
FT                   EDQVFVMAFVKCHGSIKDMEKFFGISYPTVKNRLQRIGANFSFVENFPTPPKTNEDDNI
FT                   LTELEKGGISVEEALRRLQR"
FT   gene            complement(494054..495232)
FT                   /locus_tag="DhcVS_529"
FT   CDS_pept        complement(494054..495232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_529"
FT                   /product="GTPase domain, tubulin/FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_529"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61682"
FT                   /db_xref="GOA:D2BH82"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR032907"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH82"
FT                   /protein_id="ACZ61682.1"
FT                   /translation="MKLIVIGLGQCGSRIADEFARMDKRARSQRNVSICPGVFAVNTDQ
FT                   ADLSGLVTIKPDHQHRILIGGRKTGGHGVGKINELGAEIARADADKVIDALRTTKRFYD
FT                   ADGFLVIAGAAGGTGSGSVSIIAQHIKERYMDKPVYALIALPFEHEEKTEERTVYNTAV
FT                   CLKSISSVADAVILVENQRYVRKDFSLRYNLSKINSLIVEPFWDLLCAGEEKNSKYIGA
FT                   KTMDAGDIIQTISGWTVIGHGKARVRTLTLPFDKTDHFRMKSVSNYKGIRAMDEAVSEL
FT                   SLKIDPRDAGRALFLISAPAKEINMDIIKEQGDWLREMAPNAIIRNGDYPREKDTMTVT
FT                   VIFSELSDLERVRYYYNRSTSMMPVIKQRQADLADRRRDIDELSRDIPSLLE"
FT   gene            complement(495327..496331)
FT                   /gene="gap"
FT                   /locus_tag="DhcVS_531"
FT   CDS_pept        complement(495327..496331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap"
FT                   /locus_tag="DhcVS_531"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_531"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61683"
FT                   /db_xref="GOA:D2BH83"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH83"
FT                   /protein_id="ACZ61683.1"
FT                   /translation="MVTRIGINGFGRIGRITLRTINQYHRGELEVVAVNDLADNKSNAH
FT                   LLKWDSTYGKYPGTVESDDCSIIVDGKPIKVFSERDPMQIPWETAGVDLVIESTGLFTD
FT                   AAKASAHLRGSIKTVVISAPAKGEDITVVMGVNEDKYNCNTHRVISNASCTTNCVAPLI
FT                   KVLHDKFGVKKGFMTTCHAYTNDQKIQDMFHKDIRRARAAAVNVIPTTTGAAKAVALVL
FT                   PELKGKLDGISFRIPSASVSLVDFVGELGRNVTVEEVNAAFKEAAQGKLAGILEYCEEE
FT                   LVSSDFKGNPASSIIDAPSTMVLGGNMVKVLSWYDNEWGYSTRLGDLIAYISK"
FT   gene            complement(496361..497371)
FT                   /locus_tag="DhcVS_532"
FT   CDS_pept        complement(496361..497371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_532"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61684"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH84"
FT                   /protein_id="ACZ61684.1"
FT                   /translation="MKNNGHPKYIGITTTVPIEILLSAGYSPLDLNNIFISDPNPERLI
FT                   RLAEKDGFPLNCCAWIKGIYGVCLDKGISEVICVTSGDCSNTQMLREVLNLKSIRTIPF
FT                   DFPTEPNPAEVKASLSKLAIRLGTTLEAAEEWRKKLSPARELAHRLDYLCYAENKVSGF
FT                   EDHYWLVSSSDFNSDYVKYQADLQKLLNTAKSRTPYPSTELRLAYLGVPSVFGQELYPY
FT                   LEQNGARVVFNEIQRQFSLPEGGADISRSYTAYTYPYPMEYRLRDIQTQLTERRIDGII
FT                   HYVQAFCHRAIGDIILRQKLPLPMLTLEGNADFHLNQHQKTRLEAFLDMLKAKNR"
FT   gene            complement(497511..498797)
FT                   /gene="eno"
FT                   /locus_tag="DhcVS_533"
FT   CDS_pept        complement(497511..498797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="DhcVS_533"
FT                   /product="enolase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_533"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61685"
FT                   /db_xref="GOA:D2BH85"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH85"
FT                   /protein_id="ACZ61685.1"
FT                   /translation="MSAVVKSIKAREILDSRGNPTVEADVVLSDGSFGRAVVPSGASTG
FT                   SHEAVELRDGDKSRYNGLGVQKAVTNVNTTIAKAISGFKASDQQRLDNLLIELDGTPNK
FT                   AKLGANAMLATSLAVAHAAAASCHMPLYRYLNNCDEYILPVPMFNILNGGKHASNSTDF
FT                   QEFMVMPTGAKSFAEALRMGTEVYHSLKKVLKGMNQNTTVGDEGGFAPSLPTNKDAVEV
FT                   ILKAIEKAGYRPGEDIFIALDPASSELYHEGKYTLATENKTLSSAEMVDYWCGWVGKYP
FT                   IISIEDGLFEDDWDGWKMLTKKIGSKVQLVGDDFYVTNIKRLERGIQEKASNSILIKLN
FT                   QIGTLSETIAAIKMANNSAWTAVVSHRSGETEDTTIADLAVAMNAGQIKTGAPCRAERT
FT                   AKYNRLLRIEEELGGKAKYPGKEAFFNLK"
FT   gene            complement(498816..499304)
FT                   /locus_tag="DhcVS_534"
FT   CDS_pept        complement(498816..499304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_534"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61686"
FT                   /db_xref="InterPro:IPR005268"
FT                   /db_xref="InterPro:IPR041164"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH86"
FT                   /protein_id="ACZ61686.1"
FT                   /translation="MLFMDNKRIFIAVIGASKATPEETRLAEEVGKELALRQVTLVCGG
FT                   MGGVMEAACRGASLNGGLTIGILPGNSREEANPYVQIPIISSIGFARNVMVVKSAQAVI
FT                   AVGGAYGTLSEIAYALQSRLPVITLNSWSMSQNGKADGAVIKAGNAIEAVTMALDLIN"
FT   gene            complement(499343..499912)
FT                   /gene="pth"
FT                   /locus_tag="DhcVS_535"
FT   CDS_pept        complement(499343..499912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="DhcVS_535"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_535"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61687"
FT                   /db_xref="GOA:D2BH87"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH87"
FT                   /protein_id="ACZ61687.1"
FT                   /translation="MKLIIGLGNPGKEYSGNRHNVGFQCLSRFAKDNHISLDKKCCLSR
FT                   TGSGRINDEEIVLAKPQTYMNLSGKAASQLLRRYNLKAADIIVVQDDLDLPAGKIRLRL
FT                   GGSAGGHNGISSIITDIGTKEFIRLKIGIGKPDSRNNGTEVVDHVLGNFGGEEREIMEK
FT                   AITRASEALTCLLTCGLDTASNRFNS"
FT   gene            complement(499912..501954)
FT                   /gene="dnlJ"
FT                   /locus_tag="DhcVS_536"
FT   CDS_pept        complement(499912..501954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnlJ"
FT                   /locus_tag="DhcVS_536"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_536"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61688"
FT                   /db_xref="GOA:D2BH88"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH88"
FT                   /protein_id="ACZ61688.1"
FT                   /translation="MEDMFSPQTEIENLRREINRHNQLYYVQDNPEISDSEYDALLRRL
FT                   KELEEAHPELVTPNSPTQRVGAEPLKAFGIVNHPYPLLSLANAFSDTELEAWYLRVKKL
FT                   LGNAAFQIDCEPKMDGLAVALTYRNGKFTTGATRGDGFQGENITRNLRTIHSIPLNTEE
FT                   DAPPVFEIRGEVYLPKEGFAKLNCERADKGLSLFANPRNAAAGSLRQLDPLVTAERPLD
FT                   IFIYALGYAEDSLLPDSHWQILEYFSRLGFRINPRNRLVNTLAEAKEYYREMTENRDSL
FT                   PYEADGVVFKVDSVSLQKKLGDAGREPRWAIAYKFPAEQVTTLLRKIGISVGRTGTLNP
FT                   YAILEPVNVGGVVVKQASLHNEDDILRKDIREGDTVVIQRAGEVIPEVVAPVLAKRSPE
FT                   SKPFSMEETLFNPKLSRPACPVCGGEIYRPAGEAMHYCANVSCPAQFERQLEHFVSRGA
FT                   MDIRGIGESLSVILAQEGLVKNVSDLYYLTAADLLKLPRMGEKSADNIIKAISDSKSRP
FT                   LDRVIFGLGIRHVGNETAALLSSRYGDIWALAGAGLDKLQTIPDIGAKIASSIKAYFSE
FT                   EKNIAVIRRLETAGVKLASDQKPSHKSLPLSGVEFVVTGKLESLSREETQQKIRSLGGT
FT                   AKDNVTKATRYLVVGADAGSKLAKARSMGVKELSEQELINMLEQS"
FT   gene            502090..503418
FT                   /locus_tag="DhcVS_537"
FT   CDS_pept        502090..503418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_537"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61689"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH89"
FT                   /protein_id="ACZ61689.1"
FT                   /translation="MAEVRAFHGLRYNPMFVDDMADVICPPYDIISPEQEKALKERSPY
FT                   NYIRLEYSQPIPQDNVVDNRYTRAAAILEKWIGERVITAEKKAAIYIHDHYFSVFGKQY
FT                   KRRGIIARVRLEEWDRMVIRPHEGTLSEPKRDRINLISAVRANTSPVYGLYQDIEKDVS
FT                   RLLELQTESKPVVSMNIEGERHELWVVTDDSAIAKVTALFDKKPIYIADGHHRYESALT
FT                   YRRERLAGNPQLPSDDPVNFVMMTLVDFADPGLVVLPAHRLLGGMDANTLSNLKTKLAS
FT                   FFDVTTITAKLPGAWDTLDKALREEGKIRLAMYGLGGTENFTLLTLREVETASNLMPYF
FT                   HSDIYKKLDVSVLDHIILEELMGLKTVEDPRISFNFDRNDVVSRVKSGEFQMAFILNPM
FT                   KAEIIKAISDVSDRMPRKSTYFFPKLPSGLVVYRFDSEASTKK"
FT   gene            complement(503491..504078)
FT                   /locus_tag="DhcVS_538"
FT   CDS_pept        complement(503491..504078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_538"
FT                   /product="SNO glutamine amidotransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_538"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61690"
FT                   /db_xref="GOA:D2BH90"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH90"
FT                   /protein_id="ACZ61690.1"
FT                   /translation="MKIGVLALQGAFREHIHMLRTLGAEAVEVRKAEELPELSGLIIPG
FT                   GESTTITKLLYTFGLAKPIKDLARNGMPVWGTCAGMICLAKELSGDISGVKTLELMDIT
FT                   VRRNAFGRQVDSFEAMLKIKGLEGGDFPAVFIRAPLVEKTGKDVDILAKLPDGIIVAVR
FT                   ENNLLATSFHPELSVDNRFHRYFIQMAKDYKP"
FT   gene            complement(504152..505732)
FT                   /gene="serA"
FT                   /locus_tag="DhcVS_539"
FT   CDS_pept        complement(504152..505732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="DhcVS_539"
FT                   /product="phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_539"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61691"
FT                   /db_xref="GOA:D2BH91"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH91"
FT                   /protein_id="ACZ61691.1"
FT                   /translation="MKKVLVSDALSATGLSPLKEIAQVDVKTGLKPEELVSIVGEYDAL
FT                   LVRSQTQVTADIINAGKKLQVIGRAGVGVDNIDLKAATGNGIIVVNAPTGNTISATEHT
FT                   LALMLSMARHIPRANASLKSGQWKRNEFVGSELKGKTLGIVGLGNIGSEIAKRALALEM
FT                   RVIGYDPFISMERAKKLQAELVPFEDLLKQADFITLHVPMTGQTKGLIGPKELEMMKPT
FT                   VRLINTSRGGIIDEEALATAIKEKRIGGAAIDVFSKEPCTESCLFECDNIIVTPHLGAS
FT                   TAEAQELATSDVVKQVIDVFEGRPARYAVNAPYISAESLPVVGPFMPVARTVGSLVSQL
FT                   TDGHMKNVTIKYCGELAAYDTTALKALVLGGILEHISEERVNVVNADIVASQRGLGVTE
FT                   QKESACQNFSSLITVTIDTDNGKSNTVAGSLVRGDVHIVKLNDYWIDIVPTGGYFLFAD
FT                   HIDRPGLIGAAGKITGDADINISYMHLSRQKARGQALMILALDEPLPEKQRQQLLSLQD
FT                   VQTVQVVKI"
FT   gene            complement(505734..506822)
FT                   /locus_tag="DhcVS_540"
FT   CDS_pept        complement(505734..506822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_540"
FT                   /product="aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_540"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61692"
FT                   /db_xref="GOA:D2BH92"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH92"
FT                   /protein_id="ACZ61692.1"
FT                   /translation="MQNLRIPGPTPCPEEVLTAMGQQMINHRGPEMAAIMKEVAEKLKY
FT                   FFQTKNDVLVLTGSGTGGLEAAAVNFLSPGETVLSVSIGVFGERFAKIASIFGAKIIAL
FT                   NFEHGKAADPALVKKALAEHPEIKAVLVTHNETSTGITNDLKSLASVVKGAGKLLMVDA
FT                   ISSLSSIDLPVDEWGCDVVVSGSQKGWMVPPGLAFISVSPDAWKAHAESKMPRFYWDLA
FT                   KHKASIEKGQTPWTPCVSVIVALHKALIMMEKEGMQNIFKRHQKIADFTRKGVKELGLT
FT                   LLAEEKYASNTVTAVLATEGLDPKKLLKVMREEYNTVLAGGQGPLEGKIFRIGHLGWVT
FT                   ENDIKVTLDNLKLALPKAGFRS"
FT   gene            complement(506882..508072)
FT                   /gene="tyrS"
FT                   /locus_tag="DhcVS_541"
FT   CDS_pept        complement(506882..508072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="DhcVS_541"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_541"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61693"
FT                   /db_xref="GOA:D2BH93"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH93"
FT                   /protein_id="ACZ61693.1"
FT                   /translation="MNQAENRIDQILKRGVAEVIVEEDFKKLLLSGKKLRLKEGFDPSS
FT                   PDIHLGHMVALRKLRQLQDLGHQVVLIVGDWTAQIGDPSGASVTRPMLSAEQVKANAKT
FT                   YLEQFFKIVDKDKTEVRWQSEWYANFKLEDVVRLSSKFTVAQMLARDDFAKRYAAGKPI
FT                   SVTELLYPMLQAYDSVMVKSDVEFGGTDQKFNLLVGRELQEMLGQKPQQVLMVPILVGT
FT                   DGVHKMSKSLGNYIGVAEEPTEIFGKCMSIPDELILQYFELVTDIPATEIADFKNQMAN
FT                   GLINPMVLKKRLARELITQLYSTAAAEEADAQFTRVVQRGEIPEDMPECRLENGKSICV
FT                   IDFIIKADLAKSKSEARRLLEQGGVEINSAKISDPGTTVKCGDIIKAGKRRYSKAV"
FT   gene            complement(508079..508996)
FT                   /gene="ribF"
FT                   /locus_tag="DhcVS_542"
FT   CDS_pept        complement(508079..508996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="DhcVS_542"
FT                   /product="FAD synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_542"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61694"
FT                   /db_xref="GOA:D2BH94"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH94"
FT                   /protein_id="ACZ61694.1"
FT                   /translation="MTLLEEEIIRHSSDQDTLVTIGIFDGVHLGHQHLINELKKQAKER
FT                   NLQSCLITFKDHPSKVLGQDDIKLILSLEERNLALSQMGLDQIIMLSFTPEISTVSATD
FT                   FVGYLLDHLHMKGIVVGSDFALGKNRAGDATALRRLSHIMDFSVSVVSPVVIENQIVSS
FT                   TAIRRALLSGNVSKARLMLGRNYHLRGTVQNGANRGTKLGFPTANLTLPGYLALPADGV
FT                   YAAKAFLGEKEYNAVANIGSCPTFGQEEHRLEVHLLDFAGDIRGQVLKVEFVEFLRPEI
FT                   CFADAEALKTQISADISKARDILR"
FT   gene            509401..513219
FT                   /gene="rpoB"
FT                   /locus_tag="DhcVS_543"
FT   CDS_pept        509401..513219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="DhcVS_543"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_543"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61695"
FT                   /db_xref="GOA:D2BH95"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH95"
FT                   /protein_id="ACZ61695.1"
FT                   /translation="MVSMLPKADAATGVIRKSYAQLPEVVNVPNLIEMQLQSFVWFQEE
FT                   GLRELIEEISPIKDFVGNRLELEFIGYEFREPRLSEYECTQRDQTYSVPLYVKARLIVK
FT                   TTGEIKEPFDLFFGDIPLMTALGTFITSGTERVVVSQLLRSPGVYFTISDDPATGRPLC
FT                   HTNLIPSRGAWLEFETSNRDVISVKIDGRRKIPVSTLLRAIGYSDDLDILNLFEVIDND
FT                   PERHYIQSSIDRDPLIKDEISALIDIYNRLRPGDPPNADNARKLINEMFFDPQHYDLGK
FT                   VGRYKVNRRLELPAREVGENRALTREDIVAIIQRIIMVNNGQDTPDDIDHLGNRRIRTV
FT                   GELVQNQFRIGLVRLERVARERMSIVNLEMVTPSALVNIRPVVSAVKEFFGGSQLSQFM
FT                   DQTNPLAEITNKRRLSAMGPGGLSRERAGFDVRDVHYSHYGRICPIETPEGPNIGLIGS
FT                   LATYSRINRYGFVETPYRKVYSKLKNSDKKLVGLKLKTEVSEKGKVLAAAGTIITEDSF
FT                   KLISKLPECDIQVMPFVSAEVKYMPADEEDRYIIAQANTRLDDKGYFLDERIEARLAER
FT                   YVIEPPEKIDYMDVSPKQIFSVAASLIPFLEHDDANRALMGANMQRQAVPLLRAEAPMV
FT                   ATGMEREAARYSGQVIFAKRAGVATSVTSEKIIIRTANGGHDEYLLKKFVRTNQGTCIN
FT                   QHAVINKGQKIEVGQVLADSSATENGELALGQNCVVAFMSWQGFNYEDAIILSERLVRE
FT                   DAFTSIHITKHELEARDTKLGVEEITRDIPNVGEESLRELDEDGIIRIGAEVGPDDILV
FT                   GKITPKGETELSAEEKLLRAIFGEKAREVKDTSLRMPHGEWGKVINVRVFSRDSGDDLP
FT                   ARVNKWVQVWVAQKRKVSVGDKLAGRHGNKGVISIIAPVEDMPYLPDGTPVDVVLNPIG
FT                   VPSRMNLGQILETHLGWAGHLLGFRVATPVFDGADDTAIEDALARSWLSTKAGAIDMSP
FT                   ENKRPSADNAKAIEWIKQQGFDGKKIFDEKHPGLAKEVSLKLWLKDMGVDASALSGAEL
FT                   EKRAYEVSSQNRLPSPIVGKSVLRDGRTGETFDQPVTVGNMYILKLIHLVEDKVHARAT
FT                   GPYSLISQQPLGGKAQFGGQRFGEMEVWAMYAYGTAHNLQEMLTIKSDDIAGRAKAYES
FT                   IVKGEDVLQPGVPESFKVLVKELQSLGLAVEVINEEVKIAPSEKVASLNEGSPPGSDDI
FT                   SAEILPETLYAGTEDIEDSMMSVIDADDQDLAMSSNDEEVSENDERS"
FT   gene            513206..517093
FT                   /gene="rpoC"
FT                   /locus_tag="DhcVS_544"
FT   CDS_pept        513206..517093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="DhcVS_544"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_544"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61696"
FT                   /db_xref="GOA:D2BH96"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH96"
FT                   /protein_id="ACZ61696.1"
FT                   /translation="MNEVNDFDAIRISLASPDQIRSWSYGEVTKPETINYRTLKPERDG
FT                   LFCERIFGPIKDFECACGKYKRIRYKGIICDKCGVEIARAKVRRERMGHIELACPVGHI
FT                   WFTRGIPSRVGLLLNLSTRSLERIIYYSHFIITAVNDEAREKAIKDLEVISSQRVADKG
FT                   SEVDTKVAQMEAEDATVEAINQVRRDFSAEREQMEEDIQLLIDQLKDLQIGNLLTENQY
FT                   YELKQRFSNVFEASMGAEALLKLLSYIDMDKERSKLIQETRSTSGQRRKKAGKQLQLVE
FT                   AFRRSSNKPEWMIMTVLPVLPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLQHLME
FT                   IGAPEIIIRNEKRMLQEAVDSLIDNGRRGKSVAVNGDHKAKSLSDLLRGKQGRFRQNLL
FT                   GKRVDYSGRSVIVVGPSLKLSQCGLPRRMALELFKPFVMHRLVRDGLAPNIKSARRLVE
FT                   RARPEVYDILEEVVKERPVMLNRAPTLHRLSIQAFEPVLIDGSALRLHPLVCSAFNADF
FT                   DGDQMAVHVPLSKAAVKEARETMLSIHNMMLPSSGEPVVSPSLDMVFGCYYLTTTRPGA
FT                   KGEGKVFSDFEEAKHYYEMGIIDLRAIIKVRDGKGNMLETTTGRIIFNDVLPKAVEFQN
FT                   MDIPKSAIKKIIGRCYKILSSQDMAIMLDKIKQLGFKYATSSGISIAMSDISVPREKAK
FT                   LVAAADERTAISEGQFARGLITEDERYNSIIETWMETTDRITDAIQAGFDKQGSVYMMA
FT                   NSGAKGNISQIRQMAGLRGLMTNPSGRIIDFPIKSSLREGLTALEYFISTHGARKGLAD
FT                   TALRTSGSGYLTRRLIDVTQDVIILQEDCGTSNGTWIVEPKEKGMLPPLVDRVLGRWAA
FT                   HNVVHPQTGEIIVENNEEIDEAKAKAIGEAGITEVFVRSPLTCEATHGMCRRCYGRDLG
FT                   RVRLVDMNTAVGIIAAQSIGEPGTQLTLRTFHTGGVVGVDITTGLPRVEELFEARPPKV
FT                   QSIISEIDGAVEVIENENGRHIRIASDEVYQDEYELPSGWKTQVQSGQWVDSGMVLASP
FT                   EMEGKSKAVVQSDQNVVARVAGEVSVDGNLITIKYSESEEREYAIPAAMQIKVKTGDSV
FT                   RAGQQLTDGSINPQDILSILGRDAVQKYLVEEVQKVYYSQGVHINDKHIEVIARQMLIK
FT                   VRIDSSGDTDLVPGELVDKFRYEDINAKVLAEGGEPATAHTVLMGITRASLSTESWLAA
FT                   ASFQETTRVLTDAAIYGKVDKLSGLKENVIIGKLIPAQCKSCKEATVERAERIAAAASA
FT                   PAVSSLPENCL"
FT   gene            517267..518316
FT                   /gene="ruvB"
FT                   /locus_tag="DhcVS_545"
FT   CDS_pept        517267..518316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="DhcVS_545"
FT                   /product="Holliday junction DNA helicase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_545"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61697"
FT                   /db_xref="GOA:D2BH97"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH97"
FT                   /protein_id="ACZ61697.1"
FT                   /translation="MSEEKERLISGKLAADDAKLDTSLRPRCLPDFIGQKRLKDNLGVA
FT                   IQAAKQRGEALDHVLLYGPPGLGKTTLSHIIALEMGVNIRITSGPAIERQGDLAAILTN
FT                   LKPFDILFIDEIHRLSRNVEEVLYPAMEDYALDIMVGKGPGARSLRLKLPHFTLIGATT
FT                   RYAMLSAPLRDRFGSIFRLDFYDEEAIYDIVRRSARILGVEADENGLHQIACRSRGTPR
FT                   VANRLLRRVRDYAQVKGNGLITGDIAAESLACLEVDKLGLDEIDHKVLKTIIHKFGGGP
FT                   VGLETIAAAISEEADTIMDVYEPYLLQLGFLERTPRGRQATRLAYQHLSIPYPADKNTQ
FT                   QGLWTENGT"
FT   gene            518306..518854
FT                   /locus_tag="DhcVS_546"
FT   CDS_pept        518306..518854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_546"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61698"
FT                   /db_xref="GOA:D2BH98"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH98"
FT                   /protein_id="ACZ61698.1"
FT                   /translation="MAPKLLLHGCCAHCTAYSFKYWQEQGFLVSVYWYNPNIHPFTEHQ
FT                   SRLEAMEKLSDEMGFELITEPSYQMAEYFKNVAANVDGRCRICFDMRLGQTAAYAAQHG
FT                   YEYFSSSLFISPHQKHADAVCAAEISAKEAGIKFAYADLRKRYSDSRHITKPLDLYRQQ
FT                   YCGCIYSEYERFGKADSPA"
FT   gene            518930..519565
FT                   /gene="rimI"
FT                   /locus_tag="DhcVS_547"
FT   CDS_pept        518930..519565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="DhcVS_547"
FT                   /product="ribosomal-protein acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_547"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61699"
FT                   /db_xref="GOA:D2BH99"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2BH99"
FT                   /protein_id="ACZ61699.1"
FT                   /translation="MAYLIRPIKDEDIPELNQLDKEAFPTMWPATNFKREMENIMAHYM
FT                   VLVDEDVSAAAKPVLSIWKRLRNCIRHDTGTIQQAVDCPKVIGYGAIWVMAGSAHLVSV
FT                   AVREAYRRKGFGELLLISSLKEAIKHKCFEMTLEVRVSNIVAQNLYLKYGFAIKGIRKK
FT                   YYLDNHEDALIMTLDSIDSPDFTSKLEEYKNSHTRKWKTTPGMAELAS"
FT   gene            complement(519584..519811)
FT                   /locus_tag="DhcVS_548"
FT   CDS_pept        complement(519584..519811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_548"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61700"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHA0"
FT                   /protein_id="ACZ61700.1"
FT                   /translation="MMVKIPCPDCGVIGSFSLADEVYEGPYKCWKCRKLFKIRIERGTV
FT                   KLCEPIDEAEFERLKSLGDLKRKSRGGDEE"
FT   gene            complement(519876..520415)
FT                   /locus_tag="DhcVS_549"
FT   CDS_pept        complement(519876..520415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_549"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61701"
