(data stored in ACNUC7421 zone)

EMBL: CP001828

ID   CP001828; SV 1; circular; genomic DNA; STD; PRO; 3516334 BP.
XX
AC   CP001828;
XX
PR   Project:PRJNA18743;
XX
DT   09-MAY-2010 (Rel. 104, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Legionella pneumophila 2300/99 Alcoy, complete genome.
XX
KW   .
XX
OS   Legionella pneumophila 2300/99 Alcoy
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Legionellales;
OC   Legionellaceae; Legionella.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-3516334
RX   DOI; 10.1186/1471-2164-11-181.
RX   PUBMED; 20236513.
RA   D'Auria G., Jimenez-Hernandez N., Peris-Bondia F., Moya A., Latorre A.;
RT   "Legionella pneumophila pangenome reveals strain-specific virulence
RT   factors";
RL   BMC Genomics 11(1):181-181(2010).
XX
RN   [2]
RP   1-3516334
RA   D'Auria G., Jimenez-Hernandez N., Peris-Bondia F., Moya A., Latorre A.;
RT   ;
RL   Submitted (13-NOV-2009) to the INSDC.
RL   Genomics and Health, Centre for Public Health Research (CSISP), Avda. de
RL   Cataluna, 21, Valencia, Valencia 46020, Spain
XX
DR   MD5; 27b7182a1df8ee35d6564fa76cbb99a7.
DR   BioSample; SAMN02604292.
DR   EnsemblGenomes-Gn; EBG00001454271.
DR   EnsemblGenomes-Gn; EBG00001454272.
DR   EnsemblGenomes-Gn; EBG00001454273.
DR   EnsemblGenomes-Gn; EBG00001454274.
DR   EnsemblGenomes-Gn; EBG00001454275.
DR   EnsemblGenomes-Gn; EBG00001454276.
DR   EnsemblGenomes-Gn; EBG00001454277.
DR   EnsemblGenomes-Gn; EBG00001454278.
DR   EnsemblGenomes-Gn; EBG00001454279.
DR   EnsemblGenomes-Gn; EBG00001454280.
DR   EnsemblGenomes-Gn; EBG00001454281.
DR   EnsemblGenomes-Gn; EBG00001454282.
DR   EnsemblGenomes-Gn; EBG00001454283.
DR   EnsemblGenomes-Gn; EBG00001454284.
DR   EnsemblGenomes-Gn; EBG00001454285.
DR   EnsemblGenomes-Gn; EBG00001454286.
DR   EnsemblGenomes-Gn; EBG00001454287.
DR   EnsemblGenomes-Gn; EBG00001454288.
DR   EnsemblGenomes-Gn; EBG00001454289.
DR   EnsemblGenomes-Gn; EBG00001454290.
DR   EnsemblGenomes-Gn; EBG00001454291.
DR   EnsemblGenomes-Gn; EBG00001454292.
DR   EnsemblGenomes-Gn; EBG00001454293.
DR   EnsemblGenomes-Gn; EBG00001454294.
DR   EnsemblGenomes-Gn; EBG00001454295.
DR   EnsemblGenomes-Gn; EBG00001454296.
DR   EnsemblGenomes-Gn; EBG00001454297.
DR   EnsemblGenomes-Gn; EBG00001454298.
DR   EnsemblGenomes-Gn; EBG00001454299.
DR   EnsemblGenomes-Gn; EBG00001454300.
DR   EnsemblGenomes-Gn; EBG00001454301.
DR   EnsemblGenomes-Gn; EBG00001454302.
DR   EnsemblGenomes-Gn; EBG00001454303.
DR   EnsemblGenomes-Gn; EBG00001454304.
DR   EnsemblGenomes-Gn; EBG00001454305.
DR   EnsemblGenomes-Gn; EBG00001454306.
DR   EnsemblGenomes-Gn; EBG00001454307.
DR   EnsemblGenomes-Gn; EBG00001454308.
DR   EnsemblGenomes-Gn; EBG00001454309.
DR   EnsemblGenomes-Gn; EBG00001454310.
DR   EnsemblGenomes-Gn; EBG00001454311.
DR   EnsemblGenomes-Gn; EBG00001454312.
DR   EnsemblGenomes-Gn; EBG00001454313.
DR   EnsemblGenomes-Gn; EBG00001454314.
DR   EnsemblGenomes-Gn; EBG00001454315.
DR   EnsemblGenomes-Gn; EBG00001454316.
DR   EnsemblGenomes-Gn; EBG00001454317.
DR   EnsemblGenomes-Gn; EBG00001454318.
DR   EnsemblGenomes-Gn; EBG00001454319.
DR   EnsemblGenomes-Gn; EBG00001454320.
DR   EnsemblGenomes-Gn; EBG00001454321.
DR   EnsemblGenomes-Gn; EBG00001454322.
DR   EnsemblGenomes-Gn; EBG00001454323.
DR   EnsemblGenomes-Gn; EBG00001454324.
DR   EnsemblGenomes-Gn; EBG00001454325.
DR   EnsemblGenomes-Gn; EBG00001454326.
DR   EnsemblGenomes-Gn; EBG00001454327.
DR   EnsemblGenomes-Gn; EBG00001454328.
DR   EnsemblGenomes-Gn; EBG00001454329.
DR   EnsemblGenomes-Gn; EBG00001454330.
DR   EnsemblGenomes-Gn; EBG00001454331.
DR   EnsemblGenomes-Gn; EBG00001454332.
DR   EnsemblGenomes-Gn; EBG00001454333.
DR   EnsemblGenomes-Gn; EBG00001454334.
DR   EnsemblGenomes-Gn; EBG00001454335.
DR   EnsemblGenomes-Gn; EBG00001454336.
DR   EnsemblGenomes-Gn; EBG00001454337.
DR   EnsemblGenomes-Gn; EBG00001454338.
DR   EnsemblGenomes-Gn; EBG00001454339.
DR   EnsemblGenomes-Gn; EBG00001454340.
DR   EnsemblGenomes-Gn; EBG00001454341.
DR   EnsemblGenomes-Gn; EBG00001454342.
DR   EnsemblGenomes-Gn; EBG00001454343.
DR   EnsemblGenomes-Gn; EBG00001454344.
DR   EnsemblGenomes-Gn; EBG00001454345.
DR   EnsemblGenomes-Gn; EBG00001454346.
DR   EnsemblGenomes-Gn; EBG00001454347.
DR   EnsemblGenomes-Gn; EBG00001454348.
DR   EnsemblGenomes-Gn; EBG00001454349.
DR   EnsemblGenomes-Gn; EBG00001454350.
DR   EnsemblGenomes-Gn; EBG00001454351.
DR   EnsemblGenomes-Gn; EBG00001454352.
DR   EnsemblGenomes-Gn; EBG00001454353.
DR   EnsemblGenomes-Gn; EBG00001454354.
DR   EnsemblGenomes-Gn; EBG00001454355.
DR   EnsemblGenomes-Gn; EBG00001454356.
DR   EnsemblGenomes-Gn; EBG00001454357.
DR   EnsemblGenomes-Gn; EBG00001454358.
DR   EnsemblGenomes-Gn; EBG00001454359.
DR   EnsemblGenomes-Gn; EBG00001454360.
DR   EnsemblGenomes-Gn; EBG00001454361.
DR   EnsemblGenomes-Gn; EBG00001454362.
DR   EnsemblGenomes-Gn; EBG00001454363.
DR   EnsemblGenomes-Gn; EBG00001454364.
DR   EnsemblGenomes-Gn; EBG00001454365.
DR   EnsemblGenomes-Gn; EBG00001454366.
DR   EnsemblGenomes-Gn; EBG00001454367.
DR   EnsemblGenomes-Gn; EBG00001454368.
DR   EnsemblGenomes-Gn; EBG00001454369.
DR   EnsemblGenomes-Gn; EBG00001454370.
DR   EnsemblGenomes-Gn; EBG00001454371.
DR   EnsemblGenomes-Gn; EBG00001454372.
DR   EnsemblGenomes-Gn; EBG00001454373.
DR   EnsemblGenomes-Gn; EBG00001454374.
DR   EnsemblGenomes-Gn; EBG00001454375.
DR   EnsemblGenomes-Gn; EBG00001454376.
DR   EnsemblGenomes-Gn; EBG00001454377.
DR   EnsemblGenomes-Gn; EBG00001454378.
DR   EnsemblGenomes-Gn; EBG00001454379.
DR   EnsemblGenomes-Gn; EBG00001454380.
DR   EnsemblGenomes-Gn; EBG00001454381.
DR   EnsemblGenomes-Gn; EBG00001454382.
DR   EnsemblGenomes-Gn; EBG00001454383.
DR   EnsemblGenomes-Gn; EBG00001454384.
DR   EnsemblGenomes-Gn; EBG00001454385.
DR   EnsemblGenomes-Gn; EBG00001454386.
DR   EnsemblGenomes-Gn; EBG00001454387.
DR   EnsemblGenomes-Gn; EBG00001454388.
DR   EnsemblGenomes-Gn; EBG00001454389.
DR   EnsemblGenomes-Gn; EBG00001454390.
DR   EnsemblGenomes-Gn; lpa_05000.
DR   EnsemblGenomes-Gn; lpa_05002.
DR   EnsemblGenomes-Gn; lpa_05004.
DR   EnsemblGenomes-Gn; lpa_05005.
DR   EnsemblGenomes-Gn; lpa_05006.
DR   EnsemblGenomes-Gn; lpa_05007.
DR   EnsemblGenomes-Gn; lpa_05008.
DR   EnsemblGenomes-Gn; lpa_05009.
DR   EnsemblGenomes-Gn; lpa_05010.
DR   EnsemblGenomes-Gn; lpa_05011.
DR   EnsemblGenomes-Gn; lpa_05013.
DR   EnsemblGenomes-Gn; lpa_05014.
DR   EnsemblGenomes-Gn; lpa_05015.
DR   EnsemblGenomes-Gn; lpa_05016.
DR   EnsemblGenomes-Gn; lpa_05017.
DR   EnsemblGenomes-Gn; lpa_05018.
DR   EnsemblGenomes-Gn; lpa_05019.
DR   EnsemblGenomes-Gn; lpa_05022.
DR   EnsemblGenomes-Gn; lpa_05025.
DR   EnsemblGenomes-Gn; lpa_05026.
DR   EnsemblGenomes-Gn; lpa_05028.
DR   EnsemblGenomes-Gn; lpa_05029.
DR   EnsemblGenomes-Gn; lpa_0503.
DR   EnsemblGenomes-Gn; lpa_05030.
DR   EnsemblGenomes-Gn; lpa_05032.
DR   EnsemblGenomes-Gn; lpa_05033.
DR   EnsemblGenomes-Gn; lpa_05036.
DR   EnsemblGenomes-Gn; lpa_05037.
DR   EnsemblGenomes-Gn; lpa_05038.
DR   EnsemblGenomes-Gn; lpa_05039.
DR   EnsemblGenomes-Gn; lpa_05040.
DR   EnsemblGenomes-Gn; lpa_05041.
DR   EnsemblGenomes-Gn; lpa_05042.
DR   EnsemblGenomes-Gn; lpa_05043.
DR   EnsemblGenomes-Gn; lpa_05044.
DR   EnsemblGenomes-Gn; lpa_05045.
DR   EnsemblGenomes-Gn; lpa_05046.
DR   EnsemblGenomes-Gn; lpa_05047.
DR   EnsemblGenomes-Gn; lpa_05048.
DR   EnsemblGenomes-Gn; lpa_05049.
DR   EnsemblGenomes-Gn; lpa_05050.
DR   EnsemblGenomes-Gn; lpa_05051.
DR   EnsemblGenomes-Gn; lpa_05052.
DR   EnsemblGenomes-Gn; lpa_05053.
DR   EnsemblGenomes-Gn; lpa_05055.
DR   EnsemblGenomes-Gn; lpa_05057.
DR   EnsemblGenomes-Gn; lpa_05058.
DR   EnsemblGenomes-Gn; lpa_05059.
DR   EnsemblGenomes-Gn; lpa_05060.
DR   EnsemblGenomes-Gn; lpa_05061.
DR   EnsemblGenomes-Gn; lpa_05064.
DR   EnsemblGenomes-Gn; lpa_05065.
DR   EnsemblGenomes-Gn; lpa_05066.
DR   EnsemblGenomes-Tr; EBT00001607951.
DR   EnsemblGenomes-Tr; EBT00001607952.
DR   EnsemblGenomes-Tr; EBT00001607953.
DR   EnsemblGenomes-Tr; EBT00001607954.
DR   EnsemblGenomes-Tr; EBT00001607955.
DR   EnsemblGenomes-Tr; EBT00001607956.
DR   EnsemblGenomes-Tr; EBT00001607957.
DR   EnsemblGenomes-Tr; EBT00001607958.
DR   EnsemblGenomes-Tr; EBT00001607959.
DR   EnsemblGenomes-Tr; EBT00001607960.
DR   EnsemblGenomes-Tr; EBT00001607961.
DR   EnsemblGenomes-Tr; EBT00001607962.
DR   EnsemblGenomes-Tr; EBT00001607963.
DR   EnsemblGenomes-Tr; EBT00001607964.
DR   EnsemblGenomes-Tr; EBT00001607965.
DR   EnsemblGenomes-Tr; EBT00001607966.
DR   EnsemblGenomes-Tr; EBT00001607967.
DR   EnsemblGenomes-Tr; EBT00001607968.
DR   EnsemblGenomes-Tr; EBT00001607969.
DR   EnsemblGenomes-Tr; EBT00001607970.
DR   EnsemblGenomes-Tr; EBT00001607971.
DR   EnsemblGenomes-Tr; EBT00001607972.
DR   EnsemblGenomes-Tr; EBT00001607973.
DR   EnsemblGenomes-Tr; EBT00001607974.
DR   EnsemblGenomes-Tr; EBT00001607975.
DR   EnsemblGenomes-Tr; EBT00001607976.
DR   EnsemblGenomes-Tr; EBT00001607977.
DR   EnsemblGenomes-Tr; EBT00001607978.
DR   EnsemblGenomes-Tr; EBT00001607979.
DR   EnsemblGenomes-Tr; EBT00001607980.
DR   EnsemblGenomes-Tr; EBT00001607981.
DR   EnsemblGenomes-Tr; EBT00001607982.
DR   EnsemblGenomes-Tr; EBT00001607983.
DR   EnsemblGenomes-Tr; EBT00001607984.
DR   EnsemblGenomes-Tr; EBT00001607985.
DR   EnsemblGenomes-Tr; EBT00001607986.
DR   EnsemblGenomes-Tr; EBT00001607987.
DR   EnsemblGenomes-Tr; EBT00001607988.
DR   EnsemblGenomes-Tr; EBT00001607989.
DR   EnsemblGenomes-Tr; EBT00001607990.
DR   EnsemblGenomes-Tr; EBT00001607991.
DR   EnsemblGenomes-Tr; EBT00001607992.
DR   EnsemblGenomes-Tr; EBT00001607993.
DR   EnsemblGenomes-Tr; EBT00001607994.
DR   EnsemblGenomes-Tr; EBT00001607995.
DR   EnsemblGenomes-Tr; EBT00001607996.
DR   EnsemblGenomes-Tr; EBT00001607997.
DR   EnsemblGenomes-Tr; EBT00001607998.
DR   EnsemblGenomes-Tr; EBT00001607999.
DR   EnsemblGenomes-Tr; EBT00001608000.
DR   EnsemblGenomes-Tr; EBT00001608001.
DR   EnsemblGenomes-Tr; EBT00001608002.
DR   EnsemblGenomes-Tr; EBT00001608003.
DR   EnsemblGenomes-Tr; EBT00001608004.
DR   EnsemblGenomes-Tr; EBT00001608005.
DR   EnsemblGenomes-Tr; EBT00001608006.
DR   EnsemblGenomes-Tr; EBT00001608007.
DR   EnsemblGenomes-Tr; EBT00001608008.
DR   EnsemblGenomes-Tr; EBT00001608009.
DR   EnsemblGenomes-Tr; EBT00001608010.
DR   EnsemblGenomes-Tr; EBT00001608011.
DR   EnsemblGenomes-Tr; EBT00001608012.
DR   EnsemblGenomes-Tr; EBT00001608013.
DR   EnsemblGenomes-Tr; EBT00001608014.
DR   EnsemblGenomes-Tr; EBT00001608015.
DR   EnsemblGenomes-Tr; EBT00001608016.
DR   EnsemblGenomes-Tr; EBT00001608017.
DR   EnsemblGenomes-Tr; EBT00001608018.
DR   EnsemblGenomes-Tr; EBT00001608019.
DR   EnsemblGenomes-Tr; EBT00001608020.
DR   EnsemblGenomes-Tr; EBT00001608021.
DR   EnsemblGenomes-Tr; EBT00001608022.
DR   EnsemblGenomes-Tr; EBT00001608023.
DR   EnsemblGenomes-Tr; EBT00001608024.
DR   EnsemblGenomes-Tr; EBT00001608025.
DR   EnsemblGenomes-Tr; EBT00001608026.
DR   EnsemblGenomes-Tr; EBT00001608027.
DR   EnsemblGenomes-Tr; EBT00001608028.
DR   EnsemblGenomes-Tr; EBT00001608029.
DR   EnsemblGenomes-Tr; EBT00001608030.
DR   EnsemblGenomes-Tr; EBT00001608031.
DR   EnsemblGenomes-Tr; EBT00001608032.
DR   EnsemblGenomes-Tr; EBT00001608033.
DR   EnsemblGenomes-Tr; EBT00001608034.
DR   EnsemblGenomes-Tr; EBT00001608035.
DR   EnsemblGenomes-Tr; EBT00001608036.
DR   EnsemblGenomes-Tr; EBT00001608037.
DR   EnsemblGenomes-Tr; EBT00001608038.
DR   EnsemblGenomes-Tr; EBT00001608039.
DR   EnsemblGenomes-Tr; EBT00001608040.
DR   EnsemblGenomes-Tr; EBT00001608041.
DR   EnsemblGenomes-Tr; EBT00001608042.
DR   EnsemblGenomes-Tr; EBT00001608043.
DR   EnsemblGenomes-Tr; EBT00001608044.
DR   EnsemblGenomes-Tr; EBT00001608045.
DR   EnsemblGenomes-Tr; EBT00001608046.
DR   EnsemblGenomes-Tr; EBT00001608047.
DR   EnsemblGenomes-Tr; EBT00001608048.
DR   EnsemblGenomes-Tr; EBT00001608049.
DR   EnsemblGenomes-Tr; EBT00001608050.
DR   EnsemblGenomes-Tr; EBT00001608051.
DR   EnsemblGenomes-Tr; EBT00001608052.
DR   EnsemblGenomes-Tr; EBT00001608053.
DR   EnsemblGenomes-Tr; EBT00001608054.
DR   EnsemblGenomes-Tr; EBT00001608055.
DR   EnsemblGenomes-Tr; EBT00001608056.
DR   EnsemblGenomes-Tr; EBT00001608057.
DR   EnsemblGenomes-Tr; EBT00001608058.
DR   EnsemblGenomes-Tr; EBT00001608059.
DR   EnsemblGenomes-Tr; EBT00001608060.
DR   EnsemblGenomes-Tr; EBT00001608061.
DR   EnsemblGenomes-Tr; EBT00001608062.
DR   EnsemblGenomes-Tr; EBT00001608063.
DR   EnsemblGenomes-Tr; EBT00001608064.
DR   EnsemblGenomes-Tr; EBT00001608065.
DR   EnsemblGenomes-Tr; EBT00001608066.
DR   EnsemblGenomes-Tr; EBT00001608067.
DR   EnsemblGenomes-Tr; EBT00001608068.
DR   EnsemblGenomes-Tr; EBT00001608069.
DR   EnsemblGenomes-Tr; EBT00001608070.
DR   EnsemblGenomes-Tr; lpa_05000-1.
DR   EnsemblGenomes-Tr; lpa_05002-1.
DR   EnsemblGenomes-Tr; lpa_05004-1.
DR   EnsemblGenomes-Tr; lpa_05005-1.
DR   EnsemblGenomes-Tr; lpa_05006-1.
DR   EnsemblGenomes-Tr; lpa_05007-1.
DR   EnsemblGenomes-Tr; lpa_05008-1.
DR   EnsemblGenomes-Tr; lpa_05009-1.
DR   EnsemblGenomes-Tr; lpa_05010-1.
DR   EnsemblGenomes-Tr; lpa_05011-1.
DR   EnsemblGenomes-Tr; lpa_05013-1.
DR   EnsemblGenomes-Tr; lpa_05014-1.
DR   EnsemblGenomes-Tr; lpa_05015-1.
DR   EnsemblGenomes-Tr; lpa_05016-1.
DR   EnsemblGenomes-Tr; lpa_05017-1.
DR   EnsemblGenomes-Tr; lpa_05018-1.
DR   EnsemblGenomes-Tr; lpa_05019-1.
DR   EnsemblGenomes-Tr; lpa_05022-1.
DR   EnsemblGenomes-Tr; lpa_05025-1.
DR   EnsemblGenomes-Tr; lpa_05026-1.
DR   EnsemblGenomes-Tr; lpa_05028-1.
DR   EnsemblGenomes-Tr; lpa_05029-1.
DR   EnsemblGenomes-Tr; lpa_0503-1.
DR   EnsemblGenomes-Tr; lpa_05030-1.
DR   EnsemblGenomes-Tr; lpa_05032-1.
DR   EnsemblGenomes-Tr; lpa_05033-1.
DR   EnsemblGenomes-Tr; lpa_05036-1.
DR   EnsemblGenomes-Tr; lpa_05037-1.
DR   EnsemblGenomes-Tr; lpa_05038-1.
DR   EnsemblGenomes-Tr; lpa_05039-1.
DR   EnsemblGenomes-Tr; lpa_05040-1.
DR   EnsemblGenomes-Tr; lpa_05041-1.
DR   EnsemblGenomes-Tr; lpa_05042-1.
DR   EnsemblGenomes-Tr; lpa_05043-1.
DR   EnsemblGenomes-Tr; lpa_05044-1.
DR   EnsemblGenomes-Tr; lpa_05045-1.
DR   EnsemblGenomes-Tr; lpa_05046-1.
DR   EnsemblGenomes-Tr; lpa_05047-1.
DR   EnsemblGenomes-Tr; lpa_05048-1.
DR   EnsemblGenomes-Tr; lpa_05049-1.
DR   EnsemblGenomes-Tr; lpa_05050-1.
DR   EnsemblGenomes-Tr; lpa_05051-1.
DR   EnsemblGenomes-Tr; lpa_05052-1.
DR   EnsemblGenomes-Tr; lpa_05053-1.
DR   EnsemblGenomes-Tr; lpa_05055-1.
DR   EnsemblGenomes-Tr; lpa_05057-1.
DR   EnsemblGenomes-Tr; lpa_05058-1.
DR   EnsemblGenomes-Tr; lpa_05059-1.
DR   EnsemblGenomes-Tr; lpa_05060-1.
DR   EnsemblGenomes-Tr; lpa_05061-1.
DR   EnsemblGenomes-Tr; lpa_05064-1.
DR   EnsemblGenomes-Tr; lpa_05065-1.
DR   EnsemblGenomes-Tr; lpa_05066-1.
DR   EuropePMC; PMC2976443; 20833813.
DR   EuropePMC; PMC4126679; 25105285.
DR   EuropePMC; PMC4473214; 25926494.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01760; traJ-II.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02057; STnc40.
DR   SILVA-LSU; CP001828.
DR   SILVA-SSU; CP001828.
XX
CC   DNA Source: Legionella pneumophila serogroup 1 strain 2300/99
CC   Alcoy, Pontiak (Knoxville) Health Institute Carlos III, National
CC   Center of Microbiology, Spain.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3516334
FT                   /organism="Legionella pneumophila 2300/99 Alcoy"
FT                   /strain="2300/99 Alcoy"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:423212"
FT   gene            204..1562
FT                   /gene="dnaA"
FT                   /locus_tag="lpa_00001"
FT   CDS_pept        204..1562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="lpa_00001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COG0593, DnaA, ATPase involved in DNA replication
FT                   initiation [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00001"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23246"
FT                   /protein_id="ADG23246.1"
FT                   /translation="MSTTAWQKCLGLLQDEFSAQQFNTWLRPLQAYMDEQRLILLAPNR
FT                   FVVDWVRKHFFSRIEELIKQFSGDDIKAISIEVGSKPVEAVDTPAETIVTSSSTAPLKS
FT                   APKKAVDYKSSHLNKKFVFDSFVEGNSNQLARAASMQVAERPGDAYNPLFIYGGVGLGK
FT                   THLMHAIGNSILKNNPEAKVLYLHSERFVADMVKALQTNSINEFKRFYRSLNALLIDDI
FT                   QFFAGKDRSQEEFFHTFNALLEGQQQIILTSDRYPKEIEGMEERLKSRFGWGLTVAVEP
FT                   PELETRVAILISKAEQSNIELPYEVAFFIAKRIRSNVRELEGALRRVIANAHFTGKPIT
FT                   IEFVHEALRDLLALQDKLVTIENIQKTVAEYYKVKVADLLSKRRSRSIARPRQMAMALS
FT                   KELTNHSLPEIGDHFGGKDHTTVIHACRKVKELIQDDSDFAEDYKNLMRILSS"
FT   gene            1576..2679
FT                   /gene="dnaN"
FT                   /locus_tag="lpa_00002"
FT   CDS_pept        1576..2679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="lpa_00002"
FT                   /product="DNA polymerase III subunit beta"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG0592, DnaN, DNA polymerase sliding clamp subunit
FT                   (PCNA homolog) [DNA replication, recombination, and
FT                   repair]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00002"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23247"
FT                   /protein_id="ADG23247.1"
FT                   /translation="MFELTIKKEDLLTPLLTVSGAVDKKQSLAILSHFLLKLSDGLLYI
FT                   TATDLEIEMSAQVACDSNNTSGSITVPAKKFIDIIRSLDENPSPSIVFDKALVTIKQNR
FT                   STFKLATLPAENYPSSEDECNDVELTIPRLVLLQLLQSTHFAMSQQDVRIFLNGLLLEF
FT                   DSNIISAVATDGHRMAISRYSCNNITQTKLLIPKKGVQELLRLLNCINDEQVLLAAGKS
FT                   HIKLITNQFVFLSKLIEARFPPYTKAIPREQDKYIVIDCATLKRALSRIVILAHEKSKA
FT                   VLLHLQPGQLTLIANNNEQEEAIETLSAETQGDELKIGLNATYLLDVLAHFSDGQIRLS
FT                   MSNTESSILIESLVNDNYQYIIMPMKI"
FT   gene            2808..3737
FT                   /gene="recF"
FT                   /locus_tag="lpa_00003"
FT   CDS_pept        2808..3737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="lpa_00003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="COG1195, RecF, Recombinational DNA repair ATPase
FT                   (RecF pathway) [DNA replication, recombination, and
FT                   repair]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00003"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23248"
FT                   /protein_id="ADG23248.1"
FT                   /translation="MLSCAHSFRSREVAPIISYGQNQLNVFAHTYDESTISVQKSITDG
FT                   TQIKLNNQFCCTTSQLAYALPCQVIYSDIFQIIDAGPSVRRSLLDWGLFHVKHDYLKIW
FT                   KDYKRILSQRNALLKSRATYEHFIPWDQQLSQLANQLDKARNDYFLQWQPKFYQVLSDL
FT                   TNISCTIEYYKGWDRKNAGQNMEELLQKSFDSDKNKLYTQYGPHQADLIINIEQYRVKH
FT                   TLSRGQQKIILIALKLAQGQLLDKDCLYLIDDLAAELDDYHQRNLIKYLTQQKGQFVIT
FT                   NLINNNNYDILPIDSGLFEVNCGAIKVL"
FT   gene            4112..6451
FT                   /gene="gyrB"
FT                   /locus_tag="lpa_00004"
FT   CDS_pept        4112..6451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="lpa_00004"
FT                   /product="Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /note="COG0187, GyrB, Type IIA topoisomerase (DNA
FT                   gyrase/topo II, topoisomerase IV), B subunit [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00004"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23249"
FT                   /protein_id="ADG23249.1"
FT                   /translation="MYIGDTDDGTGLHHMVFEVVDNSIDESLAGYCKEIFVTIHSDESI
FT                   TVKDDGRGIPVDIHKEEGKSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSE
FT                   ELHLLVRRHGKVYEQHYRHGVPESPIAETGESNSTGTQIWFKPSAETFSNIEFHYDILA
FT                   KRLRELSYLNSGVCIHLFDERTQKKDTFHYEGGIKAFVEHLNKNKTPVHPVVFSMTSEK
FT                   DGIVIELAMQWNDGYQETIFCFTNNIPQRDGGTHMAGFRAALTRTLNNYIENEGYAKKA
FT                   KVSPTGDDAREGLTAVLSVKVPDPKFSSQTKDKLVSSEVKPAVESCVAEKFNDFLLENP
FT                   TAAKSIVAKIIDAARAREAARRAREMTRRKGALDIAGLPGKLADCQEKDPSLSELYLVE
FT                   GDSAGGSAKQARDRKFQAILPLKGKILNVEKARFDKMLSSQEVATLITALGCGIGPEEY
FT                   DPDKVRYHRIIIMTDADVDGSHIRTLLLTFFYRQTRELLERGYIYIAQPPLYKVKRGKQ
FT                   EQYVKDDEALFDYLTQCALDGATFYPAKEAPPISAKSLEELVQHFRRVEKIIKRYKRRY
FT                   PSDILKRVAYMPMLHQEDFNNLSKIESWCRQLHLSLQQVDSKTEQYKVDIQKLTEGNQY
FT                   TPKITVYQHGLENDIPMQVEFFLSKDYKEMVDLGHKLSNLIEEGAYIQRGDKSLPVENF
FT                   EQVLNWLMDEAKKGQTIQRYKGLGEMNPEQLWETTMDPEVRRMLQVSIEDAVAADEIFT
FT                   TLMGDNVEPRRDFIETNALDAENIDI"
FT   gene            complement(6815..7861)
FT                   /locus_tag="lpa_00005"
FT   CDS_pept        complement(6815..7861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00005"
FT                   /product="peptidylarginine deiminase"
FT                   /EC_number="3.5.3.12"
FT                   /note="COG2957, Peptidylarginine deiminase and related
FT                   enzymes [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23250"
FT                   /protein_id="ADG23250.1"
FT                   /translation="MNMNTAPKQYGFYMPAEWYPHERCWMAWPCHHDTWSKIGLDKAKM
FT                   AYARVAKAIAQFEPVTLLVNPGDEDSAENLCKGHNIEIISLPINDSWTRDTGATFLINN
FT                   ERQLAGVDWIHNAWGGNYADCSLDNLLASHLIKYTEAQYFHAPLVMEGGSFHVDGEGTI
FT                   LTSKECLLNSNRNPHLSQQEIEQYLINYLGAERIIWLNMGLIGDETDGHVDEIATFIAP
FT                   GKVLCLITKDKEDPNYHRLQENFEILKSSKDARGRTFEVYTVEQPPATYLNGERLTLSY
FT                   INFYMANQGIVMPAFGYESFDRLAYQLFVQIFPGYQITQIDALDVFSGGGGIHCITQQQ
FT                   PKSYKLVG"
FT   gene            complement(7858..9750)
FT                   /gene="speA"
FT                   /locus_tag="lpa_00006"
FT   CDS_pept        complement(7858..9750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speA"
FT                   /locus_tag="lpa_00006"
FT                   /product="arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /note="COG1166, SpeA, Arginine decarboxylase (spermidine
FT                   biosynthesis) [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00006"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23251"
FT                   /protein_id="ADG23251.1"
FT                   /translation="MNNNTLSDDNLYNIENWGEGYFRINSKGNIEISKKPGKPGVELQT
FT                   IVDAADRAGLHLPLLIRCSDILHDRVHRIYQAFTQAREDTYYAGNYQLVYPIKVNQEQS
FT                   VVRELLKSPDNQIGLEAGSKPELMAVIGMLGDHQSTIVCNGYKDTSYIRTALIAQQMGH
FT                   KVFIVIEKKSELDIILKESARLQIKPTLGVRIRLVSKSAGKWENTGGVKSKFGLNAKQV
FT                   LELILQLKANDMLDCLQLMHCHLGSQIANIHDIRHCMQEVARYYIELRQLNAPIGTIDV
FT                   GGGLSVDYEGTRSNKGCSMNYSLVEYATHIMLALKHLCQEAEIPEPDLISESGRALTAH
FT                   HAVLISNITDVEIINKAPVLPEISEDDSHVIRDIYDTYQAITDSSPTEIYNYAAHSLNE
FT                   AHSLFKHGVISLQEKAKVEAFYTNICMEIKDKLDEENPSEKALLMRINECMAAKIFCNI
FT                   SFFQSIPDAWAIGQIFPVAPISQLNRTLSMHSILQDLTCDSDGTIKQYPGSSCVTTTLM
FT                   LPSYDINNPYNIGFFLVGAYQEILGNLHNLFGDTNSLDVKLSDDGQFELDDLVSGDTVT
FT                   NVLNLAHFDTKKLIQSYEKQLIKSELPKEKALSYLNELRSIFSQLTYLDGNIAQ"
FT   gene            complement(9770..10615)
FT                   /locus_tag="lpa_00008"
FT   CDS_pept        complement(9770..10615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00008"
FT                   /product="probable hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00008"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23252"
FT                   /protein_id="ADG23252.1"
FT                   /translation="MKENKLTVALVQEQWYENPKEHQDKLASGIFSATQQGAKLVCLQE
FT                   LTLSPYFCTRSDVDPAPYMEDIATGPTAQFVSQMAKSNQIHITASLFEKAGYNTAVAFN
FT                   PQGELIAVTRKQHIPSGEKYHENFYFKPGDSNYPVHTIAGHYLGLPTCYDQWFPELSRI
FT                   YGLKGAEILVYPTAIGGEPTAPGFDSQPMWQKVMVAQGIMSNTFIIAVNRIGCEDGLSF
FT                   YGSSFISTPMGEILVQAPRNEPAVLVAELDFSQRELWGRLFPFPQQREPETYHELVKSR
FT                   "
FT   gene            11054..11170
FT                   /locus_tag="lpa_00010"
FT   CDS_pept        11054..11170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23253"
FT                   /protein_id="ADG23253.1"
FT                   /translation="MRNINMNYCYMMCKEWVKKCKVALNQVRAKDMAALLAE"
FT   gene            complement(11156..12415)
FT                   /locus_tag="lpa_00011"
FT   CDS_pept        complement(11156..12415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23254"
FT                   /protein_id="ADG23254.1"
FT                   /translation="MTFTCDELKGLEHPYKVLGNGDALAENREELNKLTNDEKLVLASR
FT                   LVLECPVNELKDFAHAIEAARMPQDDSDTFHSFLFQAYQVKKRIISLLDPRNKNPHSMI
FT                   LEKEFDGELFNNFNKLAIDVLTNNEVAIALRLAETTPAQDRSRVSQNINNIFPQSLFAA
FT                   KVGHAFAVRRDIERLLLGDRPDQFFSSREFKIDSCIEFASLFNVINDKESSIAGKLALR
FT                   TPAENRSDVVMKIKGFCAEDSELAIKVQSAFALRRDIERNLLGDNPEQFFNSRDFSVDL
FT                   CLEFAILFPELLKGHEQAIGEKLAKLDAKVRSDISRKLEMINGAAHEQSSPFRIIASAM
FT                   VPKEEPCLTKPTPVVLPSTEEIIPKQESPTSLRNRNVLFKEQTEEHKKKNSQMEPIASD
FT                   SEEEEEKQNCWTSFCGLFGK"
FT   gene            12603..12860
FT                   /locus_tag="lpa_00012"
FT   CDS_pept        12603..12860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00012"
FT                   /product="hfq host factor-I protein for bacteriophage Q
FT                   beta replication"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00012"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23255"
FT                   /protein_id="ADG23255.1"
FT                   /translation="MSKNHLLQDPFLNELRKEKVPVSVFLVNGIKLHGIIDSFDQYVVM
FT                   LKNSITQMVYKHAISTVVPSRMVKIPAEESSGEEEGTVAD"
FT   gene            12888..14132
FT                   /gene="hflX"
FT                   /locus_tag="lpa_00013"
FT   CDS_pept        12888..14132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="lpa_00013"
FT                   /product="GTPase"
FT                   /note="COG2262, HflX, GTPases [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00013"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23256"
FT                   /protein_id="ADG23256.1"
FT                   /translation="MFERPQGGERAVLVQLALPGVDADKALAEFEELALSAKAEVLDCV
FT                   LGARATPDAKYYVGKGKAEEIAHLVNMLDADLVLVNHELSPSQERNLERLFGCRVVDRS
FT                   GLILDIFAQRARTFEGKLQVELAQLQHLSTRLIRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRERIRYINKRLEKVRCSRDQNRQARRKASMPTVSLVGYTNAGKSTLFNVLTGEHT
FT                   YVADQLFATLDPTMRKLELPGSSAAILADTVGFIRDLPHHLVEAFRATLEETQQADLLL
FT                   HVIDISDPNWRETVFEVQKVLDELKVSNIPVIQVFNKIDLQEGWQPKIDYTEDACKVWL
FT                   SATTGAGLDLLKEAIATQLHGMILIEDIVIKPDQAKLRAQLYQLGAVLKESVDENGDWL
FT                   MKIRITADQKRRLLS"
FT   gene            complement(14237..14707)
FT                   /locus_tag="lpa_00015"
FT   CDS_pept        complement(14237..14707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00015"
FT                   /product="thiol-disulfide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23257"
FT                   /protein_id="ADG23257.1"
FT                   /translation="MKRLIPTFIYLLALAITPFSTHAEALLKDTFGHNIPFSSLKGKWV
FT                   FINYWASWCETCVDEIPEFNRFYKNHKNEAVALYAVNYDALPLPEQKLLIKKFNINYPN
FT                   LLKDPAQDLQLGDITGVPVTFVFNPKGQLIKKLYGGQTAKTLEKVIAENRTS"
FT   gene            complement(14876..16453)
FT                   /locus_tag="lpa_00016"
FT   CDS_pept        complement(14876..16453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00016"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23258"
FT                   /protein_id="ADG23258.1"
FT                   /translation="MNTTEHTELGNGLLMDKIEGNPYLRIDEFGVLHLRLQRFGENNLP
FT                   EPMELEMSAGEIIAMAGDYFTQANWTMDLDLPKCELFNSPAELGKHLIRKPIDPKEESA
FT                   LITAYNNLAAPDVTRKEIDRIYSINNANYVPFSPTLNFYAQQLMYYFRVKDYGEMLVRN
FT                   QTHFTPWSIRVYILGHAIALRYAHLSYELKQLATDRNYQSDNPDLSTLKISLQNKNETL
FT                   SSNTLLDLANRYHAQAYSIELFTFHYYSDHFATGHMSMIGDLRVVLKERFGVWGNILAN
FT                   NLHDEVNRVGVYTVRPYDPTPNATEAPSRARGDGKFDTCLNQFNRLACLNGMTASLKDI
FT                   NQVLSGSVIPEQKDFGGLVHMPDVDFNSRQHQPLLVLSKGKVYYRNNLSQIHIISPSEY
FT                   EALRESPEKHGYKELTSKWTAFKLVTKLRLFPYLYDGSVMPVSDEKLAEIIADEKRRNP
FT                   QRAPIPTPSCLPESEPTVFDWRTKASWRNNKDSLDILDGLKKHSILGAKQTHSAIQEEE
FT                   EVRLNLGV"
FT   gene            16599..17438
FT                   /locus_tag="lpa_00017"
FT   CDS_pept        16599..17438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00017"
FT                   /product="pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00017"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23259"
FT                   /protein_id="ADG23259.1"
FT                   /translation="MKAIEVERLIQGTLIREGGGVKLRRYIGADKTNHFEPILLFDYFD
FT                   SSDPLDYLAGFPPHPHRGFETITYLMEGSITHEDNKGNKGVINAGGVQWMTAGKGIIHS
FT                   EMPSSSTGRLHGLQLWLNLPAAEKWREPRYQEKSSDQLPIEVMESGATIKVIAGRIDQG
FT                   LSSPIVEIATRPLFLDINLPANATIQQTIPDDYQAVLFVIEGAVNTGGQQITAGTLASL
FT                   TNGERIQIEGKDKENRNHCLLIAAAKLHEPIVRYGPFVMNTQEEITQAIHDFRTGHF"
FT   gene            17875..19086
FT                   /locus_tag="lpa_00018"
FT   CDS_pept        17875..19086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00018"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00018"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23260"
FT                   /protein_id="ADG23260.1"
FT                   /translation="MSLEVEPKPHGNNPYANRFDNLPSKAQGRFPRVAYVLQGGGSLGA
FT                   YQFGVVKGLLEAGYEPDWIAATSIGAIQAAIIVGNPPEKRIEKLERFWDEIAPGNFFDF
FT                   LGESDITLDFYNKLSAACALLFGQPEFFFPKWCTGTIPLWGDPTTLSYYDTTPLRKTLL
FT                   DLIDFELLNSCPIRLSLGAVQISNGHLIYFNNINYRIEVEHIMASAALPPGFPAVNIDG
FT                   ELYWDGGVHSNTPLEVILEAIPAENTLCFLIDCFGGRSFIPKSMSEIEERRKDISYGTH
FT                   AQRTIYNYLQRQKMRNSMMELSRILTDEQKKESAHLLDIGSPHHCTLVHLAYSSRIVKA
FT                   ASKDYNFGRVVIKKRMESGYSDAKAVLAEESQWGYLPEDGKSRLYESPNNLSRLFRKRK
FT                   KEVF"
FT   gene            19188..20261
FT                   /locus_tag="lpa_00020"
FT   CDS_pept        19188..20261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00020"
FT                   /product="multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23261"
FT                   /protein_id="ADG23261.1"
FT                   /translation="MKEKFATWYKIATKHIRFFFSYSIPMFFKKAKNYINLPIIVVGLA
FT                   LIIGLFHLFSYLIPFTDNAFVVTNVTPVAADVSGFITEIYVKNGQKVKKNDPIFSVYRV
FT                   PYELAYQQAMADYKEGLKKIDVFQKQIERTVALIKATDSELEKAQFALGLKKNKNVAEA
FT                   VSVLELKNLGYDVSTLSNKRNALQQEVAVLQAKIEQQRHTVASLKAKMDNAKVNLDLTI
FT                   VRAPGDGVIDNMYVSPNTPIEIHKPVFSFIDTANYYIQANFNETDLRNVRQGDKAYIIL
FT                   RMYYFDKIFHGVVVNSLWAAERQSTAPKSQIQVVTNQNEWLLLPQRFPLQIKILDPDPD
FT                   YPLNPGASAYVYISTKR"
FT   gene            20569..21168
FT                   /locus_tag="lpa_00022"
FT   CDS_pept        20569..21168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00022"
FT                   /product="Phage minor tail protein"
FT                   /note="COG5280, Phage-related minor tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00022"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23262"
FT                   /protein_id="ADG23262.1"
FT                   /translation="MLHHFKKMLVIVPLILSLASYSLIYGVEADSNFYIAINNALYTLA
FT                   AMAVIFAGLFIFPKKYYFDIWERAFLEVITGLESLSAKICKGEVKTIAIFSGIIVMERY
FT                   SKMLPRNIKCYSILKITILSFELILTMSYLLSFQKQLRKEYIIVLHHYLERLCQSCKAR
FT                   QPLILSDQELPAFKETHELEILYQLILSWNYLCADG"
FT   gene            21153..22058
FT                   /locus_tag="lpa_00023"
FT   CDS_pept        21153..22058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00023"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23263"
FT                   /protein_id="ADG23263.1"
FT                   /translation="MRRWLGVQAFSYVELRSIQISTVFAFTIFVQEWLRYPRAGWTGFA
FT                   VMMIYAGFDNGTTIFRTYHRFLGVLLGLFTGYLLWFVGHLDYRTLILIMPLMVFFAFFL
FT                   VGRAYSVPTVFTVNVSVLGSGYFSTEDTLPVTYFIIDYTLCTLIAFTIILGFEYFWFRH
FT                   YGLMQRFIKSTQAEVIDDLYRLVRLLNQGKIKKTEWFQACIKLTDSLFEVNKLITNSQF
FT                   LISSEHAVGDEFNQFVELANRIFIGLKALYMAYYTKHYHTFDYYQLFQQVQKDLVHLKD
FT                   FVAGEQTIDLSEGVKHATSG"
FT   gene            22042..23448
FT                   /locus_tag="lpa_00024"
FT   CDS_pept        22042..23448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00024"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00024"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23264"
FT                   /protein_id="ADG23264.1"
FT                   /translation="MLRPVKIILLSVFLVGCYSEPYHRPHVEVINKWSVKDKNVKNIDS
FT                   KNIPYIAWWRDFKDPTLNQLIERGLISNTSLGMSRGSIEAAEGELKKIRYQWVPTLDLM
FT                   TGYSRNPATGFPGVLIVFIPNYTINIINQIREQKRAKYTLAQVKAEDDALKLTIISQIA
FT                   ASYFTYLAEIERKEFLQTLANDLTQLAKVANKVYQGGLSSEIEQEELYSQVNLIQGELE
FT                   VTERNIVISRNALRYLLNQNPGEIKTVKKLLQLKNRKLIPGSLPLTVLENRPDMQVAEN
FT                   RLRASHEGIGVAESNLLPTIQLDYIGGLAAGDSRYALPKKTVKFNDQLLKAPIIDMPVL
FT                   GAVAKAKGVNKVSYYNYIDTLQKALRDTTNALSENERLTNKLKQTASAQKHLAKAYNLN
FT                   DRLYQTGIQSYIETLNSKISLDKINISLNQDKLQELLSIVRLYQELAGGYRANLESEIK
FT                   SSGRATRTRL"
FT   gene            23674..25350
FT                   /locus_tag="lpa_00026"
FT   CDS_pept        23674..25350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00026"
FT                   /product="hemagglutinin/protease, zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00026"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23265"
FT                   /protein_id="ADG23265.1"
FT                   /translation="MSKKTMFFILSISTSSIFAADNVDLYQAPLNSINKYPILQTPKNA
FT                   IILKSSSAVIDNSLQKLNQTKEDNQMIVRYQQLYKGIPVIGAQVMITKGTDSGVQSNDN
FT                   AEVNGHLLDNIELNTKPAISAQQAKEYAKKSYFQFSPQSNIQQETAELQIRPDHNNQLK
FT                   LVYLVSFKSVQQSGKPDWPFFVIDAQTGALIKQWNNIKNYLDTGPGGNEKVQEYWYGKD
FT                   GLPALDVTQNGSQCVMENSKVKLVNLHSQWDWENTINTPFEYVCNNNIEEKINGGFSPG
FT                   NDAYYFGHVIVGMYKDWYGLNALQHSNGAPMQLVMRVHFGQNYDNAFWDGQAMSFGDGL
FT                   DFYPLVSLDVAGHEVTHGFTEQHSGLEYHDQSGALNESLSDMAGQASRAYLLEKNPQLY
FT                   NKAYLQPNEVTWGIGETIVRDSYGKALRFMDYPSSDGSSADCLDKGIAQNNGSYCAISY
FT                   DEVVAYANTHIALPQERQSFIVHTASGVFNKAFYLMSKDMGIKNAYHIMVVANTKYWTP
FT                   TTDFKNGACGVIYAARDLNTDINKVKSAFGQVGIDTAGCVI"
FT   gene            25570..26481
FT                   /locus_tag="lpa_00028"
FT   CDS_pept        25570..26481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00028"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00028"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23266"
FT                   /protein_id="ADG23266.1"
FT                   /translation="MAFFLITLCILILSFFCLAVMVLKFMQQPSSPLSFSQYVKLMCSG
FT                   VIAFIADTVGVGSFAVNVALAKLLGTFRDDELPAVNNGAQVLPGAIESLFFIHMVDVDL
FT                   TTLLTLVTGTCIGGLVGGFVVSQLSKQAIRLAMICSFALIIVLLIAHQLRLLPVGGDLT
FT                   ELHSWKLVIGFFAMVVCGSLTSVGVGLFVMVQGVLFLMNVSPVVAFPIMTTAGAMQQPL
FT                   TTLVFLQKNKIPLKKTLILSFSGCLGVMITIPIFTKLTITWLHFLLLFILIYNFLAIGH
FT                   TYLRSRPVKQYVQSSVKLAAAD"
FT   gene            26673..27152
FT                   /locus_tag="lpa_00030"
FT   CDS_pept        26673..27152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00030"
FT                   /product="alpha helix protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23267"
FT                   /protein_id="ADG23267.1"
FT                   /translation="MDEQISKSQKKRDAHYLQDIGIKFIDLSASKLDSLPLPDNLRQAI
FT                   IDARSIKSHGAKRRQAQLIGKLMRAADFEAILAAYEKILEEESSITASFHEIELWRDRL
FT                   LQDGKDALTEFIDAYQPEDVQQLRQLIKKALDDQMKEKNTGAAKALFRYLRSLIK"
FT   gene            27149..29272
FT                   /locus_tag="lpa_00031"
FT   CDS_pept        27149..29272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00031"
FT                   /product="N6-adenine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00031"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23268"
FT                   /protein_id="ADG23268.1"
FT                   /translation="MNYSLFISCSKGLEYLLEDELKGLGLHVTQVSPQGVYGEASLPVI
FT                   YNLCLWSRLANRIQLILFSGHAAKEQAVHQLCTDFHWQTVFTHDKTIAIEFHGASEQIR
FT                   NTMFGAQIVKDGIVDHFRRLNGSRPSVDKEKPQILIHAHLKNDILTVSFDLVGYSLHQR
FT                   GYRKKAGKAPLKENVAAAMLLRAKWPELAAQGYGLHDPFCGSGTLVIEAAMMAAHIAPG
FT                   LLRQDQSLQYWARHQSSLWEKLRTQALQQVKPLAVKLVGTDADGKIITLARSNAERAGV
FT                   LPLVEFNTLPLNACRPGTKKGLVVCNPPYGERLGEVTQLVPLYQQLGTTLHTCYQGWQA
FT                   AILTSSPVLAKALGLRADKQYTLYNGPLECKLYCLTLSAANKLKNTPNAPLSDNAQMLF
FT                   NRLEKNRNHLQKWARKNQITCYRIYDADLPEYAYAIDIYNDYAVLQEYAPPASIPVHKA
FT                   EKRSLEMLQVVPRALGIHPEKLIVKQRKQQKGSEQYQKIGKTSQRLIVTEGKAKLIVNL
FT                   YDYLDTGLFLDHRLMRLKFAQLEPGTRFLNCFCYTASASVHAALAGALTTNVDLSKTYL
FT                   LWAEDNFRLNDIDLSKHQFLQYDCKEWMKITRDKFDVIFLDPPSFSNSKRMSDILDIQR
FT                   DHVSLINMAMRLLNPNGVLYFSTNLRQFKLEPMLKEKYAVQDITPQTIDQDFKRNSKIH
FT                   HCFKIVMPHFADN"
FT   gene            complement(29342..29884)
FT                   /locus_tag="lpa_00032"
FT   CDS_pept        complement(29342..29884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00032"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00032"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23269"
FT                   /protein_id="ADG23269.1"
FT                   /translation="MKSFIEQAQFYATYHQNPATRYTHMAGVPLIMLSIMIFLGFVKIV
FT                   IPGVYATDLACLATLAALIYYFLLNWQLALALTPILIFLLWLASWFNYDGPTKFGLWVF
FT                   IITFVVGWGLQFYGHFIEGKKPAFMVNFTQALIAPLYLTAELFFMAGLMNSLREQIYGN
FT                   EEVNTEEISKTKTKSKS"
FT   gene            complement(30031..30456)
FT                   /gene="hbp"
FT                   /locus_tag="lpa_00033"
FT   CDS_pept        complement(30031..30456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hbp"
FT                   /locus_tag="lpa_00033"
FT                   /product="hemin binding protein Hbp"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00033"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23270"
FT                   /protein_id="ADG23270.1"
FT                   /translation="MMLKTQLTAFIGAVILAGSSLANPIKPEVCPSVPSIQSEGMSMSS
FT                   EILEGMYITYNLSHYNTSSSWVFIVGPIAAENDDMALAESNKLLSTMSGSPHPEDDGEG
FT                   NWICQYTTKSKDIIAFAIEADDMLSPLKMMRYLRTIR"
FT   gene            complement(30596..31168)
FT                   /locus_tag="lpa_00034"
FT   CDS_pept        complement(30596..31168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00034"
FT                   /product="Rcp"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00034"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23271"
FT                   /db_xref="GOA:D5T5P7"
FT                   /db_xref="InterPro:IPR009746"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/Swiss-Prot:D5T5P7"
FT                   /protein_id="ADG23271.1"
FT                   /translation="MKRLISCLTIICALNASAAAETTSNPCSRWISFLKPVCQRIHQTW
FT                   AEGHDDMYFSGYAWHNRYVYSNEKIKSYNETAWGGGLGKSLFDEKGNWHGLYAIAFLDS
FT                   HRHLEPAVGYAYLKTASVNKDLKAGLGYSVLVTSRVDYDNVPIPGALPWAALFYKRITI
FT                   AATYIPGSSREGHENGNVLYMLGKISL"
FT   gene            31328..32719
FT                   /gene="potE"
FT                   /locus_tag="lpa_00036"
FT   CDS_pept        31328..32719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potE"
FT                   /locus_tag="lpa_00036"
FT                   /product="basic amino acid/polyamine antiporter, APA
FT                   family"
FT                   /note="COG0531, PotE, Amino acid transporters [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00036"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23272"
FT                   /protein_id="ADG23272.1"
FT                   /translation="MDLFRKKDIKGSLDNESHLAKCLSVFDLTFLGVGAIIGAGIFVLT
FT                   GIVAATISGPAVIFSYVVAGFACAFAALSYAELAASIGGCGSAYGYAYAGFGELIAWIV
FT                   GWDLLLEYSIAVSAVSIGWSGYANDFLMALKIFIPANLLHGPADGGDLNILAILIIAVL
FT                   TTLLIVGVKSSSRFNNIMVLVKLLVIFIFIAVAFGEVKVENWSSFMPYGWAGVMKGASI
FT                   IFFAYVGFDAVSTAAEEAINPQRDLPIGIIASLAICTVIYILVSGLLTGIAHYTTLNVS
FT                   SPISHVLLVLGYKTAAGLVGVGAIAGLTTVMLVLFYGLTRVFLAMSRDGLLPRFLSKTN
FT                   EHTKTPIRIILLCGILMASLASVTPIGTLAELVNIGTLFAFIVVCGGVLYLRRTHPDME
FT                   RPFKTPFMPYVPILGIISCFYLILNLPWVTILRFIIWMLVGIAVYFAFSRTNSALSVEG
FT                   DCAAE"
FT   gene            complement(32729..33724)
FT                   /gene="pitA"
FT                   /locus_tag="lpa_00037"
FT   CDS_pept        complement(32729..33724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pitA"
FT                   /locus_tag="lpa_00037"
FT                   /product="inorganic phosphate transporter, PiT family"
FT                   /note="COG0306, PitA, Phosphate/sulphate permeases
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00037"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23273"
FT                   /protein_id="ADG23273.1"
FT                   /translation="MDYNTIFILFVIFIAFVFDFINGFHDAANSIATIVTTGVLTPRQA
FT                   VLWAAFFNFIAFLIFNLTVAQTIGYGLIDTDLVDTYFILAALMGAIFWNLVTWYYGLPS
FT                   SSSHALIGGLAGAAIAKGGLSSLKIAGFAKVAAGIFISPVLGLLIGLLFTHIFSLFLRH
FT                   KNEEELNTLFKSFQLISSALLSITHGGNDAQKTMGIIAVLLFSASWLDGVFYVPFWVVI
FT                   SCHGVISLGTLAGGWRIVHTMGTKITKLNTLKGCAAETGAAITIFAATEFGVPVSTTHT
FT                   VTGSIAGVGLISGIGGAHWKVLRRIFYSWLLTIPAAALVAAAIMTISPTA"
FT   gene            complement(33741..34382)
FT                   /locus_tag="lpa_00038"
FT   CDS_pept        complement(33741..34382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00038"
FT                   /product="ubiquinone biosynthesis monooxygenase Coq7"
FT                   /EC_number="1.14.13.-"