FT                   /db_xref="GOA:D2BHA1"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHA1"
FT                   /protein_id="ACZ61701.1"
FT                   /translation="MVNNSCKRGQRPSMIIPTIILAVAAVVVSVIAYNKNGAHVEGFKA
FT                   AWDIFIQVLPMMVLAFVIAGMLRVIIPEETVSQWLGQESGFKGVLIGTAVGGLMPGGPY
FT                   SCMPIAAGLLGGGAGAGTMVAFMTGWSLLAVNRLPLEIGMLGWKFALIRLAVTALMPIA
FT                   AGMLANALFSKVNLLE"
FT   gene            complement(520444..521118)
FT                   /locus_tag="DhcVS_550"
FT   CDS_pept        complement(520444..521118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_550"
FT                   /product="methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_550"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61702"
FT                   /db_xref="GOA:D2BHA2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032873"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHA2"
FT                   /protein_id="ACZ61702.1"
FT                   /translation="MNEQNFTSQSQVFDRIAAGWYSFRHRSIFSPELSALAEKWQTGKL
FT                   LNAGCGCGADFIPFKNNFELYGIDFSAEMIDQAGKYARKHGFKPNLAVADMQNLPFKDA
FT                   EFDWLIAVASFHHLKGPDSQLKALNEFGRVLKDNGQIFLTVWNRLQPRFWFKGRETLVP
FT                   WKSQDQILMRYYRLYTCWEIEALVKKAGFRVVSSSGEKSHRGPKYFARNICLILEKQTL
FT                   KK"
FT   gene            521163..522542
FT                   /locus_tag="DhcVS_551"
FT   CDS_pept        521163..522542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_551"
FT                   /product="radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_551"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61703"
FT                   /db_xref="GOA:D2BHA3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR034687"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHA3"
FT                   /protein_id="ACZ61703.1"
FT                   /translation="MKKLSRTISGVTPVAVMTKPLPCPGKCIYCPTFDATPQSYTPESP
FT                   AVLRAKSCEYQAYKQVALRLRIIQDMGHPTDKVELIVMGGTFLSADTAYQYGFIKDCYD
FT                   ALNGIVAGSLEEAKTINETAQHRCVGLCIETRPDICGETEIQRMIDFGTTRVELGVQML
FT                   DDDIYKLVERGHTVADVAEATRLLREYGLKVHYHWMPGLPGSAPEKDLALSRMVFEDPR
FT                   FCPDGLKLYPTMVVEGTVLEEWWKEGRYTPYPSDIMTGLIADIKALVPPYVRISRVLRD
FT                   IPAVFISAGLKDSLRDGVRQILESRHQKCRCIRCREYGHRQRKGQTSGEPTLRRLDYPA
FT                   SEGNEIFLSFEDSSDTLYGLLRLRIPRLSLPVPDKKYGGKIGLVRELHVYGIELSLGEQ
FT                   RDQSAQHRGLGRKLVAEAERLAHDEYGLSSLAILSGVGAREYYRSLGYELSAGYMCKRL
FT                   A"
FT   gene            522758..523696
FT                   /gene="vhuG"
FT                   /locus_tag="DhcVS_552"
FT   CDS_pept        522758..523696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vhuG"
FT                   /locus_tag="DhcVS_552"
FT                   /product="nickel-dependent hydrogenase, group 3, small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_552"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61704"
FT                   /db_xref="GOA:D2BHA4"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHA4"
FT                   /protein_id="ACZ61704.1"
FT                   /translation="MVRVAEEWFAVCGGCELSILDIGEPLLDVLPNLKIVHMPVLMDHK
FT                   LLGQKGDGIKYEIPEADLGIITGGIRNEENRELALEMRKKCKLIVALGTCACFGGIPAL
FT                   ANLSTTEDMLKQVFSKEKGTDPASPPGDKSLPKMLDRVYAVDEIITVDIHLPGCPPTPA
FT                   HIVELLTAVLAGKTFALPERSVCDTCPTIREKQSTGGSIKRPLQNAQFTPGRYDNMRCL
FT                   NEQGLFCLGPVTKAGCNRILGADPSEEIPRCIKAYMPCRGCFGPVRKGSNPTADIMGSL
FT                   SYIGRDPKEIVDRVATINRFIGSGRLRPQDK"
FT   gene            523726..525165
FT                   /gene="vhuA"
FT                   /locus_tag="DhcVS_553"
FT   CDS_pept        523726..525165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vhuA"
FT                   /locus_tag="DhcVS_553"
FT                   /product="nickel-dependent hydrogenase, group 3, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_553"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61705"
FT                   /db_xref="GOA:D2BHA5"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHA5"
FT                   /protein_id="ACZ61705.1"
FT                   /translation="MKQITIQPVTRIEGAAKVVINLDNSGNVSDARMHIIELRGFEKFC
FT                   IGRPVEEMPRITPRICGVCPLSHHLCSAKACDNVFGVTPPSAGRKLRELANAAAYLEEH
FT                   ILHFFFLAGADLVMGPGENYSMRNVFGIAQKMPELGQKVIRSRHLASKMLDYLLGKDIH
FT                   PVAAVAGGFSKPLTETEREKMMEMAKELLEFSKFSIAYAKENLFSKYESLIKEIGVIKT
FT                   GFLGTVDKNGALNQYDGNLRLMRPDGKFTEFSPKDYLDHITERVEDWSYAKFPYAKELG
FT                   EFNMDLDNPSGILRVNTLARINVCDRIATPLAQKELEEFRAKFGRPAQQSLLFNWARLI
FT                   ELLYNAERVIELLSDPEITSTNTRVPVTPKAGRGVGCIEAPRGTLIHDYTTDDNGLVTD
FT                   ANLVVATVFNNAAINMSVKQAAQTLIKGGKYDETILDEIEMVIRAYDPCLSCSTHELNG
FT                   KVAVRLDIVDASGQLAQTYSN"
FT   gene            525168..525671
FT                   /locus_tag="DhcVS_554"
FT   CDS_pept        525168..525671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_554"
FT                   /product="hydrogenase maturation protease"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_554"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61706"
FT                   /db_xref="GOA:D2BHA6"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004411"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHA6"
FT                   /protein_id="ACZ61706.1"
FT                   /translation="MDCLPEYCSRPVVVFGCGNILYGDDGFGPAVADYLNAHSRVPSFA
FT                   CVMDVGTAIRELLFNIIISDVKPKVIVLVDAMETGLEVGELGHLTVEQVSPEKINDFSL
FT                   HLMPTLNMLKELHADGGVKIDVLAVKPERIPEEMEQGLTEKVQKAVVETARYITDTYFA
FT                   QPPF"
FT   gene            complement(525668..525973)
FT                   /locus_tag="DhcVS_555"
FT   CDS_pept        complement(525668..525973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_555"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61707"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHA7"
FT                   /protein_id="ACZ61707.1"
FT                   /translation="MTDILNEASNIAQCKECPWYRACTTPMRYTSEDIRRQVQSGGPGI
FT                   NAPQDEAAMQQMLSMASAAQNSMLEACPIFIERLRNNPKLGQKIKEMMQNWSQESH"
FT   gene            complement(525990..526529)
FT                   /locus_tag="DhcVS_556"
FT   CDS_pept        complement(525990..526529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_556"
FT                   /product="thiol-disulfide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_556"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61708"
FT                   /db_xref="GOA:D2BHA8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHA8"
FT                   /protein_id="ACZ61708.1"
FT                   /translation="MKSKLLALCFLLLGSLCLSACSQSTPSPSDNANQPVTGIKINNFA
FT                   PDFSLKNLAGQEINLSDFRGSGVIINFWKISCSYCKQEMPFFEAAYLKNKALPDSIKIL
FT                   MINITESQSLIEQFMEDNHYTFPVLLDTTGAIGQIYNANYIPITYFINAEGIIKAIKFG
FT                   AFSSQTDFDNQLDKIN"
FT   gene            complement(526531..527253)
FT                   /locus_tag="DhcVS_557"
FT   CDS_pept        complement(526531..527253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_557"
FT                   /product="cytochrome c biogenesis-type protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_557"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61709"
FT                   /db_xref="GOA:D2BHA9"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHA9"
FT                   /protein_id="ACZ61709.1"
FT                   /translation="MGRCRTGLEDISYLLALVGGLAAFFSPCVLPMMPIYLASLTGAEI
FT                   LDAKPNSAISYKTLRHSAAFVAGFSLIFTSLGALAGLGGVIINPSDLWVRILSGGMLII
FT                   FGGYMLLCLRFPSINFEKHLASPQNLKMSGYARSFLSGAVFTLAWTPCISPVLGSILTI
FT                   TFGGENPLYGSALLAVFSLGMGIPFIALGLLLQKTLPSIGKISRYSAAIYGASGVILIF
FT                   IGILILGNRIGFFSTLQI"
FT   gene            527316..528455
FT                   /locus_tag="DhcVS_558"
FT   CDS_pept        527316..528455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_558"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61710"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHB0"
FT                   /protein_id="ACZ61710.1"
FT                   /translation="MRPLSYSQIDQYLSCPLKYRFLYIDGLKPLEKGYFSFGTTLHDCA
FT                   EHFFRIKVPPPPSLEKMLEYYRLHWRSEGYESVEAEENYRQLGKEILAEFCRIHSADFH
FT                   MPLAVEYQYTVNLDGVKLTGKIDRVDKLLSGELCIVDYKSNKDLFSSEYVQNNLQLSLY
FT                   QLAVEQIWFLPVGELCLYHLRSNTAMRCSSRSKEVITDARQLVLEVAEKIKKAIFPACE
FT                   NGFCPCDFAHLCPLYRHKYAPPPQLPEAPAVDIPRAVEEYAELQSRKSEIEARIDTLKE
FT                   SIIEYCRANSLGRVYGSEHSLSYKEVSRSGYNNQAVRDLLVPLGLWDKVSELDKSLLEK
FT                   YLETDACGQILKEELLALKEVVSTSPRLYIKQFSADNDS"
FT   gene            528476..528964
FT                   /locus_tag="DhcVS_562"
FT   CDS_pept        528476..528964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_562"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61711"
FT                   /db_xref="GOA:D2BHB1"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHB1"
FT                   /protein_id="ACZ61711.1"
FT                   /translation="MFFQMIGVFLLALVEIWLAIPAGLTWGLHPALVILLVCGGTLSGV
FT                   GIIIILSERIRAGSNRWLDKNRTGDASASLSALFAQIIAALQERLHSGRLYKIWLKYGI
FT                   IGLGLLSPVLTSAPLAAFLGVMLNADKLKLFIWISAGVAVWTTGLTLAMYFGLILLGI"
FT   gene            529154..529903
FT                   /locus_tag="DhcVS_563"
FT   CDS_pept        529154..529903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_563"
FT                   /product="radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_563"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61712"
FT                   /db_xref="GOA:D2BHB2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHB2"
FT                   /protein_id="ACZ61712.1"
FT                   /translation="MKVYHLAYEPSYHSMDFHFWTECNLKCRGCYTNYEVYDFGLLDDP
FT                   VAEIITRERQAPPTKFLTFDQVMEKIDGYTIKYAVFLGTEAVLDSELPKLAKAVHEKYG
FT                   SYNILLTNGIRMPDLTDIDQVIFSLKAYSEDIYRDYTSRSNKSALENLKKIHASLGERK
FT                   LHVEVVYIPDYIAKDEIEKVAQFLASIDKDMSFRIDAYFPIPGCPWRAANKEEVEEAAE
FT                   VARKYLNNVVVLTLDMKRIGDKAVKVF"
FT   gene            529904..531703
FT                   /gene="nrdJ2"
FT                   /locus_tag="DhcVS_564"
FT   CDS_pept        529904..531703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdJ2"
FT                   /locus_tag="DhcVS_564"
FT                   /product="ribonucleotide reductase, cobalamin-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_564"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61713"
FT                   /db_xref="GOA:D2BHB3"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHB3"
FT                   /protein_id="ACZ61713.1"
FT                   /translation="MTVESGRQSVVIAARLSTTAKRVLEKRYLKKDADGRVIETPEDMF
FT                   HRVARVVASAEYKYAPGADISRIEEEFYQAMFRLEFLPNSPTLLNAGRQVGQLSACFVL
FT                   PVEDSIESIFDAVKQTALIHKSGGGTGFSFSDLRPAGDKVGELTEVAGGPVSVINIFAA
FT                   AADYVRQGGVRRGCNAAILDVTHPDILNFISCKGDPNALTNFYISVVVTRDFMTKVRNG
FT                   EDYDIINPHTGEVVQRLNAACVFDRIVDQAWKTGDPGLVFIDRINDDNPTPLLGRIKHV
FT                   SGCGEQTLLPYESCNLGSISLPRMLKRDGERVVVDYEKLGRTVKMAIRFLDNVIDVNKF
FT                   PTPEIEKATLRNRKVGLGVMGFADMLVLMGIPYNSEEAIFQADQIMEFIKETSHRASSK
FT                   LAEVRGSFPAYEGSIYDVPGGRPMRNATCTSIAPTGTLSIIAGVSSGIEPSFAMVFVRN
FT                   ILDGENLLEINPYFEEMARRGGFHSKELFEKLVSSNHLHDIECIPDWLKRLLVTAHRIR
FT                   PEWHIRIQAAFQKYTDHAVSKTVNFSHEATREDMANVFNMAYDKGLKGITVYRDGSRAA
FT                   QPLCTCESGVKLVDQYLDNCSCR"
FT   gene            complement(531700..532704)
FT                   /locus_tag="DhcVS_565"
FT   CDS_pept        complement(531700..532704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_565"
FT                   /product="response regulator receiver:metal-dependent
FT                   phosphohydrolase, HD subdomain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_565"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61714"
FT                   /db_xref="GOA:D2BHB4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHB4"
FT                   /protein_id="ACZ61714.1"
FT                   /translation="MTTKNETILTVDDEDTIRRLLCQKITGEGYKCLTAPNAAEAMEIV
FT                   KNNNIALAILDIKMPGISGMDILPEIRIGSPDTAVIMATAISDTDTAINCMKLGAYDYV
FT                   TKPFKLDAVMMSIERALEKRRLILDNRDYQQHLELKIKDQAEKIRSSFFNAITSLAYAL
FT                   EAKDSYTIGHSQRVAETSVSIASAMELPAAAIEQIRLAGLVHDIGKIGIRSVCLNKAGN
FT                   LTEEEYNHIKTHPSIGERILSPITEDREILKIVRNHHEHFNGRGYPDGLKGDEIPLGAR
FT                   IMALADAYDAMTSLRPYRKAMTDKEAWEELKRCSGIQFDPEILAVFARMNKHT"
FT   gene            complement(532733..535291)
FT                   /locus_tag="DhcVS_566"
FT   CDS_pept        complement(532733..535291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_566"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_566"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61715"
FT                   /db_xref="GOA:D2BHB5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHB5"
FT                   /protein_id="ACZ61715.1"
FT                   /translation="MEDQYKSCRTTAEQSVLPESVNLTEILSLIESTRNLFFIFETSPK
FT                   PRLTYVSSNSSAISGYSPAEYLSNPALMKDIFKAAGLNTDTQKLPQFKTSSRPIPCYIP
FT                   CKNGFPLSAELLCKLFSDKLICVIQCQSQVQHNPDYPAFPDKTLPALPLVMGFQPDGKL
FT                   IFANQIFEEITGYFLNEIAGDNWKSCGLFSSEAADLINQMLKDTKTDSTQPVEIRLTLK
FT                   NGQTCWLSVYSRIINRNTSSPYLQLSARDITICKRSEKILLLTRFAVERTTDAIFWTDS
FT                   EGNFADVNQSACDSLGYKREDLLKLNVTDIDTFITNRTDWIRHWEKLKNSTRLNFESTH
FT                   RNKRGEEIPVEINANYMQYDGVEYNIAVVRDIRLRKEAEKHLKFTSFSVEHSADSILWV
FT                   NQKGHIIAANKAACQSLGYTHTEIRNLTVKDINPVCISEKWATLWGRLKNDIKFSVESV
FT                   QFTKSGQQIPIEVMCNFLEFEGVDYCCAVLRDITERKKVDAKLLHAAEEWRITFDNISD
FT                   IVFLLDNDFNILRANRAFTNTLNCQPQDILNKKCYQVLHHKDCPKESCSKLIVSNTKKT
FT                   QHINYFEENLEKHFQETIDPILNTDGQSLGTIHTIKDLTEHHKIAAQLMITDRLASVGE
FT                   MAAGLAHELNNPLTSVLGFSELIQEKDLPEDLMHDVQIISQEAQRAADIIRNLLTFARR
FT                   HEQARDWVDMNQVIKKVLAICNYGQKVNNIQMVTNLDPNLPEIKADYFQMQQVLLNIVI
FT                   NAEYFITQAHGEGTIVITSCRLDNSIRISIEDDGPGMSENVLKHIFDPFFTTKEVGKGT
FT                   GLGLSIGHGIITQHGGKLYAESSEGKGATFFIELPINQPD"
FT   gene            complement(535451..535792)
FT                   /locus_tag="DhcVS_567"
FT   CDS_pept        complement(535451..535792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_567"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61716"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHB6"
FT                   /protein_id="ACZ61716.1"
FT                   /translation="MKYMNDIANTDVFECRRCGNCCLHFQPHLEMDEAQSIAKHLSLSL
FT                   EDFKEIYADKRWPGHRTMLIRHNENGCIFLGRGVDNLSLCTIHDFKPQACRDYQPSFKH
FT                   RECREGLMF"
FT   gene            535865..537130
FT                   /locus_tag="DhcVS_568"
FT   CDS_pept        535865..537130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_568"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61717"
FT                   /db_xref="GOA:D2BHB7"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHB7"
FT                   /protein_id="ACZ61717.1"
FT                   /translation="MKMKKDYIIRLLATLVISVAMFFATPSVNRAALEGQLFFSDTIIK
FT                   VGTELTVYGQNFLRQSDVKLFFDDEEVAIGATNQLGEFTLSFIVPPSGRGLHVVKALDA
FT                   DYNMGSGLVLVESWIDLSKSEAAIGETVNINGTGFTPLTAVSFYYNDTPLTVVPGVVKA
FT                   DITGSFSVSFTVPERFAGIYLVEVRQGEYINSQSLRTNVWLDINPEIGLGKLLDVGTEL
FT                   NISGKGFKPNGQVDLQYDGISLLKAFTDSSGTFSVQITIPSSVAASHALILDDGQNRIV
FT                   REIWLENTPPAAPVITLPASGEALSYPFIFGWEGVSDASGVEYVLQIASDSGFSGILLE
FT                   IKGIKTSQYILTDNEDINSSEAANFYWRVKAVDGAGNAGNWSEASVFGRASLVQNLGLV
FT                   VGVGAGLIAIVVFMWWTIRNRR"
FT   gene            537271..538590
FT                   /locus_tag="DhcVS_569"
FT   CDS_pept        537271..538590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_569"
FT                   /product="lysine 2,3-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_569"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61718"
FT                   /db_xref="GOA:D2BHB8"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHB8"
FT                   /protein_id="ACZ61718.1"
FT                   /translation="MTTTEKNENKQSDDPLGSGAVETCGKVDDEPPSRLNQTKKFRLKY
FT                   FPKVSDQDWNDWHWQFKNRVTSVAEIARFFHLSAEEYRDMDSVSAVFPLSATPYYLSLI
FT                   DFDNVNDPVKLQLMPDTAELCFDAYCCSDPLGEEHSSVVPGLVHRYPDRVVMVLTDICP
FT                   VLCRHCTRKREWKNGGWVHTQAEIDAMLAYIRQNPVIRDVIISGGDPLTLSTSRLESVL
FT                   SALRSIPHVEIIRIGTRYPVVLPQRIDDELCNMLSKYGTIWLNTHYNHPNEITEESRRA
FT                   CDRLVRAGVPVNNQSVLLKGINDSVAIQKSLCHKLLMSKVRPYYLFQCDNVQGTEHFHT
FT                   TIETGVGIIEGLRGYTSGLAVPNYVIDLPGGGGKITVQPDYVLDKQADEYIIRNYKGDI
FT                   IRFKNPVGHKVLGNNVNTVNVKTAAKINGEANANRAVIRS"
FT   gene            538562..539578
FT                   /gene="ddlA"
FT                   /locus_tag="DhcVS_570"
FT   CDS_pept        538562..539578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="DhcVS_570"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_570"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61719"
FT                   /db_xref="GOA:D2BHB9"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHB9"
FT                   /protein_id="ACZ61719.1"
FT                   /translation="MQIGLSYDLKQALKPVAGGPDDALEEYDSPETVEAITTALKAAGH
FT                   TVYRLGGGKEFLRRVQEQKLDLVFNISEGLGNYRSREAQIPSILEMLDIPYTGSDPQTL
FT                   AICLDKPLTKKLVASAGIKTARWQLVNNCEELSAIDWSGFPLPAFLKPACEGSSKGVRF
FT                   ASRAESIDEIMSMAADLLTTYEQPVLIEEFINGEEITVGVIGNTSPEVLGIMRVVPKTK
FT                   TDYFVYSIEVKRNWRQMVEYEVPAALPGETLARIEKATLDAYKVLECRDLCRMDFRISP
FT                   DGVPYFLEVNPLPGLNPVSGDLPIMASKLGISHAELVLKILNTAMVRHNLLAENCLL"
FT   gene            539710..540141
FT                   /locus_tag="DhcVS_571"
FT   CDS_pept        539710..540141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_571"
FT                   /product="transcriptional regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_571"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61720"
FT                   /db_xref="GOA:D2BHC0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHC0"
FT                   /protein_id="ACZ61720.1"
FT                   /translation="MSTIQSRIRQNKYKITPQRQAVLKVLSSTNQPLSPAEVHKLVQAD
FT                   KPSTGMATVYRSLQLLAELGLICELHTAGNCHRYLLKRIDSHHHHLICSGCGQVVHVEG
FT                   CGLKEITENLSRQTGFAIDTHLLEFIGRCRNCQKETGKV"
FT   gene            540138..541010
FT                   /locus_tag="DhcVS_572"
FT   CDS_pept        540138..541010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_572"
FT                   /product="cation ABC transporter, periplasmc-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_572"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61721"
FT                   /db_xref="GOA:D2BHC1"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHC1"
FT                   /protein_id="ACZ61721.1"
FT                   /translation="MKYRTLFLGVALGVTLLSSFLLAGCQEEASSTDKLKIAVSIVPLK
FT                   EFTQQIAGDKAEVVLMVPPGAEPHTYQPLPSQMVDISQSDMYVKLGSDFGFEQNWLSKI
FT                   LSLNNSMLVVDSSVNITLERSSEDGGADPHIWLSPRNAIQMVKNITLGLMSLDPENQSY
FT                   YAANRDAYLAKLGQLDNEITLALSHLYNRTFLVFHPAWVYFARDYNLEELSIEIEGKEP
FT                   TPQQMIEIIDLAIQNNISIVFASPQFSSRSAESIASEIDGQVIMIDPLAQDYIKNMEFV
FT                   YKQMQEVMS"
FT   gene            541013..541777
FT                   /locus_tag="DhcVS_573"
FT   CDS_pept        541013..541777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_573"
FT                   /product="cation ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_573"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61722"
FT                   /db_xref="GOA:D2BHC2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHC2"
FT                   /protein_id="ACZ61722.1"
FT                   /translation="MSDTPALVFRGVSAGFDGLTVLEDITFSQPAGRMLGIIGPNGGGK
FT                   TTLLKLILGLIQPDCGTIQVLGKSPEDARPEIGYVSQYHLFDRDFPISVLEVVLMGRYA
FT                   KRGLARRYSSGDVALAKEYLDKVGMLPFANRQIGQLSGGQQKRVFIARALVNQPKLLIL
FT                   DEPTAGVDAAMQTGLYELLESLKKEMTIIMVTHDISAVAVCIDDIACLNKHLSYHHAEE
FT                   GLTAEDLAETYNCPIQLIAHGQVPHRVLKEHE"
FT   gene            541774..542595
FT                   /locus_tag="DhcVS_574"
FT   CDS_pept        541774..542595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_574"
FT                   /product="cation ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_574"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61723"
FT                   /db_xref="GOA:D2BHC3"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHC3"
FT                   /protein_id="ACZ61723.1"
FT                   /translation="MIEALGYSFIQNAIWAGLLAALGCGIIGSYVVVKKLASISGGIAH
FT                   ASFGGIGLGYLLGINPVLGALVFSLLAAASMGTLTRRSRISEDTIIGMLWALGMALGVI
FT                   FIGLTPGYAPDLFSYLFGNILTVPSSDLLLMLVLDALIIGVVWFFYKEFLGVSFDEEFC
FT                   RVSGMPTGFLYIIMLGLIALTVVMLIRVVGIILVIALLTIPAAVARRFTDNLFKMMLFS
FT                   IGFGVVFCLGGLWISYVLDFASGATIILFSVAVFLAVLVFKGKKKQKPASD"
FT   gene            complement(542643..542993)
FT                   /locus_tag="DhcVS_575"
FT   CDS_pept        complement(542643..542993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_575"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61724"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHC4"
FT                   /protein_id="ACZ61724.1"
FT                   /translation="MELDEFLKQSAVDYTSRQIILLFSKHPFARFDRSAIASTIEGGSD
FT                   ILPTLQSLVSSGIIKLCQKGGAELYYLTSEPDLRDMVTRLGNMEWKQQQNFSRRKLIGL
FT                   NVFSQTRPLGTR"
FT   gene            complement(543110..544240)
FT                   /gene="ftsZ1"
FT                   /locus_tag="DhcVS_576"
FT   CDS_pept        complement(543110..544240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ1"
FT                   /locus_tag="DhcVS_576"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_576"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61725"
FT                   /db_xref="GOA:D2BHC5"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHC5"
FT                   /protein_id="ACZ61725.1"
FT                   /translation="MSKKVYVPSGAKIKVIGCGGAGSNAVTRMVRDNIQGVEFIAVNTD
FT                   AQHLAITEAATRIQIGERCTRGLGAGGNHTMGKAAAEESMSELKENVMGADMVFVTAGM
FT                   GGGTGTGSAPVVAKIAKESGALTIAVCTKPFCFEGAHRMQTAEEGINNIVDSVDTLIII
FT                   PNDRLLDMVDQKTGVDGAFKLADEVLCNGVKAIAEVITVPGIINLDFADVKAVMKDAGP
FT                   AWMSIGKGAGQNRAADAARAALASPLLDIAVDGAMGVIYNVCGGEDLSLMEVNSAADVI
FT                   RQAVDPEANIIFGVSTDPRMGKEVQITLIATGFATKESMLSNNHEKEMTRMMKGLRSKT
FT                   QEELEVPSFMRYRSAQPSIRKPAPPAHQAPPRFLSR"
FT   gene            complement(544273..545475)
FT                   /gene="ftsA1"
FT                   /locus_tag="DhcVS_577"
FT   CDS_pept        complement(544273..545475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA1"
FT                   /locus_tag="DhcVS_577"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_577"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61726"
FT                   /db_xref="GOA:D2BHC6"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHC6"
FT                   /protein_id="ACZ61726.1"
FT                   /translation="MKRRQIAAIDVGTSKICTVMADTENGDLRILGVGVVASRGMQKGM
FT                   VVNLNEAKEAIRESVSMAERTAGYKLKSALIGVTGKHINSKNNRGVISITRNDHLVRQS
FT                   DLQRAIDIASSITMPQDRKVLHIIPRNYSVDGQEGVSNPVGMHGFRLDVETHIITAASN
FT                   SIENLTKCIRAAGVEIDDLVFNPLASAEAALTDEEREKGVILADIGGGTTDIAAFKGNS
FT                   IYHTSVLPIAGAQVTHDISVGLGIPFEMADDIKQRYSSVVPGECNDANFVESGHTFSYP
FT                   DLCEIVRMRVEELLRLIILELPSDDYSKMVPSGLVITGGTANLPGIAELGSEVLRLPVR
FT                   VGTPPNLFGVSDILNDPACTNVVGMLLWSINNRDASKSHPAPEESAKGGFISRMFGNPK
FT                   N"
FT   gene            complement(545537..545746)
FT                   /locus_tag="DhcVS_578"
FT   CDS_pept        complement(545537..545746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_578"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61727"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHC7"
FT                   /protein_id="ACZ61727.1"
FT                   /translation="MGTAIEYQKLMTEIVHINLPGPAEPMPGMSGGELLHGFLAELYRA
FT                   PSTDSKAFIESLSGKWNVHFRHVK"
FT   gene            545986..546675
FT                   /locus_tag="DhcVS_579"
FT   CDS_pept        545986..546675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_579"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61728"
FT                   /db_xref="InterPro:IPR035235"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHC8"
FT                   /protein_id="ACZ61728.1"
FT                   /translation="MANLKGSKPLPPYVSYRTFLNFLLGLQEAIPSRLDRSFWGDKWSG
FT                   STGTQLMSALRFLGLADDEGMPREKLRRLVDARGEDRTLILRQITLEKYEFVFNSSADS
FT                   ESLTYAQLEELFHNSFKVADDVVRKCIKFFLGLAEDADIPISPFVTKKSRTGRSGIGTK
FT                   KVQRKIVPRTASHVLIPDNTVKVPDNADMDKVLLGKFPTFDPAWTDEVKVKWFEAFDVL
FT                   LKKVSKT"
FT   gene            546834..547697
FT                   /locus_tag="DhcVS_580"
FT   CDS_pept        546834..547697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_580"
FT                   /product="universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_580"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61729"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHC9"
FT                   /protein_id="ACZ61729.1"
FT                   /translation="MYFKRILVTLDGTKIAEKTLPVAELMAKDTETELLLVSICDPKPK
FT                   ITDERQKYLDAKSAELREKGIKASGKMFCGELLPLILKCITDNSIDLLCMASHGYTGIK
FT                   KMVLGSVSEKLIKSTKLPVLLIKEGYEPDKALFENILLPLDGSLFSETCLKQVSILAHD
FT                   FKSKLTLLVVIQPPCIPSDRSPNIQPSWDEYYQALLEELRQQAQSYLERLTGELQSNGI
FT                   KTEFRMEISDKIPETILSTAEDINASLISFTTHNRSGIEKWYYGSVAAGLIENSPHPML
FT                   LWRNSI"
FT   gene            547751..548380
FT                   /locus_tag="DhcVS_581"
FT   CDS_pept        547751..548380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_581"
FT                   /product="cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_581"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61730"
FT                   /db_xref="GOA:D2BHD0"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHD0"
FT                   /protein_id="ACZ61730.1"
FT                   /translation="MKKIYDLSPEICPEMISWPGDGCPEITLLHSIKNGSHSNLSRLTM
FT                   TLHNGSHIDAPLHFSEDGDGAGEIPLEILIGNVRVLRFSGVKTVTRDMLEQVDLRGVIR
FT                   LILATDNEALWYKPDFDRNYTYIDIGAARYLTEIGVRLLGIDYLSVEDFEGLAGVHRHL
FT                   LSHGVFILETLQLAGVPEGDYELYCLPLKLGKVDGAPARVILIERD"
FT   gene            548380..549042
FT                   /locus_tag="DhcVS_582"
FT   CDS_pept        548380..549042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_582"
FT                   /product="ribulose-phosphate 3-epimerase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_582"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61731"
FT                   /db_xref="GOA:D2BHD1"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHD1"
FT                   /protein_id="ACZ61731.1"
FT                   /translation="MKDVKVVPAILTDDPAAFEMMIKQSEGFAPSAQIDIMDGQFVPSL
FT                   SIPPEVLVRYKPRFASEIHLMTINPEEYLIYCKRHGAFRVIFHFEATTRPEYVISRIKE
FT                   LGFQAGLAVNPETPVSDFAYLVPQLDMVLFMSVIPGFYGAPFIPAVLLKVKEFKLRFPE
FT                   TEIGLDGGAKEGNIAEIVAAGVNDICVGSAIFRQTDPKSSYRYLDELAKNAAKEAGI"
FT   gene            complement(549039..549503)
FT                   /gene="rpiB"
FT                   /locus_tag="DhcVS_583"
FT   CDS_pept        complement(549039..549503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiB"
FT                   /locus_tag="DhcVS_583"
FT                   /product="ribose-5-phosphate isomerase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_583"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61732"
FT                   /db_xref="GOA:D2BHD2"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHD2"
FT                   /protein_id="ACZ61732.1"
FT                   /translation="MKMSNISVAIGADHGGYGLKIDLLPFLNQLGADVLDLGACAYNST
FT                   DDYPDFALAVARKVACGQTDRGIIICGSGVGACITANKIKGVRAGLCHDVYSAHQGVEH
FT                   DDMNVLCLGARVIGIEVAKEIITAFLNARFTGEERHKRRMEKLLQAEKES"
FT   gene            complement(549490..551490)
FT                   /gene="tktA"
FT                   /locus_tag="DhcVS_584"
FT   CDS_pept        complement(549490..551490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktA"
FT                   /locus_tag="DhcVS_584"
FT                   /product="transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_584"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61733"
FT                   /db_xref="GOA:D2BHD3"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHD3"
FT                   /protein_id="ACZ61733.1"
FT                   /translation="MSNTKLDSLCINALRFLSVDAVQKANSGHPGAPMGMAAMAYALWQ
FT                   KFLKHNPQDPVWPNRDRFILSAGHASALLYSLLHLTGYDLPLDELKNFRQWGSKTPGHP
FT                   EYGLTPGVEMTTGPLGQGFASGVGMAMAEAHLAAVFNQPDCKIIDHYTYGIVSDGDLME
FT                   GVASEAASLAGHLALGKLIYLYDDNEISIEGSTELAFTENTALRFESYGWQVIGPVDGL
FT                   DPEAVSVAIKEAQSDSARPSLIICKTVIGFGSPNKAGKASAHGEPLGTDEVAKSRKSLG
FT                   WDYEPFVIPPEALAEFRMALDKGKTAQQVWQSKLDYYSSRYPEKAALLQDRLSGKLPED
FT                   WDKDLDKLFDKAMASREASGLIINTLASRLPALMGGSADLSPSNKTVIKDGGEYEPPHY
FT                   EGRNIHFGVREHAMGAIANGLALHGGITPYVATFLIFYDYMRPAVRLASLMGQRIIYIF
FT                   THDSIGLGEDGPTHQPIEQLAGLRSVPGLVTIRPADSYETAQAWKMAILRKNGPTAIAL
FT                   SRQKLPLLDNSQANSVNLSKGAYILAETDSRPQVALVASGSEVSIAVQAAEILKNKGIS
FT                   SRVVSFPSWQLFEAQPQTYRQSILPASLPRVIIEAGSAQGWCKYLGANGALISIDHFGA
FT                   SAPVPVLYQHFGLTPENMAEKALKLLENEDE"
FT   gene            complement(551542..552051)
FT                   /locus_tag="DhcVS_585"
FT   CDS_pept        complement(551542..552051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_585"
FT                   /product="nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_585"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61734"
FT                   /db_xref="GOA:D2BHD4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHD4"
FT                   /protein_id="ACZ61734.1"
FT                   /translation="MNTLETIFSRRSIRHYQNEGISPSELDTLLRAGMAAPSAGNQQVW
FT                   HFVVIDDRRILDKIPEIHPYSEMLKEAPMAIMVCADVSAETKIGYWIQDCAAATQNILL
FT                   AAEALGLGACWLGLHPREERKAAVSQLLNIPAGISPLSLIAIGKKGEVKPPAGRYLKSH
FT                   IHKNGW"
FT   gene            552138..553019
FT                   /locus_tag="DhcVS_586"
FT   CDS_pept        552138..553019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_586"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_586"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61735"
FT                   /db_xref="GOA:D2BHD5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHD5"
FT                   /protein_id="ACZ61735.1"
FT                   /translation="MPGFPFFKIKGKFVFKKLADINNKPELYHQYSASVLWNDPHISSR
FT                   MLEFHLNPDIEPASRKAVFIEKSACWIAEYFRLGDGKLVCDFGCGPGLYTSRLAAAGAD
FT                   VTGIDFSSRSIGYAREFASAHQLDIHYIEQNYLEFAAPKKFDLITLIYCDYCALSPAQR
FT                   CRLLSVWRKCLKDSGQILLDVFSLSAYEGRAESAAYGHCLMDGFWSGSDYFGFVNTFKY
FT                   PLEKVVLDKYSIIEADKEWQVFNWLKYFSAPELEAELAANGFEVTGVFSDVAGAAFCET
FT                   SPEIAVVARKKN"
FT   gene            553197..553787
FT                   /locus_tag="DhcVS_587"
FT   CDS_pept        553197..553787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_587"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61736"
FT                   /db_xref="InterPro:IPR041164"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHD6"
FT                   /protein_id="ACZ61736.1"
FT                   /translation="MTIGVMGSAGGNMTEETKKSLRCLGECIAKRKHVLITGACPGMPH
FT                   ETVLGAKEEGGIVVGISPALNLEEHVEKYHSPTRGYDAIIYTGSGLMGREIENIRSCDV
FT                   VIFAGGRSGTLGEFAIAYDEGKVIGVLRGSGGIADHLDKIISMVDKETGARVYYESDPY
FT                   KLLDVLEAVYRERIFPRHKRLMENNDPDGMSDG"
FT   gene            554387..555403
FT                   /gene="fepB"
FT                   /locus_tag="DhcVS_588"
FT   CDS_pept        554387..555403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepB"
FT                   /locus_tag="DhcVS_588"
FT                   /product="ABC-type cobalamin/Fe3+ siderophore transport
FT                   system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_588"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61737"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHD7"
FT                   /protein_id="ACZ61737.1"
FT                   /translation="MLDNINKKLSSKSARLGTTVAGIFLSLVLLLGLVGGCKAADDTNN
FT                   DDENPVVTEVTYPLTVTDQLGRTVEIKSEPQTIVSLSPSNTETIYAMGLEDKLVGVTTY
FT                   CNYPEAAAAKPKVGGFSNVDAEAVTAIGPDIILASNIHASTVIPQLEQLGLTVIAISPD
FT                   NLEEVLESIELIGKCLNQVEKANSLVDEMQTRIDAVTSKIKNLSESQKPRVLYIVWHEP
FT                   LMSVGSTAFITGLITAAGGVSITADSAESYPTISLETVLGANPQVVVVGTGMGSGADAP
FT                   LLFMQDEPRLADIDARINGNIYSINTDLIGRTGPRIVEALEQLAKMLHPEIFGEFSA"
FT   gene            555457..556548
FT                   /gene="fepD"
FT                   /locus_tag="DhcVS_589"
FT   CDS_pept        555457..556548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepD"
FT                   /locus_tag="DhcVS_589"
FT                   /product="ABC-type cobalamin/Fe3+ siderophore transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_589"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61738"
FT                   /db_xref="GOA:D2BHD8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHD8"
FT                   /protein_id="ACZ61738.1"
FT                   /translation="MGVNTNLNKENCPAVPGGMHPHWRGRIIAMAGLFGLLLLAAIFAI
FT                   SFGSVEVPFFTTISIMISKIPFVNIIPDWTVNTQTIIWDIRLPRVLLAGVVGMALAVAG
FT                   ATYQGLFRNPLADPYLIGVAQGAAVGAVLGLILGIGFDVLGIFTTPLFAFAGAFGAVGV
FT                   VYMLARVGNRLTVTTLILAGVALGSFLTAIVSYLITVSGDKIHSVMFWLMGSFSMAGWE
FT                   SVKIVIPIVIIGTLVILLFARSLNLIQLGEEQAQELGVDVERMKIILLTAATLITAAAV
FT                   SFVGIIGFVGIIVPHAVRLIWGADYRFLLPLSALVGAVFMIMADIASRTLVAPNEIPVG
FT                   AITALVGAPFFLYLLRKRTRMLF"
FT   gene            556560..557387
FT                   /gene="fepC"
FT                   /locus_tag="DhcVS_590"
FT   CDS_pept        556560..557387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepC"
FT                   /locus_tag="DhcVS_590"
FT                   /product="ABC-type cobalamin/Fe3+ siderophore transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_590"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61739"
FT                   /db_xref="GOA:D2BHD9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHD9"
FT                   /protein_id="ACZ61739.1"
FT                   /translation="MFELEVRDVTLAYGPVDVLRNVSFKTMPGEMIGLVGPNGSGKSTL
FT                   IKSLARVIEPRLGNIYINGRNSRSIPRLELAKMVGVVPQIPVLPSAFTAFEIVLMGRNP
FT                   HMGTFQYESHKDIAIAWEALKRAGVLHLAERQIGELSGGEIQSVVIARSLCQKTEAILL
FT                   DEPTSNLDIGRQIEILDLIKSECRERNITVIAALHDLNLAAHYCERLILIDNNGIHADG
FT                   SPVEVITTDNISRVYGPGSYVHTHPLSGLPAVLPRLGNIRCNTNGEKGGTGAH"
FT   gene            557377..558147
FT                   /locus_tag="DhcVS_591"
FT   CDS_pept        557377..558147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_591"
FT                   /product="CbiZ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_591"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61740"
FT                   /db_xref="InterPro:IPR002808"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHE0"
FT                   /protein_id="ACZ61740.1"
FT                   /translation="MPTEKINIRIVAEFHGIKAEVIEHEVWGVAANALVVTFSEERRAL
FT                   SGRQGYRKVKAVCNIYLPDAIWPRLHNDKLSWNGYYRQVFSKALSAIGIPLSKVLVLST
FT                   GVTMDHLAFHEEKQGDLWVAVLATAGVESNALRIGQDKSSGIDRNGKFKPFGTINTIIL
FT                   TSESLPQAALASCFITATEAKTIALDELGVMSAYTPGLKASGTGTDQIVAVSGTGDQAT
FT                   YVGGHTLLGELMGRSVTLAIKEALTKRMASRKGH"
FT   gene            558149..559075
FT                   /gene="cbiB"
FT                   /locus_tag="DhcVS_592"
FT   CDS_pept        558149..559075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiB"
FT                   /locus_tag="DhcVS_592"
FT                   /product="adenosylcobinamide-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_592"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61741"
FT                   /db_xref="GOA:D2BHE1"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHE1"
FT                   /protein_id="ACZ61741.1"
FT                   /translation="MEVLFIFLLALIIDLVFGDPPNAFHPVAYMGRVIALFERAGFKGS
FT                   RVYQFVYGIVMVFIAMALFFIPVYFLLDWLHGVNSIVYIIVSAVLLKMCFTVTGLRKAA
FT                   LLIKQLLEKDDIAQARFELRSLVSRDTSKLPQPKLVAAAVESVAESIGDGFVAPLFFFL
FT                   IFGVPGVMAYRVVSTFDSMVGYRGKYEHLGKFAARFDDVLNFIPARLSALCILVSSLFG
FT                   RYSPAGAWRIMWRDHAKTQSPNAGWPMATAAGALEVCLEKVGHYSLGDNIRELVPQTIS
FT                   RSLLLINSAAFIWVLISAGVIYFVRIA"
FT   gene            559059..560165
FT                   /locus_tag="DhcVS_593"
FT   CDS_pept        559059..560165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_593"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_593"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61742"
FT                   /db_xref="GOA:D2BHE2"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHE2"
FT                   /protein_id="ACZ61742.1"
FT                   /translation="MFVSPKPQVEKLKPCYHGGPNYAELKKLGISPDAVMDFSVSSNPY
FT                   PAPAEIKEALCSLVIDRYPDSDSAELKEYLAGRLSLKPENLIVGSGSMEIIRLVAGAYF
FT                   GVGDTVLILKPTFGEYELAAEVAGADIIEQWADEESGFKFDLDLTCRIIKKHQPKAVFI
FT                   CNPNNPTGVYLSKADIEKVLSVCTDTLLVLDEAYIAFAEDCWKAADLLETGNIIVIRSM
FT                   TKDCALAGLRLGYGMASAEIINNLKKVCPPWNVNAAAQKAGLVCLCHPSYLAESEKKIK
FT                   ASKEYLMKGFAGLGFRVLPSESNFFLLKVKKAADFRSTLLKHGLMVRDCTSFGLPQYVR
FT                   IAPRTQSECERLLAVAAELKSKSEIYPA"
FT   gene            complement(560298..560510)
FT                   /locus_tag="DhcVS_594"
FT   CDS_pept        complement(560298..560510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_594"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61743"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHE3"
FT                   /protein_id="ACZ61743.1"
FT                   /translation="MIRVYQFLALQDMLSFSSSGACPNKKGAGTSQNIFKMSRPLYHQV
FT                   SGLVLTRLLASGLSPGSALPIRVLP"
FT   gene            560538..561596
FT                   /gene="cobT"
FT                   /locus_tag="DhcVS_595"
FT   CDS_pept        560538..561596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobT"
FT                   /locus_tag="DhcVS_595"
FT                   /product="nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_595"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61744"
FT                   /db_xref="GOA:D2BHE4"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHE4"
FT                   /protein_id="ACZ61744.1"
FT                   /translation="MELLNATLAKIHGLDKEAMTKAQAHQDTLTKPQGSLGKLEAIAVQ
FT                   LAGIQGNAKPQTARKAIITMAGDHGIIDEKFHNWPKEVTAQMLQNFAHGGAAINVLSMQ
FT                   VGARNVVVALGVATPMAEDPNIINRNIAPGTNNMVHGPAMTREQAIKAIETGIEIVNAE
FT                   VKKGLDLVGTGDMGIGNTSPSAAICSVITGRALEDVTGRGTGASDEQMKLKRNAIAKAI
FT                   ALNKPNAKDALDVLSKVGGYEIGGLAGVILGAAANRVGVVVDGFISGAAALIAYTICPQ
FT                   AKDFMFAAHQSVEPGHRILLEHMGLDAILKMDMRLGEGTGAALAMNIIEASNRIQHEMA
FT                   SFADAGVSEKQS"
FT   gene            561634..562398
FT                   /gene="cobS"
FT                   /locus_tag="DhcVS_596"
FT   CDS_pept        561634..562398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobS"
FT                   /locus_tag="DhcVS_596"
FT                   /product="cobalamin 5-prime-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_596"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61745"
FT                   /db_xref="GOA:D2BHE5"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHE5"
FT                   /protein_id="ACZ61745.1"
FT                   /translation="MGSFLAAFRFLTNIPVPWLKEDWQGEKSHLDFARSLGFYPLVGLI
FT                   VGLILAGLSWVFSLFLPGVLTAALLTVSLVVITGGLHLDGLTDTFDGIAAGHKSFERAQ
FT                   EVMHLPGVGAIGVLAAICLLLLKFAAIVSLPSGSFITGLILFPLISRWAMVYAVVCYPY
FT                   VRSQGLGKELKGGSAKASLWLATIFCLAVCVILGGWAGLLTMFGSWLLVMYLASFFRRR
FT                   LGGLNGDTYGSINEFTEVAALIFIVALSGYFS"
FT   gene            562418..563020
FT                   /gene="gpmB"
FT                   /locus_tag="DhcVS_597"
FT   CDS_pept        562418..563020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmB"
FT                   /locus_tag="DhcVS_597"
FT                   /product="phosphoglycerate mutase family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_597"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61746"
FT                   /db_xref="GOA:D2BHE6"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR017578"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHE6"
FT                   /protein_id="ACZ61746.1"
FT                   /translation="MKLILVRHGETETDNCRRYWGHSDIGLSDSGHAQANSLREYLSAV
FT                   RIDAIYSSPLKRCTETAETIAYGRPLSVNKNNDLKEIDFGRVEGLTYDDVLERYPDIAQ
FT                   KWAEGSFDVHFPDGEGMEHFAQRVVKFVKMLSKHREDETLLLVGHGGVFRILICHFLGI
FT                   DYKHWWQFTLGVGSVTVLDIYSEGSILEKLNDKSHLG"
FT   gene            563073..563639
FT                   /gene="cobU"
FT                   /locus_tag="DhcVS_598"
FT   CDS_pept        563073..563639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobU"
FT                   /locus_tag="DhcVS_598"
FT                   /product="cobinamide kinase/cobinamide phosphate
FT                   guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_598"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61747"
FT                   /db_xref="GOA:D2BHE7"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHE7"
FT                   /protein_id="ACZ61747.1"