FT                   /note="COG2941, CAT5, Ubiquinone biosynthesis protein COQ7
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00038"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23274"
FT                   /protein_id="ADG23274.1"
FT                   /translation="MRTSSFLDRLIGEVDSALRTLVLPQKRITTRQSPAENLADTVLSA
FT                   QEKKHISGLMRVNHAGEVCAQALYQGQALTARLTHIKEQMASAAAEEVDHLAWCEERLY
FT                   ELGSKPSLLNPIWYCGSVLLGALAGLAGDKISLGFVAETERQVTAHLQRHLHYLPEKDK
FT                   KTIAILKRMQEDEEHHAHTAMEAGAVELPYIIKQLMNAVSKLMTQSSYYI"
FT   gene            34605..37535
FT                   /locus_tag="lpa_00039"
FT   CDS_pept        34605..37535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00039"
FT                   /product="sensory box (GGDEF/EAL domain) regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00039"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23275"
FT                   /protein_id="ADG23275.1"
FT                   /translation="MIDKMRKSKKPHPLNHIASGDNFSHLNLLERSLISQLIELSYEEN
FT                   TLHTLSLSGLELLGKHPLLKDTITAVWHHDGSHINILASNGLKFDAPKELEKFLAVVSD
FT                   WHFLKIYKTKLKKHSEEKLKQRIDICLDKCQGNLFCISFWFDSIDCNFEILMPFFKDIL
FT                   GILNLSLAKLMNKKREKLLTTILEKAGDSVEITNEEAVIQYVNPAFENITLYNAREAIN
FT                   KTVASLLRSPVEDAQLFEEINQTLKSGNTWKGQIRSRKKDGSYWVAQTIIVPVMDDELG
FT                   RITQHIAIKQDITEQVHRFNQLKISEERYRNLMNAVADGIFIHNLQGAFLEVNEAACLS
FT                   LNYSREELINSYVWDIEVGFSQESLNQLWENVQKGPINTEGMHRRKDGTIFPVDVRLAV
FT                   FNATGEKLVLAIVRDITLQKRSEATIRKLTRALEQSPVLVIITDKTGTIEYVNAKVIEQ
FT                   TGYRKEELVGGNTRILRSGQTPHEIYKTMWEHLANGEEWHGELLNKNKSGEHFWVSAII
FT                   SPIRNENEEITHYLAVMEDVTQKKSYEEMLKHQATFDNLTNLPNRLYAVNKLERAISKS
FT                   HINNQKLAVLFLDLDEFKQINDSLGHAIGDLLLKALSERFLSMIRQTDTIARLGGDEFM
FT                   MILENIMQDKDAESIAKKCREICSQPFVIESQELLVSTSIGIAIYPDHGKDAKTLMRNA
FT                   DTAMYQSKIRGKNNWTVFQKTMIDGANNHIRIKTELHQAFTRNELYICYQPIIDLKENK
FT                   VVAAEALLRWQNTTLGQINPDQIISLAEETGMIIPLGYWILDKVCTQAKEWEFITGSKI
FT                   KVAVNISTLQLKQKDFIHKVQLILKRTKLSADSLIFEVTESAFIDDSKFILSQLNKLSD
FT                   IGIHFSLDDFGVGYSFLQYIKSYPFKNLKIDRVFIQGVNTNHNQLSLINSIITMARNLK
FT                   LSVIAEGIETAEQLELMRSMNCDMVQGWYFSKPLSGDKFLFFLMNK"
FT   gene            complement(37635..38525)
FT                   /locus_tag="lpa_00040"
FT   CDS_pept        complement(37635..38525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23276"
FT                   /protein_id="ADG23276.1"
FT                   /translation="MKTEALLSWLNVESNESYDSIRIKYQLRLEALEKEERIKKMGGIN
FT                   PFAPKIPLNNTRIITSKEIQEAWAAIDSLSKYQQFKGLVAQEENLSTIPNKKMDSKREE
FT                   TKLIHFVRERAQGPQGRRLPAHLQAKIKRAPLDKPHSKLITEGVEQQINAILDKTTLSA
FT                   SDLQSAVYTAVQNYTNYHMKSENKNNPKYNRGQGDGFFSFFRHGSFGITTANNLYTSIS
FT                   AKNATLDETIEKLKDFLGDSSRAYHHHSFTSYLADALAEKGLLTSHPASRYKQEDVVNQ
FT                   LDQWIAQNSTVNLLK"
FT   gene            complement(38584..39777)
FT                   /locus_tag="lpa_00041"
FT   CDS_pept        complement(38584..39777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00041"
FT                   /product="leucine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00041"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23277"
FT                   /protein_id="ADG23277.1"
FT                   /translation="MVFKSRLVGVILLCFSSITGWCLSQSPEEDRIIVSNCLYEQLKDK
FT                   ARLIAQSDHFSFIAIPIDENITNTLQKMRPVCGNYLNAEPYIQQTSNRFLDSQKLLDKL
FT                   TSYHSISTANPYPINHEAQVHGLLEQIDPAKIWQTNQHLTSYINRSAKSRTGVEAAQWF
FT                   KQQFDTLAQDYGRKDVESYFVKTGNKFIQPSVVTVIGKDKPGEAIVIGAHIDTLDGNMP
FT                   GADDDSSGISVELEMARVLFSSNFELNRPVYFIAYAAEERGLIGSGYVVQDFLQKKIPV
FT                   KAVMQLDQAGYRANAKDQTIWLLKDYVDKGLTEFTAELLTRYVKIPVGYTKCGYACSDH
FT                   VNWTNEGFKTTYPSATTLDDDNPYVHTSNDTLDILNLEHMVNFTKLGLAFIVELGLN"
FT   gene            complement(39839..40864)
FT                   /locus_tag="lpa_00042"
FT   CDS_pept        complement(39839..40864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00042"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23278"
FT                   /protein_id="ADG23278.1"
FT                   /translation="MGWTDRFWNAYRVVTNTVIEGAANSLNAAGSLACLLGGAGVSLSY
FT                   SMSETIKAGYFGSVGVAGTVNLDVTAVEFNYGFNQTIPFRRDLLEKSGGGSYALNDFAN
FT                   PGTIFMISSLAILSGTTLRTFGANLKKWQQNREDKYHFIAKYSTDLEPPSYKEYLYVNA
FT                   ESFFNSLAIASFSSLLAKNVLDFSIKDLSKYHFTYPFNGTNITGSVKTPDYTGPVTSEF
FT                   FPLDFFVSQNTTIHTDYFNLIVNEKVKANAMTNVTYGGGVHLEPSHQSSAPLLAASATI
FT                   GIGTYLAGTFFGKKILRERDERLQRSRSSSYSIVSGTFWDNKHDIEAKGDTKFEHTHSL
FT                   Q"
FT   gene            41230..41889
FT                   /locus_tag="lpa_00045"
FT   CDS_pept        41230..41889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23279"
FT                   /protein_id="ADG23279.1"
FT                   /translation="MLILMMEYTLVCKNKQYHLAKECVLHSKIYNLYHSSTELGDLKAA
FT                   VVKSSRSSKGNTLYYVDLLTSQGPVNLTGSSSSGRDDKEIAANSINNYISNSLETTFKV
FT                   SYPASWWMYGLSVFFLLVGALLLTVRGAITDFDRILKTIVIKRKGLFKTEETKLSFSDV
FT                   DKIIVEESLGSRGTKTYRLAIALKDKPPIPLVTTYDSSFAKKEKIANQLNQFIHES"
FT   gene            42135..42491
FT                   /locus_tag="lpa_00046"
FT   CDS_pept        42135..42491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00046"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23280"
FT                   /protein_id="ADG23280.1"
FT                   /translation="MSKFFTLLICISIGLLSFPTYAQKTIRLSPNETKTLKNSTLWTLN
FT                   ATCNVQSSTQVNGKIKIIVLKNNGKVNGKSLSTGQGTSITIKNNSSISVSAESGTQINL
FT                   INLGNQELQAVCST"
FT   gene            complement(42554..43276)
FT                   /locus_tag="lpa_00047"
FT   CDS_pept        complement(42554..43276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00047"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23281"
FT                   /protein_id="ADG23281.1"
FT                   /translation="MNYQYSPSLKKKLLLAFTTLFIVQMFYFAPVRASTRDTQLWTLMN
FT                   AIGPINKQHRKIRYWLEIQDRIGENISQLSQLILRPGIGYELLPTTTIWLGYDRIYTAQ
FT                   PFANPPVNENRVWQQLLWSKEYTRLRLTARSRLEERFIQRAIHTAWRYRQLFKTSIFIP
FT                   KHPKYAAVISDEAFFHLNDFNLQRNQGFDQNRLFVGLGYRTSKNSTIEIGYLNQMIKRV
FT                   NNPDYRGDYLSMALLLTE"
FT   gene            complement(43490..44233)
FT                   /gene="hisJ"
FT                   /locus_tag="lpa_00048"
FT   CDS_pept        complement(43490..44233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisJ"
FT                   /locus_tag="lpa_00048"
FT                   /product="arginine transport system substrate-binding
FT                   protein"
FT                   /note="COG0834, HisJ, ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain [Amino
FT                   acid transport and metabolism / Signal transduction
FT                   mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00048"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23282"
FT                   /protein_id="ADG23282.1"
FT                   /translation="MVRLRIYLCSLLLVIPFYSGYALNLVIGTLSYNPPFEIQVNNPSK
FT                   ENEFYGFEIELMNEICKRINAKCQYKPLLFEQILAEINSGAINLGIGSINITPERSERF
FT                   LFSLPYKSSYHQFLIPSNSNIKKIDDLKGKTIGIHLGSPTIDYLKVYFNNNIQFKYYET
FT                   FMDLLNGLTDPQVSAIVTNSDQAQYWASSTPDCKLLGDGFPFGIGFGVVARLDQAELIE
FT                   KINQALIEIENDGTYLKIYNLFFQP"
FT   gene            complement(44395..45912)
FT                   /locus_tag="lpa_00049"
FT   CDS_pept        complement(44395..45912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00049"
FT                   /product="ankyrin repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00049"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23283"
FT                   /protein_id="ADG23283.1"
FT                   /translation="MAATIPHIEAITFTDWFLAIIDTPGIPIDEIETRAAEGFKRKLTE
FT                   RQFQQLTELIHLISFIKHRRFSNPTLALRIYVDENTNSLSRTALVEAVRMLPPEDNKTY
FT                   ELVACLAQKNKLERYTSITKVPPLQIYQGDGVFEQYDEWILLFELFELTQATPSDVIPA
FT                   IAHLLIIKNFGIPDLRALSKFMNTTHKLGILSQNFMNNMIPHLCNGQIIEKYESFLLKL
FT                   QINDLLSEEILDVIYPLLNQPDALDTFFSLYHEELSHDSALSFLREILPPFCAMSLPCK
FT                   ESYDDQVPTNTPLHLAVIESNKANLERTLTFANRNLLKKCSYENTALLLACKLADKEAA
FT                   RLILAKMQELGCDVNQRDHHGMTALHWANFYHFDELIRELEIAGADPQLKAANGKTCEY
FT                   FYQHQFTLKDLKLNGKEIIDGEFKLSDCALTDIAFHMDKVALNLKLTTPSEIAELYARD
FT                   EVAQIRSSNRFYLFFKLFRPKLINWLEQQNDLEPQVTYRFSGQSSSA"
FT   gene            46175..46657
FT                   /locus_tag="lpa_00051"
FT   CDS_pept        46175..46657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00051"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23284"
FT                   /protein_id="ADG23284.1"
FT                   /translation="MKFRFRFYLGIILLILAIVCPLLIPLIVQSNFSVLMKGFLSSILV
FT                   FGLPEVLIVLAIALLGKEVYGLIEQKIKNILFKEKVSRARYRLGLVFFAFPLVIGLLEV
FT                   FVKEITLAYGSYYYWVEIIWTTMFALSFFICGKQFWDKFKSLFIYDSYVVFEKNKK"
FT   gene            complement(46679..47674)
FT                   /locus_tag="lpa_00052"
FT   CDS_pept        complement(46679..47674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00052"
FT                   /product="Predicted membrane-bound metal-dependent
FT                   hydrolase"
FT                   /note="COG1988, Predicted membrane-bound metal-dependent
FT                   hydrolases [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00052"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23285"
FT                   /protein_id="ADG23285.1"
FT                   /translation="MDPITHGVLGAACAQAAFGKFDKRIPWQAGALAGMAPDLDVFIRF
FT                   SQEPLSLEQWHRYLTHSLMFIPIGGLVVALFLLCFSQYRQYWKVTIGASLVGYATHCLL
FT                   DSLTSYGTVLFWPWSDSRISWDIISIIDPVFTLPLLLGTAWSVIYQNQKAVTASLFFCI
FT                   LFLIFNTILHNRAVDGIHQYATSNNFKINHPRALPKLASSTDWRIIAKQQDCLIIAEAK
FT                   TSLFYPTTIRLIRKALSFNESMIPFALSSGQKSDLATFHWFTDGFLIVANKNPLILADA
FT                   RYTIDDSPIFSLWGIEILPGQEHINKLSLPKINEYCKSPDSESYNENGLN"
FT   gene            47908..50094
FT                   /locus_tag="lpa_00056"
FT   CDS_pept        47908..50094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00056"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00056"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23286"
FT                   /protein_id="ADG23286.1"
FT                   /translation="MLFCSFALAQEKVVTHFFKEVNSSIAISEGKANIQASQYRVVDID
FT                   INQLYAELENAPHRDGISTGISLQFELPQPDGTVKRYQVMENSTLAPELSTKFPEIKTY
FT                   DAYGIDNPGELVKFDLTPQGFHAMILSPGRDTVFIDPLIKGNTQYYMIYYKKDFITSKK
FT                   MKCGVKSQNQPLINAASKRGFTDFNPCVLKKYRLALAATAQYTQFHGGTVPQALAAETT
FT                   TVNRVNGIYEIDMAITMQIIANNNLIIYTDPNNQPYTSGDPDKMINENQANIDQMIGSA
FT                   NYDIGHVVDAAGSGLAQTPSVCINGEKAMGVTGQSNPVGDPFDVGYVAHEIGHQFGANH
FT                   VQNNNCQRNNPTAVEPGSGSTIMSYAGICDPNVQDDSDPYFNGISLQEMGNFVSDAAHT
FT                   CPVKTSIPSAPVIQGTNGGVKIPAQTPFALTATATKSGGNEVLTFAWEQQNNEASQQPP
FT                   VSTSRVGPNFRSFSPQVSGTRFFPNLNALANNGPFTWEVLPSVSRTLKFRVTVRRNTPG
FT                   GSCNAYTDTTLSVESKAGPFVVTNPTESGITWTGISPRTVTWDVANTNIPPINARFVNI
FT                   LLSIDGGQTFPFTLLSNVDNTGSEVICVPNLNSSTARIMVQASNGTFFNVSKNNLTIIP
FT                   VPPRPPELTRADRNPMNTSEAFVLYANCIPTGNDVYTVNGLPPGATVRFDANNRRFVIE
FT                   NINTPKRVRNVTITATDENGVNRTSNAITIPSIL"
FT   gene            50107..50808
FT                   /locus_tag="lpa_00057"
FT   CDS_pept        50107..50808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00057"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23287"
FT                   /protein_id="ADG23287.1"
FT                   /translation="MNRYSIFFLVFCAFSLESHAGLYSGINLGINAVKINKDLVYPLED
FT                   PVPTTSSFNSAYTDFHGQLIAGYDFSLTSKISAAVEANIDLFTGKARHRITEWYFDEDV
FT                   YAEEQLKVGYSLFLLPTYHLNDMVQLFVGPGVSSSRFNIAFSNTAGNVGVSDSLNEWLT
FT                   GVSIKAGSITKLTRNIDLLLTYQFTQYNSVTGVQMEPLSEDTLRGSYKPNVNTVLIGFK
FT                   VHPSDEITKDT"
FT   gene            complement(51332..51982)
FT                   /locus_tag="lpa_00058"
FT   CDS_pept        complement(51332..51982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00058"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23288"
FT                   /protein_id="ADG23288.1"
FT                   /translation="MISYLFSEVHFTHALKKVLGISVLVGVYSAIIYFWFEQDNLHSSN
FT                   WLSYSQSVFGIILGLLLVFRSNRAYERWWEARTLWGQLVNASRNLAIKIRVLLSPNTDE
FT                   AKKFSELINTFCEVLAIHLRQKSTRDDFKKFLKMVSLPSHVPSYVAQELYCELSEKTKA
FT                   SKRLNLWLLDNEFSKFMDICGGCERIKNTFISLSFRVFVKHVFIIFILFYLAA"
FT   gene            complement(52159..52395)
FT                   /locus_tag="lpa_00059"
FT   CDS_pept        complement(52159..52395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00059"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23289"
FT                   /protein_id="ADG23289.1"
FT                   /translation="MKRVHHHPATHSHPSNATVQVSNGQQTVVANPNPPYFPGQPPMYH
FT                   PNSFFTTHHHSPYYASQNQHYHQQPAPNTHQHP"
FT   gene            complement(52598..52810)
FT                   /locus_tag="lpa_00060"
FT   CDS_pept        complement(52598..52810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23290"
FT                   /protein_id="ADG23290.1"
FT                   /translation="MKSTNNIQKKETDKPTSEQAQKKEVRTNNAPDFIPGASPYYNLYC
FT                   FFYKLCHGEDTSRQHQPATSFQHGK"
FT   gene            53020..53418
FT                   /locus_tag="lpa_00062"
FT   CDS_pept        53020..53418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00062"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23291"
FT                   /protein_id="ADG23291.1"
FT                   /translation="MNCFPFFAKKNKKNNEEKAEKTLSVFPAGTSINKTTVKEICFTDI
FT                   FCDTHPFVWYYYPEHNLAIWTSRLAGTTQKYPVDYLLNQLAKIPGITIDQGDAAIKDVS
FT                   TFLQDHQMIPIRNSESWRYIKSSSFSMS"
FT   gene            53453..53587
FT                   /locus_tag="lpa_00063"
FT   CDS_pept        53453..53587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00063"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23292"
FT                   /protein_id="ADG23292.1"
FT                   /translation="MEDFAGSVSQVMRKGYSNDFSHLIDCIEPTHNETLESYDHNNIQ"
FT   gene            53617..54279
FT                   /locus_tag="lpa_00064"
FT   CDS_pept        53617..54279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00064"
FT                   /product="chloramphenicol acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00064"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23293"
FT                   /protein_id="ADG23293.1"
FT                   /translation="MKPTDKKHWSKIEYLHQSIKNPNIHIKGKHSYYSDAWTGSFEETV
FT                   VRYLYGDEYSLKTWQPQWQIDQLYIGDYVCIAAEVIILLGGNHNHRADWFCLYPFADKY
FT                   VEAYQGKGDTIIKDGVWLGMRAVIMPGVTIGEGAIVAASSIVTKDVEPYSIVAGNPAKP
FT                   VKKRFAENVIERILALDIYSWSEAKFNLLKDYICSNNIDKLEQASRSYDQNHTIESK"
FT   gene            54276..55154
FT                   /locus_tag="lpa_00065"
FT   CDS_pept        54276..55154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00065"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00065"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23294"
FT                   /protein_id="ADG23294.1"
FT                   /translation="MINIRKLRLGDESTLETFLKSHADESMFLRSNLYHSGLSYHDKPF
FT                   HGDYFAAFDNTKKISGVLAHYWNGNVIVQCPDFNVLTALVGAFQKTATREIAGILGEDQ
FT                   QADVVMKQLQLEHVDYAVNYPDGLYALNLQNLAMPDNQDRYQLKVAKDCDKCLLYEWLR
FT                   AYQIEALGAEEGSSILKEQVESEVKNTLEGNDRWVLEENGIPVSLCGFNARLPDIVQIG
FT                   PVWTPVTLRGRGYARTVVALSLSAAQKSGVSRAVLFTNNQAAVRAYQAIGFNKVGNYRL
FT                   AILKKPILLTR"
FT   gene            55207..56502
FT                   /locus_tag="lpa_00066"
FT   CDS_pept        55207..56502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00066"
FT                   /product="amino acid transporter, permease"
FT                   /note="COG0531, PotE, Amino acid transporters [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00066"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23295"
FT                   /protein_id="ADG23295.1"
FT                   /translation="MDMDIKHKPLKRELSLFGATMMGLGSIVGTGVFVSIGIAAGVTGP
FT                   SVILAIALAALVATCNAFSSAQLAANHAVSGGTYEYGYRYLHPAFGFTAGWMFLCAKSA
FT                   SAATAALGFAGYFIHLSGLETVPVIPIALAVSITLILLVLSGLRRTNTVNIIIVMITLI
FT                   TLTVFIISGLPDFMQRGTANLRPFFPVSKQEGLSHFFYATALMFVAYTGYGRIATLAEE
FT                   VKNPGKFIPAAIIITLMVSAVLYILVGLVAIGAVGVEKLAQVTETNATPLESAAQAIGI
FT                   PGLSILVSIGACTAMLGVLLNLILGLSRVALAMGRKGDLPKMFCYVSETRHVPVSAVIG
FT                   VGVVIIALVLTGSVETTWTFSAFTVLIYYAITNLAALHLPKEEQLYPPLFAIGGLLSCL
FT                   FLAFWVPIGVWITGISLLVLGLLWKVVAHRFL"
FT   gene            complement(56719..56871)
FT                   /locus_tag="lpa_00068"
FT   CDS_pept        complement(56719..56871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00068"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23296"
FT                   /protein_id="ADG23296.1"
FT                   /translation="MFNLKRNLIKLGTLSISIALLAACHTVKGTVTGAKQDIKATGKAI
FT                   SRTMQ"
FT   gene            complement(57146..57628)
FT                   /locus_tag="lpa_00069"
FT   CDS_pept        complement(57146..57628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00069"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23297"
FT                   /protein_id="ADG23297.1"
FT                   /translation="MWLDYLHKINSDPNLLYLFIRTFIIYVFAIFIIRVGNTRYNFETA
FT                   FDYIFVFVIGAVLSRAINGNSTLISAMAGSSLLIFLHWVFAICSFYSHGFGKLVKGKSV
FT                   LLIQDGQLIWSALKRHQVTEEDLRQVFREKLNASDLTTVKEARLERTGRISFITYK"
FT   gene            complement(57841..58734)
FT                   /gene="prpB"
FT                   /locus_tag="lpa_00070"
FT   CDS_pept        complement(57841..58734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpB"
FT                   /locus_tag="lpa_00070"
FT                   /product="methylisocitrate lyase"
FT                   /EC_number="4.1.3.30"
FT                   /note="COG2513, PrpB, PEP phosphonomutase and related
FT                   enzymes [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23298"
FT                   /protein_id="ADG23298.1"
FT                   /translation="MSNFRYSQGKKLREALMKEKPLQVVGTINAYAALQAKRAGFHAIY
FT                   LSGAGVANASYGLPDLGITTLNDVLEDVRRIMSAVDLPLLVDIDTGWGGAFSIARTIKE
FT                   MIKAGAAAVHIEDQVQAKRCGHRPGKALVEKEEMIDRIKAAVDAKTDPDFVIMARTDAL
FT                   ANEGLNKALERISAYIEAGADMIFFEGVRKLEEYQALTEQCNVPVLANITEFGVTPLFT
FT                   LEELKEAGVSLALYPLSAFRAMSAAAEKVYDTIRKNGSQKDILAEMQTREELYQVLNYH
FT                   FYEDKLNELFMKEKTT"
FT   gene            complement(58848..59042)
FT                   /locus_tag="lpa_00072"
FT   CDS_pept        complement(58848..59042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00072"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23299"
FT                   /protein_id="ADG23299.1"
FT                   /translation="MIFAISRYDIRQTSLSLVHDLYAFQALDVVLLCISRSLKKYPKER
FT                   KNQINQTYEKPQDQSKKCF"
FT   gene            complement(59043..59777)
FT                   /locus_tag="lpa_00074"
FT   CDS_pept        complement(59043..59777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00074"
FT                   /product="Transferase enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00074"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23300"
FT                   /protein_id="ADG23300.1"
FT                   /translation="MLNKLMWLTGKAQEDWIEKILHLRQKIWPDYQRIKNDTLFKLYSH
FT                   YPLYQWLSHYNGEVVAVINSLPVALAQSLDNLPQEGLNWVLSHLASTIPLTPSNYLAAV
FT                   SVTVNPAYQRLGLSKLLLNRLKASAQEAQYKALIVPARPSQKENYPLISLEDYLKWKRV
FT                   DNTIFDPWLRVHAQLGGKIAYPCQQSRVITANIAQWEQWFGHPLLQTGQYLVKGGLNPV
FT                   TINKEKDIGIYIEPNVWVIHDL"
FT   gene            complement(59767..60471)
FT                   /locus_tag="lpa_00075"
FT   CDS_pept        complement(59767..60471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23301"
FT                   /protein_id="ADG23301.1"
FT                   /translation="MIREYMDKRNNQFTTEILNYFSDLKKFSTSYLGWLTMEHYQFSLN
FT                   NTRFLMNSHIQTKSLSDPGVSEELLANYNEEKNHAQMYRHALKKIGLDVTNRIPYVATR
FT                   QFFMRLEALIEVNASKTLGVMYATETAAIFEHILFKEISAELCQRKRLDFENSRIKQFH
FT                   DLHLDGVEQAHKDELGKFMDHTLAQEHVDPNIFLQEKEIIDGAYAAIDIMEDWWSGLIN
FT                   AKAHLLEQAHAQ"
FT   gene            60577..61485
FT                   /gene="lysR"
FT                   /locus_tag="lpa_00077"
FT   CDS_pept        60577..61485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="lpa_00077"
FT                   /product="Transcriptional regulator"
FT                   /note="COG0583, LysR, Transcriptional regulator
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00077"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23302"
FT                   /protein_id="ADG23302.1"
FT                   /translation="MINFSQIQVFIAIVESGGFIAAGEKMHRSQPAITNAIKKLESSLG
FT                   FELFDRKVYRPQLTAKGKAFYQKAREVAAQFMQLENSAETLRSGVETQFSIDLDIALPL
FT                   PGYAPLIQSFIRQYPETCFSLSNNTFVRCLERLERRECHLCIAASHIRSPQIEYLRMPS
FT                   IRMIPVASRDYYDQHKERINNPKLGIYCMQIMIAGTQQELYQLKIEPLSNSMPKWFVGD
FT                   MYIRKQLILSGMGIGRLPDHLVEKELAEGSLVQLNTRDYVAVTMDIYAMRLNNQEHGIV
FT                   SNYAWQSLKSYADDTVSPELK"
FT   gene            61630..62367
FT                   /locus_tag="lpa_00079"
FT   CDS_pept        61630..62367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00079"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23303"
FT                   /protein_id="ADG23303.1"
FT                   /translation="MIDFKINSQPNDESCGPTCLHAIYQHYGLDISYEEVASQVESFLS
FT                   GGTIAPMLGKHALQLGFKVTLYVNNLHLYDPTWFNSDGSSNTDVLREMLMQQMRYKRNQ
FT                   YLARGTHAILDFLTLGGAIYFRCLTAEILKEYFARKIPILTGLSSTYLYNCSREIFNKE
FT                   GKSRSDPIRGLPCGHFVVLCGYNQKHRLVVVADPYKKNPVSGDNYYTVSIHRLINAIML
FT                   GVVTRDGNLLIIEPKYAQASSKF"
FT   gene            62504..63502
FT                   /locus_tag="lpa_00080"
FT   CDS_pept        62504..63502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23304"
FT                   /protein_id="ADG23304.1"
FT                   /translation="MSVIIDSLKNSDVPHLYLLKVGLTKKEYNNTSRMSRDEKRQLVNN
FT                   IIAKAYHEEILKIINDLMDIELSIESTDPIRTGNRLIGQLLLGYITKIDQQNFMSFYDQ
FT                   TIKNGNKTLGDYLIPEQVKQIWATIKQTAAKYFSLNQRGADYQAFLNKGFRILPIFYYQ
FT                   QQFPEITPEQYRQGIRPVELTREPEEIKNAFHNNLSANVTIPAFPEANYLKTRLAEIKT
FT                   HIMASEWKLANYSFYSDGVMHGDKRLPHRVKDILDVIEKFESSKLNAKAAYEQIVVKAK
FT                   EALDYPRSGRFSETTDFYQDIYSHHILRDDYQFNHSRELTNSHGPSFNLNR"
FT   gene            64187..65434
FT                   /locus_tag="lpa_00081"
FT   CDS_pept        64187..65434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00081"
FT                   /product="SdbB protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00081"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23305"
FT                   /protein_id="ADG23305.1"
FT                   /translation="MTRSKESKTENSSFFQNHLKLSVAKLLFSEGVGDWYKKKGYGAQD
FT                   TDKDFLAPFADFLKQQKTNPEATYYNAFQNLKLTLNRVPSQLVSRDSCELEVLTCEPEA
FT                   DSPQKTGTGKHIVYFPGANTYYQACFRDISAAAKETGATVHALNYPGIGMSTGEVVEAN
FT                   DLTNAGIAVVLSLLNQGVKPDDIVLQGDCFGASVALEVKNEIEKQADIKVRLIMNNAFK
FT                   SFKAAVSDLIDRSPLIPSVSKSIVKNLLEFTGWNVAPGQKYIHSDPYQCYIQHEGDQTL
FT                   TTATLSSKVAKYKEEIRTGRTTSRSRDPVIDKCPEEYKPFRDFLDENCFVRVRDSAKER
FT                   LAAKFGVDSCGEVNAHFADLCELEMLGGQSVYEGFVNNYLVMSDKYIKAHPQKDYDPDK
FT                   INFLSSNPMGYTPKSS"
FT   gene            complement(65492..65680)
FT                   /locus_tag="lpa_00082"
FT   CDS_pept        complement(65492..65680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00082"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23306"
FT                   /protein_id="ADG23306.1"
FT                   /translation="MQLTFLANQTLKLDQHLKHVNAYTKEAVSVLIHRVETELEETILF
FT                   PNCGMFGWYYPLTGFYQ"
FT   gene            complement(65740..66144)
FT                   /locus_tag="lpa_00083"
FT   CDS_pept        complement(65740..66144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00083"
FT                   /product="putative regulator, MerR family transcription
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00083"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23307"
FT                   /protein_id="ADG23307.1"
FT                   /translation="MNNKKIGEFAKLCGVGIETVRYYQRQGLLHVPLLNKELGAEKIRR
FT                   YGDDDINRLRFILLAKKAGFTLKEIKELLEFDANNDRERVRDMAERRIEKLNLKINELT
FT                   EARNRLSLLVTKCIETSSSPCPILMTFEKS"
FT   gene            66214..66957
FT                   /locus_tag="lpa_00084"
FT   CDS_pept        66214..66957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00084"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23308"
FT                   /protein_id="ADG23308.1"
FT                   /translation="MNHTSIKKAVLYRMVIEHHVCPYGLKARDLLRRQGYEVEDNWLTT
FT                   REQVDAFKDKHNVKTTPQIFINDERIGGYDDLRHYLGKKVRDPKEKSYRPVIVLFAITA
FT                   LMAMAVSYASFANPFTPHVLSWFIAFSMAVLALLKLQNIESFSTMFLNYDLLAKRWVPY
FT                   SYIYPFAEGLAGILMIAGALNWLSIPIALFIGTVGALSVFKAVYIDKRELKCACVGGDS
FT                   NVPLGFISLTENLMMIGMALFMLLM"
FT   gene            67156..67980
FT                   /locus_tag="lpa_00085"
FT   CDS_pept        67156..67980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23309"
FT                   /protein_id="ADG23309.1"
FT                   /translation="MSKEIKKNLQNNNSAFVYLRSTGLATNSLSSILQYMTRIIVLTES
FT                   AGIALGILGVLFSVIGFVSSTIARIFDPTASKLSRVMSAGILIAAAAGAIPLIYLGTLF
FT                   PAMWVYLGIGIMGFGVLNSSYYLYSDVRKENALINQYKDNPEQYVESIKEKRQAKYEKL
FT                   LNTRLDDKQARVLLVFKLYQLDKKLAVAKQEGLARLYDIVCHRKHTRSLERFIDLGTSL
FT                   TSLIVGVSVLFWGIAAWPIGPILLGISLAVFSVSLSKSAIQFYRKLIKTMRF"
FT   gene            complement(68252..68560)
FT                   /locus_tag="lpa_00086"
FT   CDS_pept        complement(68252..68560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00086"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23310"
FT                   /protein_id="ADG23310.1"
FT                   /translation="MGEVRMDLYLKTQRWLYHRGNREVKKRILDEFCKTHGYHRKAAAR
FT                   LLRQLPIPDKKTKKQVKRKLMTRTYYWSCLKRFGLPGIRFVAHCGVNSKGSGTLIGL"
FT   gene            68700..69194
FT                   /locus_tag="lpa_00087"
FT   CDS_pept        68700..69194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00087"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23311"
FT                   /protein_id="ADG23311.1"
FT                   /translation="MKAFNVPKSMETLFSKAQAYVQDYFQNLKIDPSKGTIDINGERYI
FT                   LVRAASMSIEFFETVKKLYENDASKSEEVVFQLLFDISHSIGKQDAKKFHKQLSLKDPI
FT                   EKLSAGPPHFAFSGWAFVDILPESKPTPDENFYLVYNHSYSFESSAWLKANKKINFLFA
FT                   S"
FT   gene            69286..69447
FT                   /locus_tag="lpa_00088"
FT   CDS_pept        69286..69447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00088"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23312"
FT                   /protein_id="ADG23312.1"
FT                   /translation="MSADPHHFKYMHNMHEWCSKSVEPYFNFLQNIPINQFPWLISKLK
FT                   KKESSECK"
FT   gene            69449..70990
FT                   /locus_tag="lpa_00089"
FT   CDS_pept        69449..70990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00089"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23313"
FT                   /protein_id="ADG23313.1"
FT                   /translation="MNKLPKWALAEKKEFKREKIQSLLIVPMEKENSLVGFMGFDIVTH
FT                   KKQWLAEDIFMLSTVADIVIQSILKSYTIIEHESIVRYFDPLTRLPNKELFVNYLQAVL
FT                   SNIEQQENCFSFLILLNIDEFHIINDAYGTPFGDQLLFIIAEKLLHILPYKAKLCRLEA
FT                   DRFLILLQGNKAEILKIADEILSMFNHVFKLNNHQVYLQARIGVTKIDNHSDNPEKLIQ
FT                   RASLAMRKARLDNIKIAIFESNTEKSVNLKLNIQAELYQAITENQLVLHYQPQFCAKTK
FT                   QIVALEALLRWMHPKKGLLYPSEFLDVLLCSDLLLPAGEWVLKTVCAQNVAWIKQGLRP
FT                   VSIAVNISEPQFRQPNFVPMLKKILTKTHMDPCLLKLEVTEQVMIDHLDETARKLHEIE
FT                   AHNIQIILDDFGTGYASLSYLHQLPISKLKIDKSFIKNMLTNKNAAMITKTIILLAKGL
FT                   GIKSLAEGVETKEQFDILKQLGCDEIQGYYFSEPLPVEKIALFLQDGSTPNKGAF"
FT   gene            71043..71504
FT                   /locus_tag="lpa_00090"
FT   CDS_pept        71043..71504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23314"
FT                   /protein_id="ADG23314.1"
FT                   /translation="MPQKDCILNLPGYSIKKVGGENPVKRLSQTRAWYRVERRQSFIKA
FT                   HERSVENALIIHVRDFLIELGQGFAFVGSQVLLTFDDQLRKPGNNQTIGILLCKSKNKV
FT                   MAEYALRNISAPIGVSEYTLSKSIPTDLKGSLLTIEEIEAELNESVKED"
FT   gene            71847..72029
FT                   /locus_tag="lpa_00093"
FT   CDS_pept        71847..72029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00093"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23315"
FT                   /protein_id="ADG23315.1"
FT                   /translation="MSILIKFESLAKQAIFSSNKDIILQSIGLLDTIKAKNNQKIRMTL
FT                   SNSSEQFADMSRVVR"
FT   gene            72137..72808
FT                   /locus_tag="lpa_00094"
FT   CDS_pept        72137..72808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00094"
FT                   /product="methylase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00094"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23316"
FT                   /protein_id="ADG23316.1"
FT                   /translation="MYLVNEPITKQWIERYSKLSESLDPIYFAENDRQISYDKIRDKIL
FT                   TELETHNFITVVLYGHPTVFADPGLQSIIIAQKKSIETIVLPGISVENCLYADLKIDPG
FT                   QFGCFHVEATELLLYDKIIDPTVHLCIWQPGMIGNRSVPKPNQKSNHLELLRIKLKKYY
FT                   PDDHISILYEASMYPGVEPIIHKFPLYDIEDQNIGTLSTLYIPPLPQRKPNLDILKQIT
FT                   S"
FT   gene            72838..74016
FT                   /locus_tag="lpa_00095"
FT   CDS_pept        72838..74016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00095"
FT                   /product="multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23317"
FT                   /protein_id="ADG23317.1"
FT                   /translation="MLSVLSYRLSLLPKLSKTCYLLLLFSFLECVAGGIAYYLSLYLGT
FT                   STPLTKLQIGQVGSIVGFGALAGALCSTYITDKLNNKNIIIASFLFLGLGFFCLPQSMS
FT                   VLLISGCVFIIGFATSIFLTTNNTLLLQNAPQDQNSLRFIQSMKIVSENLGNSFSILLI
FT                   MFFAAQYYGQIFETIGLFFFLFALNTMKYLNVKQNSLEDSSYEEKETNQQGNNKRLYVT
FT                   ISAVFIVGIIYSQQRIAYPLFLHETFSSFTITAILFWLDPIIVSLFQIKITKIVSPLKI
FT                   SYQLAMGGLLLGTGLFALLIVDSIGGAIMACLTFILGEMLFMPTSFVRCYESAGNKRKG
FT                   MVAGAWRSAYSSGLIVGPFLSGFLMEYYSYNACWILAGILGFFLFILFSVKK"
FT   gene            complement(74017..75288)
FT                   /locus_tag="lpa_00097"
FT   CDS_pept        complement(74017..75288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00097"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23318"
FT                   /protein_id="ADG23318.1"
FT                   /translation="MKTINPVFFELVDKLSPDNKFAMYLVDYGYGDLVGDDDGIFLPTK
FT                   TGQYVRLDSEYTPPSMLNDLAYGLSNSPLGMFFNKSFEWFLNTSDEQINRTFPIYIDPP
FT                   GTFFSIGHIINYGYTATHLPNGVLFVTAGSKSNFMIPKIGCGIMHSRIQKNHNITKSAP
FT                   RSYHEHADIFQDIVKGNRDNNGWSASVLYFSENWIEKISKDSAWQEVRDYFYRISNHRS
FT                   EYAVNSDYYNHVYRVTNKRNNLKSNLLIYETARHLFEILLGAKLGFAPAMDDELLPLSI
FT                   IQEVYSECYKLEYLPIIAIPAYYNYRDPKPVYYSLQYPSLCSYSPKARNASTTLSDLIA
FT                   LIDVVHKYQKDFTLPIRECKNTILEEVSKITSFNFYHPATEENSIIKSPEIIPYQDERF
FT                   RGEKRFPINASFFKGCVSIFSNSI"
FT   gene            75530..76720
FT                   /locus_tag="lpa_00098"
FT   CDS_pept        75530..76720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00098"
FT                   /product="3-deoxy-7-phosphoheptulonate synthase"
FT                   /EC_number="2.5.1.54"
FT                   /note="COG3200, AroG, 3-deoxy-D-arabino-heptulosonate
FT                   7-phosphate (DAHP) synthase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00098"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23319"
FT                   /protein_id="ADG23319.1"
FT                   /translation="MFKSVQQRTIQNGQVIPFYHSTNELAHIQNILQSQTPLVSLKEIN
FT                   KFRQLIARASAGEYFLIQSGDCADNFYECDKDTTHAKLDFIRHLATFFHQKTGCSVIQV
FT                   GRIAGQYAKPRSNQYEICQNKRIYSYFGDMINQSQETQRRPDPWRILLSYNCSASIYRK
FT                   INQWNRGINPEQKIYTSQEAFLFNYEQSLIRWDERTGLYYNLSTHFPWLGKRIVSSLQH
FT                   INHLKKIANPIAVKIGPDTPIKSLVKTINELDPSYIPGRITLIPELGAQNVYHILPQLI
FT                   DAVKRTDRTVLWSCDPMHGNTETLSSGIKIRKLSNIVDEIKNSFFIHRKMGSQLNAIHL
FT                   EATHQNVTECMDYNSSRCESISDLKKNYKSLLDPRLNYAQTMHVIQCVAKHYVNSY"
FT   gene            76825..77751
FT                   /locus_tag="lpa_00101"
FT   CDS_pept        76825..77751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00101"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23320"
FT                   /protein_id="ADG23320.1"
FT                   /translation="MNSLKNEYYIRAPKEKDFQNYNGKELKKIHLFMNKIYHQILFGDK
FT                   PIDNKVFHEFKKYESSWMANEKNYFLTKYDCNVIVKDESLVRDVLQKHEVFNHPIFDYL
FT                   MHDASIEDLKKFAYSESIMNLEFFDYLALAVIGVSDQAKVEIMANLWDEAGQGCAEKFH
FT                   TVLFQNFLNDLGITYDRKQILEGLSWEGVAGINLFNYFSIYPFNKTKYFGMLAATEMLD
FT                   PPHYNKLIKGIMRIFSSHNIDYSYYTEHELVDAHHASGWLNHVVIPELARKPYKTQDFW
FT                   LGFYMRLDSTKKYYDQLLNSLIMKKAA"
FT   gene            77760..78578
FT                   /locus_tag="lpa_00102"
FT   CDS_pept        77760..78578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00102"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00102"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23321"
FT                   /protein_id="ADG23321.1"
FT                   /translation="MCYMLVSNEKVIAEEWEKYAGYTVRPLPSTCAYYKDLIQSNSNKD
FT                   SFLIYGGTPEIRSLFQESNLKVTLTDQSELIVRAMGYLTMGAAPIAANEELVVTNWLNL
FT                   EGIANDSCDFLIGDDAINMVEWTQFDLFLSNANRVLKSNGLFICHLLVKPQECFITNTI
FT                   DDVRREYKEGVIRTKYDLASRLNFICYDTNSYAMGWQNTIEQLGINQLDQFKPSFDFVG
FT                   TFGRCNSKFYCPPQDAFERLLTNYFHIEEVFYPHEYEYCQFEPVYVLRKK"
FT   gene            78595..79899
FT                   /locus_tag="lpa_00104"
FT   CDS_pept        78595..79899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00104"
FT                   /product="phosphoribosylglycinamide synthetase ATP-grasp
FT                   (A) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00104"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23322"
FT                   /protein_id="ADG23322.1"
FT                   /translation="MSIHLINYTTQPEFIKLIVQEYKNFDLTKKTILFIEPYGAVLSLL
FT                   KRGLEKKYNIIVLTANSDFRVVPEEFLNQAALNINIDTANNNSVLELAGTLQQHMSIDA
FT                   AIPGFEYFVPIASRVSALLKVPGIDCKHVLNLRRKDLMRTALNKAGLNSPRYYLVTSLD
FT                   DINEAVDYIGFPAICKPIDAAGSVHVKKVKNKKELLEAANRILNGNDVLWGHKLSSSLL
FT                   LEEYIDGKEYSLEGTVQDGVIAHFSTTEKFVSDQSEFIEIGHIVNAPIEQQLHTKIQNY
FT                   IDQVIKILGADNCPFHAEVRLRRDGEPVLMEIAARLAGDKIGDLLCLSRGINYFDYVYA
FT                   AYLGIKMPLVEMKNNYAGIRFFYRPHTDMFAIVTGMDAAKMQAIEDIAIYYNAHVAIPE
FT                   FPKPLRRLGHVIAKSDDYNKLSKMLHDIDSDIHFN"
FT   gene            79920..80510
FT                   /locus_tag="lpa_00105"
FT   CDS_pept        79920..80510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00105"
FT                   /product="YdeN-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23323"
FT                   /protein_id="ADG23323.1"
FT                   /translation="MSQSNVIIVHGAYGHPFENWFNWMKTELESLGIECFVPQLPTPDG
FT                   QELKNWLHVFNSTVSPMITHDTILIGHSLGSAFLLRWLEQANQSVFSTILAGPFIGAVG
FT                   IQKFDKINESFFENGFDWHSIINKSKQFFCYHGSNDPYISRSNFNFIANNLQARKIIIS
FT                   QGGHLNEAAGFSSFPQLLIQLKLLLGINYGKFI"
FT   gene            80494..81441
FT                   /locus_tag="lpa_00106"
FT   CDS_pept        80494..81441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00106"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00106"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23324"
FT                   /protein_id="ADG23324.1"
FT                   /translation="MANLFSFLFLGTLGWGISLYLMKILLVSLTPTEIVLYRMAIGAAS
FT                   LFILAKLFKLKTDNIRGLILDGIIVGTFNMTLPFYLTTYAVKTVSSSLASVINGLTPLC
FT                   TLILGMVFFSSKQKLSVLNLLSIVLGFIGIIIINSDVSIYQGSAVEFIALLATTISYGV
FT                   TANYFKYHARTKDPILVSAVSAFVSAITMLIFKCATESSINYWGIPQDMHQIIALLWLG
FT                   VIGSGFCLYLYCSLIQNAGAVFASMITYLMTITGVIMGMIFLHETISHQVMIGCIFIFF
FT                   SLILVNHAPLLEKILVSISRQISLKSARRYELNQ"
FT   gene            81541..81918
FT                   /locus_tag="lpa_00107"
FT   CDS_pept        81541..81918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00107"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23325"
FT                   /protein_id="ADG23325.1"
FT                   /translation="MPRKDIILNLPGYSIVKVTGNNPAYIQVSYNRVVRCIYCNEKRLR
FT                   KKDSFERKIRHESIGLRYSYLIIKSHKFQCYGCKRYFNQRFPGIGKYQRATEVLRKEVF
FT                   HHHTEGVSQKNLRVYLNFAKT"
FT   gene            82149..83372
FT                   /locus_tag="lpa_00108"
FT   CDS_pept        82149..83372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00108"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23326"
FT                   /protein_id="ADG23326.1"
FT                   /translation="MKNFTDTYIRNLKAKEKRYEEFEGGGFGIRITPNNVKTWIYRYKI
FT                   NGVTTKFTLGHYPAMSLSNAKRRFLELSQMRREGVDPKTVIQAQEEQDNNTVDKLALNW
FT                   YTNYIEKHVKRPLVIKRQIDNDIIPLLGKKKLDDVQTKDISDALDTIVKRGARILANRT
FT                   LSSIKQMFNYAVSRGYTQFNPASNIRSRDIGGIEKPKERVLTLEEIKALWLFLDSDLTQ
FT                   MSTQTRIAIKLLLLTGVRTVELRLASWHEIDFEASLWTIPALHSKASIIHKVHLSKLAK
FT                   SLFLQLKPLSHSDYVLTGVDGFHPITENALPRAIKRIQEKLGIPDWTAHDLRRTFATQL
FT                   GETLQIDPVVIEKCLGHKMPRIMATYNRNEMLPQRREALERWAVCIENMMQDNVVYINK
FT                   LLQNERSL"
FT   gene            83456..83779
FT                   /locus_tag="lpa_00109"
FT   CDS_pept        83456..83779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00109"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23327"
FT                   /protein_id="ADG23327.1"
FT                   /translation="MSWIVEFYNESVEEAILTMPPKIQARMIKLLELIETHGANLGPPH
FT                   TEAMGDGLFEIRAKAQEGIGRSLYCYMKGKHIVVLHAFVKKSAKTPKPDLQLALKRKRE
FT                   VEK"
FT   gene            83776..84060
FT                   /locus_tag="lpa_00110"
FT   CDS_pept        83776..84060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23328"
FT                   /protein_id="ADG23328.1"
FT                   /translation="MMKLKTLKAKALKNPEVKEAYDALESEFALIDALLTMRQKAGLTQ
FT                   EELAERMGTKKGNISRLEKGNTNPSWNTLEKYAHACGFDISMAVKRIAS"
FT   gene            84242..85057
FT                   /locus_tag="lpa_00111"
FT   CDS_pept        84242..85057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00111"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23329"
FT                   /protein_id="ADG23329.1"
FT                   /translation="MILRMISLSFLFANAHELAALLELPYIQRVLYLMGIRPYMDRQSC
FT                   IVGIKRRISYQSLRETLYVGPIAGVKTGSPSLQQMKRAVKSLERAGLIEIQSTERHLIV
FT                   KCIYAELDNPAQKKAVLKPNLYPDTNPTQEDTLESGESCNFRQKPNIANSTEADPPQKS
FT                   EDYNYIYMCSKFEKFWKSYPHPLDREAAFYQFRELNPDDKLFEKIMARLHGQIESYNFQ
FT                   VMMGVWVPTWKYPANWLARKCWQTNPYVFEHSSPIVQDCDNQQVGIQED"
FT   gene            complement(85832..87244)
FT                   /locus_tag="lpa_00112"
FT   CDS_pept        complement(85832..87244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00112"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23330"
FT                   /protein_id="ADG23330.1"
FT                   /translation="MKSKKILILGLSITLTAITSASYAKKIFPSDIIGRDLNYPGMGWL
FT                   GHVGIATRPMMDSSGMSTPANQVIEILNEPVIGQINTIDNFKRRSPYWGSKYGVIGNPE
FT                   QGYRVLVEANHQRWWVREYTSNTDYRIAQGNPRTGEIFVTGRWRCDTYAWWAFYSQGVD
FT                   TMPGRIWLPRNLFNFFPYYNDERLVAESSEPSAEILTNKSLDDVSAEDLNEMSLEEFQT
FT                   VIDAPLKAPTNYVAPMSAYMRFAYSDSLNDIKRGAMIDKITSKVSDVDLVPKLLRLYDE
FT                   TDREEVKNKIVSGLMFHVQGELREHPNSRDKELLRSFFHRLIGEKLNQRCADWATMGFI
FT                   DTHTADETLQNLDKIDAQLATATHPASITLKYKLVHKSKKLQSIYIKSIVDELREANNS
FT                   DLDSYFFGPLAIGYQGTGKNLLEPESKQIVINYLDEVRYKYTSKGIKANPSDFHRGTTA
FT                   PYYFELLKHMDN"
FT   gene            complement(87275..87883)
FT                   /locus_tag="lpa_00113"
FT   CDS_pept        complement(87275..87883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00113"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23331"
FT                   /protein_id="ADG23331.1"
FT                   /translation="MDASKGNNHLKSLNKYSWFILVMFIFAVFAMSYQTTNTFFDGFIQ
FT                   TLPLIIVFVFWSEKSARLIKQAESNLKRAELFNRDTFILSFSFLLGCLISLLFAYDNSD
FT                   VKGWWVLIIYFITLYGLIFSLIFSGIALQIKNHKTYTLVFSLLIIVFVSMGKFFPRYTF
FT                   IPLLGYIDTFYAVTCVLLIIHCLFAFNCKIIRTIKRNTP"
FT   gene            complement(87996..88068)
FT                   /locus_tag="lpa_05000"
FT   tRNA            complement(87996..88068)