FT                   /translation="MNYLLIGGARSGKSSYAEELAKSIGGNIVFVATAEAGDDEMKTRI
FT                   LRHQQARPPEWRLIEASLGVGEKISAYRENADVIILDCITLLVNNIMCQYMLEHGDELT
FT                   GDAADYLDTAVKKEINDIILAMEKTGASFIVVTNDVGAGLIPPNAMARVYRDLLGRANQ
FT                   MLGAYVEYIYLMVAGLPMQVKPLLR"
FT   gene            complement(563719..564042)
FT                   /gene="trx"
FT                   /locus_tag="DhcVS_599"
FT   CDS_pept        complement(563719..564042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trx"
FT                   /locus_tag="DhcVS_599"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_599"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61748"
FT                   /db_xref="GOA:D2BHE8"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHE8"
FT                   /protein_id="ACZ61748.1"
FT                   /translation="MVMEITDQSFAAEVLKSDKPVLVDFWAPWCGPCRMVAPIIDKLST
FT                   KYEGKFKFCKLNVDENKTTAAQYRVMSIPTLLFFKGGQVADMVVGAVPESALSQKIDQL
FT                   IQK"
FT   gene            complement(564133..565278)
FT                   /locus_tag="DhcVS_600"
FT   CDS_pept        complement(564133..565278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_600"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_600"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61749"
FT                   /db_xref="GOA:D2BHE9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHE9"
FT                   /protein_id="ACZ61749.1"
FT                   /translation="MKKVFSFFYSQIRRLPRLFANVHIWILILLFTGGFFLHYPQLLPF
FT                   IGQIEPDSFLYLTRHSVGRLIMLLPVTYTALVFGLRPGLLSLVLAIAIIIPNIFVTDTV
FT                   TPDDIIEIIGIIIIGLVVNLWLESYETDKKHRQQAYLKMETAQRELQRMQQNLRFYLKQ
FT                   ITIAQEDERRRIAQELHDDTAQDLIVISRAIDRFVTQNPNLGEDNLAELEELQNHVNRT
FT                   LSEVRRFAQDLRPSVLDDLGLIPALEWLIPDLSKHFGINIDIDVNGEIRRFAPETELVL
FT                   FRIVQESLRNVGKHAQATKAWVYIDFGKYKATLTIKDNGRGFLLPERVGDLAALGKLGL
FT                   TGMQERAQLIGGRLSIQSKPEVGTMVTVAVPNSGNLEDNEV"
FT   gene            complement(565295..565969)
FT                   /locus_tag="DhcVS_601"
FT   CDS_pept        complement(565295..565969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_601"
FT                   /product="DNA-binding response regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_601"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61750"
FT                   /db_xref="GOA:D2BHF0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHF0"
FT                   /protein_id="ACZ61750.1"
FT                   /translation="MQTTQMIKVLLADDHVIVREGTRELIQRESGMMVVGEASDGVEAV
FT                   EMSMKVHPDVVVMDIAMPRLNGIEATKQIKQLLPTTAILILTAYESEQYILAILEAGAA
FT                   GFLLKNVKGTQLLEAIRAVYAGESVLQPSTTRRVIDQLINKATKTEEVSAVNPLTDREI
FT                   EVLKMAARGVSNKDIADQLYLSNRTIQTHLSNICKKLSVGSRTEAILYGLKRGWFIMED
FT                   LP"
FT   gene            complement(566040..566684)
FT                   /locus_tag="DhcVS_602"
FT   CDS_pept        complement(566040..566684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_602"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61751"
FT                   /db_xref="InterPro:IPR024264"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHF1"
FT                   /protein_id="ACZ61751.1"
FT                   /translation="MMNLGEGFRLPDQRNFELATQRTLELNRSRFLSTQDFNKICQNSG
FT                   AVFQPPFIQLEYFGFKVKVDTRNAAVTSPDTDLSLREEALILHYLLKADGTPVLHEQIS
FT                   FKELPEGANYQPVFYNRVLKGLIALYTADRAKLSLSALSLGGEKTDQADMSFLFQALPR
FT                   LPLWLVFWQGDDEFPPEGNIIFDRSISHYLDTEAITEICQNLGHRLSQKTP"
FT   gene            complement(566703..568049)
FT                   /gene="cdhE"
FT                   /locus_tag="DhcVS_603"
FT   CDS_pept        complement(566703..568049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdhE"
FT                   /locus_tag="DhcVS_603"
FT                   /product="carbon-monoxide dehydrogenase,
FT                   corrinoid/iron-sulfur protein, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_603"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61752"
FT                   /db_xref="GOA:D2BHF2"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016041"
FT                   /db_xref="InterPro:IPR016218"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHF2"
FT                   /protein_id="ACZ61752.1"
FT                   /translation="MSPTGIEIYKFLPRTNCGECGVPTCLAFAMSLAGGRAELSSCPYV
FT                   SEEAKQKLEEASAPPVKTVSIGTGNYAFKTGGETVMHRHEKRFEHQPGIALLISDNLSE
FT                   TEQDAKLTAFNRFQYKRVGAILKPDMLALRADSDSGEKYLKLVKLVAEKCPASLMLMCA
FT                   DTAVLDESLKICAEHKPLLYAATAENSSEMAELAKKYNCPLVAKAANLADLADLSVKLQ
FT                   SLGIKDIVLDSSAENLKQALSDNVAIRRSAISKKFRPMGFPVINFPCQMTQDPMKESLF
FT                   AGILTAKYAGILVLSDFSGETLFPLLVTRMNLYTDPQRPLATTEGIYEINTPDANSPVM
FT                   LTCNFSLTYFIVSGEMENSRVPCYLMIKDTEGLSVMTAWAAGKFGADTIGKFVKNSGIA
FT                   AKINHRKLIIPGYASMESGGLEEELSGWEIMVGPREAAHIPAYLKQFKP"
FT   gene            complement(568070..570271)
FT                   /gene="cdhC"
FT                   /locus_tag="DhcVS_604"
FT   CDS_pept        complement(568070..570271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdhC"
FT                   /locus_tag="DhcVS_604"
FT                   /product="carbon monoxide dehydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_604"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61753"
FT                   /db_xref="GOA:D2BHF3"
FT                   /db_xref="InterPro:IPR004461"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR038571"
FT                   /db_xref="InterPro:IPR041350"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHF3"
FT                   /protein_id="ACZ61753.1"
FT                   /translation="MSNTVAEASINGARNIVNASYEVFKQTLAANCPDTAVGFPNTAYF
FT                   LPVIYGILGIKVEKLSDMETVLDKCFKMLPPPEVKAEDVTELGAILEAGLATLFAEEML
FT                   EALRYLSQPEYYTNTEDPTLDNIWLGAADDIILRKRGVEFVDGTAPGFAAIIGAAPDNT
FT                   TAESIAAELQQKNLYTFMCGESQGKRFASQLADAGVELGWTPRLVSFGDEPTAAIFAFG
FT                   FAVRVALSFGNVEPGNRAKLFEYSQERIKAFVMPLGDISDEWYANAAGALNFGFPIIAD
FT                   KSVLPILPGVDAVDSVLAGIPYDRIVSKAMDVRGIKVNITKVPVPVAYGPAYEGERVRG
FT                   EQIYLECGGGRTQMVELVTTAGMDDVTDGKIELFGQDVSDVPEGSRLPLAIVVEAAGHK
FT                   MNEDYEPILERQIHHLLNYAQGVMHIGQRDIAWLRVSKGAAAKGFSLKHIGSILHAKLH
FT                   QDFGGIVDKIQIKLYTTPEKVAEISGQSKKIYAKRDERIEGMTDENTETFYSCTLCQSF
FT                   APSHVCIVSPERTGLCGAYNWMDCRASNEINNLGPNQPVNKGAVIDAKLGQWSGINQFV
FT                   EKTSGGVVSHYNLYSIIHDPMTTCGCCECISAILPLCNGVMTVNREYAGMTPCGMKFTT
FT                   LAGTIGGGITTPGFLGHSKYNITQRKFISAENGLLRLVWMPKSLKDEIRERFNSRAAEL
FT                   GIPDLLERIADESVGTTEEEILPFLEEKQHPALTLEPLI"
FT   gene            complement(570331..571272)
FT                   /gene="cdhD"
FT                   /locus_tag="DhcVS_605"
FT   CDS_pept        complement(570331..571272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdhD"
FT                   /locus_tag="DhcVS_605"
FT                   /product="carbon-monoxide dehydrogenase delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_605"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61754"
FT                   /db_xref="GOA:D2BHF4"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016041"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHF4"
FT                   /protein_id="ACZ61754.1"
FT                   /translation="MPFETPKINYNGRIKEITLGEGPKAVTVGGETSMPFYLFEGEMPR
FT                   KPKIAMEIQDTPPEDWPEDVLKPFGDAVNNPVSWAKKCVDTYGAELICLQLESTDPNGI
FT                   DRSAEEAAKIVREVADAVDVPLIVWGTANHEKDTEVLRKASEACPDKKLILGPVEEGDY
FT                   KKIAAQAMAYKHTIIASSPIDINLAKQLNILLGNLGVPAEGLIMDPTVSSIGYGIEYSY
FT                   SVIERTRLAALTQQDERLQYPLICNIGREAWKTKEAKIPEAESPEMGHTEKRAIMIEAM
FT                   SAAILLIAGADILVIRHPESMRLAGELIDELS"
FT   gene            complement(571308..572198)
FT                   /gene="folD"
FT                   /locus_tag="DhcVS_606"
FT   CDS_pept        complement(571308..572198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="DhcVS_606"
FT                   /product="methylenetetrahydrofolate dehydrogenase
FT                   (NADP+)/methenyltetrahydrofolate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_606"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61755"
FT                   /db_xref="GOA:D2BHF5"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHF5"
FT                   /protein_id="ACZ61755.1"
FT                   /translation="MSAHIINGTEIAAAIREEIRSEVTALKAKHGIVPGLATVLVGDDP
FT                   ASHSYVDSKIKMCQNLGIYSEHHPLPQSATNEDLLTLIARLNADPKISGILVQVPLPVQ
FT                   ISENLVLNAINPDKDVDGFHPVNVGRMCLGEPCFLPCTPHGVQELLIRSGIKIEGTHVV
FT                   IVGRSNLVGKPLANILLQKAPGANATVTICHSGTKNLPLITSQADILVSAMGKPKFITA
FT                   DMVRQGAVVIDVGTTCIGYTPEGKRILSGDVDFEAVKEKALAITPVPKGVGPMTIIMLM
FT                   LNTLTAAKRAAGLVK"
FT   gene            complement(572198..572980)
FT                   /gene="cooC"
FT                   /locus_tag="DhcVS_607"
FT   CDS_pept        complement(572198..572980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cooC"
FT                   /locus_tag="DhcVS_607"
FT                   /product="carbon monoxide dehydrogenase nickel-insertion
FT                   accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_607"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61756"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR014433"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHF6"
FT                   /protein_id="ACZ61756.1"
FT                   /translation="MTYTIALAGKGGVGKTSVSSLIINQLLKNSLTPVLAVDADANANL
FT                   GESLGLDVPQTVGGLIASFNNVKLNLPPGMTKEAYLEYQLNTTLAESKGLDMISMGRGE
FT                   GDGCYCYPNSILRSYIDKLSQNYRYVVMDNEAGMEHLSRRTTQNVDHLFIVSDHSVKGV
FT                   RTLGRIRQLVDEMKLNVSQISVIINMVTGTLDPRLEAEINKLGIAYTDTVPTDEMIREF
FT                   DLKQTPLLKLPDNSPAVQAVAKILSTRLGIRNRTEVSE"
FT   gene            complement(572977..574899)
FT                   /locus_tag="DhcVS_608"
FT   CDS_pept        complement(572977..574899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_608"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_608"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61757"
FT                   /db_xref="GOA:D2BHF7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR027980"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR040506"
FT                   /db_xref="InterPro:IPR041414"
FT                   /db_xref="InterPro:IPR042259"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHF7"
FT                   /protein_id="ACZ61757.1"
FT                   /translation="MTEKKFSVCFEPSHKIINGQRGDSLLDLAIAAGTGLCASCGGEGV
FT                   CGRCRIKLVEGELECEDHLQISTEEFAQGIRLACQSRLISNVTVEILAESRFDTALSGD
FT                   AISCTLQSQPELSENKAFLPLRKVFLKLTPPSSTDNASDLARLKRFLKPVCPAEADIDY
FT                   HLLSGLSETLREKNWEVTLSLLKTPGGEKIINIQPGDQTKATYAFAFDIGTTGVRGQLV
FT                   ELTESKVLAQATEYNGQIPLGEDVISRINYAAREGGLIQLQRAVVNTLNNLGNAMLSEY
FT                   GLEADDISFATIAANTTITQLLYGLDPKHLRLAPYVPTANELPLIPARHINLSICPQAY
FT                   IYTLPCVASYVGGDIVAGVISTNIPRREGLVLYIDIGTNGEIVVGNKDFMLTASCSAGP
FT                   AFEGGGIKNGMLAKPGAVEDIELDTQNFEPKLSIIGGGNPKGICGAGLINTVSALLKCG
FT                   LLGQNGKYNSNIKTIRLRKGADGCEYVLAFGREFGQGQDITLSEVDIDNLIRAKAAMYA
FT                   GYQTLLESAGASFDNLEKVIIAGTFGAKLNIKKAINIGLLPELPEERFIFVGNGSLAGA
FT                   RLCAFDANAQTQAAAAAKMMTNVELSESTSFMDNYMAAMFLPHTKSSDFPEVYAALSKF
FT                   NGGNT"
FT   gene            complement(574937..576730)
FT                   /gene="fhs"
FT                   /locus_tag="DhcVS_609"
FT   CDS_pept        complement(574937..576730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhs"
FT                   /locus_tag="DhcVS_609"
FT                   /product="formate--tetrahydrofolate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_609"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61758"
FT                   /db_xref="GOA:D2BHF8"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHF8"
FT                   /protein_id="ACZ61758.1"
FT                   /translation="MTINNRKSHLKDLDPGLMKDWEIAEKAEEFLKPSKILAEELDLTE
FT                   DEIIPHGKYVAKVDFAGVLTRLKDRPNGKYIDVTAITPTPLGEGKSTTTMGLVQGLGNL
FT                   GKKVTGAIRQPSSGPTFNIKGSAAGGGRSQCLPLSPFTLGLTGDIDAVTNSHNLAMVAL
FT                   QARLQHEANNTDEFLSSRNLKRLDIDPARVELKWAIDFCAQSLREIIMGIGGKTDGYQM
FT                   HSGFGISVSSEVMAIFSVFTGLADLRERMSKIIVAYRQNGEPVTTADLEVDGAMTALLL
FT                   RAVNPNLLQTIEGQPVFVHAGPFANIAIGQSSIVADRLALKLADYHVTESGFGADIGFE
FT                   KFWNIKCRLSGLKPDCAVIVATVRALKMHGGGPKVTPGAPLDPAYTTPNAALVEKGCQN
FT                   MLAHIQTVKTAGINPVVCINHFSTDTHQEINIIRRTAEQAGARVAVSYHWANGGEGAAE
FT                   LAEAVIDACNEPNDFHFLYPEDMPLRERIYTIARKVYGADGVSYTQTAMEKLTRLENTG
FT                   NTQFMPSCMVKTHLSLSHDPTLKGRPSGFTLPIRDILTYMGAGLVVPVAGDIKLMPGTS
FT                   SDPNFRRIDIDTHTGKVKGLF"
FT   gene            576860..577441
FT                   /locus_tag="DhcVS_610"
FT   CDS_pept        576860..577441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_610"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61759"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHF9"
FT                   /protein_id="ACZ61759.1"
FT                   /translation="MHELLPFYGKRQKSFLKWYMRLASLSRWPLAGGLVKKYANHYARK
FT                   QHGGYLLNLPEAKEILDMSENIYLGPCSCREVFNNCDAPVMAEIIIGAGGHVYRDTLGK
FT                   FKPISREQALEVIISCQQAGLMTTLVHCKEHFYSICNCCRCCCVPYRLKHQYGIEFALV
FT                   RDKNIVSRFAQFLKEEGLHGVPENIQPPKT"
FT   gene            577404..577739
FT                   /locus_tag="DhcVS_611"
FT   CDS_pept        577404..577739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_611"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61760"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHG0"
FT                   /protein_id="ACZ61760.1"
FT                   /translation="MEYRKIYSRLKPELLFDTLKDLITKHGGHLESASSDNYSVTDSSS
FT                   DFIFKGTMVFSRVKNSSAACASVYVMGSERKDSRVILDIEPGAFGEASVKCLMDEVDFL
FT                   LGEYEKK"
FT   gene            577816..579612
FT                   /gene="aspS1"
FT                   /locus_tag="DhcVS_612"
FT   CDS_pept        577816..579612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS1"
FT                   /locus_tag="DhcVS_612"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_612"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61761"
FT                   /db_xref="GOA:D2BHG1"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHG1"
FT                   /protein_id="ACZ61761.1"
FT                   /translation="MLKTHSCALTQENIGTEVTLAGWVHRRRDHGGVIFIDLRDREGIV
FT                   QVVFNPEQSTGCLDIGKELRSEYVLQVKGVVSRRPAGTENSRMPSGLVEVVAADAKILN
FT                   AAKTPPFYINEEVEVDESLRLKYRYLDIRRQGMKNNLIIRHKAVSFMREFLNTRGFIEI
FT                   ETPILIKSTPEGARDYLVPSRLFPGQFFALPQSPQQLKQLLMVAGMEKYYQVARCFRDE
FT                   DLRADRQPEFTQLDMEMSFVDENDMMQLMEDLFTGLVASVRPDMKYNKKFPRISFADAM
FT                   EKYGCDKPDLRFGMELADITDIGASSAFGVFKNVAAQGGAIKAISAPGCGGYNKSQQEE
FT                   LINLAKKYGAAGSVPISLSAESGELKDLTMEMVKSVAAKYLTLEEIKTIAERSGAKSGD
FT                   LILIVAGARKMVNSVLGEMRNHLAAKLGLCDKNELSFAFVVDFPLFQWDEEGKRWDSVH
FT                   HPFTAPLEADMPLMDTDPAKVGSRAYDVVCNGYEIAGGSIRIHQADLQRKVFHLLGYND
FT                   EQINERFGHLLEAFEFGAPPHGGVAPGIDRFVMLLAGETSIREVIPFPKNQAAQDLLFG
FT                   APSVVDDKQIRDLHIRIQAEKE"
FT   gene            579632..580975
FT                   /gene="tig1"
FT                   /locus_tag="DhcVS_614"
FT   CDS_pept        579632..580975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig1"
FT                   /locus_tag="DhcVS_614"
FT                   /product="trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_614"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61762"
FT                   /db_xref="GOA:D2BHG2"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHG2"
FT                   /protein_id="ACZ61762.1"
FT                   /translation="MKVTDKKIEGCQASITVEMDSTEVEEGLSKTYRRLVKKVEIPGFR
FT                   KGKTPRDVFEKYVSREKMLDEMVDDIVPEACQQAIKDEDIKPFAAPKVAMVTTEPFVFS
FT                   ARIPLPPVVELGDYKTIRATKEKVEITEENIDTVIDQVLHQRATWEKVERSVKIGDMLL
FT                   MNVESTLNGEPYLNREDMQYSVREEAIYPAPGFGEHLVDMVVGEPKEISIVFPEDHARA
FT                   ELAGKTAAFKITIKEIREEKLPELNDAFAHELNPEFNTLAELRQRIRENMQERQDDKAQ
FT                   AKFEDQIVEALIKMSKIDYPEVMVEAELDQIIEQQLQRLQSNVKSPEEFRAMLSQMTPE
FT                   DMQQRYRPLAEQRVESSLALGKLATAENLIPSDEEVDAEIEKLTQDSGDKKEEEKAFYN
FT                   KSETRDRLIQLLTARKTMAFIDEIALQPAIEVVEPKADKGEKTEEADK"
FT   gene            580972..581574
FT                   /gene="clpP"
FT                   /locus_tag="DhcVS_617"
FT   CDS_pept        580972..581574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="DhcVS_617"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_617"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61763"
FT                   /db_xref="GOA:D2BHG3"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHG3"
FT                   /protein_id="ACZ61763.1"
FT                   /translation="MISPENVVPMVIESSARGERAFDIYSLLLKERIIFLGSQINDQVA
FT                   NLVIAQLLFLDREDPDKDISLYIHSPGGVISAGLAMYDTMQLIRPKVSTICVGVAASMA
FT                   TVLLCAGAKGKRYALPNATIHMHQAMGGAQGQASDIEIAAREIMRQQDILRNILVKHTG
FT                   QPMEKIIHDSDRDYYLNAQQAVEYGLIDEILQKPENK"
FT   gene            complement(581654..582640)
FT                   /locus_tag="DhcVS_618"
FT   CDS_pept        complement(581654..582640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_618"
FT                   /product="sugar kinase ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_618"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61764"
FT                   /db_xref="GOA:D2BHG4"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHG4"
FT                   /protein_id="ACZ61764.1"
FT                   /translation="MTACRLEAIGLGAVHVDHIYTVEQILHDGECVVTESALFPGGSGA
FT                   NTIHGLSRLGLKCGFIGAVGNDPDGNLLIKDFENAGIDNRYLMVKNEAQTGSVVSLSES
FT                   SGRRSTYVNPGANNYLDLSDINLEYLSQAKLVHMSTFFNQNEFALCHEIAERLAPGVLF
FT                   SFSPGALFAAQGLKRLAPILSRTNALFTNQQDIEKMTQKNYQRATDMCIRSGCEHVVVT
FT                   LGESRRFQRKGKITLQTYIRDKDHECHMESTVSLRKDIRTVVDTIGAADAFTTGFLFGL
FT                   MGDKPIEECGLLGDISARFCISKLGARSGLPDLAGLKERFGMHYFTN"
FT   gene            complement(582642..583463)
FT                   /locus_tag="DhcVS_619"
FT   CDS_pept        complement(582642..583463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_619"
FT                   /product="phosphoribosylglycinamide transformylase,
FT                   folate-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_619"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61765"
FT                   /db_xref="GOA:D2BHG5"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHG5"
FT                   /protein_id="ACZ61765.1"
FT                   /translation="MFELGWFSTARGKGSRNLLTAVLDSIQKGELKAKISFVFCSREPG
FT                   ESAETDAFFELVKSHNIPLVTFSYQKYKAKVNGSDETPGGSLPRWRLDYDSEVLKRLKP
FT                   YKPQLCVLAGYMLIMGPEMCSRYNIINLHPATPWGPKGTWKEVIWELMQQKASETGAMI
FT                   HLVTPELDRGPVVSYCRFSIQTDSFKPLWDDIAGRAVNEIKATEGENNALFRTIRHQGT
FT                   IRELPLIVRSIKAISEERVNIRQGKITDNCGQTIPGYDLSTEIDPIIQGRE"
FT   gene            complement(583466..584125)
FT                   /locus_tag="DhcVS_620"
FT   CDS_pept        complement(583466..584125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_620"
FT                   /product="PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_620"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61766"
FT                   /db_xref="GOA:D2BHG6"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHG6"
FT                   /protein_id="ACZ61766.1"
FT                   /translation="MLKADLHVHTNYSMDSNTKPEDLIKKCVEKGVNCISLCDHGTAEG
FT                   ALMLAQNSPIKIIVSEEVLTHHGEIMGMFLKESIPSGISVDECVSRIKAQGALVCIPHP
FT                   YDKLRGSALIDSELERLASEGKIDVLEVFNSRTLLNGSLKKARKLAKQYDLPMSAGTDS
FT                   HTLPEIGTTYVTMPNFNSPEEFITALRQGRITGRQNRMVRIRALIRKLSKYIKPEK"
FT   gene            complement(584128..584688)
FT                   /gene="efp"
FT                   /locus_tag="DhcVS_621"
FT   CDS_pept        complement(584128..584688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="DhcVS_621"
FT                   /product="translation elongation factor P
FT                   (EF-P)/translation initiation factor 5A (eIF-5A)"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_621"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61767"
FT                   /db_xref="GOA:D2BHG7"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHG7"
FT                   /protein_id="ACZ61767.1"
FT                   /translation="MATGNELKKSCIIQQENSLFQVMDIQHVKMKHTALLRLKLKDIRD
FT                   GHTMEQTFQSDEKFNLVNLEYRHMQFLYNDDNVYHFMDDKTFEQIALNKSVLGDAVNYL
FT                   LENGSVRVMTFQEEAIGVELPASVNLRIAHTEPGFKGDTAATTTKPATLETGLVVQVPL
FT                   FINTEDLIRVDTRSGQYLGKATA"
FT   gene            complement(584704..585792)