FT                   /locus_tag="lpa_05000"
FT                   /product="tRNA-Asn"
FT   gene            complement(88128..89306)
FT                   /locus_tag="lpa_00114"
FT   CDS_pept        complement(88128..89306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00114"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="COG0436, Aspartate/tyrosine/aromatic
FT                   aminotransferase [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00114"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23332"
FT                   /protein_id="ADG23332.1"
FT                   /translation="MDIALAKRVQKVKPSPTLAVAAKAAQMKAQGLDIIGLGTGEPDFD
FT                   TPQHIKLAAISAIEAGDTKYTAVDGIVELKEAVKNKFKRDNELDYQLNQILVSVGGKQS
FT                   CYNLCQAYLNPGDEVIIPAPYWVSYPDMVLLADGVPVIIETTPAQRYKINAQQLEQAIT
FT                   PKTRMIFLNSPSNPSGIAYTQNELKELGDVLKKHPQILIATDDMYEHIIWSQPFTNILN
FT                   ACPELYDRTIVLNGVSKAYAMTGWRIGYAAGPAPLINAMKTIQSQSTSNPCSIAQRAAV
FT                   AALNGSNESIEEMVNAFHQRHDYVADRLQSIDGIEVIPADGTFYIFPSVQAIIEKRGYA
FT                   NDIEFSEKLLNEVGVALVPGSAFGTEGCIRISFATGIDTLKDALNRLQRFCS"
FT   gene            89353..91344
FT                   /gene="uvrB"
FT                   /locus_tag="lpa_00115"
FT   CDS_pept        89353..91344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="lpa_00115"
FT                   /product="excinuclease ABC subunit B"
FT                   /note="COG0556, UvrB, Helicase subunit of the DNA excision
FT                   repair complex [DNA replication, recombination, and
FT                   repair]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23333"
FT                   /protein_id="ADG23333.1"
FT                   /translation="MKDLFKIYSNYQPAGDQPTAIASLIDGLESGLAKQTLLGVTGSGK
FT                   TFTIAHVIQAMKRPTLIMAPNKTLAAQLYGEFKAFFPDNAVEYFVSYYDYYQPEAYVPA
FT                   SDTFIEKDASINEHIEQMRLSATKALIERKDAIIVATVSAIYGLGDPDSYLRMLLHLSR
FT                   GEQSDQRKILKRLAEMQYTRTNLSLERGQFRVHGDVIDIFPADSEKEAIRIELFDDEVD
FT                   NIARFDPLTGEILQRLPRVTIFPKTHYVTPRERILETVEKVKAELQERLAELNAQNKLV
FT                   EAQRLEQRTCFDIEMMLELGYCSGIENYSRYLSNREAGEAPPTLFDYLPPDALLIIDES
FT                   HVTVPQIGGMYRGDRARKETLVNYGFRLPSALDNRPLRFEEFEERSPQTIYISATPGPY
FT                   EQEHSDNVAEQVVRPTGLIDPEVEIRPVKTQVDDLMSEIRQVIAQGSRILVTTLTKRMA
FT                   EDLTEYLSEHGIKVRYLHSDVDTVERMEIIRDLRLGEFDVLVGINLLREGLDMPEVALV
FT                   AILDADKEGFLRSERSLIQTIGRAARNVKGRAILYADTMTGSMQRALMETERRREKQKA
FT                   FNLKHGITPKGINKSVEDILEGAYIGKRKTMVAEQAPRYTHWSPQELAKQINALEKQMY
FT                   AHAQNMEFELAAKIRDEYLLLKEQLMKI"
FT   gene            91699..93312
FT                   /locus_tag="lpa_00116"
FT   CDS_pept        91699..93312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00116"
FT                   /product="diguanylate cyclase/phosphodiesterase domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00116"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23334"
FT                   /protein_id="ADG23334.1"
FT                   /translation="MNIKSNLAYSSVILKGHVNRYAFLGLLISVGSILIASCIVSYQLT
FT                   GSVSLGGFIQAQRTNPAIWILDLTPFMFVYWGQAFCYGLVNKAESLLVDKTKELLNISG
FT                   NLELKLKYESNHDSLTNLPNNRLLNEKIRLAIEQLGLQGELAVIVIKINDLNYNFSSFN
FT                   ANNIVKQFAEKLKSILIDPYMLKASLGINMVARLQSDEFAILMPRLKKDLDINELLIHL
FT                   LTLLNNNLMVDGISINVTSTVGAAIYPAHGEEDDVLVNHAIIAVYQARKENKSYAIYSP
FT                   EMEEDLIQNRIVMNELQRSIENKDLKIYYQPIVELANGQIVGAESSARFEHPELGLLSA
FT                   EKFMPLIEGTSLIHNLTTLMLKEVIKQLAAWHDAGHKIFVSVNLSVHHELPELIEKLLN
FT                   DYEIAPEFLKLEFTERACLTEQMVTKEVFDRLSTMGIKLCIDDFCSENSSFIHLTNFPI
FT                   ENIKIEKSFVLKIAKDAKKAKIVEAIVKLAQTLGWEPLADGIADQNALEKLRDLGCLYG
FT                   QGLYFSRAVNVAEFTSLLKK"
FT   gene            complement(93403..94974)
FT                   /locus_tag="lpa_00117"
FT   CDS_pept        complement(93403..94974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00117"
FT                   /product="glutamate synthase (NADPH)"
FT                   /EC_number="1.4.1.13"
FT                   /note="COG0069, GltB, Glutamate synthase domain 2 [Amino
FT                   acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00117"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23335"
FT                   /protein_id="ADG23335.1"
FT                   /translation="MRRQWYIGFGVILLCLFALFAMLQDIVWFFAFLIPIVILWIYDVL
FT                   QTKHTILRNFPVLGHVRYFLEFLRPEIQQYFIATDESELPFNRETRSMIYQRAKNVRDT
FT                   IPFGTERDILSVGYTWALHSLSPKHSSEVEPRIDVGGPDCKKPYNASRLNISAMSFGSL
FT                   SSNAIMALNKGAKLGGFYHNTGEGGLSPYHLQGGDIVFQIGTAYFGCRDDKGNFDENEF
FT                   IKEASRDEVKMIEIKLSQGAKPSHGGILPAAKLTEEIAKVRKVPMGKDVLSPIAHTAFD
FT                   NPVGLLHFVKRLRDLSGGKPVGFKLCLGRRHEFMAICKAMLKTNILPDFITIDGAEGGT
FT                   GAAPVEYTNFIGTPLEAGLVFVHNALVGTGVRDKIRVICSGKVTNGFDLLTNIALGADI
FT                   CNSARAMMMAIGCIQSKQCNANTCPTGVATQKKRLQYGLVVDEKKFLVANFHNNTIKSF
FT                   LEMVGALGLNNPSDLKPSHIMRRIGVDEVKSFDQIYTYVKLGQFLQGDIPDDYRIHWEY
FT                   ADPDKF"
FT   gene            complement(95052..95366)
FT                   /locus_tag="lpa_00118"
FT   CDS_pept        complement(95052..95366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00118"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23336"
FT                   /protein_id="ADG23336.1"
FT                   /translation="MTNIKLCKIKLLNKIYEIKCPDGEEVSLILAAEKLNEKMQNNKNK
FT                   FKHLDNFHILLLAALDIGHELIVCKNEQEQQRLQVTQFISSLENKINKAVVGSETDSNQ
FT                   "
FT   gene            95522..96103
FT                   /locus_tag="lpa_00119"
FT   CDS_pept        95522..96103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00119"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23337"
FT                   /protein_id="ADG23337.1"
FT                   /translation="MSLDNDSLHLPKYDDFVQSISVLALTMSGSELHGIMCGYLCAGAD
FT                   SQGEAYIRALLNNKKDEQSRNALLSMFSVFSISQQQMNNFDFEFEMLLPDDDESLVTRA
FT                   QAFSEWCEGFTQGLTIAGVGMEQFYEEESQDALQHLIEFAELDCESLEVGEEDERALME
FT                   VSEYTRMAVLRLHSDLVLHERELGDSGTTH"
FT   gene            96208..97518
FT                   /locus_tag="lpa_00120"
FT   CDS_pept        96208..97518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23338"
FT                   /protein_id="ADG23338.1"
FT                   /translation="MISQQEYKARRKKLAAQLPDDSVAVIPAAHEVLRSGDTHYRFRQD
FT                   SDFYYLTGFNEPDALLVIIAGKDSQSILFNRPRNPAEEQWTGKRLGQDGALQELGVQAA
FT                   YPLSSIAEELPKLFSGKSAIYYDLGRNLSLEKKIRHVLSSLKAQVRRGIKAPESLCDLE
FT                   PILSEMRLLKSDAELELMRQAARISVAAHKRAMQVCQKMEYEYQLEAELIYEFSRHGCR
FT                   SVAYDPIVGGGANACILHYTENNKPLRRGDLVLIDAGGEYGSYAADITRTFPVSGTFSP
FT                   EQKIIYELVLKAQKAGIAAIEPGLPWNHIQQTIIRILTEGLCDIGILKGDLEELIKNEA
FT                   YKPFYMHNSGHWLGLDVHDVGRYKINNEWRPLEAGMVLTVEPGLYISAGMEGVDKRWWD
FT                   IGVRIEDDILVTRAGYEVLTGDLPVNVDDIEALMRGE"
FT   gene            97508..98710
FT                   /gene="ubiH"
FT                   /locus_tag="lpa_00121"
FT   CDS_pept        97508..98710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiH"
FT                   /locus_tag="lpa_00121"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="COG0654, UbiH, 2-polyprenyl-6-methoxyphenol
FT                   hydroxylase and related FAD-dependent oxidoreductases
FT                   [Coenzyme metabolism / Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00121"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23339"
FT                   /protein_id="ADG23339.1"
FT                   /translation="MANKETDILIIGGGLTGASLSLALQGLGFSVTLVESRPYSDKVNP
FT                   DFDARSLALSPASQRILAMLGVWEILKEYTTPIHMIHVSDQHRFGVSRLHGEKNSPLGY
FT                   VVEMQYINRALSILLNKEHLLAPAALKSIDFNNSTATVAHGDDMISIQAQLIVAADGTE
FT                   SMTRHLCNLPVKIKDYAQDAIVANVGLIKPHGNRAFERFTPNGPLALLPMMNDKMSLVW
FT                   ASKPEEAKRLVMLNDGDFLRELQTAFGYRLGRFGKVGKRYSYPLKQVLMPQQTKWPVVF
FT                   VGNAAHTLHPVAGQGFNLGLRDIAALAQCVSQKGLNPQMLEHYLKLRAHDQQMITWLTD
FT                   GLIHLFTSRLPGMGVARNLGLLALDNIPALKNLLARYARGFGGITPDLVCEIALSTGEF
FT                   Q"
FT   gene            98707..99870
FT                   /gene="ubiH"
FT                   /locus_tag="lpa_00123"
FT   CDS_pept        98707..99870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiH"
FT                   /locus_tag="lpa_00123"
FT                   /product="2-polyprenyl-6-methoxyphenol hydroxylase"
FT                   /note="COG0654, UbiH, 2-polyprenyl-6-methoxyphenol
FT                   hydroxylase and related FAD-dependent oxidoreductases
FT                   [Coenzyme metabolism / Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00123"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23340"
FT                   /protein_id="ADG23340.1"
FT                   /translation="MSQHFDVLVIGGGIVGLTAALAMAQRHYTVAVIDAGTLMVNTDKS
FT                   DLRVYAINKASKMLLSELGVWQHLDDARVAPYNKMHVWDGVSGAYIDFDSRSIAEPNLG
FT                   AIIEESILKQALLRRISSESKINLFPQSVIDEVCHLERSIKISGQNTAWEGQLLMIADG
FT                   ANSPMRHKLKVDVTTWSYEQQALVATVNSEKSHQNTAFQVFHPDGPLAFLPLSNLNQCS
FT                   IVWSTHADNAMRLKLLDDNEFSRELTKAFGGQLGQIKVASNRHQFPLQMRHVKQYAGHR
FT                   WLLLGDAAHTIHPLAGLGLNVGLADVKSWLTCLEMGKGELISKKVLGTYQRERKHSVWQ
FT                   IILLMEGFKRLFGTSASPVTSLRSLGLRACNEFIPIKRLFMRQASGL"
FT   gene            complement(100199..101146)
FT                   /locus_tag="lpa_00125"
FT   CDS_pept        complement(100199..101146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00125"
FT                   /product="glutathione synthase/ribosomal protein S6
FT                   modification enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23341"
FT                   /protein_id="ADG23341.1"
FT                   /translation="MINLFRRLKNHGVLSINQRNTDFVLRYNPRKLFPLVDDKLKTKKL
FT                   ALKAGIAVPALYDIIETEQQIKSIETRFASYNDFVVKPARGSGGDGILVFKDKVYGRYR
FT                   QINGKLTTVQELSYHLSCLLSGAYSLGGSSDYAIIEKRVVVDPVFAEVSYEGIPDIRII
FT                   TLLGYPAMAMVRLPTRLSGGKANLHQGAIGVGVDLATGKTLGGVFQNDTIDYHPDTLNP
FT                   IVGIEVPYWNQILEIASSCYELTGLGYLGVDIVLDKEHGPLMLELNARPGLNIQIANRE
FT                   GGLKRYRTIEARFKENGKESTLDKVNFCRKEFAR"
FT   gene            complement(101143..102666)
FT                   /locus_tag="lpa_00126"
FT   CDS_pept        complement(101143..102666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00126"
FT                   /product="Predicted membrane-associated HD superfamily
FT                   hydrolase"
FT                   /note="COG1480, Predicted membrane-associated HD
FT                   superfamily hydrolase [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00126"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23342"
FT                   /protein_id="ADG23342.1"
FT                   /translation="MKNNKRHVYGLILTLLLLGSGIFLYRHIILDVPLTDTETINSWMV
FT                   ESNLRFTADRNTPIKASFNIPYLPPNFAILDEYFVSRNYGVTTNLNGSNRETVWSIRRG
FT                   NGPQSLYYRAIFRQTDSDESSLPKPSVTKSQPLNDSQKSAVETITNQVRSTSADIQTFA
FT                   QSTIKELNKRDGNAKLLVGNEFNDDNIINATILILNQSKIPAITVQGIYLNQQKKADLK
FT                   SLLAVFNGKNWIYINPKTGSAGLPKEFLIWQYGNGPLFNVVGGNRAQFSLTVSPTPINA
FT                   LSVAKSRGLEDSQLLRFSLLQLPVNVQGIYKILLTVPIGAFIILILRNFIGIKTFGTFM
FT                   PVLIALAFRETHVAWGITLFVIIISFGLLARFYLDQLRLLLVPRLAAILTVVILLMIFI
FT                   SVLCQNLSLDTGMSVALFPMVILTMTIERMCITWDERGASEAIKSGIGSLAAAVISYGA
FT                   MSYEPLQYLIFAFPELLLVLLSLILWFGQYRGYRLVELKRFKSLASAMK"
FT   gene            complement(102656..103129)
FT                   /locus_tag="lpa_00127"
FT   CDS_pept        complement(102656..103129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00127"
FT                   /product="putative protein conserved in archaea"
FT                   /note="COG4067, Uncharacterized protein conserved in
FT                   archaea [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00127"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23343"
FT                   /protein_id="ADG23343.1"
FT                   /translation="MANSEAQIYGYVEKATLIDQNLTLSAKLDTGAKSASLHAVNITEI
FT                   EKKGIPYLRFTVPTKTGDYSFEGEYVGKVKIKVRSSETNPGLLRTTPIKRPVVLLNIKL
FT                   GDKVRTIKVNLTNRKRFLYPLLLGRDAIIDFNGAVDPALTFTTKSKSPVNNEK"
FT   gene            103433..105364
FT                   /locus_tag="lpa_00128"
FT   CDS_pept        103433..105364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00128"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23344"
FT                   /protein_id="ADG23344.1"
FT                   /translation="MPHASDENQASKPTDLVFILAIAGRIDAQSRILAQKLDKSRSIYY
FT                   AYAVMDSLSSSYSMFKYFFDLFASPNDNDAMHEFLNSPTGLITIAVESVFLVTFSVLAC
FT                   QFENEKEDYYKKFIANAWPYFRDVMKGLKNAYKGWRSAVVAFSLIGGVDAKFLILPMGV
FT                   ILGVFAAANRFWIRSMLEDRKTMMSENIALLMEIKKLISLSHEESFSYFKRIRSQTMQT
FT                   RNFAFWAVAAGGLLDGLYLYVGVLSLAVLSPQLLMAMALICAFYTVACVITRIYEEYDF
FT                   QLRLLVTQTKCQLALITKELETNYAKLLLLQDKMDLDKADQEELKRLKRLVHNLITRFD
FT                   DSRKLLSQQSNRTYLSSALLGMKNGLYAYGALASVLFLVGSILVMAGVSFPPALLTACI
FT                   ILGLVLVLSFTIHSLVSNYWHQKKQETQKQRPYERLIEWNNCLNDEFNKTELLAPEEFN
FT                   KLLNDGLSLDPSPQFFFQEWFEVLRSLFSGFGKGQKFIDFAGNSLQELGEDGHYRDTPV
FT                   MYVLSVFSALLFGVTLALRALAKGLGRTPLAQQAKLTEDSKEASVSPEITKGVMQKTEE
FT                   QRESIQSEKTRTDSPGHTDSLSLFGIFETKTKTKRNQPDSPSIPHSKSESALNQLIPSQ
FT                   NSTILGLA"
FT   gene            complement(105330..105920)
FT                   /locus_tag="lpa_00129"
FT   CDS_pept        complement(105330..105920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00129"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23345"
FT                   /protein_id="ADG23345.1"
FT                   /translation="MQESFDPSTITTLHKTSIIRWKANGIEYQHKQFLQLVEENHAFNF
FT                   QLWHAEDKARRNDMGFEFVYQAKREIDAFNQQRNNRMEAMDEWLYKALQPENHNHCPVN
FT                   SESPGMIIDRLSILSLKSYHMDLQTKRQDVGVEHRIACTQKLEIIQQQLNQLALCLDEL
FT                   LNEVRAKTRTFRVYHQFKMYNDPKLNPELYCSD"
FT   gene            complement(106147..106875)
FT                   /locus_tag="lpa_00130"
FT   CDS_pept        complement(106147..106875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00130"
FT                   /product="glutamine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23346"
FT                   /protein_id="ADG23346.1"
FT                   /translation="MKRFMFILLIFINFHAFGKPLIIGVPDFAPPFVSRSGGGEFYFGF
FT                   NIDLMNSICKIIEEECQYKGMNIQQLYTNLNAGKVDIMLAPTPIVSTAGTNYIFSLPYL
FT                   PSNAQIVTLKANDHINALTDLKGKKVGTLKYTLYGGLLQEHFQDYVDLMQFSKLPDMAI
FT                   ALSNREIEAVVLNANAAKYAMSNSATELKFVGDPIPIGNGYGILALKNNAPLIMKINKA
FT                   LLQIEKNGTYLEIYNTYFGD"
FT   gene            complement(106967..107413)
FT                   /locus_tag="lpa_00131"
FT   CDS_pept        complement(106967..107413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00131"
FT                   /product="putative protein conserved in bacteria"
FT                   /note="COG1671, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00131"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23347"
FT                   /protein_id="ADG23347.1"
FT                   /translation="MTIWVDADACPKMIKDILFRAAIRTNTNLILVANSYLTYPNSPFI
FT                   RSVLVEKGYDRADHYITSHMKAKDLVITADIPLAAEVIVKQGLAMSPRGELFTANNIKQ
FT                   RLTLRDINEQLRSAGERTGGPSALSAKEKTNFANALDRWLVKSK"
FT   gene            107524..111498
FT                   /locus_tag="lpa_00132"
FT   CDS_pept        107524..111498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00132"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23348"
FT                   /protein_id="ADG23348.1"
FT                   /translation="MKQLISIIKGQIQQLPIPDLKHLLLSHLKEDAHDLTELFCQQTPA
FT                   QKNQFSHNQSVPFGLPASLSVLAIVLTYAPNLLHRELSEQLLTMLDSIRETETSVDNQL
FT                   AERCTEQLNYYSDAKPVLIALKERGAKDLIQILEQADERSLLAFSHLAKDTDLNVLIET
FT                   FLVKNNKDLDLVNRNHLVQFLRQPDLAGWLTRFLDSLIDGSINALSIRLLLSLISSVKA
FT                   IEKLKAARACLAQYPFSIDLHAMRAVFDFYQYELKRDLFSPESHLVMQLLHDLLKNTKL
FT                   DKQQEFFQGLSQETVLLIIEYCIAEYNKTTGEEKQNCKNLLTRLCSAFSDSSQDFLGKI
FT                   RTKINQLDPYLFDTPQLYQLASDLITKSCNSGKESLSSSPIALLLSMPQFVGVCTPKVL
FT                   KQLVERYSLYTLTLNQKDYKQDLCFKEYAPYFDEINEHMAQIERNLLIHPEAQSFWLDK
FT                   KYSLLQFRVEISKSALLHQMECLLEANKGGEELNNKGLEVLYHYYALSYPNLRSDLFLK
FT                   VVNHIYSRFFIKGNNETEARDGLFHWLKQNFPLIDKLPKDLDRKKEIFLYNSAGKKIGF
FT                   LGESNAAMTFVNEEIVLLAQTGSMDINEPLYDQEGLVLGYLTEESCLRSESAIHKNAAA
FT                   WVLAGLSKSDLESSSFGLESLLHNVLFENSIGVLYQCESICLDANKRIWLNNKLLKEIQ
FT                   EAPGEIPASVLYPLLDHFEDETVFELLGVIRNKNNALELFHYILNRDSRCSILLNGLYE
FT                   SDFQRFLEHQGADVCLADYLVNYYDKPWFSEVLLRFAYHGKKYKKPDLLSSALTFITKE
FT                   ISRDKKQETICDAVLDRLISSEACAALVLKEFLGDRTHNSIQRVNNPEIGKVSQFFDRR
FT                   HIVSLIAQLNKTSYWEQNAQYKLALHILANQHGRLFSETDLNPDSPQVWQGKELKELAC
FT                   FTSRHLSKKRPFDNKHDIGYRVLGELLFRCANSGITSLFYKQKTLNRAITRLSITEPFL
FT                   VRMVDKLWMPKGIRELYGKSLFFKGSWFDDQVFLQKELKDHHPLLDWSHFIKQTWNKRD
FT                   KQKKSPIICTYLLSYTGRKSVLSRLLQDYFNSFQGMPDYIRPVSQLLRFFPQRDVSAVI
FT                   YDALEAEMIKKPQLLDRQILSDMAFYYGKQLARKDTSFPQADINLLTYWGQNKHYSLVK
FT                   RGCELLVRDCEDKGVKKRLVSAAKEAEVEQDLSSSVQTFYFGLIKFFKRLWHYGFNAEN
FT                   SSSKIIKFCDDPTPGPTRKKAGDLINAPVAESRTNSLYLGFSERRKQLISLLATIKSSP
FT                   AHFTRVVNYSDNTQTFFGEQPKQSIDYNTPAIPSSFESIM"
FT   gene            111716..112180
FT                   /locus_tag="lpa_00133"
FT   CDS_pept        111716..112180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00133"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23349"
FT                   /protein_id="ADG23349.1"
FT                   /translation="MRILLSFFLLLLSTGLFAESTFPDGCRAVPVQGQSVTLKAKKNKL
FT                   VFIHNVTNLDLWITHPVTDPGASAGWTSRLQAGKWSALVVDKPAFILNCIESRPGHEQQ
FT                   IPCENAIAVCQWKGVKIPASNQGTFWVAEDLSLAALNAAVGGRGFVLPEK"
FT   gene            112576..114756
FT                   /gene="vacB"
FT                   /locus_tag="lpa_00138"
FT   CDS_pept        112576..114756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vacB"
FT                   /locus_tag="lpa_00138"
FT                   /product="Exoribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00138"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23350"
FT                   /protein_id="ADG23350.1"
FT                   /translation="MSKKSKDPFYKREREKYAEPIPSREYIMEILDEYGRPMSRSKLFD
FT                   KLDLSSESQQESLGFRLKAMLRDGQIMQDRRGRFCLLQKINLLRGTVQGHPDGFGFFIP
FT                   DDGSEDMVLSAKEMRAVMHGDMVLAYQSGLDRRGRPEAKIHEVLEHANTTVVGRFFTDH
FT                   GVNFVIPDSKRLTQDISIPQEFIGEAKNGQIVLVELIAYPNKRSQAIGRVIHILGEHMA
FT                   PGMEIQVAIHAHGIPFEWPDDVLAEVGKIPQQISEEQLKGRTDLRNLPFVTIDGEDAKD
FT                   FDDAVYCYKKPKGGFQLYVAIADVSHYVAKDSALDQEAARRGNSVYFPGKVVPMLPEAL
FT                   SNGVCSLNPHVDRLCMVAELSITQEGKISRSRFYRAVIHSHARLTYTSVGAWLEQGKAD
FT                   EKHQALWPMLESLYDLYHVLLDTRRLRGAMDFETTETRIEFDENKKIKCIVPVIRNDAH
FT                   KLIEECMLAANVATARFLEKAEIPTLYRVHAAPEEDKITALRQFLGELGLSLGGGRKPG
FT                   PKDFQRTMNMIGDRPEKHLIETVMLRSLKQAQYVESNEGHFGLAYSAYTHFTSPIRRFP
FT                   DLLIHRAIGHLLDNHPVYEFEYSHEDMNRLGKHSSMTERRADEATREVITWLKCEYMQD
FT                   KLGQVFKGRISAVTSFGIFVELDEIYVEGLVHVTSLKNDYYTFDSAKHRLIGARGGQVY
FT                   RLGDKMTVLVARVDLNERKIDFEPVEDEVCNE"
FT   gene            114749..115498
FT                   /locus_tag="lpa_00140"
FT   CDS_pept        114749..115498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00140"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COG0566, SpoU, rRNA methylases [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23351"
FT                   /protein_id="ADG23351.1"
FT                   /translation="MNEQYVYGLHAVSALLANPHRMIKKLFVNQDRIDKRLHEFLVKAE
FT                   NAHVPIEKLSAQKMNQQFSEFTHQGVVALASALPEYGESDLVTLLERSKKPVLILILDG
FT                   ITDPHNLGACLRSADATGVDFVVIPKDKSANITPVVSKVACGAAESIPLVRVTNLARAM
FT                   DILKQQGVWIFGAAGEAEHLLYAMDCSGNIALVMGAEGTGLRRLTREHCDGLFSLPMMG
FT                   SVESLNVSVATGVSLYEVIRQRGQFRE"
FT   gene            115491..116141
FT                   /gene="rpiA"
FT                   /locus_tag="lpa_00141"
FT   CDS_pept        115491..116141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="lpa_00141"
FT                   /product="ribose 5-phosphate isomerase A"
FT                   /EC_number="5.3.1.6"
FT                   /note="COG0120, RpiA, Ribose 5-phosphate isomerase
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00141"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23352"
FT                   /protein_id="ADG23352.1"
FT                   /translation="MSELKIKAAKAAIAYIEDDMVIGVGTGSTVNFFIKELAAIKHKIE
FT                   ACVASSKATEALLRAEGIPVIDLNSVQDLPIYVDGADEVNERGEMIKGGGGALTREKIV
FT                   ANVATQFICIVDESKVVKRLGEFPVAVEVIPMARSFVARQIVKLGGDPEYREGFVTDNG
FT                   NIILDVFNLNFSTPMALEDSLNVIPGVVENGVFAKRLADKVLVASASGVNNLK"
FT   gene            116244..117584
FT                   /locus_tag="lpa_00143"
FT   CDS_pept        116244..117584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00143"
FT                   /product="cytosolic IMP-GMP specific 5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00143"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23353"
FT                   /protein_id="ADG23353.1"
FT                   /translation="MRKIKLIGLDMDHTLIRYNSKNFESLVYDLVKERLAESFHYPEEI
FT                   KKFKFNFDDAIRGLVIDSKNGNILKLSRYGAIRLSYHGTKQISFSDQKKIYRSIYVDLG
FT                   DPNYMAIDTSFSIAFCILYGQLVDLKDTNPDKMPSYQAIAQDVQYCVDKVHSDGTLKNI
FT                   IIKNLKKYVIREKEVVEGLKHFIHYGKKIFILTNSEYSYSKLLLDYALSPFLDKGEHWQ
FT                   DLFEFVITLANKPRFFYDNLRFLSVNPENGTMTNVHGPIVPGVYQGGNAKKFTEDLGVG
FT                   GDEILYIGDHIYGDILRLKKDCNWRTALVVEELGEEIASQIRALPIEKKIVEAMSIKKE
FT                   LEQKYVDLCTRSIDESSQQYDQEIHDLQLQISTVDLQISRLLQEQNSFYNPKWERVFRA
FT                   GAEESYFAYQVDRFACIYMEKLSDLLEHSPMTYFRANRRLLAHDIDI"
FT   gene            117968..119161
FT                   /locus_tag="lpa_00145"
FT   CDS_pept        117968..119161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23354"
FT                   /protein_id="ADG23354.1"
FT                   /translation="MPKVIIFTDFDGTVTGRSGNETVFTDFYQSLLQGYKKDVEQDYKN
FT                   TPMKDPIEAQALFEAKYGKYNENFDHDQQDIDFLMSPEAVAFFHEVLKNDDVTVNIVTK
FT                   NRAEYIKAVFKYQGFSDEEIEKLTILESGYKFNDVNSRLNHPTERANRVYILDDSPTDY
FT                   AEMLRAVKGKGYNEEEIRGHRKNPGEFEWSQYLEDVREMFPPKENSPEEVRLPYEQGDE
FT                   VSIGEEIPVLLQEDNLSRREETATVLSNQPVPSSDFRTLKIMGVFAGIGFGFGFALGVT
FT                   LVATGVFAPPGVGLLGALTLGAISGTGAAALSSAIGFAVAKGTEITPEPVSEEPVPAVK
FT                   QSSHEAMRGLGGSQLLSTNNIHPVGHFPSVLSGRTPTKGKEEQCQKEYVLTNPLNNS"
FT   gene            119323..119664
FT                   /locus_tag="lpa_00146"
FT   CDS_pept        119323..119664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00146"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23355"
FT                   /protein_id="ADG23355.1"
FT                   /translation="MNQLPNCPKCLSEYCYEDGDVLICPECTHEWPRNSNNNDEESAKI
FT                   IKDANGNLLQNGDTITVVKDLKIKGSSQVIKVGTKVKNIRLVDGDHDIDCRIDGIGAMK
FT                   LKSQFVKKI"
FT   gene            119779..120231
FT                   /locus_tag="lpa_00147"
FT   CDS_pept        119779..120231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00147"
FT                   /product="two component sensor and regulator, histidine
FT                   kinase response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00147"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23356"
FT                   /protein_id="ADG23356.1"
FT                   /translation="MRVLIVEDSAFNAFCLRRLLESVVASISVTIVNNSQAALSFVNNY
FT                   CPDIVVVDGDLGASPDEMNCNGPELAGILLQKYPQLPIVAWSDSDAMREDFIKVFKSRG
FT                   LFLNEYNTWPKVIGLERIHKTWSYYFGEFIGGQNPSFASQTSINYY"
FT   gene            complement(120261..122951)
FT                   /gene="polA"
FT                   /locus_tag="lpa_00148"
FT   CDS_pept        complement(120261..122951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="lpa_00148"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG0749, PolA, DNA polymerase I - 3'-5' exonuclease
FT                   and polymerase domains [DNA replication, recombination, and
FT                   repair]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00148"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23357"
FT                   /protein_id="ADG23357.1"
FT                   /translation="MKPPLILIDGSSYFFRAFHALPPLTNSKGQPTGAIYGVANMIKKI
FT                   IKDYQPEEIAVVFDAKGKTFRDEWYPEYKAHRPPMPQELSSQFQPLIQLLQAMGLPLLI
FT                   IDGVEADDVIGTLAKQATEQGIPVVISTGDKDMAQLVNEHVSLINTMSNYSMDIDGVKA
FT                   KFGVTPEQIIDYLTLIGDSVDNIPGVEKCGPKTAVKWLTEYQTLDNLLAHANEIGGKIG
FT                   EYLRASIPHLPLSKKLVTIKTDLDLPLNLNQLMPKPADSEQLIKLTRELEFKSWLKELL
FT                   QEEENQKSTKEMDAGNNKSYEIITTHQQLNHWLNKLEQSQQFCIDTETTNLDVMQAELV
FT                   GISLAVEEDNASYIPLAHTDGSTQLVKEEVLTALKPILENPAIGKIGQNIKYDYSVLKN
FT                   YGITLQGIRYDTMLESYVLNSGAGRHDMDSLALKYLGYKTISYEDVAGKGAKQLRFDQI
FT                   PVEKAGIYAAEDADITLRLHHKLYPMLDKPLRNVLHDIEMPLLTVLADMEMHGVLIDPV
FT                   ILEKHGSRLKEQMKSLEQEAVQLAGKAFNLNSPKQLQEILFDEQKLPVVAKTPTGQPST
FT                   AESVLQELAFDYRLPAVILEYRSLSKLVSTYIDALPKRINPKTHRVHTSYNQAVAATGR
FT                   LSSSDPNLQNIPIRSEEGRLIRTAFIAPEGSLIMAADYSQIELRIMAHLSQDDNLLRAF
FT                   ANGWDIHAATASEIFQTNLEAVSKEQRRRAKAVNFGLIYGMSAFGLAKQIGVERQDAQH
FT                   YIDTYFRRYPKVLEYMERTRKQAHQLGYVETLFGRRLYLPEINSRNLMRQKAAERTAIN
FT                   GPMQGTAADIIKKTMLAVSSWEHSQKNPSAKMIMQVHDELVFEVRKEAVEECHAIIHKL
FT                   MEQTVKLSVPLVVSIGTGSNWDDAH"
FT   gene            complement(122954..124009)
FT                   /locus_tag="lpa_00149"
FT   CDS_pept        complement(122954..124009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00149"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl) glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00149"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23358"
FT                   /protein_id="ADG23358.1"
FT                   /translation="MNSSLRDIANLVQGMVIGNDAITVSTLSPIDNILPGSLVFAEGED
FT                   NIKLAENSEAAAILIGQGTIDSPKPLIQVKNPFKAFIALLNHFYPPRRISPGVHPTAVI
FT                   GAEVQLGDEVYVGPYVVIESGSIIGNHSVLKSHIHIGHNVVIGDHTTIHPQVTIYDNCR
FT                   IGSNVTIHASTVIGSDGFGYTFVDGQHLKVPHSGYVVIENNVEIGANTAIDKATLGATV
FT                   IGEGTKIDNLVQIAHSVKLGKHNIICAFTGIAGSTTTGNNVIFAANVGVSDHVHIEDEV
FT                   ILGARTGVPPHKHLKKGTVYLGNPAKPKDVAIKHELSVNRIPLIRKNIKSLTEQVAVIN
FT                   KKLDIKAKEVE"
FT   gene            124273..125055
FT                   /locus_tag="lpa_00150"
FT   CDS_pept        124273..125055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23359"
FT                   /protein_id="ADG23359.1"
FT                   /translation="MLKKILLTGLCVLFSMNLSASEPIYDEEIPLLWSSIITVSGGPSW
FT                   ATPGQNQYIYPMSPVYINNFNPNLPPNYYLYFTYDSPTTILANGEIFFGLQRAINPKMI
FT                   GQLGLGVAGVSDAKITGDVNLNGLLNVYTYDYKVNHARVELKGKLIGSAFTPVQPYLSG
FT                   SFGIAFNNAHDYRTLSINQFLFPAPWFASNTTYAFAYSVGAGVQKMLNRNWQVGVGYEF
FT                   ADLGKSYLGGDGVNITKGPRLTHLYNNQLLFSVSYLYS"
FT   gene            complement(125052..126281)
FT                   /gene="fabB"
FT                   /locus_tag="lpa_00151"
FT   CDS_pept        complement(125052..126281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabB"
FT                   /locus_tag="lpa_00151"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase"
FT                   /EC_number="2.3.1.41"
FT                   /note="COG0304, FabB, 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase [Lipid metabolism / Secondary metabolites
FT                   biosynthesis, transport, and catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00151"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23360"
FT                   /protein_id="ADG23360.1"
FT                   /translation="MKKRVVITGMEITSSIGSGIDKFWLAASQGQCGIKRIQSYDPSPY
FT                   STQIAGEITDLSLDHLPEFNKSKRYPRAAQYALFCAHHAIEKAGLEQAELNAAGTFIGT
FT                   SIGGQPELEAGYKLFFTDSWKKIPPLSVIRGMPNSIANHIAIAFGIGGPNSTISNACVS
FT                   SGEAIGMAYQQIAHGNLTTALCGGTESLVWESVMAAWCKLRVMSTNNENPSQASRPFDL
FT                   NRDGMVMADGAGILILEELQQAKARGAQILGEIIGYGASCDAFHVTAPNSQGQARAIVA
FT                   ALNDAKLSINDVHYINAHGTGTQLNDSTETETIKMVFGKRAYDIPITAQKAMTGHAIGA
FT                   AGAMEIIATTLSLQKNTLLPTINLHTPDPACDLDYVPNAAREKTIDIALSNHFAFGGAN
FT                   AALVLRKYIS"
FT   gene            complement(126406..127266)
FT                   /locus_tag="lpa_00152"
FT   CDS_pept        complement(126406..127266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00152"
FT                   /product="N-terminal acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00152"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23361"
FT                   /protein_id="ADG23361.1"
FT                   /translation="MITQVNQLDELQLKDLKTLRAECKKNDGSIPNLYIHILKQHRSLP
FT                   TSFLYYQNGALIGFLSVYFFYDDAVEVAVLVSPQYRRQGVAKQLIKEALPLIKSQNYFN
FT                   LIFSCPSRLNDNWLTQKGFTYLHSEYFMERDDLNPILDYIRPLSFRMATLEDIPILCGL
FT                   DEVCFPDKNQDSVNRFQQILNEREYEIVIAMLNNHPIGKAHIRWQTKRATLSDIAILPK
FT                   EQGKGFGSALIAHCINMILSEGKSRVDLDVETHNKKALNLYIQLGFHIQNACDYWSINV
FT                   NQLAK"
FT   gene            complement(127385..127960)
FT                   /locus_tag="lpa_00154"
FT   CDS_pept        complement(127385..127960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00154"
FT                   /product="peptide-methionine (S)-S-oxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="COG0225, MsrA, Peptide methionine sulfoxide
FT                   reductase [Posttranslational modification, protein
FT                   turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00154"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23362"
FT                   /protein_id="ADG23362.1"
FT                   /translation="MLRIFLYFLLLINTTFCLAKTEKAIFAGGCFWCMEADFDHLPGVL
FT                   STTSGFDGGTLKDPTYEQVSAGNTHYAESVMVEFDPNKLSYKKLVEYFFRHIDPTVKNA
FT                   QFCDHGSQYRSAIFYLNDQQKKIAMEYKKELEQKFPTVYTEIAPSTSFYPAEEYHQNYY
FT                   KKNPIRYKYYRYRCGRDARIQEVWGNKK"
FT   gene            complement(128067..128663)
FT                   /locus_tag="lpa_00156"
FT   CDS_pept        complement(128067..128663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00156"
FT                   /product="cytochrome oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00156"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23363"
FT                   /protein_id="ADG23363.1"
FT                   /translation="MLEQSLRHYYQLVLVDPILPALRDRITPLSITWLSGIFGLLFIPF
FT                   VLLDKPYIAISFLLFSGYLDTLDGSLARFQNRASDFGSAMDIVMDRIVEFSAVLALYLF
FT                   DPQHRATLAILMLGSILLCITSFLVVGIFSNNTTQKSFYYSPGIMERAEAFLFFIFMTL
FT                   FSNCFNFLAALFCFLVCLTALIRLFEFKKSVRAPG"
FT   gene            complement(128987..130267)
FT                   /locus_tag="lpa_00158"
FT   CDS_pept        complement(128987..130267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00158"
FT                   /product="putative MFS transporter, AGZA family,
FT                   xanthine/uracil permease"
FT                   /note="COG2252, Permeases [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00158"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23364"
FT                   /protein_id="ADG23364.1"
FT                   /translation="MPTLKSYFLKDTSLRTEILAGATTFLTMVYIVFVNPKVLHDAGMD
FT                   QGAVFTATCLITAFACALTGFIANTPIGVAPSVALNIYFSYSVVQGMGVDWQHALAMVF
FT                   ISGLLFLFLTLTKLRRLLIEAIPHNLQIAIVIGISLLIALIALENNQIIIGDQHNLMRL
FT                   GPIIRPETGLFFLGFILILTLDYHKIPGAIIIGILSISVLSLMLGLTSWQGLIAMPPSL
FT                   EPTFLQLDFSGLSSIVALKTIFTFFLITVFDATGSLIGLLSPTIFKHEKNYYKRLTRSL
FT                   TADAAASSLAGLMGSASTSPYIESATGIEAGGRTGLTALVIATGFILMLFLFPLAKMIP
FT                   SFAVGPALLYVACCMIKHITNMKLQDITETAPCMVIIMMVPFTASIADGIGLGIILYTL
FT                   LKLFTRQKPNPLIIVLSLVFIVFFLIN"
FT   gene            complement(130285..131091)
FT                   /locus_tag="lpa_00159"
FT   CDS_pept        complement(130285..131091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00159"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23365"
FT                   /protein_id="ADG23365.1"
FT                   /translation="MECLSFCVAKTIDLTRLDLHLKNVSKEFSAVKTRDVIRLNSHRNK
FT                   DHTLFIFKNGTVVSWGVKRYQIHEYLDIIKLLVDKPVALLVHDEFHYQIGDKTAIEPHG
FT                   FYDVDCLTIEEDSDELKLSLSYGFSQSVKLQYFETIIDALIEKYNPLIQALSHKGEMPI
FT                   SRKQIQQVIGEILGAKSELNLISNFLYHPKYFWQHPTLEEHFSMLERYLHIQRRVNAIN
FT                   HRLDTLNEIFDMFNGYLESRHGHHLEIIIIVLIAVEIIIAVMNFHF"
FT   gene            complement(131190..131459)
FT                   /locus_tag="lpa_00160"
FT   CDS_pept        complement(131190..131459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23366"
FT                   /protein_id="ADG23366.1"
FT                   /translation="MNSKVFSQRFNRELATLGFPEDLTEKTKAVSKVFGVTRHLANAMI
FT                   FGHVLPDKEQLDKIAEILEVCPQWLSGATDRKKAYSGRETADSV"
FT   gene            132098..133900
FT                   /locus_tag="lpa_00162"
FT   CDS_pept        132098..133900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00162"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23367"
FT                   /protein_id="ADG23367.1"
FT                   /translation="MIQLGDLLKPTWAAEQSLNNAWSVLNDEEKETIKSRMDKIFYNEI
FT                   PFQLEHDKLIYIHLFSLFTQLETIGLRGLIKSLEKLRGTDLYQQMRQQITDEIFHATVF
FT                   AKVAFQLSAPYALPLGHQKSIKHFISSLEGEEDLATSITLVNLVGEGWVEELCIAMKEK
FT                   NIAVTIFETVLEDESRHMDEYDLYRQIGLPNKDYLRKKLAIFEDELINTVFAHEQYLTT
FT                   LGILLGKEGALKLLNNINNKHHWMLKKIGLTPSAHWQLFMDTMPLLMKNLSHDFEKDKA
FT                   IEPTNIRKLLSAIWNDPELPTESAIFNINVTPVCFFEKKFKPETITCLMLQALSKACFD
FT                   NPQTRNYIFNHKLYHSHNSYVALAVKIPGSDQLGAIEFKNCHEMTMTELAQHIQHDMRI
FT                   MKYCYEKTQSLQKEHPYLIEVVNRLLTPRHEREYRDFLFARPAISLSNIGHWGYQAAVS
FT                   PLFPNETFKITLTEIERKQVWSKTNNTFEVQDVLPVGMSVDHRVFDGNIPFPRYMQEAF
FT                   DQMFQDMEQSRIKPLSKPFSNLDNFIKYSNTLLENDLEFGFLYLFSLMHVWKNYISYDE
FT                   LSKTVEENYERIKQALSKSEHQLG"
FT   gene            134008..134937
FT                   /locus_tag="lpa_00163"
FT   CDS_pept        134008..134937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00163"
FT                   /product="squalene and phytoene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00163"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23368"
FT                   /protein_id="ADG23368.1"
FT                   /translation="MSYLLLRVADSIEDAKWQDLQAQSDSFAAFKSFLVQTPANDQFTK
FT                   WLSSFPSQLPLGEKQLLCAVPLLLEEKDNLPESIKQSVIKTILQVVDGMHYFLNHYHME
FT                   GKIIFPSLVTTNQYCFFVAGLVGKLLSHIFTDLLSNFKWTASLLNQAFHFGFFLQKINL
FT                   LKDKVDDETSGRYFISSENSLRESLVIHAHHSLAYVKSIPIIEGRQYRLFCAWSLFIGL
FT                   ASLKWLDKYGHRQKIKPRETYYLVNQINMLIDDNRALEKLFNSYLPGQYEEGSCYASES
FT                   TKKIPTWFKKIYDGEMDSLILFDLDIEV"
FT   gene            complement(135430..138651)
FT                   /locus_tag="lpa_00164"
FT   CDS_pept        complement(135430..138651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00164"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23369"
FT                   /protein_id="ADG23369.1"
FT                   /translation="MIIRELFNWIHNDSATLHLSDQTIERDLIEQEESQAKQAHRVLLG
FT                   NARLLKYSGSSNTEAIKELEQHCLFMDYLQLYKQEFVKDRKNTVFLIALKNLLSHPHEE
FT                   QLRLMPKINELFQILLRDNKESALSFYDKNKELFRHCTEIQERVTFELLQQKMEADSKL
FT                   VMTQLDYFNEHLAYQENPLGIIALCRNWIGETEKFTALILWLLERKVSVEKILLTNLLQ
FT                   DFLKYHLFTLHSKDSEVSRLYSLLGHFPEAQELVMAAQKISCGELMFQQYSLDGIFRGK
FT                   NLPVVSPEIPPLQFSLRKDNFNALYRTFGQYFLTAGVATATNHSDVAWLDMLRHTLNQP
FT                   ETLKLLPDIINIIAREYSPKVLKTLAELIAESTAHRLLTLNQSCVFHLLQHKPRLLHDI
FT                   TEENVIEYINLLVRLDTHDQEIIYQLMALFRVLLKKNHPATKAVFEAILDNLVNHPQLL
FT                   EDEEFLTQLKKYPDCELLIEERCENILKQLNFCIAEQTSGLLFGKHNYYIIEDVWLGAL
FT                   RKFAVLQQINPQMKSSFGHKYALQARVAEVVFIHQGDLFDLDTFIDALDLPPVTSSGEI
FT                   SPYERALIEILATIDNDLIRKQIIQKLETTPFNRLDWYEREYGNQTVFIKAAKKGNLGL
FT                   INLLEDKMKPSVLNKALRAAAKNYQWETLDHLCSLPGVELRQDEMDDLVVYLAEHGRIE
FT                   SVKKLLKLYDYKPSTELIGTILKKAIDNDNLQVVMYFCKLPVESPKQAMLDRLFKLAIQ
FT                   LQHWDIVEYLANSKHYSPSQATLEKAFQQTALAMQHEAVEILGNVEKTPIRAIVIERAL
FT                   LKASKLGHAKVVQSICALPSESLTKQAIEDALEQAAAEGHLDIVSCLCEPGTTTLKQPG
FT                   INSGMKIAVQAGKLSVVNYFCSMTGSNKPTPRLIDQTLVMAAKKGQTAIFIAIHSNHQT
FT                   PPGKHAIEQSFQLAITAGKLPILDYLCRHEGYGLNQSKVDQALISAVKSKQLEIVSYLC
FT                   ESLEITPSRKALRIAVSKAISSDQTGLAEYLRSRSTDKSKLTDTLVDEIDSTSKVGKQL
FT                   EANGLFKKKKRQTDREPQILFNPAI"
FT   gene            complement(138888..140132)
FT                   /locus_tag="lpa_00165"
FT   CDS_pept        complement(138888..140132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00165"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23370"
FT                   /protein_id="ADG23370.1"
FT                   /translation="MVVELDEPPVRTLLARQGIYDKNSAIFAYELLYRNSEAQNSQVDN
FT                   LNPLSGEAATSSVLLQLFANLDVNTIIGNKQAFINFTHNHLVQKIPMLLPKNRIVIEVL
FT                   ETVAIDQALLLNLMELKKQGYQIALDDFVFRNELAPLVDMADIIKIDVLHLDQQQIAEQ
FT                   LLPLKSFRGKLLAEKIEDKQQFNHCVNLGFDFFQGFFLNKPDSLTGQIITENKIQLLRL
FT                   LTEINNEEVPIQRIEEIILQIPKLSYRILRLANSASLYMSKKIESLMDAISQLGLMQIR
FT                   NWLNLLLLASLDDVAPDLLERTLIRAKMCESLAKSMDYPNSHQAYTVGILSTLDGILNE
FT                   PMPSLLAKIRLSEALNEALLNYKGDLGKILKFAIDYEQANFNQLERIPVKSETLSQSYL
FT                   KGIEYANHVIDIINK"
FT   gene            complement(140337..141791)
FT                   /gene="gcsB"
FT                   /locus_tag="lpa_00168"
FT   CDS_pept        complement(140337..141791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcsB"
FT                   /locus_tag="lpa_00168"
FT                   /product="glycine dehydrogenase subunit 2"
FT                   /EC_number="1.4.4.2"
FT                   /note="COG1003, Glycine cleavage system protein P
FT                   (pyridoxal-binding), C-terminal domain [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00168"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23371"
FT                   /protein_id="ADG23371.1"
FT                   /translation="MLIFELSKTGRQAKAQIPRAVGKNYSIPEEFQRKSPPRLPACSEL
FT                   QVVRHFTCLSQKNFSIDTNFYPLGSCTMKYNPRGVHKAASLPGFINRHPLAMDNESQGF
FT                   LETLYKLQNYISEITGMPGVSLTPMAGSQGEFAGVAMIKAYHQSRGDTARDEILIPDAA
FT                   HGTNPASAVMCGFKVVEIATAPDGDIDLDELKRKVGPRTAGIMLTNPSTLGLFMRQIKE
FT                   IASLVHQAGGLLYYDGANLNAILGKVRPGDMGFDVMHLNLHKTFATPHGGGGPGAGPVA
FT                   VGKRLIPYMPLPVVKKTDSGYHWATRQDYPQSIGRLSCFMGNAGILLRAYFYMLVLGKE
FT                   GLLRVSEFATLNANYLLKELTKVGYTAAYPDRRASHEFILTLNSEKKNYDVTAMDFAKR
FT                   LLDYGVHAPTTYFPLLVPECLLIEPPETESKEELDAFVAVMKTIREEASKQPDILKTAP
FT                   HTLPVKRLDDVKAARELDLNYFATHE"
FT   gene            complement(141785..142093)
FT                   /locus_tag="lpa_00169"
FT   CDS_pept        complement(141785..142093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00169"
FT                   /product="putative protein conserved in bacteria"
FT                   /note="COG2350, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00169"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23372"
FT                   /protein_id="ADG23372.1"
FT                   /translation="MFIVQLTYLVPINEVNKYLQAHREFLDYHYKQGLLVASGPMKPPT
FT                   GGIIIAATNDRAHLESVFKQDPYYLAEIAEYQFIEFTPVKHRNELKELIQKTEGKLC"
FT   gene            complement(142093..143463)
FT                   /gene="gcsA"
FT                   /locus_tag="lpa_00170"
FT   CDS_pept        complement(142093..143463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcsA"
FT                   /locus_tag="lpa_00170"
FT                   /product="glycine dehydrogenase subunit 1"
FT                   /EC_number="1.4.4.2"
FT                   /note="COG0403, Glycine cleavage system protein P
FT                   (pyridoxal-binding), N-terminal domain [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23373"
FT                   /protein_id="ADG23373.1"
FT                   /translation="MPYIPHTPNDTKEMLEAIGAQDIQDLFDEIPASLQYAGFQNIPAG
FT                   INEMEMLKEAQNQAQKNRNGICFIGAGCYEHHIPAAVWDIASRGEFLTAYTPYQAEASQ
FT                   GTLQLLYEYQTMICELTGMEVSNASMYDGATALAEAVLMAVRLNKHSKTNRVLIAGTVH
FT                   PFYRETIETIVRNQHIEVITLPFDEQQGITDLGSLNQYTGEDITALVIAQPNFFGCLEQ
FT                   VDKMTSWAHHNKTISVACVNPTSLALLKPPGSWGEHGVDIVCGEGQPLGSPMASGGPYF
FT                   GFLSTRMAHVRQMPGRIIGRTVDKDGKTGFSLTLQAREQHIRRAKATSNICTNQGLLVT
FT                   AATIYMSLLGPEGLSQVATQCHQNTHELITALTQIEGVELAFKAPFFHEALIKLNQPVQ
FT                   YVLQQLADAGIAGGYAPEQHYPQLANTLLVCATEVRTAEDIAKYAKTLKTIMSKRGA"
FT   gene            complement(143466..143843)
FT                   /locus_tag="lpa_00171"
FT   CDS_pept        complement(143466..143843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00171"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23374"
FT                   /protein_id="ADG23374.1"
FT                   /translation="MNDLKFTTTHEWLREDEEEVTVGITDHAQELLGDMVFVELPEIGD
FT                   EVSAGQELGVVESVKAASDFYAPISGVVTAVNEAVGKNPALVNHDPYHEGWLVKLKPSH
FT                   PDEIKSLLSDEQYQNEIAEEN"
FT   gene            complement(143877..144959)
FT                   /gene="gcvT"
FT                   /locus_tag="lpa_00172"
FT   CDS_pept        complement(143877..144959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="lpa_00172"
FT                   /product="glycine cleavage system T protein"
FT                   /EC_number="2.1.2.10"
FT                   /note="COG0404, GcvT, Glycine cleavage system T protein
FT                   (aminomethyltransferase) [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00172"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23375"
FT                   /protein_id="ADG23375.1"
FT                   /translation="MTAKTPLHTTHLACGAKMVDFHGWDMPLHYGSQLNEHHAVRNDAG
FT                   MFDVSHMTIVDILGAGGRQFLRKLLTNDVDQITHNGKALYSCMCNEHGGIIDDLIVYQR
FT                   ASDNYRVVLNSATRQNDVAWIRAKSEGFAVGLQERRELSMLAVQGPNAIAKTLSILAPA
FT                   HVDAVSTLTPFECVDVDHWFFARTGYTGEDGLEIIVPNEFITQLWNDLLNAGVTPCGLG
FT                   ARDTLRLEAGMLLYGQDMDETTTPLESGLAWTVKWEPEDRGFIGMGALVSQKQQGIKRK
FT                   MVGLTLLDKGIMRHGQKVIIEGCPDGIITSGSYSPTLQQSIALARVPVETGEQVLVDIR
FT                   GKLIPAKVGKPRFIKQGKPV"
FT   gene            145095..145562
FT                   /locus_tag="lpa_00173"
FT   CDS_pept        145095..145562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00173"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23376"
FT                   /protein_id="ADG23376.1"
FT                   /translation="MVWPIIWRWILDLGWLCFLLILFWYFWKKRRDLVEARSWLKAKGH
FT                   VTRCEWTRVGHSVWPRIEYIYEVYEKDLTGEYLFLDTTFNTPNSKYSRSIAYKVAIAYR
FT                   DNSEIDVYYNPNRPEQSALDVTIPKKLTFILILISSLILLHIGIIVWRLLV"
FT   gene            complement(145537..146067)
FT                   /locus_tag="lpa_00175"
FT   CDS_pept        complement(145537..146067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00175"
FT                   /product="IcmL-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23377"
FT                   /protein_id="ADG23377.1"
FT                   /translation="MNKTITIALSLLLSIASKLTYAGPDRAQLAVWANEAIIATYTFDY
FT                   KNYMQQQKEIAKYFSADGWIAYSKALNQSKLPEVVQKNAYFVNAVATEPPKLITLDPTH
FT                   WQAIMPILVVYKNPQYEQKQNLKVILGFTVASPGQGVRGFSITSLQSTPISPPCQCKFE
FT                   ETPENTKQGDAKQ"
FT   gene            146564..148303
FT                   /locus_tag="lpa_00178"
FT   CDS_pept        146564..148303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00178"
FT                   /product="ABC transporter, permease protein"
FT                   /note="COG4986, ABC-type anion transport system, duplicated
FT                   permease component [Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00178"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23378"
FT                   /protein_id="ADG23378.1"
FT                   /translation="MGNSRFYFANPDKFSRFINRWDLLLLILTFSVLFFLGWAGSQMAT
FT                   PYQLGDQIPISLEPSNLPFYALRTVLRMFIALIFSILFTFIVGALAAKNRRAEQIVIPA
FT                   IDILQSIPVLSFLSITVTGFIHLFPNSLLGPECASIFAIFSAQVWNMTFGFYQSLKTVP
FT                   HDLIEVSAMFRLSAWQRFWKVEVPFSMSGLLWNMMVSMSASWFFVVLSEAISVAHQNIR
FT                   LPGVGSYIALAIAQRDLHAVGYAILTMVIVIFLYDQILFRPLIAWSEKFKMEQSPDESE
FT                   YQSWLIDLIRSSRLMKRVTEWLAVFTNSFVNARWLRIGEVKAVKEIDFKRQKRLDRLWT
FT                   ALVLIAVITGGWFLLKFILAELKVSDIFHVFLLGAATGARVIILILLSSMLWIPVGVWI
FT                   GLRPRLAQKIQPIIQFVAAFPANLFYPLFVIAIVKFNLSVEIWVTPLMILGTQWYILFN
FT                   VIAGASSIPRDLYLAADNFGLKGWIWWKRLALPGIFPFYITGAITAAGGAWNASIVAEY
FT                   VSWGNITLKATGLGEYIQASTTAGDFPQIALGTAMMCVYVLAFNHLIWRPLYRLAEERF
FT                   NFN"
FT   gene            148311..149609
FT                   /gene="tauB"
FT                   /locus_tag="lpa_00179"
FT   CDS_pept        148311..149609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauB"
FT                   /locus_tag="lpa_00179"
FT                   /product="sulfonate/nitrate/taurine transport system
FT                   ATP-binding protein"
FT                   /note="COG1116, TauB, ABC-type
FT                   nitrate/sulfonate/bicarbonate transport system, ATPase
FT                   component [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00179"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23379"
FT                   /protein_id="ADG23379.1"
FT                   /translation="MPETIINIENLSKSFKKAPSQHLLVLEDVNFKLQEGEIVALLGKS
FT                   GSGKSTLLRIIAGLIAPSSGTVTYRGKPVTRPVEGIAMVFQSFALMPWLTVLENVELGL
FT                   EAQGISREERRHRAIEAIDIIGLDGFESAFPKELSGGMRQRVGFARALVINPDVLLMDE
FT                   PFSALDVLTAENLKSDLLELWKEKKTNTNGILLVTHNIEEAATLADRIVIFGNDPGYIR
FT                   AELPVTLPQPRDPESPEYLALVDKIYTLMTTGPKEKAKRAQRERQIGLGYRLPDVEPSE
FT                   LSGLIETMKSFEERIDLPELADELMMNIDDLFPILETLEILGFAKVSAGDIQLSELGKQ
FT                   FSEADLQERKQLFAQRLLEKVPLARYIRRVLDEKAGHRVSEERFLSKLEDYLSEKEADR
FT                   VLKTMIDWGRYAEIFAYDFNTGILSLENPGKGA"
FT   gene            complement(149769..150383)
FT                   /locus_tag="lpa_00180"
FT   CDS_pept        complement(149769..150383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00180"
FT                   /product="thiol-disulfide interchange protein DsbA"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23380"
FT                   /protein_id="ADG23380.1"
FT                   /translation="MFKKLIALLFLMPMTALATQFIEGKDYQTVASAQLSTNKDKTPLI
FT                   TEFFSYGCPWCYKIDAPLNDWATRMGKGAHLERIPVVFKPNWDLYAKAYYTAKTLAMSD
FT                   KMNPILFKAIQEDKNPLATKQSMVDFFVAHGVDREIAKSAFENSPTIDMRVNSGMSLMA
FT                   HYQINAVPAFVVNNKYKTDLQMAGSEERLFEILNYLVRKSA"
FT   gene            complement(150394..150996)
FT                   /locus_tag="lpa_00181"
FT   CDS_pept        complement(150394..150996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00181"
FT                   /product="cytochrome c4"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00181"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23381"
FT                   /protein_id="ADG23381.1"
FT                   /translation="MKKLALVLILCSSSVIFAQENPQEAGQSKSTVCTACHGPQGISTN
FT                   PEWPNLAGQHEKYFVKQLKDIKEGKSRSAPTMTAIVANLNERDMDDLAAYYAKMPVAEG
FT                   STPEKYLKRGEQLYRGGDLNKHIAACIACHGPRGSGNAQAGFPLLSGQHAAYTVMQLQA
FT                   FKDGKRTNDLNQIMQDISSKMSPEDMEAVAYYIQGLY"
FT   gene            151071..151673
FT                   /locus_tag="lpa_00184"
FT   CDS_pept        151071..151673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00184"
FT                   /product="GTP binding protein EngB"
FT                   /note="COG0218, Predicted GTPase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00184"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23382"
FT                   /protein_id="ADG23382.1"
FT                   /translation="MPINLYSKAVFLKSAARVNQLPEDSGYEVAFAGRSNAGKSSALNC
FT                   LTNNKNLARTSKTPGRTQLINLFSLDEQRRLVDLPGYGYAKVAMEVKLEWQKNLAHYLE
FT                   ARQCLRGLILLMDVRHPLKDLDQILVNWALHRELPVHILLTKADKLSRSEVKNAVLKVR
FT                   QYYELAEHLVSVQAFSSVKKDGVEELISLLDRWYEWN"
FT   gene            151787..155098
FT                   /locus_tag="lpa_00185"
FT   CDS_pept        151787..155098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00185"
FT                   /product="ninein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00185"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23383"
FT                   /protein_id="ADG23383.1"
FT                   /translation="MTPLFPTQGPITIRQGIGGSCYLLSSLDCILNLGKDGEQLIKSLF
FT                   TQTEDGKVIVRIKRHEALKNNLQKNKMTGKYTHYVDELNNEDVFEISPERLKEIDNQYG
FT                   GVKSNSLAIKILERLVSYYYAGDWSNTNPLASVIAHDIPDRIAGFTSTAFLGKFFGIEA
FT                   EDIPYSKLDDIIKLKLMNPDEPVYISMSYGKVDGFGKFHGRHALRIDKIIPKGHGDYDF
FT                   VLINPHDNSKTETYKLDDLNKRNCRFCLFNTSIHRASLTKKLLTLSNDEGRYVFSNSGL
FT                   QKRLISLEEMNLLTDNKIISSCISLHKQIPYLEKLFLKLSVEEKKTLIACIANADGSKK
FT                   EFLKLFLTHIPAMDLLELVLREETSQELLGEVLAELALSSRVEENKLSPQAGINFNSEA
FT                   FLHLIVKSAIQQKINQFAYTPEKAKQEIESGVINFYFGGASSNLTRASGLRALFIANVF
FT                   SKKSIETLFPPKALFAKAIANYLTLKTLPDLLIEYLKSQDTSPIDEEFFDIVLTSATFK
FT                   DPDELFENLFRLSQINPEVAKALLVFASQKINVLFGISLEEYAKKIALKDSGEFKSWFE
FT                   SLSNPQPAIKIPEIDKVLRQQRVEDAKRVISDIVQRINSFSFSFEGFKTVAHLNLNAEE
FT                   LRSQLKKIVHSGELQNALQILDLPDGHPEVQKALERKLRMIDVAANRRLDFLKKYEADI
FT                   DEHVRRIKDFPIDFNGAGTIVAIESQRILLNKRLHTLVKAEDLLGERLIANPKIKMVYF
FT                   AQVEKINLRAELLQKQLLDEAQKVIDSVEKRIDNFVIRFNDISTSSAVEWQRNNLLQQL
FT                   DNLVKPNQALLGAEKVLDCNDLQPSIVRALQAKKQEINETADQLIIKINAEEVVKSYEK
FT                   QIREFPISFNRCQTVEEVITRKQDLIQSVRNLVGNKPDLLKAQEQLQLLSGEYHSDIKM
FT                   ALTDKVREINRQADAVSKRITDQIAATKETLNILAEIKFSDHLKIIESMVKTLEAKAVG
FT                   DKNYKRAAPIARAFYNNLLMAEERFKNSQLPKNVKCKDFHQACARAINAVIPVLEIHRG
FT                   WKQVFADLASALVTLCTLGGANLYAGRWRLFPVPTESEKIVKDFSVSMQPLAVRA"
FT   gene            complement(155195..157078)
FT                   /gene="acs"
FT                   /locus_tag="lpa_00186"
FT   CDS_pept        complement(155195..157078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acs"
FT                   /locus_tag="lpa_00186"
FT                   /product="acetyl-CoA synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /note="COG0365, Acs, Acyl-coenzyme A
FT                   synthetases/AMP-(fatty) acid ligases [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00186"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23384"
FT                   /protein_id="ADG23384.1"
FT                   /translation="MLPVHLKHPHLTPTEESLSEFWSEIAAQTIDWIQPWSITLQGGLH
FT                   KGDVKWFQGGLLNVSANCLDRHLPHKANQTAIIWEGDDENQNKTLTFAQLYSEVCKMSN
FT                   VLKSLNVRKGDTVGIYLPMIPEAAIAMLACARIGAIHTVVFAGFSAHALQQRLTASSCK
FT                   CLITVDAFQRGGKTIPLKKQADEASVDLNITKLVVKNSNVPMALNKNKEHWWHELKQTV
FT                   SDQCTPEPMNAEDPLFILYTSGSTGQPKGVVHTTGGYLVQAAYTHQLIFACQDNEVFWC
FT                   TADVGWITGHSYVVYGPLCNGITTLMFEGIPTWPDAARNWRIIDKHQVNVFYTAPTAIR
FT                   SLMRAGDQWLNSSSRNSLRLLGSVGEPINPEAWNWYHQKVGQGKCPIVDTWWQTETGAI
FT                   MISPRASDEVIKPGSARKPIPGIIPLLLNEQGHEINGSGEGFLAIKYPWPSMARTIAGD
FT                   HQRYCNTYLSNGYYITGDGAKRDEDGDYWITGRIDDVLNVSGHRLGTAEIESALVSHPK
FT                   VAEAGVVGIPHDLKGQGIFAYVILKQGNKPDAKLQTELMERVKDEISAIAKPDVIQFVN
FT                   DLPKTRSGKIMRRILRKIACKEVSHIDELGDLTTLANPQVVEELMKNVLRQ"
FT   gene            complement(157080..157976)
FT                   /locus_tag="lpa_00189"
FT   CDS_pept        complement(157080..157976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00189"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase
FT                   and related beta-hydroxyacid dehydrogenases [Lipid
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00189"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23385"
FT                   /protein_id="ADG23385.1"
FT                   /translation="MANIGFVGLGHMGFPMAINLLKAGHSVMGYDLQQSALEHFAEQGG
FT                   AIAHNLQELAKDKDVIVTMLQTGQQVLHVCLGVDGIFSQLNAGSLYIDCSTIDVKSSRE
FT                   THQIAKENHLLVVDAPVSGGVAGATAATLTFMVGGEAEAYNAAHPILSAMGKKIIHTGG
FT                   AGSGQAAKICNNMILGTTMIAISEAFILAKELGLSDGKLFEVVNNSSGQCWAMSKYVPV
FT                   PGILENVPANNDYKPGFAANMMLKDLLLSQNTAKSVHIETPLGAKTTEIYQQFVDQGLG
FT                   DIDFSAIIKHIGKTQEV"
FT   gene            complement(158000..159499)
FT                   /locus_tag="lpa_00191"
FT   CDS_pept        complement(158000..159499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00191"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.27"
FT                   /note="COG1012, PutA, NAD-dependent aldehyde dehydrogenases
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00191"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23386"
FT                   /protein_id="ADG23386.1"
FT                   /translation="MGYNVPHYIGGQLINETDTEAQAIYNPALGEIIGQVHFASKATCD
FT                   RAVAIAKAAGNEWSQTPAIKRARVLFRFRELLEKYQMDLARIVTREHGKTLDDAKGSVA
FT                   RGIEVVELHCGLVNELKGDFSAEVASHIDCHTFRQPLGVCAGVSPFNFPVMVPIWMMIP
FT                   AIACGNTFILKPSEQNPSAPVRLLELLSDAGLPPGVANCIQGNKTTVEHLLTHPDIAAF
FT                   TAVASTPVAEYIYTTAAAYGKRAHTFGGAKNHCVVMPDADLDQAANAIVGAAYGSAGER
FT                   CMALSVVVTVGQHTADALINKISPLIRAIRVDAGDVEGTDMGPLVSQAHRQRVLAAIEK
FT                   GVNEGARLIIDGRTFQHPQYPQGFYLGPCLFDEVTEEMSVYQNEIFGPVLVIVRVNHFE
FT                   EALALVNKHQYGNGTAIFTRDGFTAREYSQRVQAGLVGINIPIPVPIANHPFGGWKRSV
FT                   FGDTNMHGEESIHFYTRRKTVTSKWPITELKDSSFAMPTHD"
FT   gene            complement(159610..159786)
FT                   /locus_tag="lpa_00192"
FT   CDS_pept        complement(159610..159786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00192"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23387"
FT                   /protein_id="ADG23387.1"
FT                   /translation="MKSIEDFTGFSESGIDDAIQNALKKAGNPTHFEVVETLGSQDSQS
FT                   DRRYRVTLKTLSD"
FT   gene            159964..162432
FT                   /locus_tag="lpa_00194"
FT   CDS_pept        159964..162432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00194"
FT                   /product="Predicted oxidoreductase"
FT                   /note="COG3573, Predicted oxidoreductase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00194"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23388"
FT                   /protein_id="ADG23388.1"
FT                   /translation="MGKGIILRVLENTILSPQVFDTLERLLPGYKVEYFKEQPDYRKSI
FT                   ARRIDSLHDAFSFILKAYPLDPKHTSLTVATLSTYAAECKASCDLEKLTLEELHLELER
FT                   FTAKLVEAIAIAWKWPKGKAVKEAIASLNEAEQYVLMSRGRSDIATIMPIEMGSETKYV
FT                   LQYDESLSPVYEQWLTELKQLKEYNFPKTPAWFKNLPPYQQAYYCNLNLSSVDPKKALQ
FT                   HFNTFFGNWGDIAKRSLNLTTELNQIHTNSPPYPSWFNELSPAQQAMIRVLSATPHEIK
FT                   SSLKEFKKFMVEQARNDQYASTLSLVPKLPQWYWVLSEQQQYFLEYALKNAEKVEDVVS
FT                   YLSSRHRTLPAPANYGAHSLYLIDGEGKETLFYDKRYRSSHVASRDSLKFPEDVQQRHV
FT                   DSNLVKVMEFAKPQQPLLLQTLISPIHAVDYIPTVVTDFLPELPPDLELYKIAREAVTR
FT                   SKRRHEIFQHNHPFNIAKRYYYTQATDTDSEFLLKAAQKYVSSKLGLQALIDDYKAVLE
FT                   SPLGSATFWDYDGRELFLSSLEELIILNMGGYSYGSCVSGKDRKAVELLHTDAMILYKA
FT                   KYGNWPKFGIPKEKQERVNFINIVVDLYISRHQHELAGQNAPGSEGIKTPDWYWPNDIA
FT                   EAINERLGTEKALAYDDRLATDNEVKNISKDLRSFFLPENELHCLLIAKQLGEKMCTML
FT                   YDVLSALINEERRFQKSSKDSWKLRWFSDKDVSSTPTGILNIREVMHDENSGNDNVLRI
FT                   GKIFAAVLNRPESDSSRTTATNSVYDRIRKLLQPLSSESTLQTLAEEAILEWSSLFESS
FT                   KRENSGLVYM"
FT   gene            complement(162536..163267)
FT                   /gene="dapB"
FT                   /locus_tag="lpa_00195"
FT   CDS_pept        complement(162536..163267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="lpa_00195"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="COG0289, DapB, Dihydrodipicolinate reductase [Amino
FT                   acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23389"
FT                   /protein_id="ADG23389.1"
FT                   /translation="MRTRVIVNGANGKMGILACETLENHEQFEVVAKLSRQDNLGQSIL
FT                   DTKAQIVVDLTRADCVYENSLTIINHGARPVIGTSGLVETQIDELTKLCEIKQIGGIIA
FT                   PNFSLGAILMMMLATKASEYFSEVEIIEGHHQQKLDAPSGTALKTAEMIAAARKKPKNK
FT                   LPLKELTPGARGGSHHDINIHSLRLPGLLARQEVLFGNIGETLSITHNSIDRHCFMPGI
FT                   VLACQKVLNLTNLVYGLEHLL"
FT   gene            complement(163446..163631)
FT                   /locus_tag="lpa_00197"
FT   CDS_pept        complement(163446..163631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00197"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23390"
FT                   /protein_id="ADG23390.1"
FT                   /translation="MRIILSILAIFMPWLVLLIKDNPGGAVVALIMQATLIGWPFASIW
FT                   AWRAVNPLTPASQSKQ"
FT   gene            163988..164680
FT                   /gene="proQ"
FT                   /locus_tag="lpa_00201"
FT   CDS_pept        163988..164680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proQ"
FT                   /locus_tag="lpa_00201"
FT                   /product="Activator of osmoprotectant transporter ProP"
FT                   /note="COG3109, ProQ, Activator of osmoprotectant
FT                   transporter ProP [Signal transduction mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00201"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23391"
FT                   /protein_id="ADG23391.1"
FT                   /translation="MRKQALHPRTAVINKAQKNQSKRARSDALLWLAANFPEAFDNSLR
FT                   IRPLKIGIMSDILQHAEKAEQVGISKSKLREAVVLFTRRLDYLACLKAREVRIDLHGNP
FT                   VAEVTEEEAENASMKIKKRVEKSVKNARKQVNAKAANHSHVNNQPSTVSSVKPMNSFDS
FT                   HPEPLLPIYPLRSSTYASQNVAMQSAKSPSVVVKHKAPKQYDPDAVARLKEKLGLSRKA
FT                   EDKKETTE"
FT   gene            164681..165751
FT                   /locus_tag="lpa_00203"
FT   CDS_pept        164681..165751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00203"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23392"
FT                   /protein_id="ADG23392.1"
FT                   /translation="MRIATLFSAVLFISPLWAAPKFFPSQPALNGVYDIKGTELCSTAK
FT                   HTLAYLNKGKNYDPQVIHDGKVIKISLDRVKKTLEFICQNQKKLNNPDFVKQHFDFIRW
FT                   YPDLRQAKQLSANKPLLQNIPKDKILMTKYFVHLAGASPKPSSAKPYPLYALPEDEQNL
FT                   TLDEANAKPGLIRFKYGKQAILSGALKNQPVSELAYLSRDDLEAALLQGTVVADFGPTA
FT                   GKKIFNVHRSNNITYDRTKTPYQQERFWYFKEVDGIKGYGKDAEYKITVNPKVTFAADL
FT                   AEFGLGKLLMIQYQDKSGRPMTKMGILADTGGAFNNNLYQIDYLAGSFAGKDALYRATR
FT                   DLPDYVDAYFMILKQP"
FT   gene            complement(165851..171448)
FT                   /gene="sdhB"
FT                   /locus_tag="lpa_00204"
FT   CDS_pept        complement(165851..171448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="lpa_00204"
FT                   /product="SdhB protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00204"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23393"
FT                   /protein_id="ADG23393.1"
FT                   /translation="MPDKKSSETLLSQQINEVRGLLLQALKTQLDDLVAEKLIPQPSGV
FT                   PFVDFEKDPPQIATLKKVINCLYHAEEAFKSWESIDTSTLLGKAKAAPKLIHALTQIYK
FT                   SLGLLDEASPEIRSVIADNYHLLEPLFTQAYAIVQESGWLSEFMEMDVTDKASKVIFQG
FT                   MDLLGPDVDKWHDTHPLVDAFSKISKLVETISTLQEKDMPGKEKEQAVELIRALLDDLD
FT                   NNPFISKLSISDFEDSKAIKDLLEWFKNIQDDGFDFSKKSIKQYVSWANHYLPTLIAFA
FT                   DQLERQNYLKPGSLSANLCSQIEHLGKQVNDILSEPGFGVTERVVTIDSLQGQREQKIH
FT                   NAQVKSVQVIMATEKQLAATADFYQILEAYKGMNLSQITEPDRRVLRQLYPQIQTALAH
FT                   ASLDLENQLTSVLNTTGPEKTPAKPKSWWELAKDGLGYVASYVVNYNVDKILGTRESVD
FT                   RFLSSQIASEQFKILIAEKAREKLRTGSDKIKETALQYQAEARLNAIKSTLRKQPSQIE
FT                   APPSEFVAVKPSKLVNLRGTLTAIQEMQLSTTVNGTRTSVDTLIHRHLPEKYQACFSTL
FT                   PYQINENDPELVKKIKTVENNLFQLEKALKDFEKIDLSYGIMIRLHYFIAIASAASKLK
FT                   SSVKELPPEGQKALAPLLQQIMTLGLSFSDTNYTANDLSALQQLKMEGEVRPKSPSVAS
FT                   PDTIGTLPEETGKRTVKKPKEKTTELLDYADKISNARASLLNKFKNTLSPALADSLNPQ
FT                   KNGVPFVHLDQDPPQIAAIKKIINSMYHAECALKTWHGIDTSTTLGKVAAAHQGVAALS
FT                   QVYKSFTLFTEDFSDIHNLIRENHDLIAPVIIEANKLVNQYGWARQFSELDIAQQLGSI
FT                   LGQGINTVQPKTDEITQTASLVKLFSEIPRLLNNISSSLDQKSEKSIDELRISNKKIEA
FT                   IGAVFELFFEENAHLMSMFKGFSAISGLIELNKKIQLEGTNLQEVTIRQYQSWLKEGYP
FT                   NLMMMLDEIETRHYLTPGFLSAPIALELDQINDKLNEIIETKPDFKLQKIPLSFYMGDK
FT                   RIERLMTKKTEHCLAVLQIEEQKKAVNTFFGILKHYSDQPLSNIKPNELAQLRLAFVEI
FT                   QSAMANSNLELSNDFVATLNQLETSPPEKTKKIQVTVSQLLKVQPAVETYLNEHKKSSE
FT                   LKIAVIDKAIEHVKDKSFELKSGASKEINIPQLRRTFLETESKKPVVGPGELKPTSVSS
FT                   LNTVRGNLAYIQELKMSSTVGMMREQFSALTRDNFSNRVQKYLIKPQDKPLHMINDNDP
FT                   LMVRQIKEVENGLYHLETALKQFEQMKKSDSLVSQTKALLEIANHALQLKMAVERFSPE
FT                   LKEHYGPLVRTVLSFSNKIQSINYNKEDWADLQFILNRAHKELLKRKTPRDHRIEKAFF
FT                   EAGVREVQIDRDESVGKKAAKLGVKYAHLASPQLEKARAYLSSRYKNAFGQQPKVIRSF
FT                   TREQLANEEFMDAEISRLKETLEEKYGFNIATIKVLLDLLEQIQRAGAQAAEVAGMVNT
FT                   LVTYDFPKIKENAYRDLLTKLSQEEDYLNLKPGTLINPAMAAVNQLFLSAALELDMPFS
FT                   KKLSILDDTTYVNILIRQTESDLQTLKKKLSEDPSNHEIAFEIEIKNDKLAFLRQQMVL
FT                   LEDKNPNQTRNVLMDMQFEVSLRNHLVYTTLKAPIAQEYEQIAREYYKKNKNRFLYADD
FT                   CSKELLQGLKEFEKKYLPDHLIVFEAYDRLRLFSAKLPPKNQDVKEYIENINRELQNRD
FT                   IPIRQRALKVKLLPNDTVFIEKLISADKGTHFLRKFMQFITIITSSITEAIKTGGSLVY
FT                   IYRQKQMEQSIKNIEKSISFKEELHTIKDPDGPSPRKEEGQEGEIEFTKL"
FT   gene            complement(171570..172994)
FT                   /gene="pykF"
FT                   /locus_tag="lpa_00206"
FT   CDS_pept        complement(171570..172994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pykF"
FT                   /locus_tag="lpa_00206"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="COG0469, PykF, Pyruvate kinase [Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00206"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23394"
FT                   /protein_id="ADG23394.1"
FT                   /translation="MLRRTKIVATLGPASKEPEILRSMLAAGVNVVRINFSHADSSALQ
FT                   LIALVRKIADELNHPVAVMADLQGPKIRVGRFQNKSITLIDGQNFTLDCMAPDTLGDIN
FT                   GVSVAYPNLANELSISDHLLINDGLIELEVIEISGSKIHCKVVEGGVLTDLKGLNRKGG
FT                   GLAARTLTEKDRNDLRTAIEAEVDYISLSFVKDAEDIRQARALMKDYGAQITPIIAKIE
FT                   RMEALDHLTDIIREADAIMVARGDLGVEVGAAEVPAIQKHIIEQTRLLDKVVITATQMM
FT                   ESMISNPQPTRAEVSDVANAILDGTDAVMLSAETASGLFPVKVITMVNKICLSAEKHAS
FT                   FFYHSDLETCHYQRADQAIAMATMHTANHFPIQAIITLTESGDTALWVSRHHSTVPIFA
FT                   ISANKRTIGRLSLVNNVFPIYIDFHQFNPEGLNQQILHELIKSGHLEKRGYVLLTRGTQ
FT                   IGMPGGTNCMEIIPVV"
FT   gene            complement(172978..174168)
FT                   /gene="pgk"
FT                   /locus_tag="lpa_00207"
FT   CDS_pept        complement(172978..174168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="lpa_00207"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="COG0126, Pgk, 3-phosphoglycerate kinase
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00207"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23395"
FT                   /protein_id="ADG23395.1"
FT                   /translation="MNLIKMSDIDLSGKRVLIREDLNVPIKDGMITSDQRLQAALPTIK
FT                   SALDSGAAVIVLSHLGRPEEGKYEKKFSLEPVADYLRENLEYPVRFVKDYLSGVDVNPG
FT                   ELVVCENVRFNPGEKGNDEALAKKLASLCDVFVMDAFGTAHRAQASTYGVAQYAPVAVA
FT                   GPLLIRELEALNQVLKAPKKPIVAIVGGAKVSSKLSLLKQLVGMVDVLIPGGGIANTFL
FT                   KAQGFEIGISLYEPDLLDEARHILILAKEKGCQIPLPTDVVVGKTFSETCPAFNKSLSN
FT                   VAADDMILDIGPETIRDYVDLIHEANTIIWNGPVGVFEFPQFAYGTRAIAIAIAESDAF
FT                   SIAGGGDTLAAVDLYDLNQQISYISTGGGAFLECLEGKTLPAVAILQERAKHVKTN"
FT   gene            complement(174179..175171)
FT                   /gene="gapA"
FT                   /locus_tag="lpa_00210"
FT   CDS_pept        complement(174179..175171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gapA"
FT                   /locus_tag="lpa_00210"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="COG0057, GapA, Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23396"
FT                   /protein_id="ADG23396.1"
FT                   /translation="MTIRVAINGYGRIGRCILRSIFEYNRQNEFEVVAINDLSGIDVTA
FT                   HLTRYDSTHGPFRSDVSIEGNMLIVDGHGIQVIAERDPAKLPWKQLDIDIVFECTGFFT
FT                   SRDAAMGHINAGAKKVLISAPAKGVDTTVVYGVNHSVIKASDVIVSNASCTTNCLAPVV
FT                   KVLNDAIGIESGLVNTVHAYTKDQMLLDGSHKDLRRARSATQSIIPTKTGAAAAVGLVL
FT                   PELAGKLDGFAMRVPVLNVSVVDLTFQAKRATSVEEVNDIMRKAKSRILQINEDPLVSC
FT                   DFNHNPASAIFDTTETKVIGNLVKVVAWYDNEWGFSNRMIDTAHQMMNC"
FT   gene            complement(175253..177259)
FT                   /gene="tktA"
FT                   /locus_tag="lpa_00211"
FT   CDS_pept        complement(175253..177259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktA"
FT                   /locus_tag="lpa_00211"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="COG0021, TktA, Transketolase [Carbohydrate transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23397"
FT                   /protein_id="ADG23397.1"
FT                   /translation="MNSFTELANAVRMLSIDAVNQAQSGHPGMPLGMADIATVLWKKFL
FT                   KFNPKNPHWFNRDRFVLSNGHGSMLLYSLLHLTGYNLDINELKNFRQLHSKTPGHPEHG
FT                   HTPGVETTTGPLGQGLANSVGMALAERVLASHFNHDHYNLVDHYTYTFAGDGCLMEGIS
FT                   HEACSLAGTLGLGKLIVFYDDNGISIDGKVESWFTDDTTSRFKAYNWQVIGPIDGHDAA
FT                   QIEQAISAARENTTQPSLIICKTVIGLGSSVAGSEKAHGSPLSAQDINNVREFFNWKHA
FT                   PFEIPDSIYKQWDHREQGEKEEQQWLQLLHEYRQQHPSEHDEFLRRANGDLPDDWQEIS
FT                   AGFLKQCLNNEKAIATRKASQQCIEFFAPILPEMFGGSADLTGSNNTDWSGSKAITAHN
FT                   FSGNYLYYGVREFAMAAIMNGLAVHGGFIPYGGTFLVFADYARNAIRLSALMKQRVIYV
FT                   LTHDSIGLGEDGPTHQPIEHIAMLRMTPGMTVWRPADLMETAVAWQQSLEHHNGPSALL
FT                   LSRQNLPALAHGADAADLIKKGGYIIADCEGKPDAILIATGSEVQLAITAAEKAKARGL
FT                   QVRVVSMPCAERFLAQSDAYKNQVLPGQVRTRIAIEAASSAYWHQFVGFDGAVIGLDCF
FT                   GVSAPATDAFNYLGITVEKIINTLDTLTKQTMV"
FT   gene            177517..178851
FT                   /locus_tag="lpa_00214"
FT   CDS_pept        177517..178851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00214"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23398"
FT                   /protein_id="ADG23398.1"
FT                   /translation="MTPIISHLLKIFPELNTQVKTDSLNWTFNTHLKQLGPDFYSKVAR
FT                   LHPILNVEYSVLCQRLRHNLSSPDYSSLEQIKEQLIDALKLAELLEYTYQHYLVVPREV
FT                   VRLRRHKAIYRELLTELSGYSFALDNPEPESLKTSLSLTQAIREKTAQSNWYRIFISRS
FT                   KRVINLLDNLDTGSKAFRDFVVLLDKYTNPFLAYLGWCFFAPRLFTNLFLILKHTIPGE
FT                   WMGEKEKSLDWSDRFYAHLQRRWFELANDSVWFTVGILNCFVLVGALAPLSVYLSLFAF
FT                   VFDVANTSLRAYIEIGRLQQLQKEYGELFDQEENEDQKKIIKEYQDSISYRIKFEILRS
FT                   FLSVGGAVAVVIAMALSVPALGIINPVIPLIGAVLLLALWGVSLYLSNKLDEYRPVDNI
FT                   EKPAPSVINKLSFFAPKNEKKESLHLSSKPEKDLEAEELIPTFTF"
FT   gene            178951..180966
FT                   /gene="dcp"
FT                   /locus_tag="lpa_00215"
FT   CDS_pept        178951..180966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcp"
FT                   /locus_tag="lpa_00215"
FT                   /product="Zn-dependent oligopeptidase"
FT                   /note="COG0339, Dcp, Zn-dependent oligopeptidases [Amino
FT                   acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00215"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23399"
FT                   /protein_id="ADG23399.1"
FT                   /translation="MSTTVGLPQFSHIKIEHFKSHLDALLKNHLEEIDRLLKENHHYTW
FT                   DNLIYPLDSLADELERFWSPFAHMHAVMDSEAIRESYEACLPLLSAYDAAIGHNQDLYE
FT                   AIKSIDQHSLNPAQKKIIADSIQDFELSGVALSKANKKRFEAIQSRLAELSSKFENNVL
FT                   DATHAYTIHITEAERVEGLPEHALNTAKELAHEKGLDGFVLTLEYPCFQAVITHAEDRA
FT                   LREEMYRAYITRASDQGPNAGTFDNTPLIDEILSLRHEKAELLGFNNFAELSLATKMAA
FT                   STNQVTEFIYDLISRTRDKGKAEFRQLEVFAQDKWNLSPVNPWDVAYLSEKRRQDLYSL
FT                   SQEELRPYFPQPKVMQGLFAIVKKLFGMSIEEIEGVDVWHKDVQCYCIVDESNQTRGYI
FT                   YTDLFARPHKRNGAWMDSMQSRRKLEDGTVQLPIATLTCNFAKPSANRPAMLSHDEVVT
FT                   LFHEFGHCLHHVLTQVDYLGGSGINGVEWDAVELPSQFFENWCWDEHALSLLTSHVDTG
FT                   ETLPSALYERLIAAKNFQSAMAMLRQMEFALFDFRIHQEYQTGKASYVANILADVRSKT
FT                   CVVPIVPYNRFQHSFSHIFGGGYAAGYYSYMWAEVLSSDAFARFEEEGIFNPKTGHDFL
FT                   KSILEAGGSRKAADAFLEFRGRPATIDALLRHNGIL"
FT   gene            181120..181524
FT                   /locus_tag="lpa_05002"
FT   tmRNA           181120..181524
FT                   /locus_tag="lpa_05002"
FT                   /product="tmRNA"
FT   gene            181577..181738
FT                   /locus_tag="lpa_00217"
FT   CDS_pept        181577..181738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00217"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23400"
FT                   /protein_id="ADG23400.1"
FT                   /translation="MSLQLIKRCFSWSFVGYKMPQKSPTILKFCPSGAPKAHSKIGNIG
FT                   LLFIQQLW"
FT   gene            complement(181799..183103)
FT                   /locus_tag="lpa_00218"
FT   CDS_pept        complement(181799..183103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00218"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23401"
FT                   /protein_id="ADG23401.1"
FT                   /translation="MGDILPNSPDIQKPELQQHEIVLRLFVTQLNTGYKDGWLYYKCKE
FT                   KDLLSVYNEYRSKGFFNLLKSNAKDGFDKPKLTIELVPKTCWFSNVRSNVTPSQWNKLK
FT                   KISSQEANHRCKICGGKGPKWPVECHEIWEYDDSRLVQTLKGLISLCPSCHSAKHMGFA
FT                   QLCGREVEITCHLAIVNKWSYEFACEYISEQFKVWENRSKYTWLLDISWLEQHGILVEN
FT                   QDRIDTLYTNINKAKREYFLNNRKAAIDHFNQGANFEKSGNYKKAYSEYLAASNFGDFD
FT                   AAYNLAIFYSRGDLGEVDLRKSWYYLKKAACLGDKQASTLIQKGKQHFERSINKKADCV
FT                   KKESSQLPEDIEKHQAVLINNTSENDYTSMVHSSTLEEKDSNSNKQAAFNETSQSKLVY
FT                   EHAFKNYENVFLRSLKIIRKSFKKWANRSSPSNSS"
FT   gene            complement(183238..183897)
FT                   /locus_tag="lpa_00219"
FT   CDS_pept        complement(183238..183897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00219"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23402"
FT                   /protein_id="ADG23402.1"
FT                   /translation="MNIKKEIGKRIFEARKEKGLTLKELGELTGGLKQTRLTNWEQGTR
FT                   APGPEEIKLLAQALDVSPAFLMCLSDDQQVKRTKSYSHLIPLLDHHQACDAKSFIEAIS
FT                   DQGSAGDVVWISVSATLIQELSSEAFALKMPDESMMPELRLNDVLVVEPSVTPCPGDFV
FT                   VVKLANKLEAIVCQYRETTYTEFELVTLNDNWPNIKNTKEFRIEIIGKIIENMRLY"
FT   gene            184068..184952
FT                   /locus_tag="lpa_00221"
FT   CDS_pept        184068..184952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00221"
FT                   /product="Legionella vir region protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00221"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23403"
FT                   /protein_id="ADG23403.1"
FT                   /translation="MMDFVINGEELEAMSGLPHIQQLAYLRGIRPYMDVKTGITGIKRR
FT                   ISYQSIAEQLYIEPHQGIKSQSFSRDQVRRAISGLTRAGLIEVQSEGKQLILKCPLASR
FT                   HFSVQNKAAINPPQKATIKPHEKNLVNTGFSEKECTKADTVEPPKAATPLKDNNYIYLL
FT                   SAFEQFWNLYPEKKSRERAFEAFKQINPDQHLLRTMLQALQNQIKARNAKEAHGGWVPP
FT                   WKYPTNWLAQKCWEDEVNIDLKQEKRNAKRRSSTETTARDPFWNPETEDTASIAEEEYE
FT                   HDNVVNLQRYRQQ"
FT   gene            184969..185280
FT                   /locus_tag="lpa_00222"
FT   CDS_pept        184969..185280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00222"
FT                   /product="lvrB2 Legionella vir region protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00222"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23404"
FT                   /protein_id="ADG23404.1"
FT                   /translation="MFTRFAVFYGHLWRSQFKSDGFLEFAKKEWLEGLSQFNDEILHQA
FT                   IIECRDYCEMPPSLPQLIGICRDIKKRNHFYVTPKEYTPASKEVVKTNIKQCKAFLFK"
FT   gene            185299..185565
FT                   /gene="csrA"
FT                   /locus_tag="lpa_00223"
FT   CDS_pept        185299..185565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csrA"
FT                   /locus_tag="lpa_00223"
FT                   /product="Carbon storage regulator"
FT                   /note="COG1551, CsrA, Carbon storage regulator (could also
FT                   regulate swarming and quorum sensing) [Signal transduction
FT                   mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00223"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23405"
FT                   /protein_id="ADG23405.1"
FT                   /translation="MLVLTRRVGESVVIHDDVYCTIVGYRDGEVRLAFDAPRSIPVHRD
FT                   EIQRRIHRARIKDNWFIDKAANKESIVDRLINKFKNSTSAVKA"
FT   gene            185578..186543
FT                   /locus_tag="lpa_00224"
FT   CDS_pept        185578..186543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00224"
FT                   /product="hypothetical protein"
FT                   /note="COG4962, CpaF, Flp pilus assembly protein, ATPase
FT                   CpaF [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00224"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23406"
FT                   /protein_id="ADG23406.1"
FT                   /translation="MNVDNEPLVTVKDRAKEKLRRELGDLIGNVLNDPKTVEIMCNADG
FT                   KIWQERLGESMRCIGNITVARAESIIKTIAGFHGKEVTRFKPMLEGELPLDGSRFAGQL
FT                   PPVVSGPTFAIRKKAISVFTLDDYVQSEIMTPAQCEVIQQAVANHRNILVIGGTGSGKT
FT                   TLVNAIIDEMVKSAPEERIFIIEDTGEIQCTAENCIQYHTTLDVSMTQLLKTTLRMRPD
FT                   RILVGEVRGGEALDLLDAWNTGHEGGAATLHANNCIAGLHRLKSLITRNPAAPSEIEPL
FT                   IGEAVHCVVHIARTPAGRRIEEIISIHGFDKGRYRIEKLV"
FT   gene            186556..186933
FT                   /locus_tag="lpa_00225"
FT   CDS_pept        186556..186933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00225"
FT                   /product="Conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23407"
FT                   /protein_id="ADG23407.1"
FT                   /translation="MTQVSTLNYKKMWMMGLVVLFLLFITHPAMASTAGGGLPFDSWLT
FT                   KIQKSITGPFAFSAAIIGLVAAGATLIFGGDMNGFMRTLVFFVLVLSFLVAAQNTMTAI
FT                   TGKGAEISKPSTEVNAAEHQL"
FT   gene            186930..187229
FT                   /gene="trbD"
FT                   /locus_tag="lpa_00226"
FT   CDS_pept        186930..187229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbD"
FT                   /locus_tag="lpa_00226"
FT                   /product="Conjugal transfer protein trbD"
FT                   /note="COG5268, TrbD, Type IV secretory pathway, TrbD
FT                   component [Cell motility and secretion / Intracellular
FT                   trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00226"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23408"
FT                   /protein_id="ADG23408.1"
FT                   /translation="MSLRTIPIRKCGNRPNLFLGGDRELVMFSGLLSAILVFAAQDWLA
FT                   AIAGMVMWFLSLKGLRLMAKSDPFMRAIYLRQRSYQAYYAPRSTPFRENKRGYQ"
FT   gene            187226..189763
FT                   /gene="trbE"
FT                   /locus_tag="lpa_00228"
FT   CDS_pept        187226..189763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbE"
FT                   /locus_tag="lpa_00228"
FT                   /product="Conjugal transfer protein trbE precursor"
FT                   /note="COG3451, VirB4, Type IV secretory pathway, VirB4
FT                   components [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00228"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23409"
FT                   /protein_id="ADG23409.1"
FT                   /translation="MIPVITFLLSLTGLIFLSFLFYQTRLNSQTHHLKKHRQQKAGFVD
FT                   LLNYAALVDDGVIIGKNGSFMAAWLYSGEDHANSTDKAREMVSFRINQALSAMGSGWMV
FT                   HVDAIRRAAPSYSERGCSHFPDPISLAVDEERRQLFERLGTLYEGYFVITLTWYPPVLA
FT                   QKRFEALMFDDNQARLSQKAKTHQLIEEFKQSCRNFESRMSSALNLERLQSEKIINEQG
FT                   STVIQDNFLRHLQFCATGLNHPVNLPKNPIYLDALIGGQELLTGITPKIGKKFIQCVAI
FT                   EGFPMESYPGILTALTLLPIEYRWSSRFIFLDAHEAVAHFTKFRKKWKQKVRGFFDQIF
FT                   HTHSGAIDEDALNMVEDAQAAIAETNSGLVGQGYFTSVVILMDEDRALVEKAALFIEKN
FT                   INALGFTARLETINTMDAFMGSLPGHGVENIRRPLINTMNLADLLPTSNIWTGENKAPC
FT                   PLFPPLSPPLMHCITSGNAPFRLNLHVRDLGHGIMFGPTRSGKSTHLGLIALSWRRYKD
FT                   ARIYSFDKGMSMYPTCKATGGEHYTIADKDSKLAFAPLQFLSTSADRAWAMEWIDTILA
FT                   LNGLNTTPAQRNEIGHAVISMHKSGSKTLSEFVMTIQDEQIRETLKQYTIDGLMGHLLD
FT                   AESDGLGLSSFMTFEIEHLMGLGEKFALPVLLYLFRRIETSLDGRPTLILLDEAWLMLA
FT                   HPVFKNKIAEWLDSMAKKNCVVFMATQHLSHAANSGILDTIVESTATKIFLPNLYARDP
FT                   ETRLIYERMGLNPRQIDIIASAQPKRDYYYVSEKGQRLYQLALGPLALAFVGATDPDSI
FT                   ERMKQLEDKYGAEWVSFWLSEKGVDIKSHGVAA"
FT   gene            189760..190503
FT                   /gene="trbF"
FT                   /locus_tag="lpa_00230"
FT   CDS_pept        189760..190503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbF"
FT                   /locus_tag="lpa_00230"
FT                   /product="Conjugal transfer protein trbF"
FT                   /note="COG3701, TrbF, Type IV secretory pathway, TrbF
FT                   components [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23410"
FT                   /protein_id="ADG23410.1"
FT                   /translation="MNKLKQWLNRLNTECKKSNLTDNPYLNAKRAWNVHTAGLMKSLQV
FT                   WQLVGLGSLLITLAAVGGLISIGSQSKFIPLVFQQDANGNTLSITRADRISQPSIDDYR
FT                   ATAAHFIENIRMVSADVELQKKAVFQVYSYLNQNDAALAKVQEFYNDKQHSNPFERAAH
FT                   EIVNVEIRSVLQESDKTWQVDWVETVRNRDGSIKEKPYVMKAMLTMYQDETLNDISSES
FT                   ILKNPHLIFIRDFNWSYDLKHGESR"
FT   gene            190500..191375
FT                   /locus_tag="lpa_00231"
FT   CDS_pept        190500..191375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00231"
FT                   /product="type IV secretion system protein VirB9"
FT                   /note="COG3504, VirB9, Type IV secretory pathway, VirB9
FT                   components [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00231"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23411"
FT                   /protein_id="ADG23411.1"
FT                   /translation="MKKIILSIGLLLPFSIFAQDNDELSNRYFSQSMPKLTYQETQALK
FT                   IAGKWQKGDKTSKPFQSSDGSVSFVYGSGQISIVCAPLQVCDIALQPGELFNDMNVGDP
FT                   RFIVEPSITGSGRNQQIHLIIKPKDVGLDSSLVVTTDRRTYHFRLKSERFEFMPYISFI
FT                   YPDEAKEKWRLIQKIQAENRKANTFPETNEYLGNLNFNYRIQGNARFKPVRVYNDGVKT
FT                   IIEMPKAMAQFEAPALLVLRKHGFLQKSKPVMVNYRLQGCRYIVDSVFDKAMLVVGSGS
FT                   AQEKITITRC"
FT   gene            191378..191788
FT                   /locus_tag="lpa_00233"
FT   CDS_pept        191378..191788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00233"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23412"
FT                   /protein_id="ADG23412.1"
FT                   /translation="MKKLSILLLTVLLSSCASMRYGNFTNASTAKDAYLAKDAVSQLTR
FT                   VYPPAQNTFCFRQKICDGFGRHLIQAMRQKGYGVIENVHPRQKANFFYVVDEAEPGRMY
FT                   RVSLYIGPQILSRAYANTRGKLAPISPWSHKE"
FT   gene            191794..193035
FT                   /locus_tag="lpa_00234"
FT   CDS_pept        191794..193035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00234"
FT                   /product="type IV secretion system protein VirB10"
FT                   /note="COG2948, VirB10, Type IV secretory pathway, VirB10
FT                   components [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00234"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23413"
FT                   /protein_id="ADG23413.1"
FT                   /translation="MHKNNDYLSPDSSPQKLQTTGVKRVNNMPLFIAIGVLTVFVLLIA
FT                   FVALKRANAQNLVTEPAKLTTAKKNTMSLAYEVIGNRKPETNQPVVNAPEPTLPVPPPQ
FT                   NTHENQSLDAQSVPDAEMERIRQEKTQAFEEAVNAKTSIMVDNARLNAREITNASTINH
FT                   DTTTEVNVVLNFKEQLNKLQARQNARPMPQTLGGEEGESRWHLNSRLESPNSRFELRAG
FT                   SVIPGVMVSGISSELPGQIIGQVSQNVYDTATGKYLLIPQGTKVIGLYSSDVSFGQDSV
FT                   LVAWQRLVFPDGKALDIGSMPGADNAGYAGFRDQVDHHYARIYGSALLMSGIVAGITYS
FT                   QNTNQTNPYGYNQPTAGSVLSQALGQQLGEVTSQMVSKNLNISPTINIRPGYRFNIIVI
FT                   KDLTFKSPYRQFAY"
FT   gene            193049..193789
FT                   /gene="trbJ"
FT                   /locus_tag="lpa_00235"
FT   CDS_pept        193049..193789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbJ"
FT                   /locus_tag="lpa_00235"
FT                   /product="Conjugal transfer protein trbJ precursor"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23414"
FT                   /protein_id="ADG23414.1"
FT                   /translation="MKLRLMLIFLWSANAFSNGAPVFDFANWLENGKIIVNQVHQYKTQ
FT                   IDQYNNQLQQYQNMLDNTKSLTSFQWDNANGVINNLLDATNTIDYYKQEAGSLQGYLDR
FT                   FQTEEYYQKSPCFNGDRRCTPAEMRKINQNKMAASVAQKRANDAMLKGIDKQQQNLKSD
FT                   SEKLRMLQTQAQGAQGQKQALQAASQLASNQSHQLLQIRGLLLAQQNAQATKDAAALNK
FT                   EAIQTAGDERFRSGTYHKSSGKKW"
FT   gene            193819..194031
FT                   /locus_tag="lpa_00237"
FT   CDS_pept        193819..194031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00237"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00237"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23415"
FT                   /protein_id="ADG23415.1"
FT                   /translation="MKILSLSIALLACLLSGCDNPETKARKKAAHLASLTCDSSKKGRT
FT                   KEELQAIADACFKRGSYSKSSGHKW"
FT   gene            194036..195451
FT                   /locus_tag="lpa_00238"
FT   CDS_pept        194036..195451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00238"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23416"
FT                   /protein_id="ADG23416.1"
FT                   /translation="MKKKTITYLAVFLLIGFSVNCHAHNSSIDSRDLLDNILYRFSATA