FT                   /locus_tag="DhcVS_622"
FT   CDS_pept        complement(584704..585792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_622"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_622"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61768"
FT                   /db_xref="GOA:D2BHG8"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHG8"
FT                   /protein_id="ACZ61768.1"
FT                   /translation="MKHTNARLALLRKLMSENELGGLLVSKPENIFYLSGFTGGEGHLL
FT                   ITQTHAFIAVDFRYYEQAENESLEYTLCKVTNGMSCWLPELLSSGNIRRLGFESFYITF
FT                   EEYSKLKTALNESGSDILLTETADLAGKLRQIKSKEEIDDIKQAAAIGDAAFSALPSLL
FT                   TQGMTEQKLAWELEKFMRNRGSQSMPFEVIAATGANSALPHAQTRPVTIAYGQPLLMDY
FT                   GAKASWYVSDMTRTVLPGKPDSKFKKIYDIVLSAQQKAIDQITSGMTGQEADAIAREII
FT                   EKAGYGANFGHSLGHGVGLEVHEAPRLSPKSTDILENGMVFSIEPGIYLPGWGGIRIED
FT                   TCTLKNGKIELLSKSDKQNPYI"
FT   gene            complement(585789..586712)
FT                   /gene="xerD3"
FT                   /locus_tag="DhcVS_623"
FT   CDS_pept        complement(585789..586712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD3"
FT                   /locus_tag="DhcVS_623"
FT                   /product="site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_623"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61769"
FT                   /db_xref="GOA:D2BHG9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHG9"
FT                   /protein_id="ACZ61769.1"
FT                   /translation="MQENFNKYLEYLSVEKNVSAYTLRNYRTDLIGFVNYLIEKKVSSF
FT                   DRVDRYILRDYMSSLIAKGIVKGSIARKLSAVRSFYRYLMREGLIQKNPTLNASSPRLD
FT                   KRLPEFLTTAEVSKLLRMPDSSTPQGLRDKAFMELLYASGLRVSELVKLDIENLDLHSH
FT                   QIRVWGKGSKERIVLMGLPAIQSIQTYLNLGRPLLKGKRNTPALFLNPNGGRLSARSFQ
FT                   ERLDKLAHQAGIEKHVHPHMLRHTFATHLLDGGADLRVVQELLGHSNLSTTQIYTHVTK
FT                   SQARKVYMSSHPLAKPQNDTSGSEEE"
FT   gene            complement(586713..588824)
FT                   /gene="topA"
FT                   /locus_tag="DhcVS_624"
FT   CDS_pept        complement(586713..588824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="DhcVS_624"
FT                   /product="topoisomerase IA"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_624"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61770"
FT                   /db_xref="GOA:D2BHH0"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHH0"
FT                   /protein_id="ACZ61770.1"
FT                   /translation="MKEKLVIVESPAKARTISKMLGKDFNIMATMGHIRDLPKSTLGVD
FT                   VENSFTPKYVSLKAKAKVIKELKEAVKNSKAIYLATDPDREGEAIAWHISEVTKANLAK
FT                   PKRVVFHEITKEAIDKAFKNTRELDMDLVNAQQARRVLDRLVGYKLSPLLWRKVQRGLS
FT                   AGRVQSVSLKIIVDREREIEKFVSAEYWNIEALLNKKVKSAAFKASLAGYVTKGKLEIH
FT                   NESEAEQIKKELEVADYQVLKIKKKSNLRQSPAPFITSTLQQEAWRKLHFSAKQTMVIA
FT                   QQLYEGLNIEGEGEVGLITYMRTDSTNVARTAVAETRDYISEKYGPAYLPKQARVFSSK
FT                   VKGAQEAHEAIRPTRITRTPDLIKKSLSAEQFKLYQLIWQRMMASQMSPAAFDNTTIDI
FT                   EAKHQPSKTRYLLRTTSSVNTFPGFTIVYIEGKDEDEEAAQSSLPSMEEGEELKLKNLE
FT                   ASQHFTQPPPRYTEATLIKALEQYGIGRPSTYAPTISTIQEREYITKLKGSLKPSELGM
FT                   LVNDLLVEYFPDIIGIDFTAAMETELDKIATEKLDWVPIIRRFYEPFIKEIEAASEKIE
FT                   KIKPPEEELDELCPECNAKLVVKRGRFGKFIACSRYTKEEGGCRYTRSYQIKTGAKCPE
FT                   CNSDIVEKYSKKGKIFYGCAGYPNCKFVSFYKPLSKPCPECGALMTKSGKNWAKCTKCG
FT                   KRKKLEDES"
FT   gene            complement(588831..589952)
FT                   /locus_tag="DhcVS_625"
FT   CDS_pept        complement(588831..589952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_625"
FT                   /product="Rossmann fold DNA uptake nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_625"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61771"
FT                   /db_xref="GOA:D2BHH1"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHH1"
FT                   /protein_id="ACZ61771.1"
FT                   /translation="MQNQDCKYAIGFSYINGVGRVRLNLLESYFGNLESAWHAGKEALV
FT                   SAGLDNSLAENIVTSRPTIDLPKTLETLKRHDIQVYTHTDSDYPARLKQIHDYPPLIFV
FT                   KGQLLGNDELCLGIVGTRQPTVYGKLVTEELAESLARAGLTIVSGLARGIDTVAHTAAL
FT                   KAGGRSIAVFGCGLDIIYPSENSCLARQIAENGALVSEHPPGIHPRPEFFPRRNRILSG
FT                   LCRGILITEAGENSGAVITANFALEQNREIFAVPGSILSAASVGTNRLIQEGAKLVSSA
FT                   KDVLEELNIGLFSAQDNTLASAPENQTESLILDKLGYEPIHIDQICRECGLGIALVSST
FT                   LAIMELRGQVRSAGGMNYVRTREKKEIYQLEMN"
FT   gene            complement(590082..590171)
FT                   /locus_tag="DhcVS_626"
FT   tRNA            complement(590082..590171)
FT                   /locus_tag="DhcVS_626"
FT                   /product="tRNA-Ser"
FT   gene            complement(590205..590294)
FT                   /locus_tag="DhcVS_627"
FT   tRNA            complement(590205..590294)
FT                   /locus_tag="DhcVS_627"
FT                   /product="tRNA-Ser"
FT   gene            590725..591999
FT                   /locus_tag="DhcVS_628"
FT   CDS_pept        590725..591999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_628"
FT                   /product="Kef-type K+ transport systems membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_628"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61772"
FT                   /db_xref="GOA:D2BHH2"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHH2"
FT                   /protein_id="ACZ61772.1"
FT                   /translation="METEIYFKFILSFGLILLVARLGGAIAERFLKQPAVIGELLAGII
FT                   ISPFLVGQFLFANDPIIMNFALIDGVFSQNGEHLSEFAPMEIISQIAVVVLLFVAGLET
FT                   NVASFIKNSFTGAMVAIGGVIVPFALGVFSAMYFFPDLHMAGWLFIGAILTATSIGITV
FT                   RILMDMGKLSSREGTIILVAAVVDDIIGLVILSVVISMAQSGSINALSAIGTGVIGFAV
FT                   WLGILLLGVYGHKYISKYILTPFKASGTMPVMALIVGLLVSYLVTLVGLHPVVGAYVAG
FT                   LMFASTMEKEEILHQTRPIMLFIAPFFFAYLGMQVDLKEVWAVIVPALVIVVLAIVGKI
FT                   VGCYFPARFVGKTSHNGALIVGVGMVPRGEVGLIVAGAGLIAGAITRDLFGIAVAVSIL
FT                   TTLVMPLMINPLFKPKAEANGKRLS"
FT   gene            592035..592106
FT                   /locus_tag="DhcVS_629"
FT   tRNA            592035..592106
FT                   /locus_tag="DhcVS_629"
FT                   /product="tRNA-Arg"
FT   gene            592141..592713
FT                   /gene="porG"
FT                   /gene_synonym="korG"
FT                   /locus_tag="DhcVS_630"
FT   CDS_pept        592141..592713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="porG"
FT                   /gene_synonym="korG"
FT                   /locus_tag="DhcVS_630"
FT                   /product="2-oxoacid:ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_630"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61773"
FT                   /db_xref="GOA:D2BHH3"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHH3"
FT                   /protein_id="ACZ61773.1"
FT                   /translation="MKHFIEIRWHGRGGQGAVTSAELIAQAAIGKGKYAQAFPSFGPER
FT                   RGAPVQSFNRISDNNPIRERSGISQPDIVVVLDPSLVIIGNVVSGLKEGGTLIINTTKP
FT                   LEYFASQYGDRWKVATVDATAIAKEVLGVNIVNTTMLGALIKATALADMEAFEEPLKHR
FT                   FGKLAAKNMAAMKKAFEETAVKELKVG"
FT   gene            592706..593002
FT                   /gene="porD"
FT                   /gene_synonym="korD"
FT                   /locus_tag="DhcVS_631"
FT   CDS_pept        592706..593002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="porD"
FT                   /gene_synonym="korD"
FT                   /locus_tag="DhcVS_631"
FT                   /product="2-oxoacid:ferredoxin oxidoreductase, delta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_631"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61774"
FT                   /db_xref="GOA:D2BHH4"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHH4"
FT                   /protein_id="ACZ61774.1"
FT                   /translation="MAKQENQITWQEVTPGCIVSEPGNASQYKTGDWRSQLPIHNFKKC
FT                   IKCGVCYIFCPEGCINETKEGFFEADLFYCKGCGICAHECPTGAIVMKDEEEK"
FT   gene            593002..594174
FT                   /gene="porA"
FT                   /gene_synonym="korA"
FT                   /locus_tag="DhcVS_632"
FT   CDS_pept        593002..594174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="porA"
FT                   /gene_synonym="korA"
FT                   /locus_tag="DhcVS_632"
FT                   /product="2-oxoacid:ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_632"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61775"
FT                   /db_xref="GOA:D2BHH5"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHH5"
FT                   /protein_id="ACZ61775.1"
FT                   /translation="MARVGLEVSIALSEAVGLCNADVIAAYPITPQTHIVEHLAEMVAE
FT                   GELDAEYIPVESEHSALSACLGSAAAGARTFTATAGQGLELMHEVLYVASSMRLPIMMA
FT                   VANRALSGPLSVWGDHSDVMSCRDIGWIQIFTENGQEVVDNTICSFKIGEDKRVLLPVM
FT                   VHLDGFHLSHVIEPIDMPEREQVDAFLSVNDYPYALNPDNPRAMGDFAPPVIFTEAKWA
FT                   QEQDFQKSKAVILEVWKDFEKQFGRSYKPVETYRTEGAENLLFTMGSFSETAMAAIDKM
FT                   RDDGMSVGLVRLRLWRPFPFEELRAAVKNAKNLIVLDRALSVGGPGGPVCSEIKAALYP
FT                   LEKKPKIVSIIGGLGGRDITVANFEDIMKKGMAIAEKGSPNEYEIYGVRA"
FT   gene            594174..595115
FT                   /gene="porB"
FT                   /gene_synonym="korB"
FT                   /locus_tag="DhcVS_633"
FT   CDS_pept        594174..595115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="porB"
FT                   /gene_synonym="korB"
FT                   /locus_tag="DhcVS_633"
FT                   /product="2-oxoacid:ferredoxin oxidoreductase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_633"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61776"
FT                   /db_xref="GOA:D2BHH6"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHH6"
FT                   /protein_id="ACZ61776.1"
FT                   /translation="MQNYSVFVPKLLPKRELFAPGHRGCIGCGEALAVRLATKAMDENT
FT                   IMVNATGCMEIIASQYPYTSWRLPWIHTLFENTAAVASGVESAIKVLKRKKRIEDRDIK
FT                   IVAIGGDGATVDIGLQALSGAMERGHNFTYICFDNEAYMNTGIQRSSATPFGASTTTSP
FT                   AGKVGKGQFSWKKDMPAIAVAHNIPYVATCCPSYPFDMIEKVSKALAADGPAYIHCLSV
FT                   CPTGWRCATEDTIKIGRLAVETGVFPLYEVINGQYKLSMETPELKPLREYTSLQRRFRH
FT                   LTEESLDLIQERVQLEYNKIAERAACAPKLEK"
FT   gene            595091..595564
FT                   /gene="hymA2"
FT                   /locus_tag="DhcVS_634"
FT   CDS_pept        595091..595564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hymA2"
FT                   /locus_tag="DhcVS_634"
FT                   /product="[Fe] hydrogenase, HymA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_634"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61777"
FT                   /db_xref="GOA:D2BHH7"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHH7"
FT                   /protein_id="ACZ61777.1"
FT                   /translation="MCTETREIVAPKVKDILNKYAKDKGMLVAILQDIQTEFNYLPRPA
FT                   LEAVSQGLGVPMSQVYSVATFFKAFSLKPKGKHSIHVCMGTACHVRGANKILDKLVEKL
FT                   GCCAGENTEDMKFSLDAVNCVGACALGPVVVVDGQYMGNMTTEKVKPLIEGCQ"
FT   gene            595555..597435
FT                   /gene="hymB2"
FT                   /locus_tag="DhcVS_635"
FT   CDS_pept        595555..597435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hymB2"
FT                   /locus_tag="DhcVS_635"
FT                   /product="[Fe] hydrogenase, HymB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_635"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61778"
FT                   /db_xref="GOA:D2BHH8"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHH8"
FT                   /protein_id="ACZ61778.1"
FT                   /translation="MPVMSNTAIKKFSSVAELEAKRQEILKSRNSGQTVIAICCGTGCQ
FT                   AYGAKKVADAFEEELAKAGLGDKVEVRTTGCHGFCERGPLVVIRPQNIFYQRLKISDIP
FT                   EIIEKTIKNNEVIERLLYVDPMTKDKKVHEHDVPFYKKQMRLVFGNNGNIDPTSIEDYL
FT                   AVGGYKSLAKAISGLKPEEIVDEIIKSGLRGRGGGGFPTGWKWKSCRDAHDPVKYVICN
FT                   CDEGDPGAFMDRSLMEGNPHSVIEGMIIGAYAIGSHEAYIYIRDEYPMAVRHALLAIKQ
FT                   AEDYGLLGGNILGSGFNLKIHINRGGGAFVCGESTALMASLEGKVGEPRAKYVHTSEKG
FT                   LYDKPTTLNNVETWANIPLIMEKGADWFNKIGTAGSKGTKIFSLVGKVNNTGLIEVPMG
FT                   ITLREIVYDIGGGIPKGKKFKAIQTGGPSGGCLPESMLDLPVDFDELTKAGSMMGSGAM
FT                   IVMDEDNCMVEIARYFLSFLEGESCGKCVPCREGVKRMRQILEKITKGEGEEGDIELLE
FT                   QLSQAIQDASLCALGGSAPNPVMSTIKYFREEYEAHIRQKTCPAKECKALINYNIIDAN
FT                   CPGCGLCYKACPTGAIIPQGKKMPVILDQSKCTKCGACFDACKLHAVEIR"
FT   gene            597447..598169
FT                   /gene="hymC2"
FT                   /locus_tag="DhcVS_636"
FT   CDS_pept        597447..598169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hymC2"
FT                   /locus_tag="DhcVS_636"
FT                   /product="[Fe] hydrogenase, HymC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_636"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61779"
FT                   /db_xref="GOA:D2BHH9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHH9"
FT                   /protein_id="ACZ61779.1"
FT                   /translation="MIDLTIDGKKYQAEEGQTVLEVAHRHGIFIPTLCVDEAVSAYGAC
FT                   RLCMVEIERKGRKKLVASCLYQAEEGLVVTTQNDRITNIRKTVIELLLARCPQSEGVQA
FT                   MAKKLGVTCSRFESEKPENLCTLCALCTRVCSEVVGKSAISLVSRGTSREVALPYYDDK
FT                   TDCIACGSCAYICPTGAITMKDGNGMRIITWPNCKVSFKLRRCAKCGAEWIPEKQVKHI
FT                   LNTTEVPAEFFDVCPDCR"
FT   gene            598225..598302
FT                   /locus_tag="DhcVS_637"
FT   tRNA            598225..598302
FT                   /locus_tag="DhcVS_637"
FT                   /product="tRNA-Pro"
FT   gene            598733..600232
FT                   /locus_tag="DhcVS_638"
FT   CDS_pept        598733..600232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_638"
FT                   /product="mercuric reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_638"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61780"
FT                   /db_xref="GOA:D2BHI0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHI0"
FT                   /protein_id="ACZ61780.1"
FT                   /translation="MILPDGKRTGMKYQYDLVVIGGGLAGFTSAVFANGLGKKVALVER
FT                   DKLGGACTWNACVPSKALLQIGLRIRQIEKYNRNGVKLVSVNLQPGNIMSYLHSILGDI
FT                   ARIDDFDNLGNIGINILKGEAVFTDHHHINLNGQVISAKRFIIATGSSPAIPPVEGLVD
FT                   IPFYTNETVFDINTIPSSMIVLGGGPAGIELGLAFAWLGCKVDIVEMADHILPKDDTEL
FT                   SELLFEYLNVEENLRIHISTKAIRFQKQNNGQVKLEMQTREGKIDEIAAEAVLVAVGRR
FT                   ANVSGLGLEKTGVKYTSQGISVDKKLQTSSSNIFAAGDVAGPIQLGMMAEKQAILAASN
FT                   ACLPFKQSIRYEDVAWVTYSEPQMAHIGLTEDEARRKYGNNVRIIRYPLNKVRRAVMDH
FT                   DIRGMCKFMLDKKDRLIGAQLLCSHAENLIHELQILKCLHKPFLKLHSIPHIYPTYEEG
FT                   IIKRAADISYTMKMRHNPLIRLVLRYWPGYKDKLDAVINRL"
FT   gene            complement(600267..600341)
FT                   /locus_tag="DhcVS_639"
FT   tRNA            complement(600267..600341)
FT                   /locus_tag="DhcVS_639"
FT                   /product="tRNA-Gly"
FT   gene            600491..600877
FT                   /locus_tag="DhcVS_640"
FT   CDS_pept        600491..600877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_640"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61781"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHI1"
FT                   /protein_id="ACZ61781.1"
FT                   /translation="MPIYEYSCSKCNKVFELMRPRSESSLSATCPVCNAESPRIVSDFT
FT                   HGVAFSKDAPESRKDSANEKMWISQQKVEENKVKNPDPLKKWREEREKSCGKGPEAWVE
FT                   YAKQEEAKVQKVKDYGTGFTGREV"
FT   gene            600894..600968
FT                   /locus_tag="DhcVS_641"
FT   tRNA            600894..600968
FT                   /locus_tag="DhcVS_641"
FT                   /product="tRNA-Met"
FT   gene            complement(601034..601831)
FT                   /locus_tag="DhcVS_642"
FT   CDS_pept        complement(601034..601831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_642"
FT                   /product="oxidoreductase, short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_642"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61782"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHI2"
FT                   /protein_id="ACZ61782.1"
FT                   /translation="MMTVAELFDLKGKVAIVTGGAMGIGKGISMRLAEAGASIMIPDLN
FT                   LEVAQKTAAEIQSMGGKAAAVQADVSNISDAQKVIDTTLKEFGDLDIMVNNAGIYRFMP
FT                   AIDMTEAMWDKTLGINLKGLMFFSQAAAKAMIAAKHGGKIINIASIDGFRPTGNLAHYD
FT                   ASKGGVVMLTKAMAQEWAPHGILVNAVAPGGINTPGAAALMPSGNMSAEQLMELSRSFV
FT                   AKLPLKRMGEPDDIGKVVLFLASAAADYMVGSVIIADGGALLV"
FT   gene            601978..603189
FT                   /locus_tag="DhcVS_643"
FT   CDS_pept        601978..603189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_643"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_643"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61783"
FT                   /db_xref="GOA:D2BHI3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHI3"
FT                   /protein_id="ACZ61783.1"
FT                   /translation="MEGVINKTVVNNVIIQPERAVLAAVDTNNNSNWAIEDSLDELSQL
FT                   VLTAGATVVGRIIQKLHAPARNSYLGKGKLDELVGMKKELNYNLVIFDDELSPIQQRLL
FT                   EEALGVKVIDRVALILDIFAKHANTREGQLQVELAQMQYLLPRLAGQWSHLERLGGGIG
FT                   TRGPGESQLETDKRIIRTKIRSLQDHLDEVTTHRDLYRERRRMRGVPVVSLVGYTNSGK
FT                   SSLLNAVAKTDVLAENKLFATLDPTTRRLYINGLGNVLLTDTVGFIRKLPPAIVKAFRA
FT                   TLEEINQADLLVHVVDITAKNAVEQCQTVEKILADMGVADKPRLTVMNKIDLKLDGGRN
FT                   WTEDEALNLLKAECPVAENTVLISAAKRWGLMEFTRMLKEKLLGIGFNPGYAVYDEIGG
FT                   KKER"
FT   gene            603195..603407
FT                   /locus_tag="DhcVS_644"
FT   CDS_pept        603195..603407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_644"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61784"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHI4"
FT                   /protein_id="ACZ61784.1"
FT                   /translation="MEKELAGNIMSCLDELSKGLSRRRELLAKAGACEDYYFYYDLAAI
FT                   DEEERKALNKLNSLGKQDATENIAK"
FT   gene            complement(603505..603795)
FT                   /locus_tag="DhcVS_645"
FT   CDS_pept        complement(603505..603795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_645"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61785"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHI5"
FT                   /protein_id="ACZ61785.1"
FT                   /translation="MPSFMLSYIFSLIDYITYIVRTTIKLKFDVFCLGYQDEIFFQTFV
FT                   VIYFKLSFEDQCEPMKSFARSQKLILNAPYPKLCKNELHLHKLVCLMRLII"
FT   gene            complement(604033..605205)
FT                   /locus_tag="DhcVS_646"
FT   CDS_pept        complement(604033..605205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_646"
FT                   /product="class I/II aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_646"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61786"
FT                   /db_xref="GOA:D2BHI6"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019881"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHI6"
FT                   /protein_id="ACZ61786.1"
FT                   /translation="MKLSKRIENLPPYLFVQISKKIAEKRAKGEEVISFAIGDPDLPTP
FT                   KHILAELCKAAEDPSNHRYPETEGMPVLRKAMAEWYKKRFGVKLNPDTEILPLIGSKEG
FT                   IGHAAWCFLDPGDIALVPNPAYPVYAISSQLAGADVFNMPLNKENNFLPDFNTIPEDIL
FT                   LKAKVLWINYPNNPTGAVADLDFFKKAADFAAKHNLAVCHDGPYSEIAFDGYKPVSFLE
FT                   AEGAKDVGIEFHSLSKSYNMTGWRIGMAVGNAKMIDALRRFKSNLDSGIPQAIQLMAIA
FT                   ALKGSQEVINHNCAVYQRRRDRLVKALHNIGMEVTAPKASLYIWAPVPEGYTSASFATE
FT                   LLDKTGVVVTPGTGYGTAGEGYIRLSLTVPDEQLEKGITKLSGYKRNTFS"
FT   gene            complement(605192..606046)
FT                   /gene="dapF"
FT                   /locus_tag="DhcVS_647"
FT   CDS_pept        complement(605192..606046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="DhcVS_647"
FT                   /product="diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_647"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61787"
FT                   /db_xref="GOA:D2BHI7"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHI7"
FT                   /protein_id="ACZ61787.1"
FT                   /translation="MKFTKLQSVGNDFVLVDPQGEERDWPKLALHMCHRHFGAGADGLM
FT                   LLLPSAKADFRMRIFNADGSEAEICGNGLRCLIHYIVANKLIGSRDELSIETLAGIRHA
FT                   QIFKDGRIRTTMGKPMFEAHQIPVAAEPDPKHYSGQLISDFPLNINNRRVLVSLVSMGN
FT                   PHAIHFCTKPVEEFLLGEVGSLVETHKAFPKRTNFEVANILDTEHIKVRVWERGVGETL
FT                   GCGSGASAVAVAAQILGYVGKFVYIKLPGGTLGVEWDGHDDVYLTGKAEIIYTGEWLKD
FT                   EIV"
FT   gene            complement(606033..607019)
FT                   /gene="miaA"
FT                   /locus_tag="DhcVS_648"
FT   CDS_pept        complement(606033..607019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="DhcVS_648"
FT                   /product="tRNA