FT                   SMWSQTILSYARYLFWSLATISMVWTYGLMALRKADIQEFMAETVRFLVVVGFFYWLLD
FT                   NGPAIATAIMDSMRKLAANAAGIDAHISPSDIVDVGFDIVSKAIDNSSIWSPAATTVGL
FT                   IVAGVILVVLALVSINMLIILITAWILTYAGVILLGFGGGRWTQDIAIQYYKTMLGTAL
FT                   QAFSMILIIGIGKSFVDQYYAAMSNDILLKEMFIMLVVAILLLVLINKIPPVLSGIVSG
FT                   GGPSGGGNGIGLGGALGAAGIAGTALAGAAGAASAHSAGGLSALHAAFKAASQSVGAGD
FT                   SGSFSGGNSGSKLGGLAQAMGQASKFAGSFSSHLASGAFDVASEKLGSMKDSFSAKTAE
FT                   TTGGKIADAIQQRASSNAHSVTSNKTPATDNVTSMGAPEGSFSSGSGEYNQESGGADEV
FT                   SQFVNQKASGESL"
FT   gene            195448..197337
FT                   /locus_tag="lpa_00239"
FT   CDS_pept        195448..197337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00239"
FT                   /product="hypothetical protein"
FT                   /note="COG3505, VirD4, Type IV secretory pathway, VirD4
FT                   components [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00239"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23417"
FT                   /protein_id="ADG23417.1"
FT                   /translation="MSMSKPNKSIGPQVRKKRVEKTNKQIVFLVVLALFVSMQIGTQFV
FT                   AYKLHYHQSLGFSVAHIYLPWQLLWWNLQYHSIYPDYFNAAFGLVAMSGSLFLMIILFV
FT                   SKQLTQENVSEYLHGSARWANQDDLKDAGLIGNEEGVYVGAVENEKGDIHYLRHNGPEH
FT                   ILTYAPTRSGKGVGLVIPTLLSWKQSCVITDLKGELWALTAGWRQKHANNKVIRFEPAT
FT                   LKGSARWNPLDEIRVGTEYEVGDVQNLATLVVDPDGKGLETHWQKTSQALLVGFILHAI
FT                   YKLKNQGEPATFPNIDRMLVDPNTNIADLLIEMTQYPHIDGKTHPVISASARDMIDRPE
FT                   EEAGSVLSTLKSYLALYRDPVVAHNVSASDFCIKDLMHHNNPVSLYIVTQPNDKARLQP
FT                   LVRVMLNMVVRLLADRMEFERVDDGKGNRFVRTKRNYKHRLLCMIDEFPSLGKLDILQE
FT                   SLAFVAGYGLKFYLICQDINQLKSRERGYGPDETITSNCHIQNAYPPNRIETAEHLSKL
FT                   TGQTTIVKEHITTSGKRVSTFLNQISKTKQEVSRPLLTIDECQRMPGPKKDANGLITEA
FT                   GDMVVYVAGFPAIYGKQPLYFKDPVFIARASVESPEQSDILRTRLSEDEEIRL"
FT   gene            197334..197879
FT                   /gene="traF"
FT                   /locus_tag="lpa_00240"
FT   CDS_pept        197334..197879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traF"
FT                   /locus_tag="lpa_00240"
FT                   /product="Conjugal transfer protein traF precursor"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23418"
FT                   /protein_id="ADG23418.1"
FT                   /translation="MKKFMAWVAVVLLGLISLSFLLIIMGFRVNITDSIPVGLYRITNL
FT                   KNLKNAFVIFCPDDRPAFKQGLDRGYVEKGLCPGGYGYLMKKVVATSGDKVSVISEGVF
FT                   VNRQFLPYSKPKLTDGMNYALPQWRAIDYQLKEDEILTMTNQSEWSFDARYYGPIRLGQ
FT                   IKGVITPVWVKAKMERKT"
FT   gene            197876..198040
FT                   /locus_tag="lpa_00241"
FT   CDS_pept        197876..198040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00241"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23419"
FT                   /protein_id="ADG23419.1"
FT                   /translation="MNKDTELMDVITDKLEDLMVPGFVAEISPLEAEIMGAFSEEALSE
FT                   MDAKEAAYD"
FT   gene            198033..200219
FT                   /gene="traC"
FT                   /locus_tag="lpa_00242"
FT   CDS_pept        198033..200219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traC"
FT                   /locus_tag="lpa_00242"
FT                   /product="TraC Protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00242"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23420"
FT                   /protein_id="ADG23420.1"
FT                   /translation="MTKLSHHQIVGNQIIESLKQGTAPWIKPWEPGIGNGQVPFNPVTG
FT                   KRYRGINALYLMLNQSNDNRWLTYKQAQSIDAQVKKGEKGTTVQYWKFHDEKIKKDEAG
FT                   NPVLDEQGNPVKVQVNLERPKVFYARVFHASQIDNMPELIQKEQDWSLIERAETLLLNS
FT                   GAKIFHSEADRAFYRLSTDSIHLPPKEQFKSAANYYATALHELGHWSGHPSRLDRDLSH
FT                   PFGSEAYAKEELRAEIASMLLGSELGIGHDPSQHTAYIKSWIRIIEDDPLEIFRASADA
FT                   EKIFNHICALKQVQEIQYAQSVEIRDEQLREENLMEIDKKISDKIWLNIPYKQKDTAKS
FT                   VIGKLPDGTPGIAWDKEQKCWYAKPGVSFDRIKAWLPENQVASEDKALSPVDEFKEALI
FT                   NLGAMVTGEHPIMDGKTHRIQMEGDKPGEKAGFYVAHLDGIPAGYIKNNRTGTELKWKC
FT                   KGYVLTDEQRAAFKAQALENQKNRDIELDEKHRSTALKLKHKLSQMSEAFEQTPYMKSK
FT                   GIQVHSGVYTDNDKKLTCIPATDIEGTIWTVQYIAEDGTKRFAKDSKKEGCFHVLGGIE
FT                   KLADSPVIVIAEGYATAATIKEACELPAVVSAFDSGNLKSVAKALHEKYPHTPIVMAAD
FT                   DDRHLEQSKGINPGKDKAGEAANAVNGFIVIPTFAPDEQSSNPRQFSDFNDLANHSKLG
FT                   IEGVRRQIKPKVEKIAKRYSWLRRSIKNNVVSLA"
FT   gene            complement(200301..200672)
FT                   /locus_tag="lpa_00243"
FT   CDS_pept        complement(200301..200672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00243"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00243"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23421"
FT                   /protein_id="ADG23421.1"
FT                   /translation="MKVLLSIKPEYAEKILNGKKKFEFRKVIPKAGAKTVLLYATKPIG
FT                   KVVGEFEVDSFLSEKPNKLWDLTSSFSGISECFFYKYFEGYETAHAFKISKVYRYKEPV
FT                   DIKTVLASGVIPQSFCYLK"
FT   gene            complement(200650..201708)
FT                   /locus_tag="lpa_00245"
FT   CDS_pept        complement(200650..201708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23422"
FT                   /protein_id="ADG23422.1"
FT                   /translation="METVNLEKVQFKTIDLSDPFFDSLKSDYLEFPNWFKKKSEEFAYI
FT                   FRNDSGLIDGFLYLKQESEAIPDVIPPLPPKQRIKVGTMKINAHGTKLGERFLKKIFDH
FT                   AIFESVSEIYVTVFPHHTNLVTLFERYGFNCTAEKITQNGKELVLIKKMFGPYTDIISN
FT                   YPLINIAGQKIYLLSLYPKWHTRLLPDSILKGENSNVVQDISYTNSIHKVYLASMREMD
FT                   NLKKGDVLVIYRTNDNKGPARYRSVVTSICVLEEYKSIYEFKKLEQFLAYCDPYSVFEK
FT                   SELEDFWKNKKFAHIIRFTYNLALKKRIIRDDLINQIGLNEHDYWGFMPLTNEQFLEII
FT                   KRGEIDESLIVH"
FT   gene            complement(201823..203697)
FT                   /locus_tag="lpa_00246"
FT   CDS_pept        complement(201823..203697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00246"
FT                   /product="TraI protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00246"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23423"
FT                   /protein_id="ADG23423.1"
FT                   /translation="MIIHHIPMKSARLSSFSGLVKYITDHQNKQERVGKVRISNCNSVD
FT                   PTWAVQEILATQARNQRAKGDKTYHLLISFAPGENPPEEVLNIIEDRVISSVGFKDHQR
FT                   ISVIHHDTDNLHIHVAINKIHPKTFNMIEPYRAYRTFAEVASTLEIEFGLEITNHQARK
FT                   GRSENLADDMEQHSGIESLINWMKRNCREQIESANSWNDVHRILTDHGLEILIRANGFV
FT                   FCDKKALTVKASAVSRSFSKKNLEERLGEFIPSPFGNEYYTQNVYRYEPLNKKVIGSEI
FT                   YARYLYEKEHSKTHLSKKLKQLGEAKARLIDKAKKRGRIKRKALKLMKASRSQKKYLYQ
FT                   QISKTLLKDIEKTRQNYAKERKHLLESHQTKIWADWLRQKAELGDKDAITALRYRNRKN
FT                   QSKYALSAASSNFSFANIAQVDSITKEGTEIYKLDKAVIRDDGKEIKISKGGSIATLKK
FT                   AIEMAQQRYGDCIQVNGSPLFKKIILQIVTQNNIPITFADSELEAQRQKMISEQENQNE
FT                   QSRRYGFNDGRRTSRSNEAAGEAIGESGSHFRSQPNAVSIRQGPPAKGQNSLRDLSQLD
FT                   VVQFTGRGKVLLPDNAHDQLERERLQPDNHVRRDVSGLKKKGKILNNK"
FT   gene            complement(203694..204047)
FT                   /gene="traJ"
FT                   /locus_tag="lpa_00247"
FT   CDS_pept        complement(203694..204047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traJ"
FT                   /locus_tag="lpa_00247"
FT                   /product="TraJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00247"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23424"
FT                   /protein_id="ADG23424.1"
FT                   /translation="MVEKIKKPIRKHGRHLRVPVLPDEEIAIKSHAAQAGLSVAEYLRR
FT                   IGLGYQIQSAIDKEYILQLSKINADMGRLGGLFKLWLTQDRRVAHFDYRKVKALLDRIK
FT                   TTQDVMFEVVRKL"
FT   gene            204464..204790
FT                   /gene="traK"
FT                   /locus_tag="lpa_00249"
FT   CDS_pept        204464..204790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traK"
FT                   /locus_tag="lpa_00249"
FT                   /product="TraK"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00249"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23425"
FT                   /protein_id="ADG23425.1"
FT                   /translation="MKKPLSERVIQNQSEKKNGRVNAKIQFIALKEDIREALDKGCSMK
FT                   AVWETLSDEGQISFGYKAFRHYVLKLIKSEQEDTRDDKQSKSKNTNKIKGFTFNPIPNP
FT                   EELL"
FT   gene            204790..205515
FT                   /locus_tag="lpa_00252"
FT   CDS_pept        204790..205515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00252"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23426"
FT                   /protein_id="ADG23426.1"
FT                   /translation="MAKIHITMQGKGGVGKSFVSATTAQYKIHKEQSPLCIDTDPINAT
FT                   FHSFKSLKVERLNIMEGDEINPRHFDALIEKIANTQNDVIIDNGASSFVPLSHYLITNQ
FT                   VPTLLKDMGHELIIHTVITGGQALLDTINGFSQLVNQFPEDVRYVVWLNPYWGKIESEG
FT                   KPFEQLKVYKETKDRIAAIINIPDLKEETFGLDLSNMLQQKITFNEAIDSPERNIMTRQ
FT                   RLKLIRDQLFSQIDNAMVI"
FT   gene            205515..205970
FT                   /locus_tag="lpa_00253"
FT   CDS_pept        205515..205970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00253"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23427"
FT                   /protein_id="ADG23427.1"
FT                   /translation="MPHKINEAIQDIAIKHGVVLGKDDPILILQTMNDRLLEENRKAQQ
FT                   EMLAQFKEEMENISSQWKDDAKEKAEKVLNAALAGSKETMDTILRLTTTEHVHAMKNLV
FT                   SDSLAEARDLTQKTRKFSLLVLSSSFAMLAASCFFILFFSCFGIVVN"
FT   gene            205984..206628
FT                   /locus_tag="lpa_00256"
FT   CDS_pept        205984..206628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00256"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23428"
FT                   /protein_id="ADG23428.1"
FT                   /translation="MCVNNVKNYLKKCSSCNDSGTITGIGGIRSNCSKCKFKRALVNFF
FT                   EKFWAFIINKPIQKYPVGFTIVVFLFYYFISKNFSELMRASSIIGLLGLLFAALKYKLD
FT                   QANYHKSLFDERYKLFCQIEEVIRRANALDATDEGLRMIDEIINRCQFLFGKITLEFII
FT                   EIRSNFIQLICLKKSNKNSAPEADKAMEFFASLITLRSLPSKFPELIISNY"
FT   gene            complement(206672..207154)
FT                   /locus_tag="lpa_00257"
FT   CDS_pept        complement(206672..207154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00257"
FT                   /product="cytidine/deoxycytidylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00257"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23429"
FT                   /protein_id="ADG23429.1"
FT                   /translation="MSNLSEEMIESHIYDFMTATIAVAGENPMAPYGAIIVYDDKEILL
FT                   KSVNSAHHHPLMHGELSVIHTLFNNGFDGDVSKLSLYTTAEPCPMCAAAIYWAMIPKVV
FT                   YGSSIAFLHDLFGRQIQVGAEEVLSKTPDFYSCRLIGGVMEEECNQLFLEAKKLRI"
FT   gene            complement(207111..208553)
FT                   /locus_tag="lpa_00262"
FT   CDS_pept        complement(207111..208553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00262"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23430"
FT                   /protein_id="ADG23430.1"
FT                   /translation="MNNQFKAKSKTPLQFKVFHTLLGFAVFFSLITVPAEAQVIIFFEI
FT                   PVSSELLWWPIVFFSFQLIHSIYGFSYLRHALYLVILFHAIYILFLKFAIWLPASSFWQ
FT                   MQETYTQVLGRDFLYIAMSSLCLWACTLLPLKFINDIKENQRRLLFFAGLMLFSLLDRA
FT                   LLNPQSSSSEAQFIVPILIYYFLNIFSGTLFQFISRVEGITRQKDLARDLFKFQIPDIT
FT                   NAIDQKFKYHHILFCSSIVFFIASKTMAAKFISIGFLTINVGGIVFSLAYLTADMMTDV
FT                   YGIERTKQMVLFIIFCNLLLVGDVWITNLLAIGENDPFKSILHNQARMFIASATAFFLG
FT                   MTINSTVISIIKARQRKRGISLKKEFITTVWTRIATSSAFGIIIDVSLFSLVAFYGIVP
FT                   NEKLGSVIIFEDAYKISYEIVLAPVSILLIYFLKIKEKVDIYDELSNLNPFRINTSYNI
FT                   NANKFAENYVQPERRNDRKPHL"
FT   gene            complement(208546..208905)
FT                   /locus_tag="lpa_00263"
FT   CDS_pept        complement(208546..208905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00263"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23431"
FT                   /protein_id="ADG23431.1"
FT                   /translation="MEEKKFTGRFLRFVYQQIVLRFIGQVREPYLVCIDRIFTHPDTNE
FT                   LSVAFHIANKRVNQVQSVADFVKSDMIYLIDPRIVFDIGQQFGAHSEKLTILEKKQPDL
FT                   KTKCIAGLKRVFIDE"
FT   gene            complement(208923..209576)
FT                   /locus_tag="lpa_00264"
FT   CDS_pept        complement(208923..209576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00264"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23432"
FT                   /protein_id="ADG23432.1"
FT                   /translation="MSTTILNESSQLLLAQTLNELIGRDEKLSPAALARQLGIPTNKIT
FT                   RILNGDVTDPKASTLLQIANYFDITIEQLLGLEPIARQEEIEQQQATRQLPIFEFSKVN
FT                   QSNAAKEWYRWVENEIAGEYYALAIDTDLYEPTFPKNSILIINTDIEPEDRSYILIKKK
FT                   NDPSYCSIKKYVLEGNQIYLYPINPKLPVEIFDDHLYTIAGVILEVHQRLRSKK"
FT   gene            209987..210193
FT                   /locus_tag="lpa_00265"
FT   CDS_pept        209987..210193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23433"
FT                   /protein_id="ADG23433.1"
FT                   /translation="MNWVKLKKYCEISGDTSNAVHAKRKRGMWLDGVQCKVGPDGNIWI
FT                   NLVEVERWVENGNKATNIRLRAG"
FT   gene            210394..211347
FT                   /locus_tag="lpa_00266"
FT   CDS_pept        210394..211347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00266"
FT                   /product="Putative lambdoid prophage Rac integrase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00266"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23434"
FT                   /protein_id="ADG23434.1"
FT                   /translation="MFGFSVVKSTVGELLKQYMEIAEKTLEPSTFNGYRKACEAHLYPA
FT                   FGDIPVKDLSSMMIRNYVTKLQLTLKTIRNILTPLRNTLDQALNDGMITSNPLDRLVLS
FT                   KLVDKKTRRSNWEVDPFNQDEIKAILSEAKGQARNLFQFAFYSGLRTSELIALEWGDID
FT                   WLNGIVRVSRAVVLKKEKGTKTKSGQRDVLLLPPALEALQNQKKFTFLEGGRVFYNPRT
FT                   NTPWETDGQIRKTCWAHILKKAGVRYRNPYQTRHTYASMMLSAGENSLWVAKQMGHKDT
FT                   EMIIKNYGRWIPDTSTLAGYTTVNDWSSPLTGVVKK"
FT   gene            complement(211353..212168)
FT                   /locus_tag="lpa_00267"
FT   CDS_pept        complement(211353..212168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00267"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23435"
FT                   /protein_id="ADG23435.1"
FT                   /translation="MIPSRFITQWRAYAPWAFERQIEQDLIISRALVELFNDPLISESI
FT                   AFRGGTALYKLFVDKPARYSEDIDLVQLKAEPIGPVLDAIRAHLDPWLGKPNSKRSQGR
FT                   VTLIYRYIAEGLPAIPMKLKIEINTQEHFTVLGQHQKLFSISTDWFRGEANILTYQLEE
FT                   LLGTKLRALYQRKKGRDLFDLWYVDEHIDCNHQEIVRIFQHYIQQQNLNISKAQFEENL
FT                   ALKLSSELFIRDMDPLLVSGLSWDINYAAKHIKEKFLSSLPGESWKGAD"
FT   gene            complement(212165..212956)
FT                   /locus_tag="lpa_00268"
FT   CDS_pept        complement(212165..212956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00268"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23436"
FT                   /protein_id="ADG23436.1"
FT                   /translation="MNANQYLNHLATQGQHYFTTKDMIHALKMSHTAAWAAMIRLEKKG
FT                   VIATPHRGFHIIIPPEYQRLGCLPPDQFIPDLMDYLQIPYYVGLLSAAQYYGASHQQAQ
FT                   TFQVIAPKNRKKIQCGQIRIEFIARKNIADIPTTNFNTPKGYVKVSSPEATALDLANYP
FT                   MYCGGLSNVLTTLEELAEQIDPQALERFASQLPHSPQLQRLGFMFESGQLDELALIIET
FT                   ILRKRTIRSVALVPNITNQEIDTPINKRWKIIQNEIVESDL"
FT   gene            213533..214753
FT                   /locus_tag="lpa_00270"
FT   CDS_pept        213533..214753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23437"
FT                   /protein_id="ADG23437.1"
FT                   /translation="MTENKRKGPLQDTTIRNAKAEKKPYKMPDERGLYLEVAPSGGKWW
FT                   RFRYRFEGKDKRISLGIYPDVSLKQARDRRDECRTMVANEIDPSEHRKAKKAAKIENAA
FT                   NSFEVVAREWFLKFSSSGLWSEGHADKIIQRLERDIFPWIGNIPISDINAPKLLSVVRR
FT                   IESRGALDTAHRALGNCGQIFRYAIATGRAERDPSQDLRSALPPVKETHFAAVTEPKDV
FT                   AKLLRALDDYEGTLIVKCALRLAPLVFVRPGELRSAEWEHIDFDTAEWRYKVTKTDTLH
FT                   IVPLSQQALDILKELHPQTGRDRYVFPSARDKKRPMSDNAILAAMRRMGINKEEMTTHG
FT                   FRAMARTILDEVLQFRPDIIEHQLAHAVRDPNGRAYNRTAHLPERKKMMQAWADYLDEL
FT                   KLRKSEL"
FT   gene            214775..215611
FT                   /locus_tag="lpa_00272"
FT   CDS_pept        214775..215611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00272"
FT                   /product="DNA-damage-inducible protein D"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00272"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23438"
FT                   /protein_id="ADG23438.1"
FT                   /translation="MKTEIIHILTTNFESHAHKTDEGVEFWLARDIQKLLGYEKWDNFL
FT                   NVVSKAKTACEISEHNVADHFADVGKMVELGSGSQREINDIMLTRYACYLIAQNGDPKK
FT                   QEIAFAQTYFAYQTRKAELIEQRLLEAERVTARKKLSDTEKELSQVIYEQTNGNENFAV
FT                   IRSKGDHALFGKSTQAMKKQWNVPDSRPLADFAPTIILKAKDFATEITIFNAKEHGMTT
FT                   EQAISKEHVTNNEAVRKTLIDRGITPEKLPPAEDVKKVERRLESEKKKSLKKPDAL"
FT   gene            215632..216411
FT                   /locus_tag="lpa_00274"
FT   CDS_pept        215632..216411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00274"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23439"
FT                   /protein_id="ADG23439.1"
FT                   /translation="MKNERKFLDVASHAFIEATNGLLDLYHEQPAKITLTEEFSKIVLN
FT                   VYQNFMLDVLPSSQCLVDKKNFFSFAILCRSSLDIIIQILWILSLEEDEKLKAIEYFLN
FT                   FEGVDVGQNGKKIYEWQRVFRPTYSSKKTAMELGIDKECIILPLTQHKNKELKLTVFDY
FT                   LSKITHWNPRLLNDLVGCNSEKHLGNAVEHTRMAAISVETFIFCAITFTEIFLKLCLKV
FT                   DEESVNQKTSKIKEKFRGAFAPFYNDIEQETEVVIEV"
FT   gene            complement(216562..218352)
FT                   /locus_tag="lpa_00275"
FT   CDS_pept        complement(216562..218352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23440"
FT                   /protein_id="ADG23440.1"
FT                   /translation="MNIYGLVKVFLVALVIPAIGFAVSFFIINDVNQSLKSKGIGDVTL
FT                   FCEVLQSGQLEKKATAELQEACQEVTNIVLLGQGSVITAAIGILIPVLYWLASIITGES
FT                   RKRIALLFPIVLRISVLLIAISVLLQGAILTYAVYIGESYFYGRIHPVLIGLIGLGALI
FT                   GGLSLIVVAMSFGRKLKLSTMGKVLAASDAPQLFRFVRSLAEKLGAKEPQNIIVGLEPT
FT                   FYVTNSDIQVPGYEKQITGETLYISAPLARLLSKEEFASVVGHELGHFRGNDTIYSMRF
FT                   APVYAGLGMALGALAIDENEGASGLAKVPAIAMLSYMYELFSTNVAKISRDREHKADEA
FT                   GAEAGSALALATALIKVSLYSSLWNHARQENIERLNQGKIATNLSIVFQDTAKYDIEHE
FT                   NIEQIMKSTLEQSISHPTDNHPSVSLRLKALGVNTETITKDMLLIPEDAAIHLLDKSQK
FT                   IEEEITLLEHKLMIAYGVASPPKEAERNHLLHATYSLAAAMISADGRVDLGEVAVAEGI
FT                   GKKLFEDFDSIEFREYCNNPEQIPDVVQLSEAMKEILEDEHKYLIIQYLKAISETDGSV
FT                   SKDEELLLQKVASGLGISIT"
FT   gene            complement(218720..218977)
FT                   /locus_tag="lpa_00276"
FT   CDS_pept        complement(218720..218977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00276"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23441"
FT                   /protein_id="ADG23441.1"
FT                   /translation="MDDSIFVKGIEELKRLIATQYDLTVSAHKIENGKIIISLANKRKN
FT                   LVLNELNFRDAIEFLPNSPTNDKDKEDRHSLFLEIKNQLS"
FT   gene            219119..219643
FT                   /locus_tag="lpa_00277"
FT   CDS_pept        219119..219643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00277"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23442"
FT                   /protein_id="ADG23442.1"
FT                   /translation="MNYKKKDRIRVPENHAEKALTLGINSKLKLLVMSKASEWVELPPG
FT                   EIQSISNKHPTKALVIVVRAPMVNGEYVGNHPDLQELTYRDLWLYSSDYYLLEELEKPT
FT                   TGEALEQNQYWLQLRSKAGRAIEKFEPWAAKQQGKINITDDLKGWIKKEITSKAFEIQT
FT                   ISKILQNHYKF"
FT   gene            219781..219981
FT                   /locus_tag="lpa_00278"
FT   CDS_pept        219781..219981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00278"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23443"
FT                   /protein_id="ADG23443.1"
FT                   /translation="MAYKILKLPEVKERTAISRSRIYNLISEGLFPKPILLGGARAVGW
FT                   IESEINEWIEQQIDASRNQKC"
FT   gene            220115..222520
FT                   /locus_tag="lpa_00279"
FT   CDS_pept        220115..222520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00279"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23444"
FT                   /protein_id="ADG23444.1"
FT                   /translation="MFDTISQFRAAIETSGLVPPENIIPGKMHRFPGIGKTKENKAGWC
FT                   LLFLDQLGGCYGDWSTGLSEIWWGKRNQKLTPDEKAQFKCQVQEAQLKALNEAAAIHQE
FT                   AAKRALSIWNSSKPAEANYPYLLSKNIEPKGIRCYKGLLVTPLRADGKIYSLQFIDPEG
FT                   NKQFLRGGRVAGCYFSLGNPRGADVICIVEGVATGKTINMATGYPVAVAFSSSNLLAIA
FT                   QVMSEQFPEHTLIICADDDADKEGNPGLTKANQAADILGAKVAIPYFGIDRPNKASDFN
FT                   DMAAFSGLDAVAETIRAVLFQSDDNNWPEPFPLSEEINAQPYPLDALPNTVRNAVEEVT
FT                   AFTKAPTPLVASAALAALSLAIQAHVDVKRTEGLISPVSLYLLTIADSGERKSTCDSFF
FT                   MKAIRDYESIAQEKAKPLIKDYQAEISIWEEKYRGVKEQIRILAKTNKPTHEQELRLVN
FT                   LEYEKPVSPLVPRLVYCDVTPEALKWNLAKVWPSGGILSSEAGTVLGSHGMGTESVMRN
FT                   LATLNQLWDGSPIPTERRGSESFTVNGARLTVGFQVQEVTLKHFLDRSNGLARGTGFLA
FT                   RFLIAYPESTQGNRFFTEPPESWFNLAKFNTRISEILNQEVTIDKNGSLSVIQVSLSPE
FT                   AKKAWICFHDVIEGELGVGGELSEISDVASKIADNAARVAALFKVFNQGVTGTINFDEF
FT                   ENASRIVAWHLHEAKRFFSGLALSDDQADIVKLDSWLVRYCHKKKTNIVSRRDVQRNIV
FT                   PIRLRDKKTLDIALNVLVEAKRIRQMQSGKKKGIYINPALLTGDVHDN"
FT   gene            222510..222821
FT                   /locus_tag="lpa_00280"
FT   CDS_pept        222510..222821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23445"
FT                   /protein_id="ADG23445.1"
FT                   /translation="MIINNLIKKGFLTNNIMLTSATIATDEPVKISTVAEVATVAVGNL
FT                   NNSCGSLTSNEKQKILSWLEYIGEKDPLIIIEVLEFCRNNVDSRQYFLQRAKEVPEIK"
FT   gene            222881..223255
FT                   /locus_tag="lpa_00281"
FT   CDS_pept        222881..223255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00281"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23446"
FT                   /protein_id="ADG23446.1"
FT                   /translation="MKFKPGESGNPSGRPKGSRNIQTQLIKLLEPHAEQLINKMVEKAL
FT                   EGDPHALRLCIERLLPKAKHNPIESDLLTLEEDNYMETIESILQEMLLGNIASDEGKKI
FT                   IDLIEEHQNRKRFDSLIHIP"
FT   gene            complement(223269..224027)
FT                   /locus_tag="lpa_00282"
FT   CDS_pept        complement(223269..224027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00282"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23447"
FT                   /protein_id="ADG23447.1"
FT                   /translation="MNTFKEIAYQILLEAGKPLHSKEITALALKLGRLNSAGKTPDLTM
FT                   NAELNVDINTKKAASCFIKVAPSVFAINNDKYLSSDLKLMADKEYKISPNISTQQKGHI
FT                   AEARIAELITLYGDTTLSCYRPVSDDEGIDLIVKEKGSLKTIYLQIKSRFESNPSRSFT
FT                   STIRSCNLHDHHAMAVIFCLFDTDAGDLCNQLWFVPACSLIKNAHKLQNGDFFGFVAGK
FT                   RKKESNKWDEFLIDKRDLANQIIASIKRIS"
FT   gene            224128..224373
FT                   /locus_tag="lpa_00283"
FT   CDS_pept        224128..224373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00283"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23448"
FT                   /protein_id="ADG23448.1"
FT                   /translation="MKEKHPNLIKIGKLIRDTRKEKGYSQEDFASQAQLGRTYMGRIER
FT                   GEQNMTIQTLIQIALILGVEVATLIPKLNELTPPKA"
FT   gene            224434..226590
FT                   /locus_tag="lpa_00285"
FT   CDS_pept        224434..226590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23449"
FT                   /protein_id="ADG23449.1"
FT                   /translation="MMNEIRSEKEIFEDLEALCCSDGYVHVIAYFCFKDNTILASENGQ
FT                   MISSNENPSNRLIRTEIATLIGLMVKKEIKLPIPPPDIFDTYINQTQALLHELHQTMYP
FT                   SIGQSTEEVSLKKRMDLFTMGTFLKEGIFYAGESAFPFQYRDLSLKKYEKDDSWFIEKK
FT                   GFSFADAILVITAVINFQNEKLTQTLSELKDKDVNDWSVLDGYIFSANDITQESNLTPE
FT                   VVSNVLDSFCLPQEGSNDSFNELGDFNLTNAYPLIFLNDSNYLLLQHYTLLEALYETPF
FT                   FWLKDDEAYKDEAATNRGAFVENVAVEWLSRVFGKHNVFKNVEIKASKKEKSGEIDVLV
FT                   LYADRAIILQAKSKKLTLAARKGNDNLLKDDFKKAIQDAYDQGFSCAELLNNKQHKFYI
FT                   NGTDEIEVPDNLKKIYIFCTISEHYPSLSYQSKLFLNFKETEQIAAPFVMDLFLLDVMA
FT                   EMLNSPLYFLSYVDRRCKNLEKFGASHELLILDHHLKRNLWLDGDNTFMYVADHDCLEL
FT                   YEALLTRRENYPGKETPEGILTRFKNTSFEKLIKQITHLEHPEAVNLGLILLTCSGEFI
FT                   NGFNSDINRLLKLVKTDGNGHDITILLYNNCGLTIHINFDSEFIAQKVLKSHCERRKYI
FT                   AKATDWYGLCLNPVNLDIRLALSLSYDWKYSEEMEKTVKPLIANQEKVAKSGKKKKRKI
FT                   GRNEFCPCESGKKYKKCCINKKYL"
FT   gene            complement(226620..227870)
FT                   /locus_tag="lpa_00286"
FT   CDS_pept        complement(226620..227870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00286"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23450"
FT                   /protein_id="ADG23450.1"
FT                   /translation="MRIKRKIIRHGFFWLPNSKKEVKGTLIILDGGKISLRLENLLHPQ
FT                   NELIKIIHGRIGETAITLVDSYCKVYNDLISMISGGYGFEMHVHEAIFGQFFPSEEITT
FT                   VEVYFWLEGIDNWINEINHLDVSNKLNISKDYNFILQKHAGGIKFKLSSHNPQLLSEYR
FT                   KIIQKIILFFYFILNKPTNLQKIIIKSAGNKKLPIYYQSIPFNHKKYPSKSGFIQPGDI
FT                   DNLPRIIENWFNFYDSYSPVVHLYFSFLTNTHSFAETKFISLSQALEAYHRLSGYNQDA
FT                   MAAEEFEELKSNALTSCTTTQKEWLNNQFTYLNKINLRKRLKELINPIKQYYGNKAARE
FT                   MLIDNIMDTRNYLTHITSENMKKLHEKNNLTELCLKIDTILCFLVLIKLGFSENMINKF
FT                   AEYDRIDFYLKWKQQDD"
FT   gene            complement(228299..228424)
FT                   /locus_tag="lpa_00287"
FT   CDS_pept        complement(228299..228424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00287"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23451"
FT                   /protein_id="ADG23451.1"
FT                   /translation="MCFKSLVALGKTLDSRKEVIACMWQFSKSNGITEGFHQKMK"
FT   gene            228717..229547
FT                   /locus_tag="lpa_00288"
FT   CDS_pept        228717..229547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00288"
FT                   /product="hypothetical protein"
FT                   /note="COG1715, Mrr, Restriction endonuclease [Defense
FT                   mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00288"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23452"
FT                   /protein_id="ADG23452.1"
FT                   /translation="MGDWFHLSDDEREELLSSGRTTILRTRVHWAKVYLKQAGLVEYPK
FT                   RGYVAITEKGIQVLQKNPSNIDTNYLKKFPDFIRFIERSKTESQQVSNSEYSENYSPDE
FT                   VLTRTFERMKNQTCEELLEVIKSSSPQFFEKLVVQVIVSLGYGGSLQEAGQAIGKSGDG
FT                   GVDGVIKEDRLGLELIYLQAKLKKDDKYNVGRPDIQKFYGALQGKQAKKGIFITTTDFS
FT                   NEAREYLKVIDKKIILLNGKELIELMWEYNIGLNVSATYEVKDLDLDFFKEELE"
FT   gene            230189..230350
FT                   /locus_tag="lpa_00290"
FT   CDS_pept        230189..230350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23453"
FT                   /protein_id="ADG23453.1"
FT                   /translation="MNYLLLIILGFVTALGFAANTPCSGKKGGISHCLGEYFVCKDGSI
FT                   SQSKKQMH"
FT   gene            230365..230835
FT                   /locus_tag="lpa_00291"
FT   CDS_pept        230365..230835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00291"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23454"
FT                   /protein_id="ADG23454.1"
FT                   /translation="MVNKFHSILLFISLLFSCTAYANIISGLVIKISDGDTLTILTKDN
FT                   VQLKIRLSEIDAPEKKQPFGNKSKQSLSNLCFNKVAIVDILKIDRYGRSVGRVKCDNVD
FT                   ANEYQVKNGLAWVYDKYVTDHSLYALQEQAKSKGIGLWSEKSPIPPWIFRHN"
FT   gene            231423..232364
FT                   /locus_tag="lpa_00292"
FT   CDS_pept        231423..232364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00292"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23455"
FT                   /protein_id="ADG23455.1"
FT                   /translation="MAITTTHIEPREKAQIAKLVVTYAGFSEIPVYAGIGTTRNDPREL
FT                   FLQQNPLWPPFFGYPDSLPEESPWFPQQAVPYRQMNHSIFDEMNIEEESAPEYLARIAK
FT                   NYSPQHKLVIVSLGPLHNISAALKINPSISSNLKIYSMGGIYPKGYNWLVSPEVTAPVL
FT                   GSTEVISIVSQFVDAHDFYITPEEFLEIEKSAQSEFGLAVIQDWKNWYNIDKRNLNKTH
FT                   LSDPVTLYLALHPEEITHMSSKLLTFPCLDLNGVLAPEFAGSWYNMPGLENKLMKVEDS
FT                   EESHIKFVSQVESSSAIRRKIINSIKQILGNS"
FT   gene            232664..235159
FT                   /locus_tag="lpa_00293"
FT   CDS_pept        232664..235159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00293"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23456"
FT                   /protein_id="ADG23456.1"
FT                   /translation="MKLPFKEPVAPRYIYINPQTNVVHLLMPVMSGTEIGLDNTCKSVY
FT                   SLLEFFCLLGANQQSAASMILKNYQEGLAFDIKYHPNSEQKALKEQRLVQINMYLRLLQ
FT                   QVQQEEQITNPLKLIFPTYPAALESLMQASEANLHSVILRPEEQDVQLRTTAISPVFSA
FT                   HHDTMVNGQRIEKKSSLYEILSNSYEGLVFIPKSKEQLIERVLSKCADSPVDFEHIRAM
FT                   LTQETKAYLGIEESFNQTQGNRYAPSAPVNQAYIDGELMISAEYPATPQDYLNALLEYC
FT                   TPNLFDNIEESPFYTINNKERLSILTQFFLAELNIICREEGIAETNFGQILEANPELIN
FT                   NLAKCVKQALTGYQSVEDALINYVNQHRDDFQFTSPIPQYSFPKLKERFNSHYKQIKDS
FT                   PHFDEFMLLSTKKGLFFAHQGCIATHFAHFMNALFFNDILDENTKTFLQSVQQDFETID
FT                   KFENTIPHQNTHINAGMKEAVLDLSSMDNEALQDLYEDINSYQDSNLKEALLAQLKQER
FT                   PDFKLQMNAKIFLQHVAYGEQDEAEELLNKDPELTQELLRANNIFFTDYSGRTFTCTAY
FT                   EYAYWAKDSHMQRMLEKYIRQDDETRQFMLERVKAIEELVNPPEAERFFAHPKPRGLHY
FT                   TTQNKEGKTIDHWEAHVDLTPLKKALQHFLDEFKKLYNNPKPNNYREVLNNIWVKEVGM
FT                   AQRCVPAHIAQEYCRVGWDLFLGLKDNKALFDASNPNNLKRQLKIFDWNTYTYDLWFTP
FT                   GSHAVDCGLGFSCALIRGGNNCPRPTNMYDRWTTPNEVVEQDLEMISIIDEVRTCDLKQ
FT                   SLENLSQPLIAQAAQYLSI"
FT   gene            complement(235441..235560)
FT                   /locus_tag="lpa_00294"
FT   CDS_pept        complement(235441..235560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00294"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23457"
FT                   /protein_id="ADG23457.1"
FT                   /translation="MSISYGISYMGELLDETGSVDKELKNLIAGFSASSTGLE"
FT   gene            complement(235557..235748)
FT                   /locus_tag="lpa_00295"
FT   CDS_pept        complement(235557..235748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23458"
FT                   /protein_id="ADG23458.1"
FT                   /translation="MLDKIPPVFVIVDEIKKADSTLQEYLIKSLREIMISPSFKGSISG
FT                   YFAQLWSIANELFQKYCT"
FT   gene            235912..236427
FT                   /locus_tag="lpa_00296"
FT   CDS_pept        235912..236427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00296"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00296"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23459"
FT                   /protein_id="ADG23459.1"
FT                   /translation="MFNVSIRKATSLDAEAIASVHVHSWKKAYQQFIPEIVLNSLSIPE
FT                   RTQLWNELLNNGVTVLVLEIDNQIIGFASICTFRDGIEDNSKGEISAIYIHPNFWHQGF
FT                   GKKLSLAALKTLKELGYTEALLWVLSDNHQARSFYEGMGFELNDKSKLAEFYDGGALLK
FT                   EVLYKKKL"
FT   gene            complement(236753..236914)
FT                   /locus_tag="lpa_00297"
FT   CDS_pept        complement(236753..236914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00297"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23460"
FT                   /protein_id="ADG23460.1"
FT                   /translation="MLVPIGHKAPGINALTNGLGRFHSGHACPKLPFLFNPLILKITGT
FT                   WDGNPPRF"
FT   gene            complement(236877..237101)
FT                   /locus_tag="lpa_00298"
FT   CDS_pept        complement(236877..237101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00298"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23461"
FT                   /protein_id="ADG23461.1"
FT                   /translation="MKPIKNSKEQEHIAPEAQDPRLSYTEDDRRPLTSTTSAKHPSSLF
FT                   GKSEERSARESYDQYGNNVSTHWTQGPWN"
FT   gene            complement(237318..237440)
FT                   /locus_tag="lpa_00299"
FT   CDS_pept        complement(237318..237440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00299"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23462"
FT                   /protein_id="ADG23462.1"
FT                   /translation="MNTGLQGGLEQISEISIIINGAKKDWNCFPYTTTILEARP"
FT   gene            237981..238139
FT                   /locus_tag="lpa_00300"
FT   CDS_pept        237981..238139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23463"
FT                   /protein_id="ADG23463.1"
FT                   /translation="MSLRLSYPAPEAIRIFVTNDAIISAKRPAYSHKTRQEWVLLSPGL
FT                   PGLFAQR"
FT   gene            238246..239472
FT                   /locus_tag="lpa_00301"
FT   CDS_pept        238246..239472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00301"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23464"
FT                   /protein_id="ADG23464.1"
FT                   /translation="MAGKYTYSYDPRTDEDVIFIDNEKLKEIDNSKKGSSSNSLAVKIL
FT                   EHISAYYYQIAWDGESLLAHKLHPKFRNNPIAKQSDTAFLAKLLGVHVTSFYDPHKLVK
FT                   LKTIDPMIPVYVGMNFGKLDRLGRHRRHALRVGNIKPLDDGEYEVTLINPWNNQKQTTC
FT                   LLTDLRKRKCHFAVFDSSPQKKLLTEIFLEYKTEIGCELFRNKELAFLLCEMKQCGLLD
FT                   SELAKYPLSSCMVLYKKLPNLVANYRCLPYSERYNMLMCVASTNGHVRLFNKLMQGSSV
FT                   VDKPSVARSPQRPYLSAKSFFADLFASLEASLERVHYNDLLKTLRVNYGHLRSVNTALN
FT                   QVENRQGIYSKMELKNMNQRLDRLGFFMKCHTDPRGHRNSDLGQQPNFFDQSTQKVNVK
FT                   NHQNKGVSL"
FT   gene            239435..239635
FT                   /locus_tag="lpa_00305"
FT   CDS_pept        239435..239635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23465"
FT                   /protein_id="ADG23465.1"
FT                   /translation="MLKTIKIKAFRFDTQELGSICKEPEQCNGEGGCQPRLLRATTIKT
FT                   GTSISCKLGFTSYFPELGTLF"
FT   gene            239733..240479
FT                   /locus_tag="lpa_00307"
FT   CDS_pept        239733..240479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00307"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23466"
FT                   /protein_id="ADG23466.1"
FT                   /translation="MKRYIWFHPSYVLESAEATLLGQQTNAKDHGYILLNDQELGQVTC
FT                   EDHLTIMGHSSLESTPSEDTGLYMQGDTADGLIRRLTANGLKEAPKILSLESCRAGISG
FT                   GLAQQLSCSLFFKYTLIEANLNSVGRKPMDTQWNFPTDSLGRAVLKLDNSPWMFYLGGF
FT                   LVGRLTHDTYTMENLFSLLSPPTFHKHFFANYQPGFFGGRSGRHCLFNKTTITLEKASN
FT                   FAHEDQDSASAKALEVVLKKLYSQPG"
FT   gene            240953..241663
FT                   /locus_tag="lpa_00309"
FT   CDS_pept        240953..241663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00309"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00309"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23467"
FT                   /protein_id="ADG23467.1"
FT                   /translation="MSPIPAFVIRNLTKTYLMGEVVIHALRCINLDLYQGELVVFLGPS
FT                   GSGKSTLLNIIGGLDVPSSGEVIYKDHLITSASQHDLTRYRREHIGFVFQFYNLISNLT
FT                   ALENVSIVTEIAENPMHPEDAIKLLGLEHRMHHFPAQLSGGEQQRVAIARAIAKNPDVL
FT                   LCDEPTGALDCETGKIVLATLALANQKLKTTVVIITHNIVISEMADRVIHIADGVISNI
FT                   SKNKFKRKPEELEW"
FT   gene            241657..244023
FT                   /locus_tag="lpa_00311"
FT   CDS_pept        241657..244023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00311"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23468"
FT                   /protein_id="ADG23468.1"
FT                   /translation="MVTALNKKLWRDVIKLRSQIITIALVVCSGVSVLIASVNTYVSLR
FT                   NAQQEFYSKYHFADVFASLKRAPDYLEKRITEISGVSRVETRIVKDVVLDLPWMPEPAV
FT                   GRFISISDKNKSGLNQLYLRQGRWPDSNRYDEILVNESFANSHDLKPGDNIIALLNGHR
FT                   EQLKIVGIALSPEYVYAIRGEDLLPDNRHFGVFWMDRKALSTTFGMQGAFNDIIIKLAP
FT                   NASEQFVMTQLERMFRSYGLTITYSRKDQVSDRFVTNEIKQQKIIATYIPPVFLLVAAF
FT                   LLNLVTGRLVSKEREQIATLKALGYGDLAIAYHYIKIILIIIVIGSLAGVSLGAWFGNL
FT                   MTELYAEYFRFPRFSYLFSNLAAFIGILVCFLAALLGTLRAIYQVINLMPAVAMKPPAP
FT                   IVYRATLIEKIKFFSRLPSSVKMVYRYIFRHFLRTMLTCVGIALAMAIIILGLFWQDAI
FT                   RYLINTQFIMAQREHAMVSFNNPVNKIAVTELNKITGVTSSEGYRIVPARLTYQHRSEL
FT                   SSLFGIAENAELKILLDKHLNRMIIPEQGLLISEGLAERLRLAVGDRLDIELLEGNKAK
FT                   TQLKVQGVINDYVGMFAYIEIKALNRLLNEDRLVNAAAITVDTKHVKHLYKKVKEIPKI
FT                   GTITFKTSIIRTFEETFAKHILVFTTILASFAIIIAVSVVYNNASITLAERARELTTLQ
FT                   VLGFTQGEVSTLLFLNHIFEIIISTPLGLVIGYLMSWSILQLMQTDWFKIPFVIELKTY
FT                   VISIMVIFFSSLISFYIIQRKASHLNLTAVLKVAD"
FT   gene            244023..245222
FT                   /locus_tag="lpa_00312"
FT   CDS_pept        244023..245222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00312"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00312"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23469"
FT                   /protein_id="ADG23469.1"
FT                   /translation="MKIMNLNLKKLIGYFLAIVIFFSVVLWFLSHQGISVERAKVKYDH
FT                   FIQYIEDDAKTRAIKIYSIVSPVSGELLRINLTEGDKVKKDDVIATIKSKIPALLDIRA
FT                   KQELEHELGTAEALYEQAKAESIRAEAALETAQSDFKRKEPLAKKGFVSETELEHAQLE
FT                   YQLRQKEHNAALRKLHAAEHYILKVKASLSASEGSEASQQDKIEIRSPVTGSILRVIEK
FT                   SSTTVEPGTKIMDIADVVGLEVVADILSDDAAKIPPYARVIIKRWGGPYPLEGRVRIVE
FT                   PSGYTKISALGVEEQRVNVIIDITTPYELWKNLGDGYRVDVEIILFESNHALVVPMSAL
FT                   FRDGEDWAVFVVKGHRAYKKKLTIKYHNPDYAVIERGLELGDEVILYPSSLIHDGVLIK
FT                   "
FT   gene            complement(245294..246172)
FT                   /locus_tag="lpa_00314"
FT   CDS_pept        complement(245294..246172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00314"
FT                   /product="sensory box protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00314"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23470"
FT                   /protein_id="ADG23470.1"
FT                   /translation="MLTNIERAKLQLIDETSDMVIITKADPLDAPNGPEVVWVNKAFEK
FT                   ISKYKANEIIGQTPRILQGKETNQNTLKMIREAMKAQTSINVELLNYTKDGTPYWINFS
FT                   IVYLRDGQGNLCYLGAIERDITAIKNLNFQLSEKAKTDPLTNVYNQENFFIAGNEAIKN
FT                   FHQNQEAVGLLFFDVDDFKGINDTQGHIYGDKILKKVAQESLKLVRKTDNVFRYGGDEF
FT                   AIIFSGIDVKILERKAQQLQKKLAKSHISVSIGGTISKQSDKSINTLLARADEALYYVK
FT                   ANKKGLFFIRE"
FT   gene            complement(246156..246608)
FT                   /locus_tag="lpa_00315"
FT   CDS_pept        complement(246156..246608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00315"
FT                   /product="signal transduction protein (EAL/GGDEF domain
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23471"
FT                   /protein_id="ADG23471.1"
FT                   /translation="MPCRKCDSATTYHLSGTYQLLTLPPRGHCYSKLLKYLTENNFDIK
FT                   IKDSAIIELLFTAEKAQDIGHALERCYSQAELEDSKAVLLPIDIADRNVERVLNHTHSL
FT                   KKIMPSIFIKVFCLRDLCLTKKYPTISKQAHKNGLAIGCMTNAYKH"
FT   gene            complement(246713..247474)
FT                   /gene="map"
FT                   /locus_tag="lpa_00316"
FT   CDS_pept        complement(246713..247474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="lpa_00316"
FT                   /product="methionyl aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /note="COG0024, Map, Methionine aminopeptidase
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00316"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23472"
FT                   /protein_id="ADG23472.1"
FT                   /translation="MLVKTSEEIKKMRVAGQLAASVLEMIEPYVIAGTSTRELEQICRQ
FT                   YIVEDLKAIPSTLNHYGFPACVCTSINHVVCHGIPSEKKLKNGDIINIDVTVQKDGYIG
FT                   DTSKMFLVGNIKPFAKKLVEVTQECLYKAISIVRPGAYLGDIGNIIQTHAEQHGYSIVR
FT                   EFGGHGIGKSMWEDPHIMHFGKPNTGLRLQAGMTFTIEPMLNLGRKEVKTLGDGWTVVT
FT                   KDHKLSAQWEHTILVTDNGHEILTLRADEHF"
FT   gene            complement(247455..247667)
FT                   /locus_tag="lpa_00317"
FT   CDS_pept        complement(247455..247667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00317"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23473"
FT                   /protein_id="ADG23473.1"
FT                   /translation="MGIVKISDELHEATKLMARAMSRSINSQAEYWIRIGKLAEENPSI
FT                   TYTDILKILVHQASLGEIYDVSEDV"
FT   gene            complement(247843..248322)
FT                   /locus_tag="lpa_00320"
FT   CDS_pept        complement(247843..248322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23474"
FT                   /protein_id="ADG23474.1"
FT                   /translation="MKEKTAKQLKLFIIYLISYWLLSIISCLIAFGYDDSLRMLLASPK
FT                   SDLSGALLFFSSFIATALLFVFRYKTFSDKPYPYFIFGFYVGNVSLLMLFILDAFIREL
FT                   IVWKFPEFLLVFISPFVELVLSYLFFGFAFLAIIPAVTSAFILYGVQRKLLLPPI"
FT   gene            complement(248335..248541)
FT                   /locus_tag="lpa_00321"
FT   CDS_pept        complement(248335..248541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00321"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23475"
FT                   /protein_id="ADG23475.1"
FT                   /translation="MSHLQDSRKEQSKEWEVLVLSSPVNAALCLIGKEEKIDSVARSGS
FT                   CPCINAPKSRVKIPKIEAPFKTA"
FT   gene            248634..249611
FT                   /locus_tag="lpa_00322"
FT   CDS_pept        248634..249611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00322"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00322"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23476"
FT                   /protein_id="ADG23476.1"
FT                   /translation="MNLKAEVFLNQNCAEMMIKKAAQLILGSDLDFEYTRGVQDIQVDL
FT                   GPAFMFSPDEEKTLWVSGKNQETLEKDLATLNKSSVYFFRTGTQGGAGHWQVLYYEAAK
FT                   SGWVSYSSQSNHFQVTDSNGKLTASGKGLLVPHANWGKENGNYAFLLVNASAENIIHAA
FT                   NFVYILRTQNEVAAIEYCALNHEFHPEIKRTARAKAEPETRTKGEIHNHPKDLSCENLK
FT                   TIYSKHVALLHVINRLETGSKSYNPYWMGSQAKLNTILGALGACYQKGLDVESELSNSN
FT                   SELSKAINIRRLPSLFSFWGGKIESPVESRKIIDENRTYRRNNP"
FT   gene            249704..250441
FT                   /locus_tag="lpa_00323"
FT   CDS_pept        249704..250441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00323"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23477"
FT                   /protein_id="ADG23477.1"
FT                   /translation="MNNVNGQSMTRIDEIVPDIYRISTSISQEIIPGGFSFNQYLIIDK
FT                   KPVLFHTGPLQLFPAISQAVATVIPVESLCFIAFSHFEADECGSLNEWLKVAPDAVPMC
FT                   GRIAAMLSINDLAIRSPKVMNDLEQVSLGKHNVQWLDAPHLPHGWDCGFLFETTTKTLF
FT                   CGDLFTQPGAEHQPITEEDILESSEMMRQAMDYYAHSNNQRQLFEKLASTHPKILACMH
FT                   GSAWKGNGFQLINALADRVCSNI"
FT   gene            complement(250579..250953)
FT                   /locus_tag="lpa_00325"
FT   CDS_pept        complement(250579..250953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23478"
FT                   /protein_id="ADG23478.1"
FT                   /translation="MGFINITDKVIECLKESSIQEGLILINAMHITASVFINDDESGLH
FT                   QDYKKWLEQIAPHEPIRQYRHNDTGEDNADAHIKRQIMGREVVVAITEGRLDFGPWEQI
FT                   FYGEFDGRRDKRVLVKIIGQ"
FT   gene            251424..252197
FT                   /locus_tag="lpa_00327"
FT   CDS_pept        251424..252197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00327"
FT                   /product="Hydrolases of the alpha/beta superfamily"
FT                   /note="COG1073, Hydrolases of the alpha/beta superfamily
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00327"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23479"
FT                   /protein_id="ADG23479.1"
FT                   /translation="MYKTVHFYSNNLKLEGKLEEPTGKCLGYVLFAHCFTCGKDIAAAS
FT                   RIASALVSNGFAVLRFDFTGLGSSEGSFSETNFSSNVEDLVAAADYLRTHYRAPVLLIG
FT                   HSLGGAAVLLAAKKISEVKAIATIGAPASAHHVKHHFSADLSKIESDGEAQVTLGPRSF
FT                   TIKKQFLQDIDRYQDTINSDAGKALLILHSPIDKVVSIKEAEKIYKAAKHPKSFISLDK
FT                   ADHLLSDKRDSQYAAEVIAAWASRYLTPSSEDQSG"
FT   gene            complement(252279..252734)
FT                   /locus_tag="lpa_00328"
FT   CDS_pept        complement(252279..252734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00328"
FT                   /product="Predicted membrane protein"
FT                   /note="COG3212, Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00328"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23480"
FT                   /protein_id="ADG23480.1"
FT                   /translation="MPDIKHYLKPMVLFSGLLVTPFAMAEATKAEETSTVKLSTILQQL
FT                   SDQGYKNIHDAEIDDGVLTVEGSNEQGVKFEIHLDPATGKILKKQEHPQPKYSIIDITK
FT                   KIENEGKFKIIEIEFDEGIYKIKGETDSHEKKELHIDPNTGETKTDH"
FT   gene            complement(252903..253787)
FT                   /locus_tag="lpa_00329"
FT   CDS_pept        complement(252903..253787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00329"
FT                   /product="hypothetical protein"
FT                   /note="COG2354, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00329"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23481"
FT                   /protein_id="ADG23481.1"
FT                   /translation="MAGTSLLTLIDDIATALDDIAAMTKVATKKTAGVLGDDLALNAEQ
FT                   IIGIHANRELPVIGAVAKGSAVNKLILIPLAILINFFAPALVGILLILGGLYLCFEGFE
FT                   KIVEKIFHKKNEPAKKKIDIQTIDMRQFEKEKISGAVRTDFVLSAEIIVITLGTVAATS
FT                   LVNQIAVLTLISLIMTIGVYGLVACIVKLDDLGFILREKKHPLKQIGILLIGAAPILMK
FT                   ILSVAGTIAMFLVGGGIITHQITAIHHFTENLSAMMSIGIDFFIGIISGAITAALYFIF
FT                   KKMKSKFKLMNTK"
FT   gene            complement(254063..254473)
FT                   /locus_tag="lpa_00332"
FT   CDS_pept        complement(254063..254473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00332"
FT                   /product="peptide chain release factor"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00332"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23482"
FT                   /protein_id="ADG23482.1"
FT                   /translation="MIGKDKWEILTEKMTNLHIYETDLSEKFILGSGKGGQKLHKTAST
FT                   VYLKHLPTGMEVKCQESRSREDNRYFARQRLCEKLQAVFSDEKTKTQQRIEKIKRQKRR
FT                   RSRRSKQKMLDEKSRQSQLKTLRKNPRSHDIE"
FT   gene            complement(254574..255284)
FT                   /locus_tag="lpa_00333"
FT   CDS_pept        complement(254574..255284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00333"
FT                   /product="putative protein conserved in bacteria"
FT                   /note="COG3009, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00333"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23483"
FT                   /protein_id="ADG23483.1"
FT                   /translation="MKNQKHFLKFYCIRDRSWPASARASFEGIRFLSFSNYAEFRKKPV
FT                   KLLLLLLIVLTLCDCGRSKETQFYLLTPISPQKNSHNSYNHLQIGVDEVSIPDYMKKPQ
FT                   LMIHQTPHHLTLEEFNQWAGALDKNITLVLTTNLSTLMPGVVVQTSPWDNKFHPDYHLQ
FT                   VMISQFEIDIHGNSILRAEYLIYRKEELIYKGNAYYHIKVPLISIETLVQSMNTNLTHL
FT                   TEEIARFFIKNTTK"
FT   gene            complement(255281..255967)
FT                   /locus_tag="lpa_00334"
FT   CDS_pept        complement(255281..255967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00334"
FT                   /product="probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00334"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23484"
FT                   /protein_id="ADG23484.1"
FT                   /translation="MILGGTFFYIEYKRAQKQTFVMFFKGSLKGLVTTAPVTYRGVKIG
FT                   EVKVIEITENKEHSKVLIPVYVQFFVERTYGFSQDPIHLLIDNGYVANITKPNLLTGVA
FT                   EIELIKPTPTVKYRQTYYHSYPVFPTHNSAEKYTSMEEAFEAAKKAFEDVSELVRSKEI
FT                   QDTLEAIQKVSENLGQLASSLNQDVPSVVAYLNQSLKQITSAAYSTQNLTDYLSRYPES
FT                   LLRGKR"
FT   gene            complement(256035..256790)
FT                   /locus_tag="lpa_00335"
FT   CDS_pept        complement(256035..256790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00335"
FT                   /product="probable ABC transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23485"
FT                   /protein_id="ADG23485.1"
FT                   /translation="MYVFRRFSKHIITFLHSLELAFRFLGHLVDSTIKVIFGKLSIVWP
FT                   NTLEMIYYSGARLVILLSFIGILLGATVSQTVYALLKPFQLHQRVLPIVQNILTHEILP
FT                   VLIGFILCIQAALHMVNTRLEHYQENPEAIILAQVLPIIVGMNIASLLLYVYLVSAIFF
FT                   SFYLTFHFMLGFTNNEFLSYVVSSTTLFDLIYSVVKTLILCIIVGLTSGYYYYEASIRH
FT                   IYLRKAVSRILTRGSFWLIIASMYITLTF"
FT   gene            257456..258154
FT                   /locus_tag="lpa_00339"
FT   CDS_pept        257456..258154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00339"
FT                   /product="putative protein conserved in archaea"
FT                   /note="COG1771, Uncharacterized protein conserved in
FT                   archaea"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00339"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23486"
FT                   /protein_id="ADG23486.1"
FT                   /translation="MTTLYIKNLRYNEVAVCRALFEAAEKTEEGIKTKRYGMQLTADMP
FT                   GLWSPLSNYDIENDLRMARIHRNGRMREIGYLTVNLVFQFDSLDVTEYETKYGISAKDV
FT                   LEKAGFTCSQDAAGYSEPVSTSTRLLGQESKPEKPTQTSVVNTSFFSLKSVDTDKRFTK
FT                   STKPGILYEARSYGKIEDDTLKSYGFTDGQWERQKEGIENIVIIKKLTQSISPGPAVLD
FT                   EAVDNIPTLS"
FT   gene            complement(258279..259139)
FT                   /gene="lysR"
FT                   /locus_tag="lpa_00340"
FT   CDS_pept        complement(258279..259139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="lpa_00340"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23487"
FT                   /protein_id="ADG23487.1"
FT                   /translation="MSLLLDDIKYFIAASDTLNMTRASEIIGISQPALSYSIKRLENKL
FT                   GGLLFIRLKNGIQLTKLGEEFKRRSHRLLYEWEQVQNIANPESGFVQGNYTIALHPSVA
FT                   LYTLQYFMPKLQVNYPGLGINFIHGHSREMTEKVISWEADFGIVVNPIQHPDLVILKLS
FT                   TDEVTVFYANDAQNKLIYDRKLAQSQYILKKIGKKITFNGVINSTSLEVVAKLTALGLG
FT                   YGILPTRVTYPYKHLKKVLNAPVFRDEICLVYRPEKHNNPVSKKIIQIIRSSISNDNDK
FT                   ENYFD"
FT   gene            259250..260299
FT                   /locus_tag="lpa_00341"
FT   CDS_pept        259250..260299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00341"
FT                   /product="pyoverdine biosynthesis protein PvcA"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00341"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23488"
FT                   /protein_id="ADG23488.1"
FT                   /translation="MKNTAFLITKNRYTKDYRLKKSPDSDSAMGVAKRILAEVMIFRRV
FT                   PETISLCGTGCQKCASPHLPKIISAVNKNEPVTFILPAFPGKSPNPEKVLGHLPDHAER
FT                   LSLNFLGTLCQRIKNFYTPGIKIILCSDGRVFSDVVGMNESDVTAYQLELDRLIKEMSL
FT                   ADLSTFNLDYFYKDLHFVQMREELMKSYGQSLDFLKQKIRNGAKPSASPDEQEANRMYS
FT                   GITRFLFEDAMHAGQTKSRTAIQKESRFKAYEVIRRSNAWSALIAERFPKAVRLSIHPQ
FT                   TCGSKKLGIRLIGNESWMTPWHGVAVESNKGYVLLRRSEAEALGAKLICSSDGRHSHYQ
FT                   LMAEVSYEL"
FT   gene            260289..261125
FT                   /locus_tag="lpa_00342"
FT   CDS_pept        260289..261125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00342"
FT                   /product="pyoverdine biosynthesis protein PvcB"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00342"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23489"
FT                   /protein_id="ADG23489.1"
FT                   /translation="MNYKVTSLKPFGVLLEPVSEKTKVTDVDIENLRHLFAKNQLVVLR
FT                   GFCAFQNAEDFSNYCELWGEVSLWPFGKVLELIEQEDPEDHIFDHSYMPLHWDGMYRPQ
FT                   VPEYQIFHCVKAPLPGQGGRTTFSNTILALQFASSEIKELWNKVCGTYQRKMEFYNSKT
FT                   VSPIIMKHPQKDFSVIRYNEPPSADKGHFVNPPDIEFTGIDQEELDFFHRSLNKALYSA
FT                   DNFYAHEWQNGDIVIADNFSLLHGREGFVSRSPRHIQRVHVLSNPPFDNPGLESYQ"
FT   gene            261122..262564
FT                   /locus_tag="lpa_00344"
FT   CDS_pept        261122..262564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00344"
FT                   /product="FAD monooxygenase"
FT                   /EC_number="1.14.13.-"
FT                   /note="COG0654, UbiH, 2-polyprenyl-6-methoxyphenol
FT                   hydroxylase and related FAD-dependent oxidoreductases
FT                   [Coenzyme metabolism / Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00344"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23490"
FT                   /protein_id="ADG23490.1"
FT                   /translation="MSAQVADVVIVGAGPVGLMCAYLGQRCGIHTVIVDKSDGPLEVGR
FT                   ADALNARTLQLLELADLFDELYPLGKICNTSSVWADGQFISRQSSWWEELEGCLHKHFL
FT                   MLGQSYVEKLLDEKLKETAAAVKRSTAIVNIEINEAGCLTTLANGECIQSRYVIGADGA
FT                   RSFVRNHFAIPFEIIRPQIIWAVIDGMIDTDFPKVPEIIVFQAETSDVAWIPREGEIDR
FT                   FYVRMDTKDFTLQEAMDKINHAVRPHSLNFKDIVWFSQFSVKESVAESFFIQDRIFLAG
FT                   DACHIHSVNGGQGLNTGLADAFNLMWKLHMVMHFGAPKELLHSYEAERKPVAHGVIETS
FT                   GELVRSTKYSLNGTHAQDYVRIVQKRAGYITGMGIRYGETGLCGSRLFDFEIFNGIAKT
FT                   RLYSLLDYMKFTLLIFGDCEVELEPPEFVKVIPIYPTQCQENFWTDNTHYANQAILVRP
FT                   DSYIQYSVPLDKMESLFELAQL"
FT   gene            262561..263709
FT                   /locus_tag="lpa_00346"
FT   CDS_pept        262561..263709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00346"
FT                   /product="MFS transporter, DHA1 family, arabinose polymer
FT                   transporter"
FT                   /note="COG2814, AraJ, Arabinose efflux permease
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00346"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23491"
FT                   /protein_id="ADG23491.1"
FT                   /translation="MKKSLIFLAIGMFTVGCNTFLIAGLLPQIGETLGQPVAVTGQGVS
FT                   LFSLTYLFSAPLFSLIFVNQPVKRMIQLAFTVFMLGNLITLLSENIMLFLIGRSLAGVG
FT                   SGIFTPLCISIAVHFASPSAKGRILSFIWSANSAGVVFGVPAGLYLSSSFHWQLSIASL
FT                   IILSLLALVGFSMQNIDIRLPKPSPFGGRLRLLVEPKTLSVIGITCFTALASLGLYSYV
FT                   TLIQSGSPNSLSMTLLSWGLGGFMGSSLIGVCIDRTGKPRVIMALILVGLMFALIAIPF
FT                   TRNLPYLGLIPFFMWGACGWAIVTPQQHILYELHENQGTILAAINSSALGLGAALGTLL
FT                   GGLLISSGFRGIYLPFSAATLLFFVLITQLIVINTSHKVNNT"
FT   gene            263706..264938
FT                   /locus_tag="lpa_00348"
FT   CDS_pept        263706..264938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00348"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23492"
FT                   /protein_id="ADG23492.1"
FT                   /translation="MNRPVVIVDPLSSGIELAPAFKARGIPAIAVTLKPLDWIGFGANM
FT                   QTSDFIEIIPDQPNLVEVLAKYDPIAIIPGTEEGVPLAEALAITLTPQFANDPEKSQNR
FT                   LHKALMQKALQEAGVPALKTLNTASESEVEAWIRTNGLIDSPLIIKPPVSAGSDKVFHI
FT                   PARGDWKKEFNRVLSEPSKITGKNNETVVVQEQAIGTEFAVGTVSANGKHYLAHLIQYN
FT                   KTSFNDRKTVYNYVEFVPYSQERYGELFEYTQKALDALGVRWGAAHNEIMLTKDGPRLI
FT                   ETGARMCGGPVVGFAREATGSSQADKLVEIYVDGGVSTEEYVFKKTVVPVFLKSPAKGK
FT                   ISNVEAFAELSKLPTFLNEHIWFKNGDLVPQTVDYLTSIGIIGLAGDRKSILLDYEKIR
FT                   NMESKLVIQTF"
FT   gene            complement(265106..266248)
FT                   /locus_tag="lpa_00349"
FT   CDS_pept        complement(265106..266248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00349"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23493"
FT                   /protein_id="ADG23493.1"
FT                   /translation="MLSKYDKLIYINLAQDQVTANIDTLIIHESPTILVKIPDGSDLKT
FT                   LVDPDFFPGPITNRTKIYFSAHGHEELDDMVLDRQKENPKIYKLDDVAAYFGKLLTNPD
FT                   FKNPDIKPRLTLVMSVCEGLGFAKNLQKKLFDDYGLLVDVIANKNVIHEQFVKPHHETT
FT                   AYLTHRETSIKGVGREHKRPHSKVLLTIDKEGTQQEIDAYELKWIEKVLNTIHQQVATF
FT                   GKWADFEKPENIKIQEGLNAFCHDVDALISLFINQDINLTANNLLALLLSCQKTTADPL
FT                   YKQAMNYEMFQIMTKNLINEGLRYINPKIEMQEYSHALEELQSQKDKMIRDEVAPNIFR
FT                   AKKAIFSALLAEASEYGIDSVLEQLEKAKQELSQGKMNPS"
FT   gene            complement(266414..266575)
FT                   /locus_tag="lpa_00351"
FT   CDS_pept        complement(266414..266575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00351"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23494"
FT                   /protein_id="ADG23494.1"
FT                   /translation="MLLTNQSLIQNYYKKRNFIKKITFFGNLDQLDEKAENHSVGYTHS
FT                   LACFFISL"
FT   gene            266797..267771
FT                   /locus_tag="lpa_00352"
FT   CDS_pept        266797..267771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00352"
FT                   /product="O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00352"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23495"
FT                   /protein_id="ADG23495.1"
FT                   /translation="MNKFPQSFSEANERIGNAIHHVCLNALDAKFIKSNIQESYQSWAN
FT                   VLYDRVFLNWGLCDKKIYRELSSLNFDFSTVGFFPHVYGQSLLFYLIRPLIKIHFFNKR
FT                   LLDVGCGNGVGLKISSELLKTRYALGIDLVNKLVTNSNNNFYIEDKINYMQADAENMAI
FT                   ANESFDIVTNLESSHLYPQIEHFFSEVERVLAPNGFFCYADVNFDVKRQAERFETFVKT
FT                   RKNLRIIEKHNITKMIQASIYQRLIVNEKRFYQLAQYLLGPDKINYTSELANVASSMGL
FT                   MFLPWWRIRFKNPALQALGKFARRYKHWNKKYYFYYLIQKIDS"
FT   gene            complement(267897..268739)
FT                   /gene="htpX"
FT                   /locus_tag="lpa_00353"
FT   CDS_pept        complement(267897..268739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="lpa_00353"
FT                   /product="Zn-dependent protease with chaperone function"
FT                   /note="COG0501, HtpX, Zn-dependent protease with chaperone
FT                   function [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00353"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23496"
FT                   /protein_id="ADG23496.1"
FT                   /translation="MINNLKTFILLASLTALLVVIGGLLGGSTGMLVALLFAGIMNFSA
FT                   YWYSDTLVLKMYNAEPLSNNHFVYHIVSELAHRAGTSVPKVYLINNSTPNAFATGRNPE
FT                   NASIAVTTGLLDRLTQEEITGVLAHELAHVIHRDTLINVVSATIAGAISGIANMFMWLS
FT                   MFGHNSNNEEGVHPVVGMIMMIVAPLAAGLIQMAISRSREFEADAGGARISGNPQWLAS
FT                   ALLKLDQANHEQYFDEAETHPATAHLFIINPLNGEKLANLFSTHPSTAERVARLRAMY"
FT   gene            268941..269852
FT                   /locus_tag="lpa_00354"
FT   CDS_pept        268941..269852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00354"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23497"
FT                   /protein_id="ADG23497.1"
FT                   /translation="MYSKYPVFFPNKNIKSFSGVRFSNVVGIPSAIESLYRGDNNLADI
FT                   IFLLPTLITGVFCQNFPEVVDMEQVRLHKLTNLSNDFHMVSMSEDPQIALDWGKGCFIT
FT                   IDPVLFSDYIVDVHATFRKNQLNFPDRMEQEREHIALAVPFCSIEKITIHNQELANPFY
FT                   LSIPQDNHEARMEFNTLYSELISLLRKKYTQEADGEEEKVALRAYAIRYLDFYSKFGSC
FT                   NNPFNKSLAQLVELYPEFMSNFLQSSHLSSKTGLMKDVVLNSSENLFKEHPYTQSIDAS
FT                   YIFRVKESTTCYEDDWAKPVYD"
FT   gene            270057..271535
FT                   /locus_tag="lpa_00356"
FT   CDS_pept        270057..271535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00356"
FT                   /product="amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00356"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23498"
FT                   /protein_id="ADG23498.1"
FT                   /translation="MNIAIIGGGTGLTTAWALENQRTFHVTVFEENDRLGGHIHSIKIN
FT                   NVILEGGAEFIGPPALYPNVHRLFQYLGMALDQFELNMDFDNLKQRDHIVLPPLYHTSS
FT                   GKSEDVSSILYTLSCGLFGKRRKQNETRISVDTMLTEMYNLLEMNHLIMDARNKLLHPD
FT                   NLMTLEQFIKEFKEKCVHILSPVDKFAEEFVYPLIASGWGVSIETIKKFGAHYAMNYLA
FT                   AGMNWFDAPEGLSSYIDKMVAQCTNTQFKVNTAIKKLIPITIDGKIKYQLLKRDDTFVC
FT                   DATGSPIIYDDVVISTPAYVTNELLSDIESNTIKVLREKLANVTYYDTTVVFHQDPEYL
FT                   SPYRTVVHSRFDGTQSANTMCKPWKFNKDEIPIMKTWVLPGQEMPKNVLREVHYKHPVM
FT                   DKNYYEAQQALHAAQGEAGLWHGGILAGFNDSHESGVTAALQVAAQLNQREHCLDKNER
FT                   LALFPHILDSVLSSKLSTDMRVEVAAVAAYPSMP"
FT   gene            271795..273204
FT                   /locus_tag="lpa_00357"
FT   CDS_pept        271795..273204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00357"
FT                   /product="zinc metalloprotein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00357"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23499"
FT                   /protein_id="ADG23499.1"
FT                   /translation="MIRKKITQISFFMILALIVGTVEAKTARPADEQQLARSIYKQFIE
FT                   VQSGFTTGSTTPLVEVAVKYLKKAGFSNEDIFVGGASPQKANLVVRYRGTGEMKPLLLL
FT                   AHTDVVEAKASDWSMNPFQLTEKDGYFYGRGTLDDKAQAAIWIANLIQYKQEGFKPKRD
FT                   IIVALTADEEGSSPYNGISWLIKNHKDLIEADFALNEGGWGDLANGKKISQNIQVSEKY
FT                   IVNYNLEVRNKGGHSSLPTKDNAIYRLAGALERLSKFNFPLKTNDVTAAYFKQMAAIET
FT                   GPLKTEMIEASKGSKQAMQRLANSSPQWNAILRTTCTPTLLEGGHAMNALPQLAAVTIN
FT                   CRVLPEDSPEMVEQSLKTAINDPEVTLKRIGKLSRGPSSPLSPEILKTITHLTQTYWPE
FT                   VPAIPIMVTGATDGRYLRSAGIPTYGVMGLFLDRDDFRAHGRDERISVESFYEAHAFLY
FT                   DLVKQLSSNVT"
FT   gene            273343..274395
FT                   /locus_tag="lpa_00358"
FT   CDS_pept        273343..274395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00358"
FT                   /product="acyl CoA transferase/carnitine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00358"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23500"
FT                   /protein_id="ADG23500.1"
FT                   /translation="MLKGLKVIDLSTVLAGPSVGTFFAELGASVVKIEHPVHKDVTRTW
FT                   KLPGEDPHSEISAYFASVNFGKDYLFLDLMKEEDYLCFLNLIAEADILIMNFKKGDDIK
FT                   LRIQADHLLSINPRLIIGKINGYGEESERVAYDLVLQGESGFMSINGTPDSGPVKMPVA
FT                   LIDVLAAHHLKEAILLALYNREKSGKGKVVSVSLYDAAVSSLVNQASNYLMTGQVPQRI
FT                   GSLHPNIAPYGELFRTADAALIILAIGSDRHFAKLCAVLGLNDLPDNDEFKHNQNRVRN
FT                   REKLALLIAEQTAKWQSNKLLELLHSENVPAGKIMDLKDVFDDERAKSLIRKELIGDIT
FT                   TARVTSVVFK"
FT   gene            complement(274592..275458)
FT                   /locus_tag="lpa_00360"
FT   CDS_pept        complement(274592..275458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23501"
FT                   /protein_id="ADG23501.1"
FT                   /translation="MKPGYLLGALLLSPLLAFANSDNNADGLIFSPLPQNKNTVVRHYS
FT                   NEQDMSNLNQMTQRSIDFPTQIVRVSGNLTGLELSCDDVENEIDQIFSKKISPNLFTYN
FT                   TYVSCGFDEHDPEQYATNFSIQSYFDPLTDNAVDYLKNYLKEYNGYNLFNTTTLQIENA
FT                   KGIIVSMNLNAGLKNNPDKTPFMLYRQDRNNFYFKSNFDMRKELITDIYQRFYSNDPDM
FT                   ILPFFDKWIFSYAGSVYYSILKASNYLELQPERIFVMENEGDIFVSDLRYYFANLCMKR
FT                   NPNKHCL"
FT   gene            complement(275952..276521)
FT                   /locus_tag="lpa_00362"
FT   CDS_pept        complement(275952..276521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00362"
FT                   /product="heat shock hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00362"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23502"
FT                   /protein_id="ADG23502.1"
FT                   /translation="MKNKLLPNLIIIALAATISANSITAQAKQNDQIQNSNEQFTQDPF
FT                   DTDPFFQSHDDVLLQIHKMQQAMDQFIKSQFSQMQNTLANDPHHNPFGSAKNIQITENK
FT                   DELIYKIKLPQGSDSKVDITVKNGQLVLSANVTQKITREQDNNKSVSFSQSNYMQSFPL
FT                   PQSYDPKSMVTKMKDSNLIVTFKKHS"
FT   gene            complement(277005..279254)
FT                   /gene="katG"
FT                   /locus_tag="lpa_00367"
FT   CDS_pept        complement(277005..279254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katG"
FT                   /locus_tag="lpa_00367"
FT                   /product="catalase/peroxidase"
FT                   /EC_number="1.11.1.6"
FT                   /note="COG0376, KatG, Catalase (peroxidase I) [Inorganic
FT                   ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00367"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23503"
FT                   /protein_id="ADG23503.1"
FT                   /translation="MFKRTIPLFAAFTLAISPSVFPNYAHAQEDKPKTNQYWWPKMLDL
FT                   SPLRQPNATSNPMGEKFNYAEEFNSLDLNAVIEDLKKLMTTSQDWWPADYGNYGPLFIR
FT                   MSWHAAGTYRIYDGRGGANGGFQRFAPQNSWPDNANLDKARRLLWPIKQKYGRKISWAD
FT                   LLVLAGNVAMESMGFKTIGFAGGREDAWEAININWGPEGKWLESKRQDKDGKLEKPLAA
FT                   TVMGLIYVNPEGPNGVPDPLAAAEKIRETFGRMAMNDEETVALIAGGHAFGKTHGAASG
FT                   KYLGPAPEAAGIEEQGFGWKNSYGSGKGKDTITSGLEGAWTVTPTHWSHNYLQNLFNFN
FT                   WVKTKSPGGAIQWVPENSNASSMVPDAFDPSKRHAPVMLTTDLALKFDPVYSKIAKRFL
FT                   DNPKEFDDAFARAWFKLIHRDMGPRSRYLGSLVPKEVMIWQDPVPPVDYKLVDANDIAN
FT                   LKGKILNSGLTTSELVKTAWASASTFRGTDMRGGANGARIRLAPQKDWPANDPQELAKV
FT                   LKTLESIQNNFNNAQADGKKISLADLIVLGGNAAIEQAAKQAGYDIIVPFMPGRTDATQ
FT                   GMTDVKSFEVLEPKADGFRNYFDKSNNMSPPEMLVEKASLLKLSVPEMTVLVGGMRVLN
FT                   ANTGQNQYGVFTDKPGILNNDFFVNLLSMSTEWKKSSETEGIYEGYDRKTGKLKWKATS
FT                   VDLIFGANSELRAVAEAYATDDAKDKFIQDFVNAWVKVMTADRFDIKAANANINS"
FT   gene            complement(279385..280377)
FT                   /locus_tag="lpa_00368"
FT   CDS_pept        complement(279385..280377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00368"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23504"
FT                   /protein_id="ADG23504.1"
FT                   /translation="MPKTKYALPPVVLYESHADRATSDFLIKQLPDLKKAGYTTICVDG
FT                   MEPGASLEENISMMKILIKMQIKKLSELPLEHPEYEQGIAKLRSVVAKLDLFEAMKEQG
FT                   FKLGGIDLPVSEQLKEKSLNSIRREQTLTDNTLRHVKENDGGVVVVLGFGHCIFQQMIK
FT                   EQDENADQYLWYHVHNPDNETQAYKELVESYTKKGLSTYFPLGVNIFKSSDKKLDTDFW
FT                   NKVSANCYNYDPKALETSTASILKSLLGPEVTAHLRTDGQHHVDALISLETVQKKHQVK
FT                   SSDFLRSLSKTLGDIHFEVAKIKTKDQVIIRGINEPEVAEQISKLSKKM"
FT   gene            280856..281173
FT                   /locus_tag="lpa_00370"
FT   CDS_pept        280856..281173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23505"
FT                   /protein_id="ADG23505.1"
FT                   /translation="MTMMITTGNSFEGKVIKQYLGIVRGIVVRSPTISQGLMGGLKSIV
FT                   GGKIGAYSQMCEHAREEAFQLMIEHAQALNANGIIAMRYDTGEIGQAGTEVLCYGTAVI
FT                   I"
FT   gene            281371..282741
FT                   /gene="cydA"
FT                   /locus_tag="lpa_00371"
FT   CDS_pept        281371..282741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="lpa_00371"
FT                   /product="cytochrome bd-I oxidase subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /note="COG1271, CydA, Cytochrome bd-type quinol oxidase,
FT                   subunit 1 [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00371"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23506"
FT                   /protein_id="ADG23506.1"
FT                   /translation="MLVELLSRIQFGFSIGFHILFPTLNLGLAVFLVIMEALWLKTKNP
FT                   VYLEICKFWTKIFALTFGMGVVSGIVLAYQIGTNFGPFITQFGNVLGALFAYETLTAFF
FT                   LEAGFLGVMLFGWKRVPPALHFIATLLVTIGTTVSAFWIMSANSWMQAPSGYQLIEGKY
FT                   VVDSWWAVVFNPTFIPRFIHMLLASYVTTCFVIMAVSGFYFLRKQSTAIAKKSLSFSLW
FT                   ASLILVPLQIGVGDVVGINVHHYQPLKTAAMEGIWETQKGAPLLLFAIPSQTQQKNFYE
FT                   VGIPKLASLINTHEWNGEMIGLSSVGNEEQPRMAPVFFSFRIMVGIGLIMLFTAIAGFI
FT                   LRLRGTLFENSWFHRWCIVMAPLGFIASIAGWLTAELGRQPWVVHGLLKTRDSVSAIGV
FT                   EEVIISFVLLIVAYGVVFGFYLYYLLRLISHGPGILEEDEVEHHAFQYMTDFPKEKK"
FT   gene            282741..283730
FT                   /locus_tag="lpa_00373"
FT   CDS_pept        282741..283730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00373"
FT                   /product="cytochrome D ubiquinol oxidase subunit II,
FT                   cyanide insensitive"
FT                   /EC_number="1.10.3.-"
FT                   /note="COG1294, AppB, Cytochrome bd-type quinol oxidase,
FT                   subunit 2 [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00373"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23507"
FT                   /protein_id="ADG23507.1"
FT                   /translation="MLPFIFATLLGFIVLMYVILDGFDLGIGILFPFTSSESERDKMMN
FT                   SIAPVWDGNETWLVFGGAMLYGAFPQVYGLLLPILYMPIMLMLIALIFRGVSFEFRFKA
FT                   KRSKTLWNWSFSISSVAATFLQGVILGAFVQGFSINESSMTINDPDWLTPFSLCTGIAL
FT                   VCGYALLGATWMIIKSTGRLQRKMVHYARGLLVLVSFFLLFVSIWTPLHSEEVFHRWYS
FT                   FPNMLLLSPLPLIALIAIYLVWQNLSSGSEYKPFIYSIIIFLCSYIGIAISVYPYLIPH
FT                   HVTLWEAAAPDSTLVFILIGVAIMLPILLAYTLYAYYLFRGKSSENYH"
FT   gene            complement(283731..284468)
FT                   /locus_tag="lpa_00376"
FT   CDS_pept        complement(283731..284468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00376"
FT                   /product="Predicted membrane protein"
FT                   /note="COG3752, Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00376"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23508"
FT                   /protein_id="ADG23508.1"
FT                   /translation="MCLIWLWYRYTNNPSVVDVGWASGLTLAGLIYLNNQEFSLRSLLL
FT                   VLALLTWGIRLGGYLWWTRIRLKKIDKRYLALSNDWKLAKPLGFFLNFQLQGVLICLVS
FT                   IPWYFSSSETQTTLNLLDGLALMIFLTALILETVADNQLQDFKKNYPGKVCNQKLWRYC
FT                   RHPNYFYEWLVWCSFTLFALSAPYGWIAIISPLTLYLIMTKITAPMTEQGSIESRGNLY
FT                   IEYQKVTPMFFPKWLKNNSTPRK"
FT   gene            complement(284513..285049)
FT                   /locus_tag="lpa_00377"
FT   CDS_pept        complement(284513..285049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00377"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23509"
FT                   /protein_id="ADG23509.1"
FT                   /translation="MIINPVHTVHYLSYYLCWIFCIYLASYGYPLLGLIITVLIMGLQI
FT                   IVQILNQLPWRDALYFSIGLTLLGAITDAIWLYTGMIYFKANFFGSHFPPLWMVALWLS
FT                   FGFNLVVLYGSWLTHYFLWGLVMFPSIIFAYWLGVQFGAATLIGSEVVFYLTLGLTWSL
FT                   FLPLSLYLFNYQHRK"
FT   gene            complement(285039..286826)
FT                   /locus_tag="lpa_00379"
FT   CDS_pept        complement(285039..286826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00379"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00379"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23510"
FT                   /protein_id="ADG23510.1"
FT                   /translation="MPLDKLTGITFHAAIIAGCHRLIRHKQILNDINVFPVADGDTGDN
FT                   LSSTGMAIIEFSSAKTKLRGTLESIADASIIGARGNSGIIFSQFFNLLAKHLPLKEELY
FT                   FNDFSKIMVQVGKEIASVVTNPVQGTMITLIQKWATVCEIKQPNSLLAQAMLELLPLLS
FT                   VEVEQTKNSLNILQKANVVDAGALGFYYFVEGFTQFLQQSHTTDTANTHSPLSITEHPQ
FT                   LTCTTTEYRYCTEAVLKSASIDKNKLLHFLKEQGECASVTGNDRITRFHVHTNNPREIF
FT                   TSLYKDYTIQYPKVDDMQRQHELQFGKKYKIGLVTDSSADLPQDLIDEYQIHQIPLNIH
FT                   VDEHHLLDKHCFEANYFYTQLNSFRTYPKTSCMNPNFIEEKLAKIASHYDHVLVLSISS
FT                   KMSGTYDAFLTATKKYTNITVLDTKTNSGAHGLLLHYAGQLIASGNDIDTIAKLLGKAI
FT                   KNTYIFVMVNQFESMIRSGRVNKISGRIAQWVNIKPLVSIDSAGQGIMVSKCFSASRAR
FT                   NKLINFLQEKKDEAQLILEDYCIIHAGDKNQALLLAEMTTQAFNKPPTYIEPVSLAIGL
FT                   HAGQGCIAIAGRLRERNDY"
FT   gene            286909..287607
FT                   /locus_tag="lpa_00380"
FT   CDS_pept        286909..287607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00380"
FT                   /product="2-deoxy-D-gluconate-3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23511"
FT                   /protein_id="ADG23511.1"
FT                   /translation="MARYLVIAASSAIGQSVTTLLKNRGDTVFTTARDNHKINPDFQLD
FT                   ATHFDAVLDVFRQTGPLDGVVNCAGSLLLKNAHSTSFDEFQAAINASLTTSFATIRAAG
FT                   LTMNQGGSVVLISSAAALVGLANHEAIAAAKAGIIGLAQSAAATYASNNLRVNVVAPGM
FT                   VNSPLTSSLLSNQLVLNASKAMHALGRIGVPEDIAHAIVFLLNPDNSWITGQVIAVDGG
FT                   LSRVRPKMKI"
FT   gene            287624..289162
FT                   /locus_tag="lpa_00381"
FT   CDS_pept        287624..289162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00381"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00381"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23512"
FT                   /protein_id="ADG23512.1"
FT                   /translation="MTTLCFILGDQLNETIASLAAINKQKDIVFLCEVAEETSYVPHHP
FT                   KKIAFLFSAMRHFAQQLKKKGYRVRYTAFDDPRNQGSFAKELLRAIEEEQVSAISLTEP
FT                   GEWRVLKIFHDLKSQLTIPVTLHEDNRFLCKINEFRNWAKEKKQLRMEFFYRMMRQKYH
FT                   LLVDNDGKPVGGSWNYDAQNRKNANRISSFPKRLEHARDVITDEVLGLVSAHFAKHFGQ
FT                   CYPFNLAVTREQALEEADYFMEHFLCNFGAYQDAMLKDEISLYHSKLSSYLNAGLLLPL
FT                   ELCQMAEQAYFSKQMPLNSVEGFIRQILGWREYVRGIYWLFMPDYGEMNYFNACRPLPS
FT                   FFWGEETGMFCIKEVVRQTSNEAYSHHIQRLMITGNFALLAGLDPKQVCEWYLAVYADA
FT                   YEWVELPNTLGMALYADGGLMASKPYAASGKYIHRMSNFCQSCYYNPNDLLGEKACPFN
FT                   ALYWNFLHQNQEKLKDNPRLHYAYMNWQKMDFDKQKKTIHKAQRILADLDSANL"
FT   gene            complement(289167..289580)
FT                   /locus_tag="lpa_00383"
FT   CDS_pept        complement(289167..289580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00383"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00383"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23513"
FT                   /protein_id="ADG23513.1"
FT                   /translation="MNGWTLKVFAIAFFIFIVTDMIWLGFIARNLYFDQYQQWLRLSEG
FT                   QLKPIWWSALLVYLLFALSIVVFVIPLAKTSLPYAALYGALLGAIIYGIYDFTCLAIFK
FT                   DFPVGMAFLDWLWGIVLCSWSSIATIYMAGYIK"
FT   gene            289954..292839
FT                   /gene="sPS1"
FT                   /locus_tag="lpa_00386"
FT   CDS_pept        289954..292839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sPS1"
FT                   /locus_tag="lpa_00386"
FT                   /product="Serine/threonine protein kinase"
FT                   /note="COG0515, SPS1, Serine/threonine protein kinase
FT                   [General function prediction only / Signal transduction
FT                   mechanisms / Transcription / DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00386"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23514"
FT                   /protein_id="ADG23514.1"
FT                   /translation="MKLLRFHELKSLPSMDEKALELLIKVLGNKGIRKLIKSADGKPIS
FT                   REIMIHEFGIDCQILFITTGASLKPIIVPTENKISGGGKSYCEQFKVYALDDGKTYFLK
FT                   SVKIDAESVTEFTNEKDTLSKLGRLVGTFFNEQTQVHYILTTFIKGIDLSRYKNALPLS
FT                   VNLKHFWEVLGIMISVCHQVKQFHELGLIHRDLKPGNIMLDADMQCHLVDFGSSSSDKE
FT                   PKPVSWGTASYLAPELNAQEDFIAFSQASDLFALAYSLDELFNPFRQVKFAKVDIGIKN
FT                   KHLVLLHAEIEACITGLMSNETSARTLYFSRILQLQRVPESFKSRPEAFTYMIMLLTQW
FT                   KSCYEIPELKKELDEIIAEIKVAYENHEQDVLKITSMLEQLSKADGLLNSHKSLLSVLI
FT                   KSLANVQQQELGHDDILPRRFESDIVSQLIKNPTAKMMAAIKQVSDAIVKILEQYEHSP
FT                   TESFEHEVLQDFLEQMVQSDILFGAPKEKIEISDIIKILKENRPEDFVQIQHISFKFAQ
FT                   VALRDLALHDLPKHEPEGAFLKILQKYQAKYAPEETSLFELYHHMAAVRDHSASKVKKG
FT                   EGYRFRAFICDELFYGDEIFSTGDNRGREGKPNQRLQTNQVGLMKFEHSVHTKGLLTLS
FT                   GQSWYADCKTQLPNYDSIHYLSALKTDCPYITGPSGMTSLFMNMMFLLLNPKDQDVILS
FT                   YSLGVMTYVVGAGYHSIKEILIPMVKCVGIVPDYPQHKGTEYLTASPLYNHYFKAIEEF
FT                   DKEFAEVHEKIWQEHLAYFRKTYMPVCMRNHCLPHQIPSMEDISSEVKEMLEIVSKSVK
FT                   NCLEEHKVKRTGDMGLFLSAPCGQTKALEVLSHVCQQQVGITAIFRQIQAYFKGTFETE
FT                   EGIVINKEMQLKFIAHFFNVLKESPTLLSQFNLTLRIENTIGVHQCEIGSSRRKELFLE
FT                   IKKTSIAANEEQMVANHEPRKENRNVIILPY"
FT   gene            292858..294828
FT                   /locus_tag="lpa_00387"
FT   CDS_pept        292858..294828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00387"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23515"
FT                   /protein_id="ADG23515.1"
FT                   /translation="MLSKEKINPSLKNTKRQGSDNLAAMADLTSLKNTGDYRCFNSKPE
FT                   AYTYFIFLLNQWQTNYMGDKREAIAKAIDSIKMAYENHEQDTSVVHKMLHGLSHLLEQE
FT                   HADELNALCLVPIKDSQSNANNILPRRFESELACRLIESPTKSMMQAIDLVSQAIINLI
FT                   EEYSKLDSKSSERAALNFFLQELEGSDIEFGAFKKRPSLEEVIAILKENNPKNFIQIQF
FT                   ISFMFARSVIGPFPLRNLPSFKPTGLFAQVLDKYLQDHPDLKEEEEGFSYQLIAAKNEA
FT                   EEFRTFITKKLFYQDELYTQGENRGRQGPRKTYLKTNQLGLMKLDHSAHSRGLTVIPEQ
FT                   TWCADAQAQEANQNSIYYKTALTNDCPYVTGPSGMTSIYMNMMLLLLNPQNIELIQAYS
FT                   LGIIAYIVGAGFHSVNEILIPLVKCINLLPNYPSYEGLEYLTHPPLYHEYFKQIAQFDS
FT                   DFIQLRDQVWAYYLNYFKSCYMPLCMRDFCEAEQLANCPAPAPEVKILCDIVLKSIEDC
FT                   INFHNLNRHLDSRFLGTTTADIDALNQLKEACASQSSISGIMRLLQKYFSGENIARPTA
FT                   MHKFETRSYIRFFLDALKDNPQIISHINEKMKLDPPLIISTKAEVFSDDFRIECFNMHR
FT                   ILKREHQVSEDCNNTSQFLKL"
FT   gene            294909..295496
FT                   /locus_tag="lpa_00388"
FT   CDS_pept        294909..295496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00388"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00388"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23516"
FT                   /protein_id="ADG23516.1"
FT                   /translation="MKNAAIIKNRIFLNLDKPVKRFLASDKADTPMTAEFYAEKDYEQL
FT                   FLDFLSQATGSYDEQISMLIAELDSGADRVAQKLMSALYSPWQKNLFPKAIKTIANKSE
FT                   EYPLMSDLLIKFCQQHVGSVDAVDDFGETALAKILKKDQQKKSPLLFLVKHGAKHCQLT
FT                   SALQDSLIVNNSDIYNVAEDNTMDWISNCPQP"
FT   gene            complement(295744..296217)
FT                   /locus_tag="lpa_00389"
FT   CDS_pept        complement(295744..296217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00389"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23517"
FT                   /protein_id="ADG23517.1"
FT                   /translation="MNKKSWMELIAWIITFEAIGFFLGMLTQANIPSWYEGLNKSGLTP
FT                   PGPVFSIVWSILYALLAITGWVLWCSRNESEMRSVFYLYSVQMLMNWAWIPLFFVLHWT
FT                   GLGFLWILVMASLTGLLILSLKNKKESIAILLLPYLVWLLFAAYLNGMIWLLN"
FT   gene            complement(296250..297665)
FT                   /locus_tag="lpa_00390"
FT   CDS_pept        complement(296250..297665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00390"
FT                   /product="deoxyribodipyrimidine photo-lyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="COG0415, PhrB, Deoxyribodipyrimidine photolyase [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23518"
FT                   /protein_id="ADG23518.1"
FT                   /translation="MTIALVWFRQDLRLTDNPAFIEACSHHETIIPLYIYDDKCSVLGQ
FT                   AQAWWLHHSLIALGKSLNQQGLSLVLRKGSPLEIILELVTQYGLESVYWNRCYEPQVIA
FT                   RDKKIKLALGEKGIKVHSFNGNLLHEPWTIKNKNGDFFKVFTPYWKQCRQILNIPSPFM
FT                   LTKRPRGIEITSDDLGKWKLLPAINWAARFSEYWTPGEEGAQKKLNEFVVHHLSGYKRE
FT                   RDFPAKNATSRLSPHLHFGEISPWVILRALELAKLEQTCDLASLEHFLSELGWREFSVY
FT                   LLYHFPKLDCENFRKEFDAFPWQNDEQLLTCWQKGMTGYPIIDAGMRELWATGYMHNRV
FT                   RMIVASFLTKDLLIDWRSGAQWFLDTLVDADLANNSASWQWVAGCGADAAPYFRIFNPV
FT                   LQSQKFDPDGVYIRQWIPELAQLNSQSIHQPWTDANASSIFLGKKYPKPIIDHQEARTK
FT                   ALSYYQQIKKGMD"
FT   gene            complement(297760..298467)
FT                   /locus_tag="lpa_00392"
FT   CDS_pept        complement(297760..298467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00392"
FT                   /product="inner membrane protein, LrgB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00392"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23519"
FT                   /protein_id="ADG23519.1"
FT                   /translation="MPSSILSESMIQAFFWSLITIGMYFITQKLYRRWPFWWLMPLALT
FT                   PILVASIVLLLHVNYQDYFRGTKWLVLLIGPATVAFAIPIYEKRALIRQHWPVLLIGVI
FT                   VGSFTAIASSWGLAILLGLDDNLRLSLLPRSISTPFAIEISRGIGAAPDLTAIFVIVTG
FT                   ILGAILGEFILSRLPFNSALARGALLGVGAHAAGTAQAHKIGNTEGAIASLAMILVGLF
FT                   NILLLPLISYLLK"
FT   gene            complement(298445..298834)
FT                   /locus_tag="lpa_00395"
FT   CDS_pept        complement(298445..298834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00395"
FT                   /product="hypothetical protein"
FT                   /note="COG1380, Putative effector of murein hydrolase LrgA
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23520"
FT                   /protein_id="ADG23520.1"
FT                   /translation="MANKIQQNSFFQIILVGLFWLASELLLKLVKLPLSGGILGLGIVL
FT                   LLLATNCLKLNRIRRGAELLLANMLLFFIPGVLAILEHQEFIGLLGLKILFIILLSTIT
FT                   VMLVTALVVDYCYRWRTHHAKQHSL"
FT   gene            298940..299824
FT                   /locus_tag="lpa_00396"
FT   CDS_pept        298940..299824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00396"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00396"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23521"
FT                   /protein_id="ADG23521.1"
FT                   /translation="MEFKLLQTFIEVVRQGSFSKAAENLFATQSTVSKAIKQLEEELGI
FT                   TLIERFKKRNVPTTAGEIVYQRGTKLLADRDDLLKELDEIRGLKQGRLRLGISPVGSST
FT                   LFAPLFVLYRQRYPGIEVELVEHGSDKLAECLRAGEIDFAGTLLPISEEFDCQLVRSEP
FT                   LVALLASGHPLATKHCISLPELKEIPFILFGSGFALHRIILDACRHAGFEPKVVAQSSQ
FT                   IDFMLELVAAGLGVTFLPRMIATQRHTTQIRSLLLNGSEFQWNMAMTWRRNSYLSEAAK
FT                   AWLALVREVHVDN"
FT   gene            299946..300158
FT                   /locus_tag="lpa_00398"
FT   CDS_pept        299946..300158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00398"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23522"
FT                   /protein_id="ADG23522.1"
FT                   /translation="MNNQKKIKCPICDKQNTWSPDNQFRPFCSERCKLIDLGEWASESR
FT                   KIPGSSIDPESIVTSNNKQDNEDEQ"
FT   gene            complement(300244..301323)
FT                   /gene="purK"
FT                   /locus_tag="lpa_00400"
FT   CDS_pept        complement(300244..301323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="lpa_00400"
FT                   /product="phosphoribosylaminoimidazole carboxylase ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="COG0026, PurK, Phosphoribosylaminoimidazole
FT                   carboxylase (NCAIR synthetase) [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23523"
FT                   /protein_id="ADG23523.1"
FT                   /translation="MKLGILGGGQLARMLALAAYPLGINTVCLDPSPDACAGQLTKLIV
FT                   SDFNDELALKQFLSEVDCVTIETENIPFSCAELAAQIKPFYPSTQALKITQDRLYEKNF
FT                   FRTLNIPVPEFLPVESEDELMQAISVIGMPAVLKTRRFGYDGKGQYVLRTQADISKSWS
FT                   LLGSQALILEKLISFESEFSLIAVRNKSGETSFYPLIKNHHRKGILHFSEAPVHQDTLQ
FT                   QEAQTHAFKILEALNYVGVLTIEFFYQGNQLIANEIAPRVHNSGHWTIEGAHTSQFENH
FT                   LRALFDLPLGSTEVSGSCFLLNCIGNLLPLEPCLSIPGVHYHAYGKAPRPDRKVGHVTL
FT                   VDTDLERYTKSKDLLLDIS"
FT   gene            complement(301320..301820)
FT                   /gene="purE"
FT                   /locus_tag="lpa_00401"
FT   CDS_pept        complement(301320..301820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="lpa_00401"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="COG0041, PurE, Phosphoribosylcarboxyaminoimidazole