FT                   delta(2)-isopentenylpyrophosphatetransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_648"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61788"
FT                   /db_xref="GOA:D2BHI8"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHI8"
FT                   /protein_id="ACZ61788.1"
FT                   /translation="MSIIDNTASAKASNSPVAPLLVILGNTGSGKSALALKLAKEIPAG
FT                   IINADSRQIYSHMDIATAKPTLSEMLEIPHFLYSFIQPDQSFNLAEYQTLAYQTIDSLH
FT                   RQTRLPILVGGSGQYLKAILEGWSIPQIAPDETLRAALFEKAEKEGGEALFADLEEKDP
FT                   QAASKIDSRNIRRVIRALEVIYKTGGKFSELQTKNPPPYRILKIGIHIPREELYRTVDL
FT                   RIEKMLEQGLEAEVRFLLEKGYKANLPSMSGIGYRQIAKHIEGGINLAEAIEQMKYETH
FT                   RLIRQQNTYFRLTDADIHWITLEESRSNNIIRLVRDFLAAEDKYEIH"
FT   gene            complement(607069..607824)
FT                   /gene="tpiA"
FT                   /locus_tag="DhcVS_649"
FT   CDS_pept        complement(607069..607824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="DhcVS_649"
FT                   /product="triose-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_649"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61789"
FT                   /db_xref="GOA:D2BHI9"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHI9"
FT                   /protein_id="ACZ61789.1"
FT                   /translation="MRQIIIAGNWKMNTTLSEACILVQSMKGELETIDGIEKIVCPPFI
FT                   SLSHIKTILENSSIKLGAQNLFYEEKGAYTGEISPLMLKELCQYVIIGHSERREYFGET
FT                   GQVVNQKIKAAIQAGILPIVCVGEKLEENEKGQTRQVLETQLKEALNGLSLSSIIIAYE
FT                   PIWAIGTGKAATASAANAAICYIRKVLSEILGNTAARKSSILYGGSVNEKNTAELLSQS
FT                   DIDGALVGGASLKADSFISICRQAAAISK"
FT   gene            complement(607836..609041)
FT                   /locus_tag="DhcVS_650"
FT   CDS_pept        complement(607836..609041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_650"
FT                   /product="phophosphoglycerate mutase AP superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_650"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61790"
FT                   /db_xref="GOA:D2BHJ0"
FT                   /db_xref="InterPro:IPR004456"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR042253"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHJ0"
FT                   /protein_id="ACZ61790.1"
FT                   /translation="MNKINLVSQLSQTTPSKIVLLVIDGLGGLPHPESGQTELETARTP
FT                   NLDELARKSICGMANPVGAGITPGSAPGHLALFGYDPVDCLIGRGVLEALGIDFDLKLG
FT                   DVATRGNFCTVDEKGLICDRRAGRVSSAVSAKLCTLLNGQEFEGVKVIVKPVKDHRLVV
FT                   VFRGSGLSEKVTDSDPQKLGVAPKEITHLAENARLMAKVANQFLQFAAKTLKDHAPANM
FT                   ILLRGFSEKPCFATMNEIYKLKTAAIASYPMYRGLSKVVGMDVLSTGPTLDDEIATYKA
FT                   NFEKYDFFFIHVKATDAAGEDGDFERKVKALENLDQVLPEILALQPDVIAVSGDHSTPA
FT                   VIEGHSWHEVPVLIYSKYCRPDKVCRFSETDCLQGGLGHIPARDIMPLAMANALKLGKF
FT                   GA"
FT   gene            complement(609034..610227)
FT                   /gene="pgk"
FT                   /locus_tag="DhcVS_651"
FT   CDS_pept        complement(609034..610227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="DhcVS_651"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_651"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61791"
FT                   /db_xref="GOA:D2BHJ1"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHJ1"
FT                   /protein_id="ACZ61791.1"
FT                   /translation="MENLTIRDLDFSGKKALVRVDFNVPINEETGGINDDSRIRAAIPT
FT                   IDYLLDHQAKVILCSHLGRPDGEVVESMRLAPVAKRLSEILRQEVFTVSDCIGDEVIAK
FT                   VNSLEDSQVLLLENLRFHPEEEANDPVFAKKLANLADIYVDDAFGTAHRKHASIVGVAK
FT                   YLPAVAGLLLEKELHALGKVLEHPPRPFMILLGGAKVSDKVGMLENVMDKVDTILIGGG
FT                   MAATFLKAQGLEIGDSLIDDSLDTAKMLMDKAKSKNVKIILPDDVLVTFDKIGPEAKAE
FT                   NVSVENIPHTAKIVDIGLLTITHFTKHLEKCKTVFWNGPMGIYEIPQFSEGTRAMVNTM
FT                   TRLHGTTIIGGGSTAEIVTELNIASKMSFVSTGGGASLKFLSGEKLPGVEVLAKKNE"
FT   gene            complement(610326..612269)
FT                   /gene="dxs"
FT                   /locus_tag="DhcVS_652"
FT   CDS_pept        complement(610326..612269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="DhcVS_652"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_652"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61792"
FT                   /db_xref="GOA:D2BHJ2"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHJ2"
FT                   /protein_id="ACZ61792.1"
FT                   /translation="MSTGLEISIPHNLEMSKLLDTINSPSDLKKLTLDELNELAAQIRE
FT                   ELVNRVTLNGGHLASSLGVVELTIALHRVFESPKDKIIWDVGHQSYAHKLLTGRREQFA
FT                   TLRQHGGISGFTCRDESPHDPFGAGHASTSISAGLGMAVARDLAKADYSVISVIGDGAI
FT                   SGGMSFEAINNAGHLHTKFIVILNDNGMAISPSTGALSKFLNNVRFDPRFEFAKRGAKQ
FT                   TITNMPFGKAVWAFTKSIKHKFEKSMLPGSLWEELGFIYLGPVDGHNIRELEAALKRAK
FT                   DFESQPVLIHMITQKGKGYDDAEADAVKYHGISPKSGGLKSGHGQSYSQVFGQTLHKIM
FT                   SDNPQVVAITAAMTDGCGLGEVAADFPDRVFDVGICEQHAVTFAAGMATQGYIPVVVIY
FT                   STFLQRSFDQIIHDVCLQKLPVVFAIDRGGIVGDDGKTHQGIFDLSFMSLIPDMIVAAP
FT                   SDENDLQHLLYTAVNSGKPFAIRYPRGFGEGVEMENGLHNIPIGQNEVLSTGSEIAILA
FT                   TGKSVAFSREALEILAESSIKPTLVNNRYISPLDKELVIKIARNHKYLITVEENVISGG
FT                   LGSRINTILAEAGLVNSIKVANIAIPDKFVEHGNQSLLRAKYGLDGKGIAQKILSTVDN
FT                   PGEIKHQQILCP"
FT   gene            612392..612943
FT                   /locus_tag="DhcVS_653"
FT   CDS_pept        612392..612943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_653"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_653"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61793"
FT                   /db_xref="GOA:D2BHJ3"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHJ3"
FT                   /protein_id="ACZ61793.1"
FT                   /translation="MSSEFWINLGLPPEWLVFLVSALPVFELRGALPLAINILGIPWYW
FT                   AYLIALAGNLLPVPLILFLLEKVLNVLEHFSFMRGFTRWIYVMGQKRSATVEKYKRIGL
FT                   ILLVAIPLPFTGAWTGSLVAVVLGLNRNESLLYISLGVVVAGAIVTCLCLLGWVGAMLA
FT                   GLVLGGIAFTRIIHSKNQLV"
FT   gene            612983..613059
FT                   /locus_tag="DhcVS_654"
FT   tRNA            612983..613059
FT                   /locus_tag="DhcVS_654"
FT                   /product="tRNA-Arg"
FT   gene            complement(613443..614864)
FT                   /gene="hpt1"
FT                   /locus_tag="DhcVS_655"
FT   CDS_pept        complement(613443..614864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt1"
FT                   /locus_tag="DhcVS_655"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_655"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61794"
FT                   /db_xref="GOA:D2BHJ4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR011578"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHJ4"
FT                   /protein_id="ACZ61794.1"
FT                   /translation="MVLNKERAFYKAVSRSIQSLNTPAELKAKLEGIVRLAARASHCAV
FT                   SLLLIDTAGQKLSHNISFGLPQFYIHKGVLSATDSLGETVNIQTTAITDAQNDSRIQFP
FT                   QMASKAGFSSIMGSPIIQQEKVIGSLRFYCKDFYEFSQQDINFAENMAHIISLAFFTLP
FT                   VNTASSDKITPMPISDLKTAKNITFAHQSEIEFARLLDFYNIEWIYEPRSFPLSWEGER
FT                   VTEMFTPDFYLPGLDMYIELTTLKQSLVTTKNHKLKLLRELYPDIKISLLYKNDYARLL
FT                   SKYGCGPLAQTRAHGIDRVLYTAQDIAERVASLARQISDDYPDNRPILIGVQRGFICFM
FT                   ADLIRQIAVPLDIDFMTISYYSGSNTSMVRITKDMDLDVAGRDILLVEDIVDTGITLNY
FT                   LLNHLRSKNPASLKVCTLLDRKVRRLIDIKIDYVGFELPDEFVVGYGLDYHEEYRNLPF
FT                   IGIPGIQQTPDFKPK"
FT   gene            complement(614973..615332)
FT                   /gene="rplT"
FT                   /locus_tag="DhcVS_656"
FT   CDS_pept        complement(614973..615332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="DhcVS_656"
FT                   /product="ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_656"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61795"
FT                   /db_xref="GOA:D2BHJ5"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHJ5"
FT                   /protein_id="ACZ61795.1"
FT                   /translation="MARIKGGIATHKRHKKVLALTKGHASTRHSLFKRAHESMVHAMSY
FT                   AFAHRRARKGDMRRLWITRINAAARAEGLTYGELISGLKLAGIDINRKVLADMAVSDSV
FT                   AFAAVAAKAVAVKTN"
FT   gene            complement(615351..615554)
FT                   /gene="rpmI"
FT                   /locus_tag="DhcVS_657"
FT   CDS_pept        complement(615351..615554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="DhcVS_657"
FT                   /product="ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_657"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61796"
FT                   /db_xref="GOA:D2BHJ6"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHJ6"
FT                   /protein_id="ACZ61796.1"
FT                   /translation="MPKMKTRKTAVKRFHVTGTGKIMRSKGMKSHLRRNKSARVRRQFD
FT                   EMSQVAGVDRARIQKLIPYGVS"
FT   gene            complement(615547..615927)
FT                   /gene="infC"
FT                   /locus_tag="DhcVS_658"
FT   CDS_pept        complement(615547..615927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="DhcVS_658"
FT                   /product="translation initiation factor 3 (IF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_658"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61797"
FT                   /db_xref="GOA:D2BHJ7"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHJ7"
FT                   /protein_id="ACZ61797.1"
FT                   /translation="MDYGKYRFEQTKKDREAKRTQKISLLKEIRVRPKIGEHDFDAKAR
FT                   SARKQLESGDKVKLTVMFRGREITHAELGLKLLKKMADTLTDIATIEGQPSLLGSRMHL
FT                   TLLPKAAIKVSKVKEGQETANA"
FT   gene            complement(616171..617919)
FT                   /gene="thrS"
FT                   /locus_tag="DhcVS_659"
FT   CDS_pept        complement(616171..617919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="DhcVS_659"
FT                   /product="threonyl-tRNA synthetase (thrS)"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_659"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61798"
FT                   /db_xref="GOA:D2BHJ8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHJ8"
FT                   /protein_id="ACZ61798.1"
FT                   /translation="MANQIDESKPISDLEIMRHSAAHIMAEAVLSMFPEAKLGIGPAID
FT                   TGFYYDFDLPRTLTPEDLPEIETRMNQLVKANLPFRREEMSKDEARKLFADQPYKLELL
FT                   NDIPDETVSIYRQGNFCDLCRGPHVNYTSKVKAFKLLSIAGAYWRGDEKRPMLQRIYGA
FT                   AFLDKASLADYLNMIEEAAKRDHRKLGKELELFSLHQEIGGGLVNWLPNGATIRHLIEE
FT                   FWKKEHLKRGYNLVYTPHIAKVDLWKTSGHWGFYRENMYSPMDIDGEEYVLKPMNCVYH
FT                   ILMFKNRTRSYKELPIRMAELGTVYRYERSGVLHGLSRVRGFTQDDAHIFCLYEQLEKE
FT                   VVKVLDLAKFMIDTFGFAKYKVMLSTRPEKYVGELAKWEYATDILAKALEANGISYQVD
FT                   PGEGVFYGPKIDIKFEDALGRAWQGPTIQVDFQLPERFEVSVVGEDGKDQPVAMVHRTV
FT                   LGSMERFMSCLTEQYGGAFPVWLSPKQVMIIPIADRHSEFAEKLACELREEEVRVEVDN
FT                   RSETMNQKIRQAQLAKIPYMLVVGDKEIETGSIALRSRIGSQQVMPFAEFKSMLLNKIK
FT                   TKSTEI"
FT   gene            complement(618046..620577)
FT                   /locus_tag="DhcVS_660"
FT   CDS_pept        complement(618046..620577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_660"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61799"
FT                   /db_xref="GOA:D2BHJ9"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHJ9"
FT                   /protein_id="ACZ61799.1"
FT                   /translation="MEGKKNISSNNEPVAQPKILTKPLPQILDEMDANIRAAAEAARRA
FT                   QEAAVTAGKAAESATQAANLAEKRAEDARLAGEKAAETATRAAAEAAAAAEKTAKLATN
FT                   AANEALKAAELASRKAEDAERGAAKAAEDFKKVAEEAARRAEAASQAARDAADNAMLVA
FT                   ESAAQRAEDAGENARQAAEKAIREAQDATIAAIQASELATRAAEDAAHRAEQASALARK
FT                   TAEEATNASREAVLKAEEAARKAEAASLAATNAAENAMKSASEAAKRAEAASLAAKEAA
FT                   AMATAAAQAAAKKAEEASAIAKSAAEQAIKAANDAALRAEAAAKAAALKAEEAFLASKK
FT                   AAAEAIATASEAAMSAAMKSEAAVAAAKSSAEKAILVAEDAARKAEAAAAEASRKAENA
FT                   SLHSTQKAEDAIKAADLAAKRAEAAALAATQKAEEAVKTAGEAAKLAAANATNAANEAA
FT                   KRAEAAAAAAAKKAEEAITAAKLAADEAVKAATKAAEDAAKKAQLAAEEATRRAEQAAA
FT                   AAAAAAAAAALRAEEAAYKAEDTAKAAKLAAEEATNRADEVALTAKETALANKKAAEAT
FT                   AIRASQIAITAKTDLDKTILAANKAGNNATEATAAAKEATAAANTRKDADSARKADEAG
FT                   RKAKMAATAALQLAEETARKSSLAEIAGDEALEAATRVSGDIAKRAEDAGYAAKESAKS
FT                   GFKVAEETRKKATLADEAGDAAIHASMSIIQELINRAEQVGIDAKRSAEDFARISRSQA
FT                   EAMMRDAQMKAAAEVEKARRAAEDAGAKAESIANAAKLAAEEAMSKAQEALVKAVIKRL
FT                   TSWEWISILVIINLSIVFAAVLLATAFGALI"
FT   gene            complement(620718..622124)
FT                   /locus_tag="DhcVS_661"
FT   CDS_pept        complement(620718..622124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_661"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_661"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61800"
FT                   /db_xref="GOA:D2BHK0"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHK0"
FT                   /protein_id="ACZ61800.1"
FT                   /translation="MENKSPALGQHVDQPGPKIMTKPLPIILDEMEANIRAAAEAARRA
FT                   EEAAKQASASASTSMRAAEVAEKRAEDARLAGENAAAVAKKAAAEAVAKAAEAAAKAQE
FT                   AILRSVEADKAAVKAAETFKKAADEASEKARASAAEAAAQASLAAEEAARRAEEAARRA
FT                   EETARAAIYAAEEATAKADEVARSSKEAAIAAQRAAEQTAIRAEEIAKAAKEALERLIK
FT                   QAERASAEVAAAVAAAKSAGKEATIKLTTEAGKAADDAGRKAKEMAVSALHLSEQLAHK
FT                   AEMADVAGDEAIEAATKVSGKLAAAVDEAGRMAKESAASGFKIAENMAQQAASADKAGD
FT                   DAIRTAMSILQELATRAEATAKSAAERATGAEATAKAAAERATGAETTARAAADRAVAE
FT                   VSRVRQTAEEVAQSARRAAEEALAKAEEALVKAVIKRLTSWEWIVILVVINLSIVFAAV
FT                   LIATALGALL"
FT   gene            complement(622622..622706)
FT                   /locus_tag="DhcVS_662"
FT   tRNA            complement(622622..622706)
FT                   /locus_tag="DhcVS_662"
FT                   /product="tRNA-Leu"
FT   gene            622804..623172
FT                   /locus_tag="DhcVS_663"
FT   CDS_pept        622804..623172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_663"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61801"
FT                   /db_xref="InterPro:IPR031493"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHK1"
FT                   /protein_id="ACZ61801.1"
FT                   /translation="MIVLFGNKAYFDILGYMVTTCPGCKTTSVMTVEQQRKKLTVYFIP
FT                   TFDFSRRQYMYCGHCHERFEIDKSLQSTVKARLLSKKQMENLMLKLEMENPRYECANCE
FT                   SGVEAGMHFCPQCGNCLD"
FT   gene            623183..623845
FT                   /locus_tag="DhcVS_664"
FT   CDS_pept        623183..623845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_664"
FT                   /product="alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_664"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61802"
FT                   /db_xref="GOA:D2BHK2"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHK2"
FT                   /protein_id="ACZ61802.1"
FT                   /translation="MYENITRSVKDILAELPPDVVLEAAVKKRQPSEILAAIDAGIKII
FT                   GHNYLTEAEETYPLIGDKAEWHFIGKLQSNKCKKIVRRFSVVETVDSIEIASELNRRAA
FT                   EIDKILSVFIEINSGREKQKSGVLPEETVELAKRISCLSNLKLTGLMTMGPALEAPEEL
FT                   RTIFRLTKIKFDEIASMGLPNTELQFLSMGMSGSYKVAVQEGANLVRLGTRIFGPRP"
FT   gene            complement(623842..624501)
FT                   /locus_tag="DhcVS_665"
FT   CDS_pept        complement(623842..624501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_665"
FT                   /product="HAD-superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_665"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61803"
FT                   /db_xref="GOA:D2BHK3"
FT                   /db_xref="InterPro:IPR006384"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHK3"
FT                   /protein_id="ACZ61803.1"
FT                   /translation="MPLTHNPKLMFQSDFDGTLTEGDVSFLILEKYAQGDWCAILREYQ
FT                   QGKISVGDFNYRAFALVKEDQKTLVDFIRENAVPKKGIHELINYCKQENIRFSVVSNGL
FT                   DFYIHTMLEELGFKDVEINAARTLFTSEGLDARYYGPDGKMVDNGFKESYTNHYRSQNY
FT                   KVIYAGNGPSDFPPAKLCDYAFATDMLLDRFKKSNLPCYPFQDLHDIVARLKTIPR"
FT   gene            complement(624524..625027)
FT                   /locus_tag="DhcVS_666"
FT   CDS_pept        complement(624524..625027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_666"
FT                   /product="peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_666"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61804"
FT                   /db_xref="GOA:D2BHK4"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHK4"
FT                   /protein_id="ACZ61804.1"
FT                   /translation="MAIRRICELPEPVLRKKAKKVPSIDSSIQTLIDDMIETMSSADGA
FT                   GLAAPQVGVSLRLVVFREPDAKEATVLINPEIVKKEGQRQVTEGCLSIPGYFGELTRAE
FT                   TVTAKGLDRHGKACRIKGTGIVAQLLEHETEHLDGILYIDHLESEEKLHEIGADDELPE
FT                   EIRD"
FT   gene            625153..625229
FT                   /locus_tag="DhcVS_667"
FT   tRNA            625153..625229
FT                   /locus_tag="DhcVS_667"
FT                   /product="tRNA-Pro"
FT   gene            complement(625312..626115)
FT                   /locus_tag="DhcVS_668"
FT   CDS_pept        complement(625312..626115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_668"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61805"
FT                   /db_xref="GOA:D2BHK5"
FT                   /db_xref="InterPro:IPR041113"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHK5"
FT                   /protein_id="ACZ61805.1"
FT                   /translation="MAIKKVKQSELDQLETFKKLRIYNLIMGSFHLAQSILILFLSNNF
FT                   SLPVTTNFIGGGPGGITFKPPEVLFDLPVGPMVAIFLLLSATAHFLLSLPGIFEWYKAN
FT                   LSKGINYARWYEYALSSSIMIVLIAMLSGIYDVATLIAIFGANAAMNFFGLMMELHNQT
FT                   TSKTNWLSYTFGCFAGFIPWVAISIYFFGAISQASENIPTFVYFILPTLFIFFFSFALN
FT                   MWLQYKKSGKWRDYLFGERVYVFLSLTAKTALAWQVFGGALAGGS"
FT   gene            complement(626178..626579)
FT                   /locus_tag="DhcVS_669"
FT   CDS_pept        complement(626178..626579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_669"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61806"
FT                   /db_xref="GOA:D2BHK6"
FT                   /db_xref="InterPro:IPR018687"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHK6"
FT                   /protein_id="ACZ61806.1"
FT                   /translation="MSGILVYLIVLVLVFVLDIVWIGLIAKKFYVTELSPIARWSGGSM
FT                   SPDWPSAILVYLLISLGIVAMALPLAGDNIFAALAYGGLFGFITYGIHDLTNYSTLNNF
FT                   SLKMALVDLGWGTFLGAAAGLTGGILYSL"
FT   gene            complement(626576..627247)
FT                   /locus_tag="DhcVS_670"
FT   CDS_pept        complement(626576..627247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_670"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61807"
FT                   /db_xref="GOA:D2BHK7"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHK7"
FT                   /protein_id="ACZ61807.1"
FT                   /translation="MQIYEKTINVVIGTTKLPGELAIPPEPIGLVIFVHGSGSNRQSPR
FT                   NRQVAHQLNSYGLATFLFDLLTPQEDMVDILIANTRYNFRFLADRVIKVTEMLKTREET
FT                   KNLPLGYFGASTGAAAALYASSLLPGQIKAVVSRGGRPDLARELLPMVESPTLFIVGEN
FT                   DSQVLKLNTQAQKQMRALNHLCILPGAGHLFEEPGALEKVAELAGGWFIEYMERTPKEE
FT                   R"
FT   gene            627460..627624
FT                   /locus_tag="DhcVS_671"
FT   CDS_pept        627460..627624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_671"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61808"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHK8"
FT                   /protein_id="ACZ61808.1"
FT                   /translation="MKVTINACPKCKKERVIRIEDENNLYEYRERYVHQDCTKCVAKEM
FT                   ESKAVGASA"
FT   gene            complement(627695..629821)
FT                   /gene="vpp1"
FT                   /locus_tag="DhcVS_672"
FT   CDS_pept        complement(627695..629821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vpp1"
FT                   /locus_tag="DhcVS_672"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_672"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61809"
FT                   /db_xref="GOA:D2BHK9"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHK9"
FT                   /protein_id="ACZ61809.1"
FT                   /translation="MDLSWLVWTAGLIAVLFALYLIRDVMRRDSGTPAMQDIAGRILEG
FT                   AVAFLRRQYRTIAILAIVAAVAVGAVVGLLGGERGLEAYGITGFGIAWRTALAFMAGAL
FT                   CSGISGIIGMYISVKSNLRCAAAAAKGGLSEAVTVAIRGGAVSGFLIVALSLLGVAGIY
FT                   YMYGGNPEVTPHLIIGFGFGASFVALFAQLGGGIYTKAADMGADLVGKVEAGIPEDDPR
FT                   NAAVIADLVGDNVGDCAGRGADLFESTAAENIGAMILGITLYLATGNAAWVLFPLVVRA
FT                   FGILASIIGIMFVRGKDNESPMNALNRGYFTAVGLSIIGIFIANQTIGGDLWLFGAGVI
FT                   GILTSVAMVFITQYYTEFRYNPVKEIANASRTGPATNIVSGTAVGLETAMPTAITIGAA
FT                   LLLSYWMGGQTGIAGGAVFGTAAATMGMLMTCPFILAMDTFGPITDNANGVIEMAGVGG
FT                   KVRKITDHLDAVGNTTKALTKGYALASAGLAAFLLFEAYLERVAFLRGETEMMAVDLSR