FT                   (NCAIR) mutase [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00401"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23524"
FT                   /protein_id="ADG23524.1"
FT                   /translation="MKPILIGLIMGSQSDWQTLIHAAQTLDALNIGYEAEIVSAHRTPD
FT                   KLFQYAEQAEERGLEVIIAGAGGAAHLPGMVAAKTSLPVLGVPVMSQTLNGVDSLLSIV
FT                   QMPAGIPVGTLSIGKAGAINSALFAAAILANKYPDIRAALKRYREQQTQKVLDNPNPKE
FT                   EKS"
FT   gene            complement(301880..302719)
FT                   /locus_tag="lpa_00402"
FT   CDS_pept        complement(301880..302719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00402"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23525"
FT                   /protein_id="ADG23525.1"
FT                   /translation="MHYQNQRVLLASKHQKEKAIQPPFEEKLGCRIHVPADYDTDQFGT
FT                   FTGEIPRKASAYETLILKAKAAAKQFGYRYVISSEGSFGPHPQLYFCPADTELMAFVDL
FT                   DNDLIIAEHEVSTETNYSHIDISATDDYEAFLNKAKFPSHGIIVRALNSEENYIQKGIC
FT                   EREQLKTAIQKAFTYSTTIRLETDMRAMMNPLRMNVINKLAVKLVHRIQQYCPQCHTPG
FT                   FGKISSEGHLACISCGTPTELYLRKVLNCLKCEFKTYQARDDGLEFADQRYCPYCNP"
FT   gene            complement(302744..303001)
FT                   /locus_tag="lpa_00403"
FT   CDS_pept        complement(302744..303001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00403"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23526"
FT                   /protein_id="ADG23526.1"
FT                   /translation="MVANMMEKANISGFTLLRNVSGKGHHGFHEGKILFNDKASFVMFI
FT                   AVASEEAIANIALGMKTLFQKNSGVLFVSDVSVARVDYFS"
FT   gene            complement(303110..305398)
FT                   /locus_tag="lpa_00404"
FT   CDS_pept        complement(303110..305398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00404"
FT                   /product="putative protein conserved in bacteria"
FT                   /note="COG3002, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00404"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23527"
FT                   /protein_id="ADG23527.1"
FT                   /translation="MSSHITLIKTNKDNQNQMTQCNYPIDNDVMIIQAMVNNVAKQITP
FT                   VWPLEKFIACNSLHGFESMSFEEAILINQTAKKGTPFNEKLERVNWHMIKWCGSFLDIG
FT                   QGTIEMPHRDKGLYFGFLKLAPFDSALHQNNKSTKSWLSNLPEMPEQAIRLCLDKLGVL
FT                   NQRQEEFLQSTLSHLPGWAGYIKWISEWKNRNGKEENPVSLVDFLAVRLIITCVLWPEA
FT                   NLEEKKKEKDSTHTKQLIQNIKHNEDDYRQLLLKKLLPELNKVQIKENRANAQMVFCID
FT                   VRSEPFRRCIEKLGNYETLGFAGFFGLPVSIKDYDGETIKDSCPVLLKPRFNIHEKAIA
FT                   ANEHCIEHHEKGKEIKKILNRVYQQLKYNFSTPFALVESLGIWCGITMFLKSCSPIFAR
FT                   RITRNLNEMICPSIQTQPVFELDLLEKEVGISLQEQIAYAEMALRLMGLTDNFAKLVIF
FT                   CGHGSSTQNNPYASALDCGACGGNQGGKNAQLLASILNKITVRRALAENGINIPQDTVF
FT                   CGAQHDTTTDEVEIYHSNVSQFIDQDILDQLRTDLKMAKHNNNLERINYLNSIDCPEKD
FT                   IARRSTDWSETRPEWGLARNAAFIVAPRQLTKNINLEGRCFLHSYDWTKDEDGTLLETI
FT                   LTAPMVVAQWINTQYLFSTIDNVAYGSGSKITHNVAGKIGVMQGNASDLMHGLPLQSVM
FT                   SYDDKSFHEPQRLLTIVYAPREIISELVEKHDVLKTLFFNEWVHLVAIDPRSHLFYRLE
FT                   KTNIWSVIK"
FT   gene            complement(305413..306933)
FT                   /gene="nuoL"
FT                   /locus_tag="lpa_00406"
FT   CDS_pept        complement(305413..306933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL"
FT                   /locus_tag="lpa_00406"
FT                   /product="NADH dehydrogenase I subunit 5"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG1009, NuoL, NADH-ubiquinone oxidoreductase
FT                   subunit 5 (chain L)/Multisubunit Na /H antiporter, MnhA
FT                   subunit [Energy production and conversion / Inorganic ion
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00406"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23528"
FT                   /protein_id="ADG23528.1"
FT                   /translation="MDKLLNGLSISLMLSPLIALLFYSLLGKTRNIQATYYGTTVIGFG
FT                   FGLSLLALMISANTVNQNSYFLVHASTLNLLLSTLILFISFIIHRFSIRYMHGDKCYRR
FT                   YFFKLSAITLTTVVMALADNLLLFWLAWSVSNLLLINLMIHKSQWNAAYNSGILTLKTL
FT                   LPGSLSLITAFCIFFALNNTLSIEIITSEVSNKPSPAIAVALGFIILTAMTQSAIWPFH
FT                   RWLMSSLNSPTPVSALMHAGLVNGGGFLIVKFAPLFATQANLLTILFVFGALTALLGTL
FT                   WKLLQWNIKSMLASSTMAQMGFMMMQCGLGLFPAAIAHLCWHGLFKSYLFLNSGSAVQQ
FT                   KKYQNKSRPEKLTTLLIAFFGGLLGMYGFALITGKPILSLQTSTFLLGFAFITGTQVTM
FT                   SLITNEKHFKKGILALALVFSIGVFYGGSIHLIESLLPNLTGFPQHQLSSLQSLTLIVF
FT                   FSLWIVFSMGLFKKIRETRLWDWFYMYMFNASTPHPKTITANRHTYYY"
FT   gene            307035..307886
FT                   /gene="lysR"
FT                   /locus_tag="lpa_00407"
FT   CDS_pept        307035..307886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="lpa_00407"
FT                   /product="Transcriptional regulator"
FT                   /note="COG0583, LysR, Transcriptional regulator
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00407"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23529"
FT                   /protein_id="ADG23529.1"
FT                   /translation="MSIDTITLQCFLAVAETQSFTKAAQRVGRTQSAISQQIAKLENLI
FT                   EKPLINRGRELSLTTDGEIFLGYAKRIYELHRESLDRFKAPELQGEIRFGLPEDFASII
FT                   LSDVLVEFSRLHPRVLLNVECDLTLNLIERFNEGKFDLILIKTTQQQVGSESIHVCREP
FT                   VEWIGKKELLPLLEKPGPIPLVLSPTPCVYRGNVIDTLDKNHIDWRLVYSSASYAGKMA
FT                   AVRAGLGITAIQRSMIPNYLERLDYDFLPVLNDVHVSLLKKSDSNKAIESLEFFILQKL
FT                   KH"
FT   gene            307928..309517
FT                   /locus_tag="lpa_00408"
FT   CDS_pept        307928..309517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00408"
FT                   /product="toxin secretion ABC transporter HlyB/MsbA family
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00408"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23530"
FT                   /protein_id="ADG23530.1"
FT                   /translation="MNAKPINSIIDVLDRQTISSIAMISVIISLLSLSIPIAAQTLVNL
FT                   IAFGKLLQPVITLSLMVLVLMMALGALHIWQIVIIEVIQQKLMVKVSLSLTRHFTHMSL
FT                   DNFSTHHGPELVNRFFEIVTIKKSLASLLLYGINLGLQLFFGLLLILIYHPLFLLFDIF
FT                   IIIGILLIIFIPYKKALDSAKKECSEKHVVGAWLEEILINRYLFRFNLHHRYVTQQTDK
FT                   KLVAFLKARNTHFKQLIKHQIGFYMLSALASSLLLGLGGYLVINNQLSLGQLVAAEIVL
FT                   GALIYSFRRFGALLENYYDLVASENKIDAVLNLSLEQVKEDEHGELLTPINSIQLEMDS
FT                   KNKALIAVDKPLLVFSEKSDLCQLFVEQLFGFQDPVSLHVLINEIPCAKRTLISLRRFS
FT                   LLIAEPQWFTGSIYDNLVLNHRNMSNKIIIEQLQNVGLADKIIQLPEGLHTIVYEWQDV
FT                   FTSVELTKLMLVRALLLQPELIVIDRAFDILNHQEVNEMMELVLSLKNTLLLIVSQRSD
FT                   FNYLNNRLVISS"
FT   gene            309514..310500
FT                   /locus_tag="lpa_00409"
FT   CDS_pept        309514..310500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00409"
FT                   /product="RND efflux membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00409"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23531"
FT                   /protein_id="ADG23531.1"
FT                   /translation="MKLHAYSMISKLPKPQKIAKIIFIVFVAIILFLSFTPWQQFALGN
FT                   GKVIAFSPTERQHTVNSPVSGRIKKWYVDEGMRVKPGDPIVDITDNDPELLSRLEVEKK
FT                   AILLRIEAAKQAIAAGKANVDRQKKLYEQGINSRRQYELAQIEYAKYQNDLAQANIDKV
FT                   NVDVRIARQKTQIIKAHVAGIIFRRLTGQESVVVNAGDVLAQILPETESRAVELWVDGN
FT                   DIPFVRLNQKARLQFEGWPAIQFRGWPEIAVGTFGGTVSFIDPTDNGFGLFRVVIVPNE
FT                   PWPSVRFLRQGVRVHGWIQLGQVPLWYELWRQYNGFPPESNRENKAS"
FT   gene            310497..311894
FT                   /gene="tolC"
FT                   /locus_tag="lpa_00411"
FT   CDS_pept        310497..311894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolC"
FT                   /locus_tag="lpa_00411"
FT                   /product="multidrug efflux protein, outer membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00411"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23532"
FT                   /protein_id="ADG23532.1"
FT                   /translation="MICFPSGKNRLIVLCLFLMLSFKCFPIPAKPLLLDAVLKSVDRSY
FT                   PQIVIARLEIRKAEGDYVNALGKFDPSFDVNPRFQPVGGYINNYADNLFNVPTLYNGLK
FT                   LFGGYRIGRGDWPIYYQNYLTNSGGEYRAGLSLPLLRDRRIDKERTELFTREETIRMKQ
FT                   QDAAATKIKIYQETIKAYWQWVEAGFQLRTFRHLLNLAKERQNAIIQQAQQGDLPRLAI
FT                   AENLQLIVQREQLVNQGEMLLAQAGINLSLYYRDANGKPQKPDESQLPATFPAQPIRVS
FT                   NSISQLQRHPVLRKLENYSKIVKLKQNLARNELLPNLDATAYTFKQYGTGGYPLLIPQA
FT                   AMIGVNFKFPIFQREARGKLISTTSELQQVKTEMKFTYEQLNNELSNLLVAIRIYQQQV
FT                   VLLNKELNLARQVEKGETKRFYEGDSTLFLVNQREQTTAQVKLNWINAEVNLQEATALA
FT                   RFFSSTQ"
FT   gene            312077..313183
FT                   /locus_tag="lpa_00412"
FT   CDS_pept        312077..313183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00412"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23533"
FT                   /protein_id="ADG23533.1"
FT                   /translation="MSYSIDNPGGGDCGFYALAIGLISIIQNEYKLHGKSKTYDRWKQV
FT                   EGIYGVRLQDILNVDLTKLHDSPYTYKSELLFLLQMSLRNIAVIVNKEDLIKRIIEEGR
FT                   SKDQTKIEGSNAYCKFMELVQLYLYRRDSLARISQFNELALSPEIVQTAQDIARILGPI
FT                   LRNQPFHQVQKIENAFVKEVLLNDVLSGNTINSNSIILKSLEKIKEQGRWATHDDLKEI
FT                   ADLLKINLNVVGQPNGKPLPEYPTVTLKNLSNTHWITQVESLQGSRQYSTPRKRAFGYE
FT                   TVSDRAVPLKEEQTLDRTFRTQTQSERTKRYRQHFETLFDTLSPYGFFTYEQNKRNTQV
FT                   SGKVQTGLESDESLAARLQEAELRRILY"
FT   gene            complement(313598..314431)
FT                   /locus_tag="lpa_00413"
FT   CDS_pept        complement(313598..314431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00413"
FT                   /product="heme oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00413"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23534"
FT                   /protein_id="ADG23534.1"
FT                   /translation="MFSKALISATYKNGKPGQLTEEHEKAEHHRFKTEFLFKNAEIPKK
FT                   LYASRLIQHFFIIKAIETKLQSLSKTEQSEISAFFAISYLEHLWRSPAIENDLRQLNIN
FT                   PDEIDKDEITKTTENYLENIGKFTPKILLAHFLLHIAGFMHGGNIIRSKYIEPSNRLTS
FT                   YQIAADQYDFSSAISFLSSGRHSPLALYQDMMKQIDNIALTDGEYDEILEQCKGIYETM
FT                   SNIYDDLCDMHAHHLKLPTYSLAAISVSLVALGLILKLLMDFLNPVTNPIANAPR"
FT   gene            complement(314643..316631)
FT                   /locus_tag="lpa_00414"
FT   CDS_pept        complement(314643..316631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00414"
FT                   /product="PleD like two-component system"
FT                   /note="COG2199, FOG- GGDEF domain [Signal transduction
FT                   mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00414"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23535"
FT                   /protein_id="ADG23535.1"
FT                   /translation="MAINWVSQSYEIIQTIDTCLYEVVSIESRQRFYLIRDSNNQHMVD
FT                   VDEMKSALKLNLDKLEKLTRNNLEQNKRTNRFTDLIEQRLNLLNQIVQLKAIGKFNTHE
FT                   NYDLLNQSQDMSNQVKSLGQEIKSVELVLLSERKASAVRRADRSSFTLISGGITSILFL
FT                   LIAFILANSELSTREKTELQNQNTQTQLKKVIESASDMIAAFDKEHRFITFNEAYQREF
FT                   KRLFDKYISINLSLEKALVDIPENKKELAEIWKNSLQNNEENKTIELNTEHEKIVYEMS
FT                   SKLIQNGDNEINGVVHSVRNITKRVQEHTELQESYQKLANGMKELQEKNEQITLLVEMS
FT                   DIMLACSSQQELSDVLSKYSQRLLRFSSGYLFIMHPSKNYLEKTTSWGDPQPHELTFTP
FT                   EQCWAIRRGRVHHVDSSHIELLCGHVSFSLEQQDLSLLCVPLMAQNDIYGLLYLEVNLK
FT                   QLPLFDENQRLLITAFAELTALALANVRLGESLRYQSIRDPLTGLYNRRYLEDFLFKQL
FT                   HQAERTKASFAILMLDLDHFKKINDTFGHEAGDFVLKEIGQILNNDIRLGDVATRYGGE
FT                   EFVLLLFDVDANAAKTRADNLRSAISKLQVKYGAQYVGQVTASIGISIYPDDAKSPDEL
FT                   IEAADKALYQAKNKGRNMVLLFSEISS"
FT   gene            complement(316931..319489)
FT                   /locus_tag="lpa_00415"
FT   CDS_pept        complement(316931..319489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00415"
FT                   /product="heavy metal transporting P-type ATPase, cation
FT                   transporting"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23536"
FT                   /protein_id="ADG23536.1"
FT                   /translation="MLYSNYRFYLAKDAQLLNPEESREAIEQILAKTKELELIRVAVDL
FT                   TSPNKSICLLSASKESHVIKTKVTQILKEQGLSIIDMMEVEVLQDIEKIEHHHPTHKSK
FT                   DTHLHPIKKHPKKAKHDHSHGHGHHHGHHHENHWIKAALGLIWGIGLLVLSIGTFNIPL
FT                   VAYYVITGLTSLMTLYLGHTVYQSAWQALKEKKWDTTTLYSISTLTILAVSIASVFVPG
FT                   LPMMFEAAPLVLGFWHLGEGIEHTLVGKINKKLDVRDCVPPLVLLKGNPDKEISVKTLI
FT                   PNDMIIVKKGQVIPVDGVLTQKALLYTTRIDGSPKLKEFHPGDVVKAGMQLADHIPSLE
FT                   MQVTKTYQNSYLSLIAENINKANDEKAPIEMFANKVLKYFIPGLIAVALLSGIVIGSLF
FT                   NPALAIQCVVSVLVSACPCALSLITPMAVKIGMKKASENGIHFNNGKALQAAADIDTVV
FT                   FDLNGTLTQGKMVVKSLHITDKKYLRPIALLESQSDHPVAKIIKSYIEQQDTVSTEPLE
FT                   IASIDKSHHSGMKGIINGEAFMIGNKDMLAANGITSIDKPYDNPEKGSVYIVRGTTVIG
FT                   QIALIDPLREDAIATVKQLKRLGKSVHICTGADQATAEKYAALLGIPKDNICANTVGAV
FT                   TKKGEVSKTSYIQQLKQKGFKVAMVGDAANDATAIAYSDIGIAVKSSIGDSITEQHAGI
FT                   VVQQGLLFPIATAFDVAQKTKQNIFQNLFVSLSYNSIITLVAAGLFVALGFALNPVLGV
FT                   ALMVLESTIVLTNLYLFKQQDIVSSTSSNANNAVEVEPTVNTTSKVLHALGHRSQPQEN
FT                   LAIVTESKLVNPKVINLFAPKELSSNRPDVTQQKLGCVTC"
FT   gene            319821..320267
FT                   /gene="fur"
FT                   /locus_tag="lpa_00416"
FT   CDS_pept        319821..320267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="lpa_00416"
FT                   /product="Fe2 /Zn2 uptake regulation protein"
FT                   /note="COG0735, Fur, Fe2 /Zn2 uptake regulation proteins
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00416"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23537"
FT                   /protein_id="ADG23537.1"
FT                   /translation="MKHNLLDKAYKHCVNHGYRFTEPRERVLKILVDERKPLGAYDILQ
FT                   RLSMEVDNPKPPTVYRAIQFWHQEGFIHCIDSLKSYVACLHGHHVGQAQFLICNQCDFV
FT                   KELECVVDFTSVTEAANSIQFSIINCTVEIKGLCSDCNLTNLKN"
FT   gene            complement(320385..321977)
FT                   /locus_tag="lpa_00417"
FT   CDS_pept        complement(320385..321977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00417"
FT                   /product="benzoylformate decarboxylase"
FT                   /EC_number="4.1.1.7"
FT                   /note="COG0028, IlvB, Thiamine pyrophosphate-requiring
FT                   enzymes [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase] [Amino acid transport and metabolism /
FT                   Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00417"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23538"
FT                   /protein_id="ADG23538.1"
FT                   /translation="MKKTGSDVLKEFITTFEINYIFGNPGTTELKFLEAIEQCDNATYF
FT                   LTLQESSTVGIAAGYAMITRKPALINLHNYVGLANAVCNMYNAFTSGIPLLIIAGQHSR
FT                   PYLIHSPVMSGDLTSLAQTAVKYAYEVNSASDLAVALQRGYAQAILPGPGPVFLSIPMD
FT                   IWQEETHETTIKKTRFLHACINAEIEQICEVLTNTPKGKLAFIADYEVGASNSIYLLHT
FT                   IADRLNADIYAAPYHVREVINPLSVNYKGRLSDKSGEVHNLLLQYETVVLLGEKVKGYL
FT                   YTGQSSIPQGIQFIQISAASEHLAFDYPCDLAILGNLEATLTAISKHLKIIGVSVPLKP
FT                   ATNIKNLEKKYKQHPLHSLIVTLLNQVNRSVHLITEGSSEDAVVQDIATTLGFLNVNFS
FT                   PRGGGLGWAMPLAIGISLATRHHSICFVGDGGSMYAIHSIWSAAKYKIPVIFICFVNRE
FT                   YRVLKTDMSQNRSFTEEDFFRLDLNHPPIDVQQIALSFGAQVKAIKSKEEVETVLKSSF
FT                   AFQGPTFITLYHQ"
FT   gene            complement(322273..326763)
FT                   /gene="sidE"
FT                   /locus_tag="lpa_00419"
FT   CDS_pept        complement(322273..326763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sidE"
FT                   /locus_tag="lpa_00419"
FT                   /product="SidE protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00419"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23539"
FT                   /protein_id="ADG23539.1"
FT                   /translation="MPKYVEGIELTQEGMHAIFERMGHPNITSGTIYNGEPTIDKGALD
FT                   RQGFMPVLTGVSPRQDSGHWIMLIKGQGNQYYLFDPLGESSGKYYQNILAKKLPGATLS
FT                   VIPNNAGLNMGLCGYWVASVGLRAHAALTQPIPPSLRNLGQTITQEMRDELTQDGSEKI
FT                   TQWLRAVGNEFPDGDIQPDATALRRASEKNLRIDELQPVFAGTTPKEISINPTAPQETS
FT                   VPTWNGFSLYTDEIVRNAARYAYDNYLGKPYTGTVEATPVNFGGRMVYRQHHGLAHTLR
FT                   TMAYAEIIVEEARKAKLRGESLKTFADGRTLADVTPEELRKIMIAQAFFVTGRDDEESS
FT                   KNYEKYHEQSRDAFLKYVEDNKSALIPDVFKDEKDVKFYADVIEDKDHKWADSPAHVLV
FT                   NQGHMVDLVRVKQPPESYLEYYFSQLQPWIGSKAAEAVFAAQRQFFHATYEAVAGFNSE
FT                   NTEPHLVVDGLGRYVIGPDGNPIREEPDDEDEEESGELKFFSQKKKLEENQRYMRVDEY
FT                   LKLDEVQKRFPGAGKKLDGGLPGLNEYQYLQRLNSINRARCENDVDFCLGQLQTAHHQT
FT                   KITPIKRAFQSSSEKARRQPNMDEIAAARIVQQIMANPDCIHDDHVFLNGQKLEEKFFR
FT                   DLLAKCDMAIVGSLLNDTDIRNIDTLMQHERNTEFHSTDAKAKPVKLGETWEKTIRSGG
FT                   GVTQIKHDLIFLMQNDAWYHTRVNAIAQNRDKDSTFKEVLITALMTPLTNKSLIDTSRS
FT                   PAPKTLFRGLDLSEEFKNKLINQAETIIANTTEHLFTDLSTEAFKQIKLNDFSQVSART
FT                   CASTSTNIAVPRTIFGSNTIFEILDPDGLLHPKQVGTHVPGSESEYSIYLPEDVALVPI
FT                   KVSFDGKTVKGKDRHIFTLVAVKSPDFTPKHEIGYAVGPLLRMQTPKLEEIQRLVEQAR
FT                   EEPDLERVFNLQSRVARQAKLFSTEPGYKTFLNEKVAPVLEQSLNGLLDNNVTILGKVL
FT                   SAFPSDGQWSAFNSVEARQMKIQMDAIKQMVEKKAVLEGRILPALAQCQDALEKQNIDG
FT                   ALQALKNIPSEKEMQTMLSISSGLRGQIQRAKQNLTENLEPLQRAMTAKLVSDKEKVKV
FT                   RYEKLIAGIPQQITDLEKAALSDLAGVKKVVSHFNHLQEELKLLRNEKVRMHTGSEKVD
FT                   FSDIVQLEAQLQKIHTKLYDAYLVELTKEISALAKEKPKNLSDVKRMVSNFYAMSADIE
FT                   QLRQEKIKEHGESKDPIDMSDIDKLKKELQKINQFLVKAMGTNIRVSLNQMEVKTFDAQ
FT                   EKEAQQNLKQLDELINKLESSDAVQKQKEELEKLNQLLIEKRKAYPAMVQLQFRSEALI
FT                   IHLRELCEAHQAQMAKTRKARAQEITNGRWKVQWLTDWVGLTTDERVTLANKEKELAKF
FT                   KEDLNNDEYDLQELISNLAEKTPSELEEAIGISKESAQKLHKLLTHLNHSTTFMSKIEQ
FT                   RLQSIDELLNEFGKQSPRTEMIKTVEEKQGTLLRL"
FT   gene            complement(327018..327197)
FT                   /locus_tag="lpa_00421"
FT   CDS_pept        complement(327018..327197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00421"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23540"
FT                   /protein_id="ADG23540.1"
FT                   /translation="MPTDKPYPMPLSFQNIQHISLIWLSYFSIRQNTVLPKLIQTGLTK
FT                   NPKVKAKNVFNEEV"
FT   gene            complement(327187..327669)
FT                   /locus_tag="lpa_00422"
FT   CDS_pept        complement(327187..327669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00422"
FT                   /product="putative conserved protein"
FT                   /note="COG3791, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00422"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23541"
FT                   /protein_id="ADG23541.1"
FT                   /translation="MATYYGQCACGKIQFICTGEPVFTQYCHCNKCREIASLSQKKQDK
FT                   SGYSLTAAYLTRDFRIVSEENDFEEIIKEKAKLFLCSYCHSLVYGISLDPRQQDSIGIN
FT                   VNNFKFDTNIPDSFKPIRHIWYACRIMDCDDQLPKFKDAPKEQFGSGELFELPNAN"
FT   gene            complement(327763..329742)
FT                   /locus_tag="lpa_00424"
FT   CDS_pept        complement(327763..329742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00424"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23542"
FT                   /protein_id="ADG23542.1"
FT                   /translation="MRYVNFELLKRIPQHLKGVMEYYPDVLLFQLNQIQYTHLWHELSS
FT                   AKYLYTKGFVIKPTHWLMYAFQTVKGWLGFDNHCQREKISYVLDKLSYYGYTKQFLQPD
FT                   FSSITNFSISPEISALVVKSRDDLTTAQLQNKLVNNYFKVEPHLGIDYSYQKLNPNHRF
FT                   GESWTHAHEWGLIPQLDPQDDSLIAEVISTLDKNGISAKDVFFLQHSKYAKAAAQYYCD
FT                   KAKNTIVPSFFFRLLWTDPRPRYLALALAYDPEIAKRDAQKFIEYHLAQKEYDNAFNLL
FT                   GILNDSNLVLKFLLAIPETERHALIQKDTAIAAIMAKYYIEKKQYLLATQFYTNIEEIS
FT                   PNAAFAIEIQEQNYEKAYDIFKKYNSPDLFSMPERKSLAKIFYSEAETAYVAGKTYRGN
FT                   KSWEKAKQYYLQSLEQKKAAHHLDPSDEYLEDLYVHKRLYALLLIDADIDLHKAEDSDI
FT                   ASIQKAITLLRECRSNNKEEQEHHKRALAAGLMRRVDTLREKIAFNYYSSDFESIRKHK
FT                   IEHQQDIAILIKTLGELIALLEGTQDKALRLQLGKAHYLLADVQCFFDINAPDINQHYK
FT                   MAMKAVPGNPFYVLRVAELFEEEKSKLQKIGIIQLKNMGYQVFDFLHWSEERWCKRDDI
FT                   IHNIKDIHMPPAEPINSSSWNFTF"
FT   gene            330024..330818
FT                   /locus_tag="lpa_00425"
FT   CDS_pept        330024..330818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00425"
FT                   /product="lipolytic enzyme"
FT                   /EC_number="3.1.1.24"
FT                   /note="COG0596, MhpC, Predicted hydrolases or
FT                   acyltransferases (alpha/beta hydrolase superfamily)
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00425"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23543"
FT                   /protein_id="ADG23543.1"
FT                   /translation="MATLKIHDVDIYYELYGQGKPLVLIAGYCCDHTFWNAMLHELAEE
FT                   FQVLIFDNRGIGQTRDNGDSFTLEAQADDIMAFLEQLGFRNPSILGQSMGGAIAQLLAR
FT                   KHGKKISKLVILNSVAKFNTRANQAMESLLNLRKENISFDLLIEAGIPWFFSSEYLAEP
FT                   KNIATFKENLKNNPYPQSLQDQVRQFRSIPPFDSRGWLHEIKVPTLVIAAEDDILTLPA
FT                   ESQQLAQRIPNAQFITIPGGHSSPLEHPALVNDAILKFLTSS"
FT   gene            330849..332300
FT                   /locus_tag="lpa_00426"
FT   CDS_pept        330849..332300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00426"
FT                   /product="betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="COG1012, PutA, NAD-dependent aldehyde dehydrogenases
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00426"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23544"
FT                   /protein_id="ADG23544.1"
FT                   /translation="MYIDGKFTLAKSGTTRDIFDPANGELIARVPESAKEDAILAIKAA
FT                   RKAFDEGEWRKSLALDRGKLLFKLADLIRANAKMLAELETRNCGKPLPEAEFDVTDAAN
FT                   CFEFYGGLATKIHGETMSVPANSFSYVVREPIGVCGQIIPWNFPLLMAAWKLAPALAAG
FT                   NTVVLKPSELTPITALELFKLIDQCGFPAGVVNLITGPGMGVGEELASNSIVDKVAFTG
FT                   GSATGRKIMQAATGNLKKISLELGGKNPNIVFADCDLEMAIDGALFGAFANQGEVCSAG
FT                   SRLLVERSIHKKIVEGMLKKIPNIKLGHGLDAGVKMGPLVSSAHREKVESYVKLGMEEG
FT                   AKLLCGGKRPTGSEFAKGHFFEPTIFDEVKSTMRIAREEIFGPVLVVIPFDTEEEAIRI
FT                   ANDTDYGLSGAVWTKSVTRAHRVTSQIRAGILWVNHYHPTYNEMPWGGYKQSGAGRELG
FT                   LYGIESYLEVKQVNINLDETSIGWY"
FT   gene            332305..333627
FT                   /gene="gabT"
FT                   /locus_tag="lpa_00427"
FT   CDS_pept        332305..333627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="lpa_00427"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /EC_number="2.6.1.19"
FT                   /note="COG0160, GabT, 4-aminobutyrate aminotransferase and
FT                   related aminotransferases [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00427"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23545"
FT                   /protein_id="ADG23545.1"
FT                   /translation="MKKIHIKTSIPGPKSQQLMELRRQHVARGPFHATPIFVKQAKGSF
FT                   VEDVDGNVFLDFSSGFGVVNTGHCPDSVVNAIKLQAEKFIHTGFNIIPYEAYIKVCEKL
FT                   NYHTPGHFEKKSLLLNSGAEAVENAIKIARAYTGKQAVICFDHAFHGRTYMAMTLTSKN
FT                   KPYKHGFGPFPSEIHRAPFPYEYRWKGANCVEECFNEFTDLANFRVGVENIAAVIIEPV
FT                   LGEGGFIQSPALFLQKLREFCTTNDIVFIADEIQSGFGRTGNLFAMNTLGVTPDLTISA
FT                   KGLGGGVVLAGVTGKTEIMDAAMEGGLGGTFGGNPLSCAASLEVFHIFEEGSLLQNVTH
FT                   LAKVLQSRLSGFKEKYKVVGDVRGLGVMQAIELVKDKNTKEPNKEATVQLAQFCLEHGL
FT                   VILTCGTYGNVIRLHMPLSTGVKDLEIGLSIIEEGLKRLSI"
FT   gene            333716..334483
FT                   /locus_tag="lpa_00428"
FT   CDS_pept        333716..334483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00428"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00428"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23546"
FT                   /protein_id="ADG23546.1"
FT                   /translation="MWYQNIMRNLLEKLPEASRKDGEIFLSKLFLAVKKVDNKPEMEFF
FT                   LGLIEKSFLKFENEEPGSVTLVKFSRYILGLTLLYLKSSNDLAIWNSDFIPSLTEIKKC
FT                   LEAEKAGKPFYKFINQLEVETFASLNHQLAIDFNHFSAILKRNSDLKTIQSFTEACKGL
FT                   DNDVSQGFCQVMQDAEAHMINLQFAVDFDSGFGHESTDENQGNTKLQKPSHVNYMSMSA
FT                   NNLHRLGIFKLFAMSDGLSDQSNLFINQNNELR"
FT   gene            complement(334462..334626)
FT                   /locus_tag="lpa_00429"
FT   CDS_pept        complement(334462..334626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00429"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23547"
FT                   /protein_id="ADG23547.1"
FT                   /translation="MFGKNICNLGLMHQPNMSFPAQVETPFYPGYQDRFIPEKIQEQID
FT                   ENHYLSSLF"
FT   gene            334841..335650
FT                   /locus_tag="lpa_00430"
FT   CDS_pept        334841..335650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00430"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23548"
FT                   /protein_id="ADG23548.1"
FT                   /translation="MSKGKILSYAVMTIISSTALAGAMGETKTCPDLGCMPWFVEFGTG
FT                   VSWSTKSHINPDPSRWDPANEGYNSTLGNEPLYMAGIGYTINPLLSVDANYTFRGIYKY
FT                   RKHQTALGASAVNPLGNKTRYFDLISNSLMFSGTLYGQGWSENLAYSMGNYGIIQPFLG
FT                   GGVGVAYNTVSNFRTVTDNTNFVTSVLQDYTKASFAWQLNAGLELKKNRFGLDLGYRYF
FT                   NAGSFLSNNALITRVNSAGTPITTNLIPAWSSNLSANELYLTAKIAF"
FT   gene            335792..336724
FT                   /locus_tag="lpa_00431"
FT   CDS_pept        335792..336724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00431"
FT                   /product="glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="COG2066, GlsA, Glutaminase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00431"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23549"
FT                   /protein_id="ADG23549.1"
FT                   /translation="MSSKLLTIQLLEELVHAAELNQEGKTADYIPELANVNQDLTAIAV
FT                   QPLGEKTLAYSNNPLHPVTLQSTGKMIPLIGLLEEFGADQLFEWVKVEPSGDDFASITR
FT                   LEQFGPKPSNPMLNAGAIALCSRIPGVGEQQFRWLEHWVQKLFNQRLSINPLVFASEKR
FT                   TGNRNRALAYLLKSRNNLGADVHETLDLYFALCSYEAMLDQMLYLPAVLANRGQDPDTG
FT                   EQILSIETCKITLAIMATCGLYDETGTHMVKTGMPAKSGVSGYTIAVVPGKAGIVVLSP
FT                   RVNAKGNSIRGEIMLEGLSKAMGWHFALP"
FT   gene            complement(336826..337425)
FT                   /locus_tag="lpa_00432"
FT   CDS_pept        complement(336826..337425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00432"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00432"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23550"
FT                   /protein_id="ADG23550.1"
FT                   /translation="MKIVVIGATGIIGKAIVAELNPRHEIISASYKNSDIQVDITSKQS
FT                   IDAMYKKLNTIDAVVLATGKVHFAALKDMGEDDYKIGLTNKLMGQVNVVLAGLEYINDN
FT                   GSFTLTSGILNRDPILYGSSAAMVNGALDGFIKSAALEMPRGIRINGVSPTVITEAMEN
FT                   YGPYFRGYEPVSAARAALAYSKSIEGAQTGQVYCVG"
FT   gene            complement(337756..339150)
FT                   /locus_tag="lpa_00433"
FT   CDS_pept        complement(337756..339150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00433"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00433"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23551"
FT                   /protein_id="ADG23551.1"
FT                   /translation="MVLKFDTIILGGGKGGKTLAMDLAKSGQKIAMVENNQIGGTCINV
FT                   ACIPTKTLVQSAKVAHYCRKAKDYGLNTTLHPIDFKAIRARKDAVVNGMREANLKQFLD
FT                   SGMDLMLGHGHFIGPKMIEVTLSSPRDNQKTLHITADKIIINTGALPYTPPIAGLDKVN
FT                   YFTNDSLMNTDSVPQHLLIIGGGYIGLEFAQMFRRFGAEVTVIEASSEFLGREDKDIAE
FT                   QVFQTLSNEGIQFAVDTKINAIRQEQTEVIIEANRQGQSEIIRGTAVLVAVGRIANTAG
FT                   LHLDKTGVELDERGFIKVNEFLETTAAGIWALGDVKGGAQFTHLSLDDYRLVKHNLQNP
FT                   QKKLSSQNRLIPYTVFLDPELARIGLTEAQARSQGRPIKIAKIPAAAIPRAKTQGETTG
FT                   VLKAVIDAETDLILGVSIFCAEAGEILGVIQLAMELRIPYQKLRDMMFAHPTLVEGINL
FT                   WFAQII"
FT   gene            complement(339202..342564)
FT                   /locus_tag="lpa_00434"
FT   CDS_pept        complement(339202..342564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00434"
FT                   /product="NAD-glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00434"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23552"
FT                   /protein_id="ADG23552.1"
FT                   /translation="MMTNSWKDKLQKQLTQQFGSPKGKQLIDKYTETMSMSYCEQHTPE
FT                   EAIQDILQIEKLSKDNPLVIDFYEKTHLQYPLHIKLYRYETPIPLSDILPMLENMGLRT
FT                   YTERPYKIKTRDGQLFWISDFNVTYSQTDSLNITQVKDVFAEALINITLGVCENDGFNK
FT                   LVLCAGLSWQEITILRAYAKYLHQIGIRYSQSYIEKTIEMHAAIARDLIHFFYLKFGLK
FT                   RKSTIHKDISALEQKIQINIDAISSLDEDRIMRYFWSLMKATLRTNYFQKNHAGLSKDY
FT                   LSFKLKSSEIPDLPPGQPLYEIFVYSTRFEGIHLRSTKVARGGIRWSDRPEDFRTEILG
FT                   LMKAQKVKNAVIVPSGAKGGFVLKKPLLAASREQIQQEVISCYKSFINGLLDLTDNLIN
FT                   DKTIPPQNVICYDEPDPYLVVAADKGTATFSDIANSIAKEHGFWLGDAFASGGSAGYDH
FT                   KKMGITAHGAWESVKRHFRELEINIQQQDFTVVGIGDMSGDVFGNGMLYSKHIRLLAAF
FT                   DHRHIFLDPNPDPLKSYEERLRLFNLPTSSWEDYNLQLISKGGGVYKRSSKSIPISPQV
FT                   KKALAIEANALTPNELIRALLKAPVDLLFNGGIGTYVKATTESHADVGDKTNEFCRING
FT                   AELHCKVVGEGGNLGFTQLGRVEFALKGGLINTDAIDNSAGVNCSDHEVNIKILLDKEI
FT                   REKKLTEKKRNQLLSRMTDEVADLVLQDNYNQALILSISAAHSSHYSGLYQDYMKELEK
FT                   WVNLDRSVEFLPDDKKLLERKTTGAGLTRPELAVLMAHTKIHIANELLKSHLPDDSYFT
FT                   TFLETGFPISLRKPYAKALPKHPLSREIIATQLSNKLVNNMGITFMYRMLMETGMSIAD
FT                   IACAYTISVCIFQTDVLQNLIDSFQDKISLSTQYELLHHIRQLLNLATRWFLHNNRLTG
FT                   GIEKNIKNYGKSVKKLEQLIPKLMGGVTKEYLEKLISQFVSIGIEKDMAQKIAITRALY
FT                   TSLNIIEVTTQNEFDLSLTAETYFKVGSQFNLVWFRDQIANDSREGHWNTMARLSLRDE
FT                   LDNLQRRLTIAILTTNTKERTSEKLINYWLEQNHPIQKRWEKLLEMLLGSENIDYTIFF
FT                   IALRELSSLIQVL"
FT   gene            342761..343486
FT                   /locus_tag="lpa_00436"
FT   CDS_pept        342761..343486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00436"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23553"
FT                   /protein_id="ADG23553.1"
FT                   /translation="MYKNILFFSNFSRMRWNEYDGDRYQSLWEHNKRDIKHTFFGTIAN
FT                   GKDLREVLFQPVTASFSMLVAGAFAQLLVPYSIFMLCMGEAGFAGRTLINYFEITIVAL
FT                   AMPFIALLSTVGRCIATVKCLVEDQYNLAEMVEDKEVKPNKIYLDCAEVNYTVRDENNN
FT                   QFIRKYYKFQYKMRGLNDELCQGIFTFRDLERAPDNDDFNGKLSSLTLYKYDILDLIKR
FT                   VHKDKFEEMEDENLIRISI"
FT   gene            343727..344680
FT                   /locus_tag="lpa_00437"
FT   CDS_pept        343727..344680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00437"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23554"
FT                   /protein_id="ADG23554.1"
FT                   /translation="MRLSYGLLGFMIFNLVACEKMALLTTPPKKQQLSNSPLATRAERY
FT                   FWRTLHEGRYQDIPQADYLLMAAYLENPYDSKLAAHLGFIHIWKITERERVKNNSPLLP
FT                   NEIILSKKYFADALQLDPENPIYQGFYGDTQLVEGQIFKDKQEEVRGYFTLQKAISNWP
FT                   EFNYFTAGYPMSSLSADSDHFKKGLDWQWKTLDICAGEKISRQNPDFTPYMKRETTIGT
FT                   QRACWNSEIAPHNFEGFFMNMGDMLVKSGDPETGIKIYNNAKLAKNYNKWPYKDMLEKR
FT                   VLNAKANVQHFNQKSNDPNQSIMFNSGYGCVVCHQR"
FT   gene            344840..345181
FT                   /locus_tag="lpa_00439"
FT   CDS_pept        344840..345181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00439"
FT                   /product="arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00439"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23555"
FT                   /protein_id="ADG23555.1"
FT                   /translation="MEKITIYHNPRCSKSRQALEILQNKGFEPIIIEYLKTPLDLEQLK
FT                   RLRTHLALEDLVRTNENVFKELGLSLANEAQVLEAMVKEPILMQRPIVTFKGKAAIGRP
FT                   PEKILELFD"
FT   gene            complement(345267..346418)
FT                   /locus_tag="lpa_00440"
FT   CDS_pept        complement(345267..346418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00440"
FT                   /product="stearoyl CoA 9-desaturase"
FT                   /EC_number="1.14.19.1"
FT                   /note="COG1398, OLE1, Fatty-acid desaturase [Lipid
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23556"
FT                   /protein_id="ADG23556.1"
FT                   /translation="MFGFLNMTLWGYLLTGFVLTHITTTAVTIYLHRYQTHRALTMHPL
FT                   VSHFFRFWLWLTTGMTTAEWVAIHRKHHANTDMEGDPHSPQVFNIRKVFWQVPELYREA
FT                   SKDKDMIKKYSYGTPNDWIERKLYSPHANKGIFLMLALNLFLFGIPGLTLWAIQMMWIP
FT                   LVAGVVNGIGHYWGYRNHESSDSSTNVFPWGLLIAGEELHNNHHTFASSAKFSIKWWEF
FT                   DLGWFYIRCLSFLKLAKVKKLPPKLIIDKNKSHIDVDSVKAILGNRFQVISDYYKLVIF
FT                   PTLRDMQYRIKNRDLKNARHLLKKPNEQLSHADQLRLKTLLKQHDNLQAVHNYRELLQQ
FT                   IWLKTSLSNKDLLNLIQKWCSQAEESGLLVLRQFASQLKSYSL"
FT   gene            complement(346540..347784)
FT                   /locus_tag="lpa_00441"
FT   CDS_pept        complement(346540..347784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00441"
FT                   /product="rhlE ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00441"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23557"
FT                   /protein_id="ADG23557.1"
FT                   /translation="MSFKQLALIEPLNRAVSELGYTNPTSIQLKAIPLILNGHDLLGSA
FT                   QTGTGKTASFVLPILQKASQQTQTSRNRVKVLILTPTRELAIQVHESIIQYGKYLTLRS
FT                   AVIYGGVKSHNQIKQLDSGLEILVATPGRLLDLYQQGAVKFDEIDTLVLDEADRMLDMG
FT                   FIHDIKKIIKLLPLKRQNLLFSATFTPEVRTLARNILNKAVEIDIAPRNTAVKTIKQTV
FT                   YSVDRNHKLALLSHLLHKNNWGQTLVFSRTKHGANKLVKQLAESQIYSVAIHGNKSQAQ
FT                   RTKALADFKSGKVQTLIATDIAARGIDIEKLACVVNFDLPHVPEDYVHRIGRTGRAGAS
FT                   GLAVSLVSTEEIKLLLSIEKLINQKLERIKIKDFEFLHNFSDLVSAKIQKFAPPKAGYK
FT                   GNISRKSKTAFNKSA"
FT   gene            348115..348390
FT                   /locus_tag="lpa_00442"
FT   CDS_pept        348115..348390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00442"
FT                   /product="RNA binding protein, cold-inducible rrm"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00442"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23558"
FT                   /protein_id="ADG23558.1"
FT                   /translation="MKQKKIYVGNLPFGTTEEALSIQFSQYGKIEEMFLIKDRLTGQMK
FT                   GFGFITFSAQQEAESALEMNGQPFDGRSLKVCMAQKKTNSVSRSRW"
FT   gene            348567..349244
FT                   /locus_tag="lpa_00444"
FT   CDS_pept        348567..349244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00444"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00444"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23559"
FT                   /protein_id="ADG23559.1"
FT                   /translation="MKAKGFFDEQSSLQKSKIGLNLVWMFSLGHIFLITLSNVLVQYPF
FT                   AMMGFHTTWGAFTYPAIFILTDLTTRIATANKARKIIMLSMTPGLILSYLVASYIEAGN
FT                   NLNENGLSVLHLMPLRIALACFIAYVVGQLLDVAVFQRYRNRPAWWLAPTLSAVAGNFI
FT                   DTALFFTIAFYHCSNPFLSQNWPEIAMVDVFFKIMISLIAFVPVYGLVLSILGIKTTNK
FT                   LMV"
FT   gene            349282..349920
FT                   /locus_tag="lpa_00445"
FT   CDS_pept        349282..349920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00445"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23560"
FT                   /protein_id="ADG23560.1"
FT                   /translation="MLTGLRLLTKDLKILNGKYIQLEPITSQHREELRKAANHEQIWQY
FT                   MPQKATGKLFNSWFDDCLEKMSARDQITYAVRCKKEGNLKGATSFYDIQPENKRLALGY
FT                   SWYIPKVWGTTTNPESKLLMLYQAFDAWGINRVELGTDSRNIHSYRAIKKLGATEEGVL
FT                   RQHMILHNQVITDTIMFSILFSEWPAVKERLMQRLNYAAADKDHLAVSI"
FT   gene            350055..350582
FT                   /locus_tag="lpa_00446"
FT   CDS_pept        350055..350582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00446"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00446"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23561"
FT                   /protein_id="ADG23561.1"
FT                   /translation="MYNKMFKPLDTDPILYFKMYSNYTEGRVDDCCAFILMPSGLQREW
FT                   VCLQSIQFAFNKRGDVLGINIIFSGNESNIHKKVRETMEGMLKLKLQYGRGEELFVFDE
FT                   EKKTFHMGIVPGKDTQAYLEGIIAFIKDSYRLQPDFAQDIKSQLLSKEYLAQEYSRLRW
FT                   KPPEKETVCVLM"
FT   gene            350737..352083
FT                   /locus_tag="lpa_00448"
FT   CDS_pept        350737..352083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00448"
FT                   /product="outer membrane channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00448"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23562"
FT                   /protein_id="ADG23562.1"
FT                   /translation="MYRKRWLILLCALLNNGCLWLGSEYRKPHVNTPQKWPHKYSIQTE
FT                   QAAYLPDLHWWKQFNSKELNASIQKALQNNHQIHLAMANIESAQGQLRQVQLSWLPNLT
FT                   GLAGYTQFPVLGNPGTTAIAYPAYIINIFQQYKQQKSAQAMLEASIYAQYSARLVVIAQ
FT                   TAASFFTLVAQNEALHLYNKLLKDYRTYLKLTQSQYRSGLISLDNITQIKSHIQRIEAQ
FT                   IKVVQHNIVVTKNALHFLFNENPGDVETKILFENIDSNQLVPGNLPASVLRVRPDIHEA
FT                   EALLKAAHADVGAIAANLLPGINLGAYLGEGSNVDGAIKLGQAYLNGPIIDLPLFAQVD
FT                   VSKARYKAIYIKYITTIRKALRDVANDLSAYSTSSQQLNNNLSALSDEKQQCHLAEVRY
FT                   RHGIDDYLNLIKCQILLDEFKLVINQNKLEKLLSIVALYQDLGGGYRGH"
FT   gene            352073..353110
FT                   /locus_tag="lpa_00449"
FT   CDS_pept        352073..353110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00449"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23563"
FT                   /protein_id="ADG23563.1"
FT                   /translation="MGIDQQKTVRTLRLSLTCIFLFLITWYYQVPESAWTLVTIWFVMY
FT                   EYSTVGGVLTKSFLRFAGTALSAIYGMIVVYFCANNPLINIMALVPGLFLYAYFFMGGD
FT                   KTYIGTIGAVTLTIVLLNYNDIDTAVLRVFNVIIGVIGSMFMIRFFYPQYARDKVLEIQ
FT                   LNFITQLANLLESYLNPTQPLAAIQTKYLDYERKMLDGFTLYNRYIGEAKIETKKAPFF
FT                   IPHSIAAMQHFRRLFRLFSVFVYYLSTEEIRSDPWVCDQLSKLLLNLQSLQRKLLKQDA
FT                   GPIGGDVVAAEPEEEIVIETPNIENKIATEAIVNNMQKEIALLDAEIKEIILIYDVYDI
FT                   RLNEM"
FT   gene            353167..354159
FT                   /locus_tag="lpa_00450"
FT   CDS_pept        353167..354159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00450"
FT                   /product="multidrug resistance protein A"
FT                   /note="COG1566, EmrA, Multidrug resistance efflux pump
FT                   [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23564"
FT                   /protein_id="ADG23564.1"
FT                   /translation="MSDKPKAGFPVIILLCVFLFILIYHYSYLFPFTNNAFVVANVRPV
FT                   AANVKGYITNIYVKNEQEVKKGQPLFTVFKAPYELAYRKAMSDVQEAKAQLLLFNKQVE
FT                   KTKYLLQAQKELYEKFRFDYEHNHSALRDHAVSKLTVNTMLKEKNAALSKLKALEKELE
FT                   VNQQQVIVQKKKIDSLIAVMKNAKIDLDETTVYAKQNGAVQDMFVALGTPIKTRKPVFA
FT                   IADTDTLFIQANFNETDLRRVQPGDKVSIFPRMYFGSKIYHGVILSRNWAASRLETHRA
FT                   TQIQIVRNSESNWFLLPQRLPVQIQITDYDPVHYPLSIGASAYVYIHTH"
FT   gene            354335..356278
FT                   /locus_tag="lpa_00451"
FT   CDS_pept        354335..356278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00451"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23565"
FT                   /protein_id="ADG23565.1"
FT                   /translation="MKIPFEGKWRATITKREAGFSQRVVVGGATSGNGSYNGVVGNSFV
FT                   FEDGWVELQWNNNAGSGWQESAVISSVGMTSPLVVVKFVSADDNFPNQRDGDYDDLQVR
FT                   FEHLDAPFEVTQRPYALDRGSLVMFPDGIFDASQGIQYMGVRIKNTWFFDWQSNFPATG
FT                   MKIGIAPVSRSALSAAGIVVIDSWTPQEQEGLGQIMDGGFVRVPDLKINEETTIYFKLD
FT                   VSNANPSKPEIGFVAQRDAYDPRYDEPTRIVDKKIFISRSSYNPATRELVTAIPEGTLY
FT                   LKLNKIAIDRKGATKAAQELKKCLKQHGGGIKGMSKWLHKLSRGFWQNSKDKERWCKEQ
FT                   GNDALRKLLKQLLAGKDIDICHLKAILDQCCERPGGDCECCPCGDGDGRPGGWDDGTGV
FT                   DGWCRVKPVFWLPLDFEYKVVPNPAYIGQFGPLAFEDPWWKVVLIILAIILAIASVIYD
FT                   YVYASEDDQYIIGQVVRNGDAPINLVDAAVSNLNGSRGVDLGQLDAQGNDINNGSPITA
FT                   LDSIIQLDRTAAGSYFGTLDAVLGNVVWKSGATSATTRGFISTLGTSVSIPYDEHDTLS
FT                   GTVTYTNEVVISELAAIPQTLSDPGDSGSVWVDLATARPVALNYGSPTDSSDNRAFANP
FT                   IRSVIDVLNLRF"
FT   gene            356297..356761
FT                   /locus_tag="lpa_00452"
FT   CDS_pept        356297..356761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00452"
FT                   /product="hypothetical protein"
FT                   /note="this orf have been splitted in two (lpa00454) by a
FT                   mutation C356759->T356759"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00452"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23566"
FT                   /protein_id="ADG23566.1"
FT                   /translation="MKREFFQKLDKILDIASEHKQMLLQYPDVVMVGVGPERRKGKITG
FT                   EPAIIVTVRKKRSSNELKKRGEKPLPQTIKGIPVDVIELGKAVEAPEIIAVQEKAKKTI
FT                   SKIRAKWLQTPNITAIGYGYKEKGGEIDFNTIAIQFFVKKKFPIAELQKQ"
FT   gene            356792..358081
FT                   /locus_tag="lpa_00454"
FT   CDS_pept        356792..358081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00454"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23567"