FT                   IEVFVGGLLAVALVFFFSAVAIKAVGKTASKIIEEVRRQFKADPGILAGTSRPDYARAV
FT                   DITAAAGLREMIFPGLLPVLSPIILGIFLRVTGYDSAMAIAGFLMVGTIGGIMMAAYLN
FT                   NAGGAWDNAKKYIETGEMLEKDGSPVMKHTVTHAATVVGDTVGDPFKDTAGPSIHVLIK
FT                   LLSTITLVLAPLFI"
FT   gene            629995..630225
FT                   /locus_tag="DhcVS_673"
FT   CDS_pept        629995..630225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_673"
FT                   /product="ATPase C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_673"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61810"
FT                   /db_xref="GOA:D2BHL0"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHL0"
FT                   /protein_id="ACZ61810.1"
FT                   /translation="MGITSFVIGLFSLAGMGVGLIPLLGTINFFNFFFALIGLGLGIGG
FT                   MLRSPRHRLSLAGIALCGLSLVLGFVKYILG"
FT   gene            complement(630294..630623)
FT                   /locus_tag="DhcVS_674"
FT   CDS_pept        complement(630294..630623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_674"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61811"
FT                   /db_xref="GOA:D2BHL1"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHL1"
FT                   /protein_id="ACZ61811.1"
FT                   /translation="MTKTSTGLQENVAGLLCYVLAWISAIIFLILEKDNKFVRFHAYQS
FT                   LVVFGSLQIIGLVFTIIPVLGVFITWVISVLSFILWVVLIVKAAQGFKYKLPIAGDIAE
FT                   RWANK"
FT   gene            complement(630697..631839)
FT                   /locus_tag="DhcVS_675"
FT   CDS_pept        complement(630697..631839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_675"
FT                   /product="protease"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_675"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61812"
FT                   /db_xref="GOA:D2BHL2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHL2"
FT                   /protein_id="ACZ61812.1"
FT                   /translation="MKSSFKLGQILGIEIGIHVSWLIIFALLSWSLAVAYYPAIDENIS
FT                   PLTAWVLGITSCLLLFGSVLAHELGHSIVAIRHGIPVKSITLFIFGGVSNLTKEPDNPG
FT                   AEFRMAISGPAVSIILALVFWAFQAAFSALDATLVSGVFLYLAQINAMLAIFNLIPGFP
FT                   LDGGRVLRAIIWNASNSIKKATRIAARVGLGFAYLLIFGGIAIAFLGIGISGLWLALIG
FT                   WFMATAAQGSYQQTVISEILSAVNVSRVMRREFKTIDPDKTLYQTLHEYILPLNQRALP
FT                   VFENGQLTGLISLSDIKRIPTDKLGQTYVRQVMTPLEKLQTVAPEENLSSVVNMLQSKD
FT                   INQLPVLSDGKLVGIISRTSLIEYLQMRQEMETKQPDVKQ"
FT   gene            complement(631869..632666)
FT                   /gene="greA"
FT                   /locus_tag="DhcVS_676"
FT   CDS_pept        complement(631869..632666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="DhcVS_676"
FT                   /product="transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_676"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61813"
FT                   /db_xref="GOA:D2BHL3"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHL3"
FT                   /protein_id="ACZ61813.1"
FT                   /translation="MQNSGINLDEALNQYLNDNSNKKIHQNSLVHFTRWCGKDKLVCRM
FT                   TAIEVSRYPECISSSDKEVSVKLQSVRAFLTYLNEQGWVDYNLSSHIKIKKLASRKSAA
FT                   RTNQTAVEKIPMTASGYKKLEDELSTLKGKRIEVIEEMRLAAMDKDMRENAPYHAAKEQ
FT                   RGQIEGRIKEIEHELKYAEVSEYTDNNTSKVNMGNTVKLRDLKNGECCTYTLVSPKEIE
FT                   PLKGKISASSPIGKAVFNRNKGEQIEIEVPSGTLQYIIEDISF"
FT   gene            complement(632697..633836)
FT                   /locus_tag="DhcVS_677"
FT   CDS_pept        complement(632697..633836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_677"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61814"
FT                   /db_xref="GOA:D2BHL4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHL4"
FT                   /protein_id="ACZ61814.1"
FT                   /translation="MNTDILVIGAGPVGIYTAKCLAQCGYEVRLLGKRPEMVKQICCTG
FT                   LISTECAATYGFHGEYIQNHFSEATVYSPYGRKLLLKRDTPQAIMLDRGGFQAGLLKQA
FT                   VNCGVQTNFGCQVNGLENTGNGICITTKGGQTFFAKAAVLAAGYNTELSRAAGLGEIKH
FT                   FAFGLQGEVDTSIPTALSLFTGKAISQGYFGWLSPINDHAAKMGLLTRKNPNECWSILH
FT                   NTIYKQGLIPDRNIKYACRPVPAGNLSASFGDRVLAVGDFAGQLKPTTGGGIYFGLLCA
FT                   DLAVACLDKKIKTNKLSKADMAEYEKSWKALIGSELYIGKLLSRIYAGLDDRLLEQIFK
FT                   KCAANGMIEKMAAKSHLGFDWHGKAFAHLLKNPLDLIRS"
FT   gene            633967..634203
FT                   /locus_tag="DhcVS_678"
FT   CDS_pept        633967..634203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_678"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_678"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61815"
FT                   /db_xref="GOA:D2BHL5"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHL5"
FT                   /protein_id="ACZ61815.1"
FT                   /translation="MIVTVTSVVIATATGTAAVIGGVSLASLIAFLIAREMALARKSAF
FT                   SIRVARYLGISIFPLFLVMGVIVISRIMETLAQ"
FT   gene            complement(634192..634920)
FT                   /locus_tag="DhcVS_679"
FT   CDS_pept        complement(634192..634920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_679"
FT                   /product="CAAX amino terminal protease"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_679"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61816"
FT                   /db_xref="GOA:D2BHL6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHL6"
FT                   /protein_id="ACZ61816.1"
FT                   /translation="MVYLLIITAAEIVTVACQPLFGLGIYILLLFSIIFRVAKTNRFHP
FT                   DRLILSLSLVALIRIISLAMPLSDIPQIWWYPVIYLPLLIGTVIVARTLEYNFKDIGLN
FT                   WGKIPIQILIGLTGIGLGFAEYAILKPEAIIETLSWSSLVLPGLILLITTGFVEELIFR
FT                   GVLQKAALDSFGARGIIYISLIFAILHIGFLSITDIVFVFGVALIFGYLVKKTGSILGV
FT                   TLAHGITNTILFAVAPLLLG"
FT   gene            complement(634925..636040)
FT                   /locus_tag="DhcVS_680"
FT   CDS_pept        complement(634925..636040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_680"
FT                   /product="metallopeptidase, M50 family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_680"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61817"
FT                   /db_xref="GOA:D2BHL7"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHL7"
FT                   /protein_id="ACZ61817.1"
FT                   /translation="MEQGINIGKLFGIQFRLHYGWFIIFGLVSVFLATQVFPDTLDNAD
FT                   DLKLWIMGITTSLLFFASVIVHELAHSLIGRANGMKVKSITLFIFGGAANMSEEAETAG
FT                   SEFKMALAGPASSLGLAGIFYVLYINLNGQSPELAVMDYWLAQINLILAVFNLIPGFPL
FT                   DGGRILRAAFWQQTKDLSKSTRISTVAGQIFGFLFIAAGIFIVIRTQDWLSGVWLGLLG
FT                   WYLSDTARTSFRQYTLQQVLKRVTPMEVIDFNIPKAKSTQIFGDYLTQTPNGAYILVDD
FT                   GNDPVGIINRHSLKNKDILKSKPMAELYTPISEIPIITSDTNALDIARRMNEDKIEIVR
FT                   LEGKNIQSGFITLDSLIAYMNKLPVKGITEA"
FT   gene            complement(636076..637371)
FT                   /gene="thiC"
FT                   /locus_tag="DhcVS_681"
FT   CDS_pept        complement(636076..637371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="DhcVS_681"
FT                   /product="thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_681"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61818"
FT                   /db_xref="GOA:D2BHL8"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHL8"
FT                   /protein_id="ACZ61818.1"
FT                   /translation="MTQLKQARRGIITPEMEAIAKIEGLQPEFICQGVADGNIVIPANK
FT                   LHNNLKLCGIGKGLSTKVNANIGTSTDFGSVASEIEKLKMAEMAGADTIMDLSTGPKIN
FT                   TIREAILGNTRLPLGTVPVYQAAVEAKDRYGAMVKMTADDLFGAIESQAKEGVDFVTVH
FT                   CGVTRQVIDTFKGQGRLTDIVSRGGTFTAGWMVFHQAENPLYEHFDRLLDICREYDVTL
FT                   SLGDGLRPGCIADATDRAQVAELLVLGELVKRAREAEVQVMVEGPGHVPLNQIEANIRL
FT                   QKSVCEDAPFYVLGPLVTDIAPGYDHITGAIGGAIAAAAGADFLCYVTPAEHLSLPDVT
FT                   DVRNGVIASRIAAHAADIVKGVNGAAERDRQMAMARKKLDWDSQLNLSLDPEHARLTRD
FT                   RFKTKGKACSMCGDFCAMELAEKHLGVSVSRC"
FT   gene            637599..638306
FT                   /locus_tag="DhcVS_682"
FT   CDS_pept        637599..638306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_682"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_682"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61819"
FT                   /db_xref="GOA:D2BHL9"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHL9"
FT                   /protein_id="ACZ61819.1"
FT                   /translation="MNEFICGLSSLGITLSFVQLEQFETYYRELVDYNSRVNLTAITEY
FT                   KDVQVKHFLDSVSLVLVGIKGDEKILDVGSGAGFPGLPLKILFPDIQLGLLEATQKKAR
FT                   FLSEITAKLGLTGVEIISQRAEDAAQNPLYRQKYTLVTSRAVADMATLAELTLPFCALG
FT                   GRVIAPKKSDIEEEMDRANTAVKKMGGRVFEVIKVALPGLEDGRKLVVLEKISNTPALY
FT                   PRRAGMPAKTPLI"
FT   gene            638414..640027
FT                   /locus_tag="DhcVS_683"
FT   CDS_pept        638414..640027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_683"
FT                   /product="R3H domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_683"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61820"
FT                   /db_xref="GOA:D2BHM0"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034081"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHM0"
FT                   /protein_id="ACZ61820.1"
FT                   /translation="MMPQRGVKRIDTNILIYRTVGKKITEADMPELLTDDLNALLEVLP
FT                   PNIRQPLTNPANRENLIEIVMDLGRNPEARFPDREIILSNRDVTQEDIDYVSSRIGDFG
FT                   DDNRAGIERTLHRISAIRNRKGKIVGLTLRVGRAVFGTIKIIQDLIQSGQSVLMLGRPG
FT                   VGKTTMLREVARVLAGDLKKRVVIVDTSNEIAGDGDIPHPAIGHARRMQVRTPDMQHAV
FT                   MIEAVENHMPQVIVIDEIGTELEALAARTIAERGVQLVGTAHGNVLDNLMLNPTLSDLI
FT                   GGIQSVTLGDEEARRRGTQKTILERRAPPTFQVIVEIQERNKVAVHPDVGAAVDSILRG
FT                   VSPSSEIRYLDENGEVVISKQQPSEEKIKTTAEGLPAFKGKELPVMYLFGVNRSRMEEI
FT                   AREMHLDIKLAERPEQAQLMVTSRNYYRRKPQRVRDAENMNIPIYVLKSHTPGQFHQLL
FT                   ATLSGRDVAFTADKPPEIDLAIHEAEEAIAQVKSSHIPVELSPQGAYIRRFQHIIAEKE
FT                   HLSSHSLGKEPHRRVRISRG"
FT   gene            640031..640654
FT                   /gene="tmk"
FT                   /locus_tag="DhcVS_684"
FT   CDS_pept        640031..640654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="DhcVS_684"
FT                   /product="thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_684"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61821"
FT                   /db_xref="GOA:D2BHM1"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHM1"
FT                   /protein_id="ACZ61821.1"
FT                   /translation="MSLFITFEGGEGCGKSTQSKALYRYLKKLGLECVLTHEPGGTRSG
FT                   DKITRLLKWSKEENISPLTELLLFNASRSILIDNVIKPALQDGNIVICDRYTDSTLAYQ
FT                   GYGRGLELDTVKCINSLANGGLVPDLTIWLDMDDKAALLRKGKLPPDRFESENNGFHQR
FT                   VRDGFGVIAAAEPNRFLKLDASLPQSELARCIRQRVNVLLKLPQ"
FT   gene            640651..641724
FT                   /gene="trmU"
FT                   /locus_tag="DhcVS_685"
FT   CDS_pept        640651..641724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="DhcVS_685"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_685"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61822"
FT                   /db_xref="GOA:D2BHM2"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHM2"
FT                   /protein_id="ACZ61822.1"
FT                   /translation="MNDNPGLIMVAMSGGVDSSVAAMLLLEQGYDVAGVSLQLKSNNEP
FT                   YGNGYNLKLINRAREVAAALGIPHYVVDLSDIFSQRVIADFCQQYSQGRTPNPCIRCNY
FT                   YVKIGALLDKIPDFNAGYLATGHYARVLSDGNGTHLLKGADEKKDQSYFLYTLPPASLS
FT                   RLMFPLGKRYKKDIIRLAAKMKLPVSQKESQDVCFIPDGDYKSFLSTRMGFTPGKILDK
FT                   TGKILGEHQGLPLYTIGQRQGLGLASNEKLFVSDMNPEANTITVASHDQLYTSRILLSN
FT                   FIWRESSISIDTPGMIVKVRYKAAPAEVKKISQTGDFHLLELASPVWAATPGQAAVIYL
FT                   GDMVLGGGIIEHGGDAA"
FT   gene            641726..642361
FT                   /gene="rnhB"
FT                   /locus_tag="DhcVS_686"
FT   CDS_pept        641726..642361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="DhcVS_686"
FT                   /product="ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_686"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61823"
FT                   /db_xref="GOA:D2BHM3"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHM3"
FT                   /protein_id="ACZ61823.1"
FT                   /translation="MPAAICPGWAEEKQLWKQGFSSIAGLDEAGRGCLAGPVVAGAVIM
FT                   PPRLKGEWVAMVRDSKVLTLEKREYLYCHIVSMAISFGVGVVDNTQIDCLGIAPATRLA
FT                   MKQAVEHLDCRPDYLLVDYLKLPDIPLPQKGIVDGDALCFSIACASIIAKVSRDRLMCE
FT                   LDATYPGYHLAKHKGYGTALHMECISQKGISPIHRRTFAPLKSMFDVI"
FT   gene            642351..642716
FT                   /locus_tag="DhcVS_687"
FT   CDS_pept        642351..642716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_687"
FT                   /product="endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_687"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61824"
FT                   /db_xref="GOA:D2BHM4"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHM4"
FT                   /protein_id="ACZ61824.1"
FT                   /translation="MSYKRKETGKLGEELAAEYLIALGYRIIQTNCRLPEGEIDIVGQD
FT                   GDCLTFIEVRTKRRLEYGLPAESVTLRKKTHLIASAESYIQQYHLEHLPCRIDFVSVDL
FT                   SQPEPKLELIKNALGEE"
FT   gene            642752..643810
FT                   /locus_tag="DhcVS_688"
FT   CDS_pept        642752..643810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_688"
FT                   /product="ThiE-associated domain protein/thiamine-phosphate
FT                   pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_688"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61825"
FT                   /db_xref="GOA:D2BHM5"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016229"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="InterPro:IPR041397"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHM5"
FT                   /protein_id="ACZ61825.1"
FT                   /translation="MDNLEKLWRIVDVNQNRLSEGLRVLEEIARLYLEDEKLNSRFKNL
FT                   RHSLTLQDIASNSRLLFSRQADTDIGAQLETADQSEPETLFSLVSANAKRAEQSLRVLE
FT                   EFAGLPETGLDAALYSRGRFELYTLEKDLAARLLRTNRRDMITGLYVAIDADYLAGRDI
FT                   TAVTREVLEGGCRLIQLRAKTASTRKFLALAVSLKEICLEYGALFIINDRLDIALACGA
FT                   DGLHLGQIDMPLSQARHFMPPDSIIGISADTPEQAIWAQNEGADYVAAGAVFPTQTKQD
FT                   VLFGGLSGLQAIHQVVKIPLVAIGGINKSNFYEAMQAGAGSLCLISAVLGAPDIKKATS
FT                   EFITLMEAAKID"
FT   gene            643803..644456
FT                   /locus_tag="DhcVS_689"
FT   CDS_pept        643803..644456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_689"
FT                   /product="translin"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_689"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61826"
FT                   /db_xref="GOA:D2BHM6"
FT                   /db_xref="InterPro:IPR002848"
FT                   /db_xref="InterPro:IPR036081"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHM6"
FT                   /protein_id="ACZ61826.1"
FT                   /translation="MTNISLKMEQISDSIRENFKTRDAAREKSLPVSREAIRYCSLAIR
FT                   AVHRQELAQAREMLVSAKALIKEAGQAIDACGELSNTAFFLDAQKEYAEANTVLALVDG
FT                   KDMPSPQELEVDNAAYLNGIGEAAGELRRYILDGLRKGEDTRGEELLQAMDDIYEVLVT
FT                   MDFPDAITGGLRRTTDMVRGVLERTRSDLTLYIQQKGLEQKLENFQSKLTRKGE"
FT   gene            644461..646500
FT                   /gene="vpp2"
FT                   /locus_tag="DhcVS_690"
FT   CDS_pept        644461..646500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vpp2"
FT                   /locus_tag="DhcVS_690"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_690"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61827"
FT                   /db_xref="GOA:D2BHM7"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHM7"
FT                   /protein_id="ACZ61827.1"
FT                   /translation="MSIWIALVVGLAGLVVAGLLARFVLRQDEGIAKVKEIASAIREGA
FT                   MAFITREYTVMAIFVAAVTIILALLPSLGWPVSVSFLFGALCSGLAGFIGMSIAVRANS
FT                   RTTTAASHSLNQGLKFSFRAGSVMGMSVVGIGIIGLSIMYFAFGSNADFLQILPGYGFG
FT                   ASSVAIFARVGGGIFTKAADTGADIVGKVEKGIPEDDPRNAAVVADFVGDNVGDVAGMG
FT                   ADLFESYVDSIIATMALATVGAFSMKLGYSLVPSEEAAFFLPMLVAAGGILASVIGIFL
FT                   VRTGEKLQMKALLAALRKGTLAAAFLSAVFSFLAVWYLQADLGLFFAILAGLVAGVLIG
FT                   ESTNYFTSYVYKPTLDIAASCQTGAATNIISGFSVGLLSVVPPIILVVAAIVIAYTFGD
FT                   VYGVALAGVGMLATLGIQDATDAYGPVADNAGGIAEMAGLPKEVRERTDALDSLGNTTA
FT                   AIGKGFAIGSAGLTSLALLLSYTQAVGISASQVSLLDVKVLAGLLLGVMMPAVFCSLTL
FT                   KAVGVTSFSIVNEVRRQFKEIAGIMDGTAKPEYGKCVDICTRDSIKQMILPGIITVVSP
FT                   VIVGWLLGSVAVVGFLAGIILCGFILAVTFANAGGAWDNAKKWVETGAYGGKGSDAHKA
FT                   AVVGDTVGDPMKDTAGPSLNIMIKLVAIIALVMAPILANFSGII"
FT   gene            complement(646513..647166)
FT                   /locus_tag="DhcVS_691"
FT   CDS_pept        complement(646513..647166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_691"
FT                   /product="metallo-beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_691"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61828"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHM8"
FT                   /protein_id="ACZ61828.1"
FT                   /translation="MCQNIILKDHANMLNRKLRLGLLGTNCYILGDEESREGLIIDPAA
FT                   ISNSILETVTEHHLNIKYILLTHGHLDHLAGLEYVRKLYPEAKLCFNLSDASLSENIEL
FT                   VSYLGMPELPNLVPDIPLDEGSTLELGKTRFSVISTPGHTPGGICLYTPGYLFSGDTLF
FT                   NSGIGRSDFEESDTEALRQNIINRLLSLPPETLVFPGHGRETTIGKEKAGNPFI"
FT   gene            647093..647782
FT                   /locus_tag="DhcVS_692"
FT   CDS_pept        647093..647782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_692"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61829"
FT                   /db_xref="GOA:D2BHM9"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHM9"
FT                   /protein_id="ACZ61829.1"
FT                   /translation="MPSKPKRSLRLSIFAWSLRIIFWHILALKLVSAKIFLTYLPKADN
FT                   FLFMGIDNQPNLPAASFRFRPVYFMAPLLVLVISLVLTAIYFGRLPADVAYRFSIDGAP
FT                   VTYVNTGLITGILVGVQVLVVLLAFSLAFFLPRLSFFKNNQTDFWVKPGTLLGFMGNIM
FT                   AVPQLILAYALLDVFVYNVHQIHLLPLWLFAIILIVIAAIVIGIFAIPVFVRAYKTFNG
FT                   PSASKKE"
FT   gene            647783..649120
FT                   /gene="glyS"
FT                   /locus_tag="DhcVS_693"
FT   CDS_pept        647783..649120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="DhcVS_693"
FT                   /product="glycyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_693"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61830"
FT                   /db_xref="GOA:D2BHN0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHN0"
FT                   /protein_id="ACZ61830.1"
FT                   /translation="MTLSENVSQPVSMDKIVSLARRRGFIFPSSEIYGGLNSCWDYGPL
FT                   GVELKRNVKEAWWRYMVRDRDDVVGLDASIIMHPRVWEASGHVAGFSDPMVDCKNCKMR
FT                   WRPTDLAEPKCPACGGELTESRQFNLMFKTFMGPVEEAANIVYLRPETAQGIFVNFENV
FT                   LNTTRKKLPFGIAQIGKSFRNEITTGNFIFRSREFEQMELEYFVKPGADDACLEEWTQY
FT                   RLNWYKNLGMNPENLRLRAHRSDELAHYAKGCYDVEYNFPMGWSELEGIANRRDFDLTQ
FT                   HSKYSGKALEYFDEETKEHFVPYVIEPSAGVERSTLAFLIDAYSEEPDKDEIRTVLHLH
FT                   PALAPYKIAVLPLSKKEILSDYARKIYADLRKCWMVAYDDSQSIGRRYRRQDEIGTPYC
FT                   VTVDFQSLEDGMVTIRDRDSMGQIRVKVSELSYILAAKLSGEPFNS"
FT   gene            649134..650381
FT                   /gene="sbcD"
FT                   /locus_tag="DhcVS_694"
FT   CDS_pept        649134..650381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcD"
FT                   /locus_tag="DhcVS_694"
FT                   /product="DNA repair exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_694"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61831"
FT                   /db_xref="GOA:D2BHN1"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHN1"
FT                   /protein_id="ACZ61831.1"
FT                   /translation="MKILHFADLHIGVENYGRFDSATGLSSRLVDFLAAFDRLVAYAIE
FT                   SKVDLVVFSGDAYKSRDPSQTQQREFARRISTLANSGIQVFLLVGNHDLPNATGRATTT
FT                   EIFDTLNIANVHVSAKAEVRLINTRSGPIQVASLPWLRRSSVLSVLNQKEEKSLSIEEL
FT                   NWRVEHYLAGIIENLAGQLDKNIPAILSAHLSVNTAKLGSERNISIGHEPTVMLSNIAN
FT                   PAFDYIALGHIHKQQILSSSPPVVYPGSLERLDFGEEKDDKGFYLVEIDSLSRKTEFEF
FT                   IKLEGRCFLTIEHTVTADSLDPTLEVINILQSRQQEIKDAIVRLKLELPAEIGGQLRDN
FT                   DIREALRDAHNFTVSKNFTRSSRQREGGFKAEGLDPIQALEHYLDARQTSAQEKKTLLE
FT                   YGRKLYASLDNKQTKV"
FT   gene            650403..651152
FT                   /gene="rsuA"
FT                   /locus_tag="DhcVS_695"
FT   CDS_pept        650403..651152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsuA"
FT                   /locus_tag="DhcVS_695"
FT                   /product="pseudouridine synthase, RsuA family"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_695"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61832"
FT                   /db_xref="GOA:D2BHN2"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHN2"
FT                   /protein_id="ACZ61832.1"
FT                   /translation="MSYNASSGTPLVKVLVEARLGSRRKMAEAIKQGLVTLNGQKAESY
FT                   SQPVNTQQDKVTFEGKPVELSRIRRIYLMLNKPPEIVSTTSDELGRKTVMDLLHRRYEG
FT                   AGLFPVGRLDEATTGLLLLTNDGELTNRLTHPSYQIEKEYLISIDAALTQADKESLEKG
FT                   MLLDDGLTSPARLSRVTDEPPYNYKLIIHEGKKRIVRRMFAHLGYQIKALKRSRIATLR
FT                   LGKLEEGKTRELTPGEIAALKRITRLK"
FT   gene            complement(651145..651882)
FT                   /locus_tag="DhcVS_696"
FT   CDS_pept        complement(651145..651882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_696"
FT                   /product="phosphoribosyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_696"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61833"
FT                   /db_xref="GOA:D2BHN3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHN3"
FT                   /protein_id="ACZ61833.1"
FT                   /translation="MMHRPLVSPIFENRFDAGRQLAEKLTQYKDKSAIVLAIPNGGIPI
FT                   ATQVALALDADMDMIISRKLPIPLRPEGGFGAVADDGAVMLNHEVVNYLKMTEQQIHYT
FT                   VNKVRAEVQQRSLLYRGHRTLSILNGRTAIIIDDGLASGYTMLAAIESVRRKKPARIVA
FT                   AVPAASATARKLVEKAADEVITVADGFMPKFYVSDYYRYWNVLDDEQGLKVFKDWQMRR
FT                   QNLNLRPENLHPPSMTMRRKPLI"
FT   gene            complement(651879..653594)
FT                   /gene="ade"
FT                   /locus_tag="DhcVS_697"
FT   CDS_pept        complement(651879..653594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ade"
FT                   /locus_tag="DhcVS_697"
FT                   /product="adenine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_697"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61834"
FT                   /db_xref="GOA:D2BHN4"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHN4"
FT                   /protein_id="ACZ61834.1"
FT                   /translation="MQTNLSQLIKVARGEAKADLVLLNARVVNVFNAEIEPANVAVFGG
FT                   QIAGVGDYTLGNRVIDLKGAYLLPGLINGHTHVESSMLDISQYARAVVAHGTSALITDL
FT                   HEISNVCGKEGIDYVLSASADLPLNIFLQVPSCVPATHLETAGAEINSKDVTELLCLPN
FT                   VTGLGEMMNFPGVLFGVPSVLDKIKAASGKVLDGHAPGLSGKDLNAYISVGIHSDHECI
FT                   HLNEAKEKLARGMYIMIREGSSEKNLTELLPLVTDKTYKRCIFVVDDRSCADLQRDGDI
FT                   DAVVRKAIKLGLDPVRAIQLASINTAEYFRLQGHGAIAPGYLANMIICQDLNQLDIDMV
FT                   FHKGELVAEKGQVLFKPQSRIPKSLLSSMHIKPFDIKDLALKGSSTQMPVIEVIPGQIV
FT                   TRRLNLKIPAENGVITPDIEQDLLKIVVLERHCQSGNIGRGLIKGFGIKKGAIASSVAH
FT                   DSHNVVAVGTNDADIYAAVKELERINGGIALVVDGKVSASVPLPVAGLLSTQPLEKVVD
FT                   ALEEINKQAAGLGCKLSAPFATLSFMALPVIPELRLTDLGLVDVNTFKLIPQET"
FT   gene            complement(653578..654126)
FT                   /gene="hpt2"
FT                   /locus_tag="DhcVS_698"
FT   CDS_pept        complement(653578..654126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt2"
FT                   /locus_tag="DhcVS_698"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_698"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61835"
FT                   /db_xref="GOA:D2BHN5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHN5"
FT                   /protein_id="ACZ61835.1"
FT                   /translation="MMNRMNLSLFISKADIEVYLERLAAEINRSYKDKPLIVIGVLKGS
FT                   FIFMADLIRRLNMPVELEFVGLASYGQNTQSSGKLRLTRPLKRDITGKDVLVVEDIVDS
FT                   GLTISYLLKYLKRRKANSVKLCALLSKPSRRICPVEIDYLGCEVEDKFLVGYGLDRGEC
FT                   HRQLPEIFALEEQPDADKP"
FT   gene            654409..655071
FT                   /locus_tag="DhcVS_699"
FT   CDS_pept        654409..655071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_699"
FT                   /product="ABC transporter associated protein with signal
FT                   peptide, periplasmic substrate binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_699"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61836"
FT                   /db_xref="GOA:D2BHN6"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHN6"
FT                   /protein_id="ACZ61836.1"
FT                   /translation="MKCLNCSRDFDDNLVESGLLFCPFCGVGQPRGSQNPDINNMTFCS
FT                   CGQGIVGKVNYCPGCGQMLNPDAPPLEHSGRLYKNTPRRESSDKLPPAVQPASEDNEYE
FT                   NDEEFESADKPRAYRDEEETPLPARHGRQAYPYYDQYEERPRSRMSRRYSANNDYFEDE
FT                   EPRYRNPRRPARAYREERSYRPNRRNDVMPLLVVLLIAGVGVLGYGIYLLIQNFIGS"
FT   gene            655163..656080
FT                   /locus_tag="DhcVS_700"
FT   CDS_pept        655163..656080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_700"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_700"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61837"
FT                   /db_xref="GOA:D2BHN7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHN7"
FT                   /protein_id="ACZ61837.1"
FT                   /translation="MVIQVQNLVKVYGPIRAVDGISFEVKKGEVFGMLGPNGAGKTTTT
FT                   EIIEGLRDADSGNITVMGMDVRKQREQIKQLIGIQLQAPALLPLLNVEEILKLFTSFYR
FT                   NSLPVDKLLEMVALTESRKVLSKNLSGGQQQRLSVAMAMVNNPEITFLDEPTTGLDPQA
FT                   RRGLWSVIEELRAQGKTVFLTTHYMDEAERLCDRIAVVDHGKIIALDTPKKLISGNFKE
FT                   SAIEFEMEPVPSGELLGSFPCVTSASVEGFEVILYSADIPKTMGAILDYADKNKGNTEL
FT                   RNLHVRQATLEDVFLKLTGRKIRE"
FT   gene            656077..657159
FT                   /locus_tag="DhcVS_701"
FT   CDS_pept        656077..657159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_701"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_701"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61838"
FT                   /db_xref="GOA:D2BHN8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHN8"
FT                   /protein_id="ACZ61838.1"
FT                   /translation="MNSFLNMLNANFKQFLRDKTALFFTLAFPVLFIIMFGLVFSGTDK
FT                   INYDVALVNEDDSQISQGIVQAFSQVSIFSVQDNPRDESLQLLADGKLKAVIILPEGLG
FT                   QAALSGQTTDVQVYYDGSQTSVNQIVLPVVKEILQSINREITQTPVLFQITEETIQTKD
FT                   MSMMSFFIPGVLAMSIMFLGIYSAMPLIQQREKKILKRLGASPISRSTIIFSQVVLRLG
FT                   LAVLQTVIIIVIGQLMFGVEILGNWWLLLGLVMLGTLSFISLGFLVASLAKTEEGAMPI
FT                   VQLIQFPMMFLSGIFFPLEYMPDFMQPVVNALPLTYLGDAFRQVMVDGAPAFPLGVDLL
FT                   VVTGWLVVCMVISVRFFRWE"
FT   gene            complement(657239..658270)
FT                   /gene="queA"
FT                   /locus_tag="DhcVS_702"
FT   CDS_pept        complement(657239..658270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="DhcVS_702"
FT                   /product="S-adenosylmethionine:tRNAribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_702"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61839"
FT                   /db_xref="GOA:D2BHN9"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHN9"
FT                   /protein_id="ACZ61839.1"
FT                   /translation="MKTSDFDYKLPQEYIAQKPAEPRDSSRLLVLNRQRGELTSRIFGE
FT                   ITEYFKPGDVLVMNNSRVLPARIKGIKRDTAAKIEILLLKRDGDNCWEALLKPGKRTKP
FT                   GTIIDIHQHGEETSTQAEVLADKDDGIKLLRFSDETHLMKLGEVPLPPYIHTPVSNPER
FT                   YQTVYALTNGSVAAPTAGLHFTTDLLKRLSEIGVICTYVTLHIGLDTFRPVKEEDPKDH
FT                   IIHREYGILSAETAAAICQAKANGKRVFCVGTSATRLVEQASSLSQNGIIEPYSDWADL
FT                   FILPGYKFRVVDCFITNFHLPRSTPLMLTAAFAGWPFLKKAYEKAIHEHYRFYSFGDAM
FT                   LVL"
FT   gene            658431..659228
FT                   /gene="surE"
FT                   /locus_tag="DhcVS_703"
FT   CDS_pept        658431..659228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surE"
FT                   /locus_tag="DhcVS_703"
FT                   /product="stationary-phase survival protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_703"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61840"
FT                   /db_xref="GOA:D2BHP0"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHP0"
FT                   /protein_id="ACZ61840.1"
FT                   /translation="MRILVSNDDGIYSSGLWALVKRLKEVGEVIVVAPDREQSATGTQV
FT                   TLRQPLRVQKTHPLISGIEAYSVEGSPCDCVILGLAKLIAEPVDLVVSGINHGLNLGDD
FT                   VLISGTVGAALQGYLRSIPSIAISIPVTTEEPANLDSAACITMEVARRIKNGDIARNSF
FT                   LNINIPDLPLSRINELRVTPLAHKTHIETVEEGHDGRKRYFWLRRRQLSPADNQETDIW
FT                   AIENGYISISALHERLFQQPSFTLEDAETSGILKAAKDYQERV"
FT   gene            659361..659915
FT                   /locus_tag="DhcVS_704"
FT   CDS_pept        659361..659915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_704"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_704"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61841"
FT                   /db_xref="GOA:D2BHP1"
FT                   /db_xref="InterPro:IPR024422"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHP1"
FT                   /protein_id="ACZ61841.1"
FT                   /translation="MNKTSNGKFLRGIMLSSPVLVIAAVSIIFSISVALEGKIDSSPTG
FT                   NTDSTDQVTNPITDNSTDATVDLTITAETLYSHYVDPGETNPDQYYKSKNIKVTGKVAG
FT                   FVYGTTANSCWISLKTDQSNGANVVCYFGNYVIKPGAAISIGMDIEITGTCMGLTNGRI
FT                   TLINSFTEDVQLIPYDHNLEA"
FT   gene            660065..660937
FT                   /locus_tag="DhcVS_705"
FT   CDS_pept        660065..660937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_705"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_705"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61842"
FT                   /db_xref="GOA:D2BHP2"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHP2"
FT                   /protein_id="ACZ61842.1"
FT                   /translation="MGEVLVQNIGFIGAGRVGSTLALGLSQRGYLISGIASRTPGPAEK
FT                   LCKKLCAAKFCLQSQEVADTTDIVFITTPDDAIAEVCRSTGWHPGQYVIHCSGAYSADL
FT                   LQSAKDFGAHTGVLHPLQSFNLQADPVKNLEGITYALEGDDQSLFVLKDMVKALGGKWI
FT                   VLKPADKPSYHLAAVMASNYLVTLMKMAAQLWQTFGVPEDRAIKALMPLVRGTLSNIEK
FT                   AGVTDALFGPIDRGDYGTVLKHMANLANTAPELLPVYKELGRQTVKIALDKENPNIIGI
FT                   EKVSEILAN"
FT   gene            660951..661334
FT                   /gene="panD"
FT                   /locus_tag="DhcVS_706"
FT   CDS_pept        660951..661334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="DhcVS_706"
FT                   /product="aspartate 1-decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_706"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61843"
FT                   /db_xref="GOA:D2BHP3"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHP3"
FT                   /protein_id="ACZ61843.1"
FT                   /translation="MRIMLKSKIHRATITDACIDYEGSITIDKNLMQVANLLPYEQVHV
FT                   VNVNNGTRLETYVIEGPAGSGQICLNGAAARMGMKGDKVIILGYSLITEEDTLTHQPNL
FT                   VYVDGLNRITKVKNGVASQNLEV"
FT   gene            661337..662185
FT                   /gene="panB"
FT                   /locus_tag="DhcVS_707"
FT   CDS_pept        661337..662185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="DhcVS_707"
FT                   /product="ketopantoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_707"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61844"
FT                   /db_xref="GOA:D2BHP4"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHP4"
FT                   /protein_id="ACZ61844.1"
FT                   /translation="MRTTISQLKEMKQNKQKIAVLTAYDYPTAQILDKAGIPAILVGDS
FT                   LGMVVLGYDSTVSVTMDDMLHHLKAVVRGSQKAMVIADMPFMTYHLSPEQALLNAGRFM
FT                   QEGGAQAVKLEGGVNVADKVKRIVDCGIPVMGHIGLTPQSVNQLSGFKVQGKTLTAALA
FT                   LLEDAKALEKAGAFAIVLETMPAELAAMITAAVSIPTIGIGAGEGCDGQVQVVSDMLGM
FT                   FTDFVPKHTKKYADLNSIISKAVSGYVTEVAKGEFPTLKESFTLDKKVLEELKKCVSSE
FT                   Q"
FT   gene            662164..662997
FT                   /gene="panC"
FT                   /locus_tag="DhcVS_708"
FT   CDS_pept        662164..662997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="DhcVS_708"
FT                   /product="pantothenate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_708"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61845"
FT                   /db_xref="GOA:D2BHP5"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHP5"
FT                   /protein_id="ACZ61845.1"
FT                   /translation="MRIIRTVAEMQKLHREICGPVGLVPTMGYLHEGHLSLIRASKKQD
FT                   INTIASIFVNPTQFGPHEDFKKYPRDEKRDMAMLENADVDYVFAPSVEEMYPSGFDSWV
FT                   EPGVLQERLEGAVRPGHFRGVCTVVAKLLTIIRPDRAYFGQKDYQQYLIIKKMASDLNL
FT                   DVSVEMLPIVRENDGLALSSRNTYLSASERQAALVLYRSLLTAKSLFDEKEYSAEVIRR
FT                   KMTDIIRHESMAEIDYVSLSDRDTLCEMDKVSAKTIALVAARFGKTRLIDNMFLA"
FT   gene            complement(662994..664256)
FT                   /locus_tag="DhcVS_709"
FT   CDS_pept        complement(662994..664256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_709"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_709"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61846"
FT                   /db_xref="GOA:D2BHP6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHP6"
FT                   /protein_id="ACZ61846.1"
FT                   /translation="MIQKTNPAASERKIMGFAPNVFFLGLVSFLTDISSEIIFTLVPLF
FT                   LANVLGATTTIIGFVGGLSDSTEAIFKIFSGYLSDKINRCKSLALFGYGFSALSKPFML
FT                   LANSWGVVTGVRFADRVGKGVRSSPRDALIANSVEVYERGRSFGLHKAMDSLGATLGLG
FT                   IAAAVIYFTQSGSLTLAPETYRTLVWWGIIPAFLAVVVLAVFVKEKRRTQTTKPVGERI
FT                   RFNFRHLFSGMDSRFKLFLLVMFLFTLGNSSDYFVILRAQDMSVSVLGISLMLVVFNIT
FT                   YSLVSLPAGMLSDKIGRRKVIAMGWLFYALVYLGFAVTQSQTGIWILFGCYGLYYGIVE
FT                   GVAKAFVADMIPSDKRGTAYGLYQGVVGLTLLPASLIAGILWDTIDSAAPFYFGAAMAL
FT                   LAVIGLLVFIKEPSTKTPVLS"
FT   gene            complement(664256..664555)
FT                   /locus_tag="DhcVS_710"
FT   CDS_pept        complement(664256..664555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_710"
FT                   /product="transcriptional regulator, PadR-type"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_710"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61847"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHP7"
FT                   /protein_id="ACZ61847.1"
FT                   /translation="MVDREFFLGFIRIHVLYHAQTEPIFGAEIARELGRHGYTITAGTL
FT                   YPLLHRLQGEGYLESFPKVEQGKQRRYYRTTPKGSEMLNECRKQIRELVDEVLA"
FT   gene            664688..664763
FT                   /locus_tag="DhcVS_711"
FT   tRNA            664688..664763
FT                   /locus_tag="DhcVS_711"
FT                   /product="tRNA-Phe"
FT   gene            664838..664924
FT                   /locus_tag="DhcVS_712"
FT   tRNA            664838..664924
FT                   /locus_tag="DhcVS_712"
FT                   /product="tRNA-Leu"
FT   gene            664955..665028
FT                   /locus_tag="DhcVS_713"
FT   tRNA            664955..665028
FT                   /locus_tag="DhcVS_713"
FT                   /product="tRNA-Gln"
FT   gene            665039..665113
FT                   /locus_tag="DhcVS_714"
FT   tRNA            665039..665113
FT                   /locus_tag="DhcVS_714"
FT                   /product="tRNA-Asn"
FT   gene            665219..666721
FT                   /locus_tag="DhcVS_715"
FT   CDS_pept        665219..666721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_715"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_715"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61848"
FT                   /db_xref="GOA:D2BHP8"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHP8"
FT                   /protein_id="ACZ61848.1"
FT                   /translation="MSAKKVIIIGAGLAGLSAGCYSRMNGYDTCIYEHHSEPGGVAATW
FT                   RRGEYLIDGGIHFMMGYKNGTDLFNIYRQLGVADPANFVPAKSYGSFIDIEQGRQFDIP
FT                   LNISELALDMKMLSPADAPLIDDLATAVGAFSCKDLTTYGQINPPELTSGLDRLTTIWK
FT                   MRGLFKYMSGKYTRSMEEYTSGMQNRWLADCLNNLFTPQSPVWFVIMLLAIAGDGQISY
FT                   LSKGCKDFALQIEKRYKDLNGEIIYSATVEQILVNNDCAIGVRLTDGTEDFADYIISAG
FT                   DIHNTVFHLLDGKYIGKKLQNKFDTYELSPPYFAASFGVKHTFENENVFNTIVLKQPLR
FT                   IGKREIHQIFVRIFNYSNHFAPEGKSVIQAEFETDWDYWDNLWQTGKEKYTAEKERLAS
FT                   EILTHLEMLYFGLSQLVEVTDIATPCTLNRYTLNYKGAPEGWRINLQNFKEETRRTLEG
FT                   LSNLYLAGHWVSGGVPGVILSGRQAVQLICAKEKKPFFTRTT"
FT   gene            complement(666718..667308)
FT                   /locus_tag="DhcVS_716"
FT   CDS_pept        complement(666718..667308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_716"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_716"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61849"
FT                   /db_xref="GOA:D2BHP9"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHP9"
FT                   /protein_id="ACZ61849.1"
FT                   /translation="MKTKLANYISDIFNPLTLSILFVFLLAKDSTENLWEAIRWSFIFI
FT                   VLCMLPIFLVILNMVKKGKLQSVFSNPREQRHILYVLGSVMVGAALIVLIFIGAPDKLI
FT                   AALFAGFVSSVLFMIVNFFWKISVHTAFASAFSSIALMLYGYSALGFMLLVPMMAWARV
FT                   YLKEHTVGQVTAGALLAGTVIVTVFNIFNMVNI"
FT   gene            667527..668273
FT                   /locus_tag="DhcVS_717"
FT   CDS_pept        667527..668273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_717"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_717"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61850"
FT                   /db_xref="GOA:D2BHQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHQ0"
FT                   /protein_id="ACZ61850.1"
FT                   /translation="MTETAISLRDISFNYKHIKALDGLSLEIPCGISFGIMGPNGAGKT
FT                   TLIRIMVGLLRPKSGYLAILSKEFSRQLEYQLGYMPQIHSLYTELTVSQNIDFFACIYG
FT                   LRDKTLRKARIEEVIRLVDLWDRRNDAVMNLSGGMKQRVSLACAIVHNPPVIFLDEPTV
FT                   GLDPELRCRFWEYFKDLNQKGVTIIISSHTLDDAAHCDRLAFLREGKVIAEGTPPELKA
FT                   ATGKADASLEDAFLYSIRTGGALSHE"
FT   gene            668209..668991
FT                   /locus_tag="DhcVS_718"
FT   CDS_pept        668209..668991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_718"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_718"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61851"
FT                   /db_xref="GOA:D2BHQ1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHQ1"
FT                   /protein_id="ACZ61851.1"
FT                   /translation="MPVWKMPFCIPSAQEVLSAMNNILAIAQRLIRQLLHDRRTMALII
FT                   VVPVVVMGLIGISFPDATVLDYIAPAMLATLALFFSFLLTGISFLRETSQGTMERLMAA
FT                   PVSRLNIVAGYLLGFFVFALLQTLIIVLFTIYVLGVNFQGELWQILLFQVLIITGAVTL
FT                   GIFTSSFAKNEFQMVQFIPLIIVPQIFLCGVIWPVSQMPEWLQYLSNILPLTYSVDGMR
FT                   EIMLQGKNLTELGFQCGVLILFAVITTVLATLTVPKRR"
FT   gene            669091..669846
FT                   /locus_tag="DhcVS_719"
FT   CDS_pept        669091..669846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_719"
FT                   /product="ABC-type transport system involved in Fe-S
FT                   cluster assembly ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_719"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61852"
FT                   /db_xref="GOA:D2BHQ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHQ2"
FT                   /protein_id="ACZ61852.1"
FT                   /translation="MDSEILLEVKDLHVEVDGREILHGVDLILPAGETHVIFGPNGSGK
FT                   TTLLMTLMGFPRYKITKGQLIFNGKDITHVPLDERARLGIGISFQRPPVVRGVKLREMV
FT                   RSSLRTKEDSGVIDELAKKANMINFLERDVNHGFSGGEIKRSELLQLLAQGPDMVLLDE
FT                   PESGVDLENIALIGSLINDLLEKKHPIRERKRGGLVITHTGHILDYVNARTGYVLCHGR
FT                   INCTGDPRDMLETIKQNGYQECVECPRKI"
FT   gene            669828..671063
FT                   /locus_tag="DhcVS_720"
FT   CDS_pept        669828..671063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_720"
FT                   /product="ABC-type transport system involved in Fe-S
FT                   cluster assembly, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_720"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61853"
FT                   /db_xref="GOA:D2BHQ3"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHQ3"
FT                   /protein_id="ACZ61853.1"
FT                   /translation="MSPKDLRPNLADKAGAAINKKPAIGDDILLEKFTDNTEAHKYVSK
FT                   PSELAAEDKARMLESGVVLDDLKERSGTYIQMDNRPVHFSAQQDGIEIMSTSEAALKYD
FT                   WLKDYWWKAVSVDADKYTAHVELNKADGYFIRALPGVKTEFPVQSCMYMAKNQSIQNVH
FT                   NIIIAEEGSELHIITGCTSAHRTETGLHLGVTEFFIKKGAKVTFTMIHTWSPDIAVRPR
FT                   TGAIVEENGVFLSNYVIMKTVKSLQSYPVAYLNGENAVARFNSVMVCPPGSKMDVGSRV
FT                   FLNAKHTRTELITRALTTGGEIISRGYIEGKVPDCKGHLECRGLILGDNGIIYAIPELM
FT                   GKVSGVDLSHEAAVGKIAEEEVEYLMARGLNKDEATAAIVRGFLNVDVEGLPPLLKEEM
FT                   DKAIKLGDQEGM"
FT   gene            complement(671132..671923)
FT                   /locus_tag="DhcVS_721"
FT   CDS_pept        complement(671132..671923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DhcVS_721"
FT                   /product="ABC-type molybdenum transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:DhcVS_721"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ61854"
FT                   /db_xref="GOA:D2BHQ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2BHQ4"
FT                   /protein_id="