FT                   /protein_id="ADG23567.1"
FT                   /translation="MSTDVIQLSPIRPAAASGSRGDRHDPLKGGVAIGVGSKPFHYGTY
FT                   GATVFDRTTGEQLFLSNQHVLDASPGTDTIQPSPVLLDDSVEVGFQLDVCLPIHFIRLD
FT                   TPNTTVGTVLAGAAVAAAVAAALSDEIDPTRRGQEATMPATGSKTLFETQKVKMDYPEL
FT                   PIPGTPFKVKTAWDYERHTDAGIKTFSVSEEKKNPHVLRDKLLITDKKLYHPGDTIRIF
FT                   GLILPEECAPASQSRNDRQPINPRELEDITHYPNVASSINLDLVASMDSDIASSPARRT
FT                   NTRAAVINPKRCRCDRYHPVAILTPTTEDRAFPVVLREPVFAQKNQIFQDLLTVVKQRD
FT                   DEKLLERVFVLVRYGCIYTGTLRVNNIPAGPWKHFFYVQTVNIATSDMKPLLAAQIIGG
FT                   LPVSQNAKADLDIACGPLTWEDGEFDIELI"
FT   gene            358267..358665
FT                   /locus_tag="lpa_00456"
FT   CDS_pept        358267..358665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00456"
FT                   /product="putative protein conserved in bacteria"
FT                   /note="COG3397, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00456"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23568"
FT                   /protein_id="ADG23568.1"
FT                   /translation="MFGFFSDYKQYITLRNFAVVYNGLTGLAVLYSLWSNPEADPSEYV
FT                   IDISIHALTAITLMCKQAPESVKAVAMALNTYRGFDALFKAITSLPSTIPGIANAVDVL
FT                   NHRFNFKELEKLGNEETAETTLAVQHTM"
FT   gene            complement(358751..359389)
FT                   /locus_tag="lpa_00458"
FT   CDS_pept        complement(358751..359389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00458"
FT                   /product="DNA polymerase bacteriophage-type"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG1573, Uracil-DNA glycosylase [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00458"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23569"
FT                   /protein_id="ADG23569.1"
FT                   /translation="MPDVLNNYYLQTMGIEVWVMRKSTPSCEKHLAALADEVASCVRCS
FT                   LHKTRTQTVFSRGNPKAKLMIIGEAPGFYEDQKGQPFVGKAGFLLNKMIRSIEMTENDV
FT                   YIANVLKCRPPNNRDPALEEISQCSSFLTRQIKLIKPHLILALGRFAGQFLLDKPLPLK
FT                   QLRNHIHYYDNTPFIVSYHPAYLLRNPSDKKKAYIDWLAVKNFLVDYGQ"
FT   gene            359646..360920
FT                   /locus_tag="lpa_00460"
FT   CDS_pept        359646..360920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00460"
FT                   /product="MFS transporter, UMF1 family"
FT                   /note="COG2270, Permeases of the major facilitator
FT                   superfamily [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23570"
FT                   /protein_id="ADG23570.1"
FT                   /translation="MNSQKDLKQLDIKQVIAWAFYDFANSSYFVVIFTFVFATYFTSYI
FT                   APNTILGTELWGYTISVSALLIALVSPIVGAIADFSGHHKSWLFVFTCLGVISTGCLWF
FT                   AYPDSHSIPLVLTCILISNFALEVATVFYNSFLANLAPENYLGRISGWAWGCGYLGGLL
FT                   CLILSLFAFVKGELGGLWFGTENFANIRAVTVFVALWISVFSLPLFLVVQQKTGEHLTV
FT                   GTAIRKGLQELWLTIISLPKQRDLFLFLIARIFYIDGLNSILALGGIYVAGNFHLSVSD
FT                   IMVFGIILNITAGLGAGLFAWFDDWIGSKKTILIALACLTLTFCFLLTIHSNTLFWVFA
FT                   PVFGIFVGPVQAASRTFLARLAKPEEMTRMYGFYSFSGKATSFLGPFLVSTTTALADSQ
FT                   RLGMAVLIPFFIIGGGLLLLVHENE"
FT   gene            360999..361697
FT                   /locus_tag="lpa_00461"
FT   CDS_pept        360999..361697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00461"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23571"
FT                   /protein_id="ADG23571.1"
FT                   /translation="MFLQVISYDKLCSNMKIIISILFAFISASGHAFSCYDPQTIIQKP
FT                   IQFDKKRIALTREYQLTHYGIDSESIEIEPKMIVLHWTCIPSLDTTFRIFDPPALPTSS
FT                   PRRNELPGDLNVSSHFLVDRDGTIYQLMPETWMARHVIGLNHYAIGIENIGGVDSKDDL
FT                   TDEQVKANAFLVCYLKNKYPQIKYLIGHNEYLQYKGTALWLEKDPNYQTDKTDPGPTFV
FT                   KKVKQLVLAS"
FT   gene            complement(361752..363233)
FT                   /locus_tag="lpa_00462"
FT   CDS_pept        complement(361752..363233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00462"
FT                   /product="multicopper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00462"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23572"
FT                   /protein_id="ADG23572.1"
FT                   /translation="MSINKIKVHTLGKIFVFIMAITIMLTLFNFSYATDSKLKPTVITV
FT                   SEEEFQVDGKGKKTKEFKLTFTHPDGTKDNKGYFANKGDMFHVLVENKSASPITLHWHG
FT                   LIVPSDQDGVPGVSQILIPPGQNKLFNYRLLQAGTYWMHSHQKFQEQKQLSAPLIIYDT
FT                   DDPHKNLQEVILFLEDFTYKDPQLIFDQLRTAKMDMKKMDSGNDLNDVTYDAFLANKKT
FT                   LAAPDVISVQPSKKVRLRIINASSSTNFKIDTGKLSATLIAVDGENIEPIVDSSFPIGV
FT                   GNRMDLLVEIPSAGGAFPVKAMAEGTNKQTGLVLTTDNTPTPILSPNTTNKTGRVNYYE
FT                   LEKKLKGKNALTNKKINARLHYVLDGQMNGYIWTMNKQSWPDVTPKVIHFGDRVEMIYE
FT                   NKSSMSHPMHFHGHVFQVTEIDGQPLDGAMRDTLLVQPHSTVKVQFDALNPGIWANHCH
FT                   NLYHLNAGMFTTFEYQHYPKPDFYLKTIGQPKSNN"
FT   gene            363243..363455
FT                   /locus_tag="lpa_00463"
FT   CDS_pept        363243..363455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00463"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23573"
FT                   /protein_id="ADG23573.1"
FT                   /translation="MGFGERDNWIKVYSIGHFAGLSMSMIFLLFLSANEAVSKSLIYRL
FT                   SELVLSIRHAIANNSRLYYCSHLIK"
FT   gene            363522..363956
FT                   /locus_tag="lpa_00464"
FT   CDS_pept        363522..363956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00464"
FT                   /product="putative protein conserved in bacteria"
FT                   /note="COG3501, VgrG, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00464"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23574"
FT                   /protein_id="ADG23574.1"
FT                   /translation="MKRIFLISIIGIVLNSAYAFEHIGECGAHTWHEVTSKSGSWKITL
FT                   KMISQNGQFVDPSCAEIIETGLAQNNPLSYGLKFSKDADFNLAYTLTAVSEEQGFQSKA
FT                   CVFVITANGPAQPDIQALSYHGAECTWRVIKGIGENFSVG"
FT   gene            complement(363971..364951)
FT                   /locus_tag="lpa_00466"
FT   CDS_pept        complement(363971..364951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00466"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00466"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23575"
FT                   /protein_id="ADG23575.1"
FT                   /translation="MHSFDSIAVEFDLKNHSMQKIAIEDLNIDYQDKDKIYWIHSNLNQ
FT                   KNIFKKLREKLRLPEQVIQLCGEKDNRSTTIEIDEALTLQIQGLCSMKLNDNYDADFSN
FT                   LIIHLTPNYCFTASKKLSSVLFDMLKSCPKSLPYAKTSCFLLFLLLEGVINDYAKIHLA
FT                   YEELADQLDAQVRTPNKNTYSQVLELKHGVMKVKRYTIAIREILMRITSRNILVISEQC
FT                   RTSLYNLSNHCHLIVNEIDSLRDMLNGLLGQIDNQLMQNMNETMKVLTAFAAIFLPLSL
FT                   ITGIYGMNFYWMPELGWKYGYFWALGLIVLCALLLFLIFRKKKWF"
FT   gene            365230..365826
FT                   /locus_tag="lpa_00467"
FT   CDS_pept        365230..365826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00467"
FT                   /product="Predicted hydrolases of HD superfamily"
FT                   /note="COG1896, Predicted hydrolases of HD superfamily
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00467"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23576"
FT                   /protein_id="ADG23576.1"
FT                   /translation="MSQDIEKIEKMYQLIMEINKLKLVFRNTITNPQRNESTAEHSWSA
FT                   SMITLILMNELKSEFVNVDELKIIKLVLIHDVVEIYAGDVLAFDLKARKDKEKVELEAL
FT                   EKLSAVYPSFGIELDSLWHEFEERKSLEAKIAKAADAICPIFQRLQAKQSYIPFDISMA
FT                   QLEKTKYPYFQFSKTFSNLFEKLKADLLKEQLIFL"
FT   gene            365961..367460
FT                   /locus_tag="lpa_00468"
FT   CDS_pept        365961..367460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00468"
FT                   /product="Predicted ATPase"
FT                   /note="COG0433, Predicted ATPase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00468"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23577"
FT                   /protein_id="ADG23577.1"
FT                   /translation="MYDDLWKPYASAELPSLKLGGIVLNGQLLSETPIHLVLKAFNRHG
FT                   LIAGATGTGKTKTMQVLAEQLSLNGVPSLVMDIKGDISGLAMPGETSTKLQDRGQQLHI
FT                   DFTPRGFPVELLTLTPQDPGVPLRARIDDFGPLLFSLMLDLNDTQAGVVTVLFEYAKAN
FT                   QLNLVNLDDFKSLLQFAQTDRGNQLIAAQYGGVASTSIGTIVRKIIELESQGGKQFFGE
FT                   PSFVIQDLLRTDANGYGVISILRLLNMQDKPKLFSSFMLKLLSDVYRQMPELGDPDKPR
FT                   LVLFIDEAHLIFNYSSKALLNLIETIVKLIRSKGIGLIFCTQTPNDIPEAVLSQLGLKI
FT                   QHSLRAFTAKDRKALKLVSQNFPVSSYYNTEQLLTTLSIGEALVSALDAKGQPTPLVHA
FT                   MIRAPESRMGPLSNEELKVLLDQSFLFGKYSQIIDTPSAKEKLAELISEQQVAKQQTSQ
FT                   KENNSSVLNSLSKNTLFRQVVRQVFRELTRAILSLFKSKRN"
FT   gene            367541..368944
FT                   /gene="pncB"
FT                   /locus_tag="lpa_00469"
FT   CDS_pept        367541..368944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="lpa_00469"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /note="COG1488, PncB, Nicotinic acid
FT                   phosphoribosyltransferase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00469"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23578"
FT                   /protein_id="ADG23578.1"
FT                   /translation="MINITGTYTDQYQLAMAQVYFLKGHHERIATFDYFFRALPFKGGY
FT                   AIFAGLEDLLDVLEQLRFEQQDIEFLQHQNMHPDFIDYLQQFKFTGAVYASREGDVVFP
FT                   TRPVVIIEANLIEAQIIETLLLNILNFQTLIATKARRIRQVAGERILIDFGLRRAQGAG
FT                   GYFASRAAIVGGFDSTSNVRAGRDYSIPVSGTMAHSFIQSYDSEIQAFSDYAEAWPENC
FT                   FLLVDTYNTLQSGVPNAIKIAKEMEKRGHRLKGIRLDSGDLAWLSKRARHMLDEAGLNY
FT                   VAITVSNQLDEYVIKNLLEQDAPIDAFGVGTNLAIGAPDAALDGVYKLAFINGQPSIKL
FT                   SDTPAKITIPYQKQVYRVFERDGTYRGADVVCLKTEKKIDMMHHPFEILKSLSIKHYKK
FT                   EALLHKVMENGKRLLPKKSLGEIVRFSQQCFDRLPLEYKRFINPHIYKVGLSTELKMKR
FT                   DQLIAEHSR"
FT   gene            368949..369569
FT                   /locus_tag="lpa_00470"
FT   CDS_pept        368949..369569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00470"
FT                   /product="bifunctional pyrazinamidase/nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23579"
FT                   /protein_id="ADG23579.1"
FT                   /translation="MKTLIILDVQNDFMPGGSLGVPNGDAIVPVINSILHCFDLIVASQ
FT                   DWHPSNHISFASNHPGKKSFEKIKLGNLEQALWPDHCVQGSIGAQFHAQLNTNPIEAIF
FT                   RKGTDPNIDSYSGFYDNLHKKTTGLAGYLREKGARELYFCGLCADICVYFTIKDALSQG
FT                   FDCYLIEDATQALVKDDFIKIKKELIKQGTNIINSSNLLNNLQ"
FT   gene            complement(369651..370034)
FT                   /locus_tag="lpa_00472"
FT   CDS_pept        complement(369651..370034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00472"
FT                   /product="cysteine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00472"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23580"
FT                   /protein_id="ADG23580.1"
FT                   /translation="MSIQLNHTIVWVKDRDKSAHFLTEILGLPEAIPYGPFMVVEMSNH
FT                   VSLDFCKTDKEITPQHYAFLVTETEFDDIFKRICEFKMDYWADPGQTRLGQMNYNDGGR
FT                   GLYFNDPNGHLLEIITKPYGSGS"
FT   gene            complement(370034..371221)
FT                   /locus_tag="lpa_00474"
FT   CDS_pept        complement(370034..371221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00474"
FT                   /product="major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00474"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23581"
FT                   /protein_id="ADG23581.1"
FT                   /translation="MTLLLLISFASVNAVLFTPALPSITAFFRITEHAAQQTITSFLVG
FT                   YALGQLVYGPTANRYGRKKTLYIGIGLQIISSLLCVLAGMISMYPLLVLGRFLLALGSG
FT                   VGLKMTFTLVNECYEPQLAAQKTSYLMLAFAIAPGLSVALGGILNSHYGWESCFYAGTV
FT                   YGAILLAMVRQLPETQKSLQLEAFQMKHLLQGYVSQFKNKPLISGGALMGGASCFVYIF
FT                   AATAPFIAINLLGMSTTEYGAANILPSLGLTLGSIWSAQFAKKYSQRAGIQLGILISGF
FT                   AALAMMMAALTHHSALIKLFFPMIFIYLGLSFIFANASTFAMSHTSDKAHGSAVMNFIN
FT                   MGLVTVVIWGLSLLPMSQYLLPAIYIILCILMMWLFFSFIKSNEIISSIDRNKES"
FT   gene            371366..372229
FT                   /gene="lysR"
FT                   /locus_tag="lpa_00476"
FT   CDS_pept        371366..372229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="lpa_00476"
FT                   /product="Transcriptional regulator"
FT                   /note="COG0583, LysR, Transcriptional regulator
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00476"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23582"
FT                   /protein_id="ADG23582.1"
FT                   /translation="MGKFDQITYFIAVVEEHGFAAAARKFGVSTAAVSRQIARLEAELK
FT                   AELLVRTTRKLSLTDIGARYYQQCKKTLLELNEAEIAIANSRNEAVGILNVTSSRYFAM
FT                   RFLLPYLPEFMELNPKLQIKIELAERFPDLAQENVDVLFGVSMEGPPELVRKRVSTTRY
FT                   VLCASPGYLAKNGIPKTPSELGKHRYITHSMRNPDNLVTFKDNEQIYVEPVLWLNDSRA
FT                   LCECALLGMGIIKLHEYIVAEALQDGRLIEVLPEFQESSLSVYLYYQASRYLQPKIRRF
FT                   IDFFTK"
FT   gene            372650..376000
FT                   /gene="sdbA"
FT                   /locus_tag="lpa_00477"
FT   CDS_pept        372650..376000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdbA"
FT                   /locus_tag="lpa_00477"
FT                   /product="SdbA protein, putative substrate of the Dot/Icm
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00477"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23583"
FT                   /protein_id="ADG23583.1"
FT                   /translation="MHKKYNYYSLEKEKKTFWQHILDILKAPFRLPGWVVSFFLARNIT
FT                   HVALNPNNIPQQRLIHLTKTSNRPEDDIVVINFKKRPPHKWFNDTLIKIANTIAALPFV
FT                   TPRLRTRLHYDNENDINHVNKLLAEIDALVQGKSKQKYCKGRAFDWSKIHLKGLEFLDP
FT                   KMRGYVYEQLHEKYGYVSYTTKREPNIEFFTLKTPDGSELDSVQVTGEDEEKKPMRERK
FT                   FIITCIARDQNFINWIKDLNYTAKNLGATAISFNYRGVDYSRGLVWTENNLVDDILAQV
FT                   QRLISLGADPKNICLDGMCIGGAVATIAAAKLHEKGMKVKLNNERSFTSLSSLVFGFIV
FT                   PELQTANWWSPLTYGRFLLAGVVYALLTPLIWLAGWPVDVTKAWNRIPAQDKMYSVVRD
FT                   KDNGLYDGVIHDHFCSIASLVDSQINSILYKLSTDQLLTEEEKQILCDDQLSHHFKPSQ
FT                   SVLKNPKYKGPHFISRQDLVAELGHREEYTNHDYFLDRLREKFQLDRTIRPVALAEDGE
FT                   KDIDGIPPQLSNHKERPLIIASSGGTGHISATHGIINDLQSKTDNVVITQHHAELYKNK
FT                   PFSITSVLIRIGVWLTSLPVLEDILKGVMRFIGYPVLPSSSIFWDQMSKIQQSETKKEN
FT                   GIETGRTRPYVDMLLDIYPEGYEYTAFNNATHLTSSIEDIQTMISFKGHVEEDNRNIVY
FT                   QNILQRLMHAAKQSTPYTRLISTQALSLGAICDAVKYYNTVFLPVYNAERGTSYQPITI
FT                   DQYMTDLPSLGCIHFMNNLEELTSEQRQLMEIHAVNMSEPFKEAHFGKEQGFKAVHNID
FT                   PRNNPMIRNAFKDLSLTKYLDKTQSFDLHFNVYKKEKQNALPVLNGKEKITIKPHAKIA
FT                   SIMIGSLAANASADYAQYLLNQGYDHIFLFGGLNDSIAARIDQIINSYPDSRHDEIRKK
FT                   IILLGNQSDVEMAPIMTRSNCVVIRGGGLSVMEQMAMPIMDEKIVLLHHEDNEEGPLTS
FT                   GLSWEDGNADKLIEYLSEKGAYAKKTSPGLCSGHLNEAEKDFEKKYITQLKSKGTKEKV
FT                   DLTIPQQKKPPLKKEWGRKTGYTELGHVLSHQHRFFETIPEVREPFCSKEDLHHHELSS
FT                   QSLVSVTVG"
FT   gene            376080..377537
FT                   /locus_tag="lpa_00479"
FT   CDS_pept        376080..377537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00479"
FT                   /product="Ras GEF"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00479"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23584"
FT                   /protein_id="ADG23584.1"
FT                   /translation="MIGMRAEQCNLKSFFVHSLKNKSNLLPLIACFNNREINMPKILDS
FT                   NAYREMENELNNLFEQIYKHGKNDRTAITLQVQQFLDNLSESIRDHSRLLLTNIAREEL
FT                   IYFKEKKPGDSREKFQNIDKMSDYFNNLSALINFSVMQQEDPTLRVFYYDMYIQLMNFC
FT                   YLKGDLFGAGAIYTGLIANNLPNSIDRKQLSSESRLIFKDCEEKFKRLFNLSTTYNEHT
FT                   NLKRQFKTALIPALPSLLTVQIYTKDAYDNSVSDFERVQEKLRQLDIEHNRFLNQLQND
FT                   HSTWSKAYYDYMSNVYLPQSIFEYTTLLREYEELITTHGGPIAKQFHEDKNSEHLVSFV
FT                   ESTLLENQSDLKLSPFQNERIVEMLSEIDVVKSECSSPDVFDDISWKLREMNCTLVKAK
FT                   SIGDYTSKIFANLDTPYMEENTDEDPKPVLVEELQTDDVYQLHHSGMKLIRELEQAIED
FT                   HKRRLFIIVQVRQTMVSLRKPEGGGGI"
FT   gene            complement(377698..379923)
FT                   /locus_tag="lpa_00480"
FT   CDS_pept        complement(377698..379923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00480"
FT                   /product="sensory box protein, GGDEF family protein, LssE"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23585"
FT                   /protein_id="ADG23585.1"
FT                   /translation="MSTESFRILVIDDNPAIHQDFMKILNVSKNSALLNKFDAELFDDE
FT                   TKQLGISLPEFEIDVATQGIEGIEKVKRSLEEGRPYPLAFVDIRMPPGIDGVETIKRIW
FT                   AIDPQIQIVICSAYSDYSWESTVNTLGLSDNLLVLKKPFDVIAVRQLASALTQKWVLAR
FT                   ETQKHTEFLNQLVEERTESLQQSFSLLRATIESSSDGILVVDLQGKIVDYNSQFVKLWN
FT                   IPESIIKKETSEPQLIQYMSTQLLNSEQHAQHVKEFSIHIDDSSMQIYHFRNGKVVECC
FT                   SKPHRVGLQTVGRVWSFRDITEQTRLKEKLEYQATHDALTNLPNRLLLIDRIEHAISGY
FT                   ARHKMKFAILFFDLDRFKMINDSLSHEAGDQLLCAVAERLRSLVRKEDTLARLGGDEFV
FT                   MLFQSFNSEEQIAGVAQKILKSFQKPFHIAERDINIHVSIGISVYPTDGKTVNTLLSNA
FT                   DMAMYQAKFRGGNQFSFYTEKLNKKTNQQFQLELDLQKAIVHHEFFLLYQPQFTVNTHE
FT                   IRSMEALIRWNHPQKGIILPLDFIPTAESSGLIVPIGEWVLRETCKQIGAWRTMGLPEI
FT                   RVACNVASKQLRQRDFPAMVEDLLKEYSVEPHCLELEITENVIIDKEIQRTIKKLKSLG
FT                   VLIILDDFGTGNSSLNLLKQVAVDSLKIDQSFIQNISKSPGDEAIIDAIIAIAQSMNFN
FT                   IIAEGVETQNQLKFLKKRRCNDIQGFLMSKPIPPEEIEKLLQGNRTK"
FT   gene            complement(379926..381341)
FT                   /locus_tag="lpa_00481"
FT   CDS_pept        complement(379926..381341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00481"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00481"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23586"
FT                   /protein_id="ADG23586.1"
FT                   /translation="MTEMHRLLQRQLKKFGFTADGLPQNLESWTQFIAHINKTYYENDQ
FT                   DRYLLERSIDISSKEMRDINSKLEYAQDIAQMGYWHYDADTDTATWSKGLFKILGLPPS
FT                   NVALNLSSFLELVHPNDIAGLKKVVEKALKEKEDYDYELRVRNQDNDYKWFRTIARANP
FT                   HKNEISGVLMDISKRKIIEEQVLELNNKLVSTARLAGMSEVATSILHNVGNILNSVNVS
FT                   AIILKKNISKIHYKKLSAIKTMLDENINQLSEYLLNNPKGKLVLPYLDALSKTLHEEYE
FT                   ENMKEANSLETNINHIKEIIAMQQSLSGLSNLTEKISIHDVILNAVKSVILDKHQIDVR
FT                   IEIEPDINEFITDKSKLFQILTNLLANAKDSVLLHEANASRTIVISIGRTEKNHIMIKI
FT                   NDNGIGIQKDNLDRIFSFGFTTKKNGHGFGLHCSAIYARDLGGTLYAESNGNGEGAQFV
FT                   LDLPINPKTLSPR"
FT   gene            complement(381366..382529)
FT                   /locus_tag="lpa_00482"
FT   CDS_pept        complement(381366..382529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00482"
FT                   /product="putative conserved protein"
FT                   /note="COG3287, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00482"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23587"
FT                   /protein_id="ADG23587.1"
FT                   /translation="MKIESFQYIQNQGWSIPTFPALDSENTLILVFASPIFRANSKPIE
FT                   ELAQAYKKSKIIGCSTAGEIFGPNIFDNSISVAVVQFESTKLQLAKTEVKSTEESYEAG
FT                   IHLSKSLHQKQNPQSIFVLSDGLNVNGSELIKGLNQHAGKGVIITGGLAGDGADFKNTW
FT                   IIYDGKIVDHCIGAVGFYGNQIHVGHGSRGGWDIFGPERIITRSKANILYELDNQPALK
FT                   LYKTYLGDRASELPAAGLLYPLAIRNPSAPDSQHIVRTILGVNEEEQSLIFAGDLPKGY
FT                   YAQLMRANFDRLIVSANEAGENANDRLFKNGSLNTQPVLAIDISCVGRRLVLGELTEEE
FT                   TETTLQSLPPKSIQIGFYSYGELSPLATGTCELHNQTMTITTLLESP"
FT   gene            complement(382702..383583)
FT                   /gene="lysR"
FT                   /locus_tag="lpa_00483"
FT   CDS_pept        complement(382702..383583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="lpa_00483"
FT                   /product="Transcriptional regulator"
FT                   /note="COG0583, LysR, Transcriptional regulator
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00483"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23588"
FT                   /protein_id="ADG23588.1"
FT                   /translation="MDIRDIKSFLAVVEYHSLTLAAKKLHVTQSAISKRIRKIEDELNI
FT                   RLIISEGSRLIFTEAAKQLIPYARQMLSAHQNMVHTLKNSQQFTQSIIIGASVYVSHYV
FT                   LPGFFKYLKETHPTIQAHLKTISEKEVEYILNHGTVDLVICPAREASEKLLSNSLLWEE
FT                   KLNLVVAINHELAHRTSALSLSELSEYPAILTEKGAALRDKLDTLFEKNQLILNLGFEM
FT                   STIDAIKSLVEYGLGWSYLPDSLLSEKLKILKIKDLELTIPFHAFYLKKRISDRLINDL
FT                   LCDFKKWQNRDN"
FT   gene            complement(383805..384989)
FT                   /locus_tag="lpa_00486"
FT   CDS_pept        complement(383805..384989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00486"
FT                   /product="amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00486"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23589"
FT                   /protein_id="ADG23589.1"
FT                   /translation="MHLKRTLSLTLLAFYGLGTILGAGIYALVGEVAKEAAQFTPLSFL
FT                   IASIIALFTAISYAELSSRLPHSAGSALYVRRAFHQKWLSGLIGWIVVLTGIISAATLS
FT                   HGFVKYFQLFLPLPPSLIITILTVILAGVAIWGIRESATLILFMTLMEVGGLLMIIYYG
FT                   RYSLASIDIKSFSFPHSFDGVLIGAFIAFYAFIGFEDMVNTAEETINPEKTLPKAIFLA
FT                   LISATILYIAVAWVIVLTIPSNTLVKTDMPLIEIIKLQGQSPLLFSIIALISITNGILV
FT                   QIIMASRLIYGMANQQNAPQIFSSVYSKTQTPVYSTLLVFLMILLFAYALPITTLAKLT
FT                   SSIILCIFIIIHASLIKIKLTEKKPTNAISFPIVFPMISILLTLAFLIIQFFLK"
FT   gene            complement(385057..385833)
FT                   /locus_tag="lpa_00488"
FT   CDS_pept        complement(385057..385833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00488"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23590"
FT                   /protein_id="ADG23590.1"
FT                   /translation="MSEREWPANDYAIGSYIQATVAEKYLAYLKVNPTDKILDIGCGNG
FT                   AFTKNILLQVPQGSVLGIDASENMLHLAQDMSKKFPNFSVQKADVLTMTFNSQFDYVVS
FT                   FWCLQWACANIQKAFFNIINALKTGGKFLTLFPAGDDPFIMSYYALRKSGQFTSLHNFI
FT                   PPVDYSHLNNLEKKLESLTCRDLNVKLCRQSITLPSLDTFRKFVNGIAFYQGQLPNEEI
FT                   KQINEAMVRYYDSECQTKYHGEYQFNFTIYLVTGEK"
FT   gene            386041..387252
FT                   /locus_tag="lpa_00489"
FT   CDS_pept        386041..387252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00489"
FT                   /product="NAD dependent formate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="COG1052, LdhA, Lactate dehydrogenase and related
FT                   dehydrogenases [Energy production and conversion / Coenzyme
FT                   metabolism / General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00489"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23591"
FT                   /protein_id="ADG23591.1"
FT                   /translation="MFSQSQQKIVCVLYDDPKGGFPPNYARESIPELKQYPDGQSLPTP
FT                   DSIDFIPGEMLGSVSGELGLRQFLESNGHQLVVTSDKDGSDSVFARELKDAAVVISQPF
FT                   WPAYLTRDRIESAPKLKLAITAGIGSDHVDLQAAMEHNITVCEVTYCNSISVAEHTVMM
FT                   ILALVRDFIPQYNTVIDGGWNIADCVSRSYDLEGMQVGCVAAGRIGLAVLRRLKPFAVK
FT                   LHYTDRHRLPLHMEQELNLTYHPSVESMVKVCDVVSIHCPLHPETEYLFDDRLIKQMKR
FT                   GSYLINTARGKICDQHAVADALESGHLAGYAGDVWFPQPPAKNHPWRSMPNHAMTPHTS
FT                   GTTLSAQARYAAGVREILECWLGNKPIREEYLIVSQGRLAGVGSHSYSAGNTTTGTEQA
FT                   VELV"
FT   gene            complement(387358..388482)
FT                   /locus_tag="lpa_00490"
FT   CDS_pept        complement(387358..388482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23592"
FT                   /protein_id="ADG23592.1"
FT                   /translation="MFTKSCAKATDQNRQELLMDSLLGDFQKMKEKALNQQQEKRSKKR
FT                   EFNSLSSEKTKKPNQYAALTHSQVQEVKAKARTVNDKFHLNAEEKKLWELILLGNQLAQ
FT                   NISSCDLPTDNEDDASLVKLTQIFADETLERTDLTWLNKILKIALYSRGSGFGNCQEKA
FT                   FFAFALLLHQAQKPESLIHSLRLATFNNHFILIVNERFLMDPWLNLAFPLSKGNQQLEI
FT                   GYVFEGFGRLVNYFSINQEGQCFTHAVREGDTTERDLSSEKDMANCIHSLLDHRDYFDL
FT                   SIVSEREIHTKTKRRKYETQEQEVPQPRQETSNQPKETVYTDSNHNTWDNEGAADDFLE
FT                   HFEQTHPVYNPGFFSFGQDDVGFKPDLPKNLFKF"
FT   gene            388739..389401
FT                   /locus_tag="lpa_00492"
FT   CDS_pept        388739..389401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00492"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23593"
FT                   /protein_id="ADG23593.1"
FT                   /translation="MSKEQIKKTALEIVEYIHGNIKACNIPNQKKENKFFAPLVYLCQT
FT                   ECDKILSNTKISLLERLLKCAKIVDDLQSGNCMQQAFLAFQRLLTRLIEDKLSNFSTCI
FT                   PISIMTISKHAFLIIDNDIVCDPWLNFVGDLRDYRFAKMKRKEYFGIRSDWTCFTNTEV
FT                   YDEDSTEFTIQFVNALGVGISGFSEVKLANQLMQSSSMASDLGEDPVISIPKEFHQI"
FT   gene            389415..389528
FT                   /locus_tag="lpa_00493"
FT   CDS_pept        389415..389528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00493"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23594"
FT                   /protein_id="ADG23594.1"
FT                   /translation="MIVMNSIAVVFVQVPVRFNGKYIVLDNDGGEDEFFKQ"
FT   gene            389509..390282
FT                   /locus_tag="lpa_00494"
FT   CDS_pept        389509..390282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00494"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00494"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23595"
FT                   /protein_id="ADG23595.1"
FT                   /translation="MNFLNNKIVMITGASSGIGQACARLFAAQGARLILSARRVERLHE
FT                   LSSELKHHNNQEHYILPLDVCKKDLVRQQIESLPGQWNSIDVLINNAGLALDTLPLHQG
FT                   ILEHWDTMIDTNIKGLLYISRLILPGMLERNSGHVINIGSIAGHECYPNGNVYSATKHA
FT                   VHAISKSMRLDMLGSAVRVTEIAPGAVETEFSEVRWKDKQRAIDFYKDFQPLMAEDVAD
FT                   AALYCATRPLHVDIEQMIIMPTVQASANHLSRKGR"
FT   gene            390802..391032
FT                   /locus_tag="lpa_00496"
FT   CDS_pept        390802..391032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00496"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23596"
FT                   /protein_id="ADG23596.1"
FT                   /translation="MNKLIVAVTAGASLLLLTGCAVDGVAVDDVSYDSGYSNDYVYSVG
FT                   YYSNRPYWGNNYYSSPSFVGPYGYWGGDYDF"
FT   gene            complement(391086..391655)
FT                   /locus_tag="lpa_00497"
FT   CDS_pept        complement(391086..391655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00497"
FT                   /product="translation elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00497"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23597"
FT                   /protein_id="ADG23597.1"
FT                   /translation="MAVYSTNEFKNGLKVMVDDAPCSILDCEFVKPGKGQAFTRIKIRN
FT                   LKTGRVVERTFKSGDTLPSADVADVEMQYLYNDGEYWHFMVPDTFEQYAVTENVLADAA
FT                   QWLKEQDVCVLTLWNNEPIQVTPPNFVILAITETDPGLKGDTSGGGGKPATLETGAVVR
FT                   VPLFVQTGELIKVDTRKGEYVSRAKE"
FT   gene            391727..392707
FT                   /locus_tag="lpa_00499"
FT   CDS_pept        391727..392707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00499"
FT                   /product="lysine 2,3-aminomutase"
FT                   /EC_number="5.4.3.2"
FT                   /note="COG1509, KamA, Lysine 2,3-aminomutase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00499"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23598"
FT                   /protein_id="ADG23598.1"
FT                   /translation="MRDTSLSWQKILAQGFTSTADLLDFLELPRSEGNLFAEKQFPSRI
FT                   PLGFAERMQKGNPKDPLLLQVLAKEDELTVADDYVIDPLSESNTLIKGLLHKYHGRVLL
FT                   TLTGVCAVNCRYCFRRHFPYQANNPGRRGWKEVCAYIANDPSITEVILSGGDPLLAANL
FT                   VLEELLQSLEEISHVHTLRIHTRIPIVLPERIDKGLLDLLTNTRFKKVIVVHCNHPQEL
FT                   DESVLRACSDLKKATCYLLNQSVLLAGVNDDAVILSKLSHALFDYGIMPYYLHLLDKVK
FT                   GSAHFDMPLPRAQSIYHQLQSLVPGYLLPRLAREEPGRSSKTLLI"
FT   gene            complement(392776..394848)
FT                   /gene="ppk"
FT                   /locus_tag="lpa_00501"
FT   CDS_pept        complement(392776..394848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="lpa_00501"
FT                   /product="polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="COG0855, Ppk, Polyphosphate kinase [Inorganic ion
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00501"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23599"
FT                   /protein_id="ADG23599.1"
FT                   /translation="MDTTLDNPDYYINREFSAVAFNQRVLMLANDERVPLLERMRFLSI
FT                   CSSNLDEFFEIRVAGLKEKIAMSSGKLTIDGLRADEAFSQISHKAHALIDQLYNIFNKQ
FT                   LLPALRKENIHFLETDQWTDDIHLWAKHYFKHEILPVISPIALDLAHPLPRLINKSLNF
FT                   IISLSGKDAFDRNINYAVVHAPRSIPRMIHLPSELCGDAHYFVYLSSIIKTHINSLFPG
FT                   MEISGCYSFRLTRNSDLFLREEEIDDLAKAVQREIFSRHYGHVVRLEIENKCPEKIVDF
FT                   LLQKYHLRHEDTYYCDGPVNLQRYMSAINSIDRPDLNYPAFTPQYPKFSKSQRNLFNIL
FT                   DEQDILLHHPYQAFDLVIDFVRQAASDPNVLAINQTLYRTHSESVMVDALVNAAHSGKE
FT                   VTAVIELRARFDEESNLKLANKLHAAGILVLYGVVGYKTHAKMTLVVRRTHGKLKRYVH
FT                   LSTGNYHEQTAKRYTDLGLLTSEPTITSDAQLIFQQLTGLGKVVKLKALSHSPFTLQKT
FT                   LLQFIEQCSTAATGGIDTEIILKVNGLTDKVMIQALYKASQAGVKINLLVRGVCCLKPG
FT                   LPGVSENIRVLSFIGRFLEHHRVFYFRINEEEHYFCSSADLMERNLYNRIEIMFPIYDE
FT                   GCKKRIKNEIIKNYLKDNNNVWEMQSDGTYKHLMQNGGCAQEKLIALYEEEDKSI"
FT   gene            complement(394889..396094)
FT                   /locus_tag="lpa_00502"
FT   CDS_pept        complement(394889..396094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00502"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00502"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23600"
FT                   /protein_id="ADG23600.1"
FT                   /translation="MKRIFFVVFLLCLETACNTAKNNPLPAQLSDKALVPGFKEVRTEF
FT                   TSSDDPIIKKQSLERVKQLAKAYPDTMFHQKGSFSLLIISGGGDYGAFGAGLLNGWTKS
FT                   GSRPTFTTVTGISTGALIAPLAFAGPKYDATLKKVYTTITTKDVLSNKPVLWTLLTGGS
FT                   ALKGTKPLQDLIARHVDEKLLDDIAKGYYQGRRLYVGTSNLYSRKLVVWDMTRIAASKN
FT                   PERVQLFRKILLASASIPVVMPPVYFDVMANGKPYTEMHVDGSTTFAVFLSRLGSDIKT
FT                   AKKHFKLKQKPNVKIYVIRNNQNQFHYKVIKPKLLVIGKRAIESVTASQGAADVIFIYL
FT                   CALIEGVDFNLANVPNEFDSNSEELFDTQRMNQLYQIGYSKAVKGYPWQKIPPDVRALH
FT                   GD"
FT   gene            complement(396170..396703)
FT                   /locus_tag="lpa_00503"
FT   CDS_pept        complement(396170..396703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00503"
FT                   /product="chromate transporter"
FT                   /note="COG2059, ChrA, Chromate transport protein ChrA
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00503"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23601"
FT                   /protein_id="ADG23601.1"
FT                   /translation="MIKTFIEIIYSFGKIGLISLGGGNSMLKLLEYEAVTYRHWIGKEE
FT                   FVGMLGSSFLFPGLTGIKLAALIGYKAAGITGLILAIICLNLPGLIMALVGYQWLNSHN
FT                   GPITRKIMISVQYGALALLAAATFSVVQGVIDVYYSIPMAICCILFFLALAFWNLSPFY
FT                   GFLAFIAVCFFVVR"
FT   gene            complement(396700..397320)
FT                   /locus_tag="lpa_00504"
FT   CDS_pept        complement(396700..397320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00504"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23602"
FT                   /protein_id="ADG23602.1"
FT                   /translation="MQRLVWNFEFSSEQTTPLTTLDHDAQDNLKWEKRYFWPADQIIRL
FT                   NTIDSSLLDLANYQKKHKEDYYYLLPDSDHNIKQRRNELLYKPVIKQSGSALGFGPKVH
FT                   LENPQTLSCHGDAGQLNRQELLKKIKEKGIVVFVKKEAFVFKFPTTPTVKLELARLEVK
FT                   DKVYFSACIEGRSLNLVETISVLLFGTQPSFEYVTFLKKTLKI"
FT   gene            397496..399934
FT                   /gene="caiA"
FT                   /locus_tag="lpa_00506"
FT   CDS_pept        397496..399934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiA"
FT                   /locus_tag="lpa_00506"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="COG1960, Acyl-CoA dehydrogenases [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00506"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23603"
FT                   /protein_id="ADG23603.1"
FT                   /translation="MAIVFFLIYLAFTLVVLSRRINPLIWEIGSIIYLIPATFYFGFPW
FT                   IIGLFIWFFIIAAVLVVRVEPLRFFIGDYLYKTAGKSVPKLSKTEEEALNAGDTWLEQD
FT                   IFTGKPDWQRLSAVSTELTAEEQAFLDNETHTLCSMLDEWEISQEYDLSPKVWNYIKEK
FT                   GFLGLVIPKEFGGKGFSARAHSDIVMKIATRSRVAAVTVMVPNSLGPGELINYYGTDEQ
FT                   KAYYLPRLAKGVEIPCFALTEPGAGSDATSIQSEAIVVKKKIDGKSVLGLNITLDKRWI
FT                   TLAPVATLIGLAVNLKDPDGLLKGEGEEGITCLLIPRDTENLEIGNRHLPADQPFMNGT
FT                   LRGKDIFVPIDTIIGGQKKAGSGWQMLVECLSIGRSISLPALGAGSSSISYLTTGAFAR
FT                   IRRQFNVEIAQFEGVEEKLAEIAGLNYLINSTRLLTVAAVNEHKKPSVASAITKYFNTE
FT                   LARITVNASMDVHAGRAIVVGPRNYLNSLYQSVPISITVEGANIMSRNLLIFGQGSMAC
FT                   HPFIRDEFYAISSENKEAFREIIWKHIHYFMQNFAKTVCSAWTSGLFIAVPENSMKREY
FT                   KKLARLSYAYSWLADLSLIYLGGDLKRKERLSARLADGMSYLYMAMAALRNVQLNQDHP
FT                   DEQLHARWAVSYCFYHAQKSMIALCHNFPSKFLGFIARVVAFPFGQTMRYPSDKLDHQL
FT                   ARLMTGNNHYRDRLKKSVFLSGDSKQPVDRMEHALQLIIEADGLSKKVSDLKRYKWSKL
FT                   KGKLKEKVESGQLSQQEMEELLAVEDARWDAILVDEFTFDSMKKKTLHSVIEKMKSPLA
FT                   "
FT   gene            400048..400740
FT                   /locus_tag="lpa_00508"
FT   CDS_pept        400048..400740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00508"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23604"
FT                   /protein_id="ADG23604.1"
FT                   /translation="MPKYTLPTRDALLKAMQVGETSIEAAEYMATRFEQILTQAKLLPE
FT                   CNDMLEKIQEYAQFVKFKLLSSAQVWSGQERPISDYQNMQENKAEFLASHLKELPSGLK
FT                   LEIAIGDDAKILRGFSSNGKMVEGEQLKTMDGLLEGWLAKNNLAISGGAVVQRNSTGNQ
FT                   TSVDPEEIRKLINDSEKGVAKYFADKGVSMEVVQRTYQEPKALETKREEIRQEIESGAE
FT                   APTTQSIR"
FT   gene            complement(400777..401439)
FT                   /locus_tag="lpa_00509"
FT   CDS_pept        complement(400777..401439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00509"
FT                   /product="mannose-1-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.13"
FT                   /note="COG1208, GCD1, Nucleoside-diphosphate-sugar
FT                   pyrophosphorylase involved in lipopolysaccharide
FT                   biosynthesis/translation initiation factor 2B,
FT                   gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell
FT                   envelope biogenesis, outer membrane / Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00509"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23605"
FT                   /protein_id="ADG23605.1"
FT                   /translation="MKTAMILAAGRGERLRPLTDKIPKALCTVRNKPLIEHHIINLANA
FT                   GFDRLIINHAYLGGQIRQYIGNGKQWGLNVIYSPEPPGGLETGGGIVNALPLLGEGPFL
FT                   TVNADIYTDFDFTKLQLKNIDTFHLILIPKNPSLLHHGDFGLINGSHLTNTNQAYTFSG
FT                   IACYNPKVFANCRQGRYSVTPLLRKYVEQNSATGSVHSGIWYDIGSFDRLHAANQFP"
FT   gene            complement(401436..402413)
FT                   /locus_tag="lpa_00510"
FT   CDS_pept        complement(401436..402413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00510"
FT                   /product="hypothetical phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23606"
FT                   /protein_id="ADG23606.1"
FT                   /translation="MHERENALKEWLAQTIQQKDFVLLPLAGDASFRRYFRIQYNGLTQ
FT                   VVMDAPPEKENIEPFLHIANVLDKIKIPVPDILAINKREGFLLLSDLGDQLLLNKLNHE
FT                   TVDNYYNQAMNLLLQIQKCPTDDPELPLFDKSFMLKEMNLCLEWFLKAYLSLDLKQDEL
FT                   QLFQHTIEWIASEVATQPRVFIHRDYHSRNLMLVKNKDSCLATIDFQDAMLGPVTYDLV
FT                   SLLKDCYISWPREKVLEWITYFHEKSPHTNIYSLTDFIRAFDLCGLQRHLKVLGVFCRL
FT                   YLRDNKAGYLGDLPLTLKYALECAETYEELHPFFNFLQKRVYLP"
FT   gene            402515..405175
FT                   /gene="ostA"
FT                   /locus_tag="lpa_00511"
FT   CDS_pept        402515..405175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ostA"
FT                   /locus_tag="lpa_00511"
FT                   /product="organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23607"
FT                   /protein_id="ADG23607.1"
FT                   /translation="MNMRFYKKLIISGFISFIALLRGLLYCHLKRLFKKWPGSLFSVKW
FT                   VLMAIGITACVLSLINYQGLAYSAALINEPIQACVIAREVDLTDDIRTKFAQCLGWQAD
FT                   QSSPVCLGFYKPITVTPLASPDEVRILADTASFYRTQRSTLSGHVEMQQGQRVVNAQTA
FT                   YVYRDPKTNEVTKIEFLNHVRYLEPDRMMIARKAVVYPQDKSGEVEDVLYRFNTNRSNA
FT                   LLPAWGRASLIKRFANQDYFLKEATYTTCAPQDKAWAIEAESISIDNEKGKGIARNAKL
FT                   RIHEWPVLYTPYLSFPTNRDRKSGFLMPIVGYSNVGGADLGIPYYWNMAPNYDMTLVPH
FT                   LYTKRGLMLGGQFRYLTSKSSGTFNGNFLPKDKAFGRFLQDNEVEFPQIRGLSTNRWEV
FT                   NFVDSTQFLSDLQLNVNFQQVSDDYYLQDFSTNLASVTQRQLLRQADLTYTTENWTFRG
FT                   MGQSYQTLHPINEIPVSPVYERLPQLMARGYYDDLPFNAQFNILGQYDQFHWPNDSWNI
FT                   ALNNMPQGPRFHLNPILSVPMMKPWGYVTPSVQFVENYYDISRNYTWGTSRANYNLTIP
FT                   RYSLDGGLYFERDLHLKGTYYIQTLEPRLFYLRVPYYNQTLIPVYDSGFMIFNVDQLFR
FT                   TNRFSGFDRIGDANQLSYALTTRWLEDESGAEKANFSIGQIKYFSERRVQLCQSPTGFC
FT                   TDNPDTFGNLSSTFGTSPVASRAVYKFNPAWGITGDYIWDPATRATNNADLNLHYQPAR
FT                   NAIINGGYSYLVNGDVTQVRNNDTENNALHQAILSAAWPLSEKWSGIGAYSYNISKNYS
FT                   MMSFLGVQYDSCCWAMRILGGRTFRSLNEEFEPQYNNNIYLQILLKGLGSVASSDPSGI
FT                   LNTYIPGYYDPFRRR"
FT   gene            405351..406640
FT                   /locus_tag="lpa_00512"
FT   CDS_pept        405351..406640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00512"
FT                   /product="peptidyl-prolyl cis-trans isomerase SurA"
FT                   /EC_number="5.2.1.8"
FT                   /note="COG0760, SurA, Parvulin-like peptidyl-prolyl
FT                   isomerase [Posttranslational modification, protein
FT                   turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00512"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23608"
FT                   /protein_id="ADG23608.1"
FT                   /translation="MFKRIALVCALFSGICFAEGKQLLDKVVAIVNDNVITSSELNAQV
FT                   ELSKKQIIAQNMQMPDESVLRKQVLQHLIDVDLEMQMAKQNGITIENAEIDEAIEKIAA
FT                   SNHLNLSQMRDEITKQGISWQEYRQNIRKEMLISRVQQKAVGKDIIVTNEQVEQYLKTA
FT                   GRIENSNLTYHLKNIVIPLSEEPTTKQLQRAKIEAENLLNKIKKGEDFSRLAIEESSGE
FT                   FALEGGDLGERHLAELPEVFAKEVVHMKVGQVAGPIRAGNGFHLIKLVAVGGENQRHVI
FT                   TQTHVRHILLKPDASMVPSEAIKQVNNIYRQIQSGKDFALMAKQYSLDAASAVKGGDLG
FT                   WVNPGELVPEFEKTMNSLPLHKVSKPVKTQYGWHLIEVIARRQKDDSEAFKKQQVRQFL
FT                   QQRKFVEAVQNWQQHLRSQAYINIVDKDLA"
FT   gene            406637..407611
FT                   /gene="pdxA"
FT                   /locus_tag="lpa_00513"
FT   CDS_pept        406637..407611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="lpa_00513"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="COG1995, PdxA, Pyridoxal phosphate biosynthesis
FT                   protein [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00513"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23609"
FT                   /protein_id="ADG23609.1"
FT                   /translation="MNPLLISSGEPAGIGPDLCLALAETDLPVVILGDLSLLEARASEL
FT                   NLSIKFLEYGPHQSFEKKAGYLTVWPVPCAAPVISGELNPQNAAYVMELLTLGASLCSK
FT                   GEFSALVTAPVHKANINAAGITFTGHTEFFADFFEVETVVMMLACSQMKVALVTTHLPL
FT                   RMVPDAINSLLIIKVIQQLHHSLKHDFGIQSPRINVAGLNPHAGESGYLGREEIEIITP
FT                   ALNTLKNQGIDVLGPLPADTMFITNNINHCDAYVAMYHDQGLPVLKYAGFNEAVNITLG
FT                   LPIIRTSVDHGTALELAGKNKANPGSMLAAVKMAKDMALTRIK"
FT   gene            407613..408104
FT                   /gene="folA"
FT                   /locus_tag="lpa_00514"
FT   CDS_pept        407613..408104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="lpa_00514"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="COG0262, FolA, Dihydrofolate reductase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00514"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23610"
FT                   /protein_id="ADG23610.1"
FT                   /translation="MSVISLIAAIDETGGLGINNQLLCYLPADLQHFKSITMGKPIIMG
FT                   RKTYESIGKPLPGRLNIVISQSIQSIPGVVVVDSLGQAIKETTGASEVMIIGGAKIYSQ
FT                   AISMANRLYITRIHHQFTADVFFPKINELVWSCRSKEYRQHDDKNQYDMTFCIYERISI
FT                   "
FT   gene            complement(408111..408656)
FT                   /locus_tag="lpa_00515"
FT   CDS_pept        complement(408111..408656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23611"
FT                   /protein_id="ADG23611.1"
FT                   /translation="MSKLVYLLLMIFFLNPAWANTHYHQHPVSPLANALRTGTDTNGNA
FT                   LYLCKAKLFNSIQPGKTWAGYGRCNVPYGGKEYVLSQFTIPNQNEFGRYSWEPNVEHAL
FT                   LMGKDTNGNPLFVCQSNFNGSIQPGKTWPGYSHCNISYGGREIITDNYRILSRPTEIIV
FT                   RTQPPVHRHPSQNRHYHY"
FT   gene            408944..410457
FT                   /locus_tag="lpa_0503"
FT   rRNA            408944..410457
FT                   /locus_tag="lpa_0503"
FT                   /product="16S ribosomal RNA"
FT   gene            410562..410634
FT                   /locus_tag="lpa_05004"
FT   tRNA            410562..410634
FT                   /locus_tag="lpa_05004"
FT                   /product="tRNA-Ala"
FT   gene            410803..413663
FT                   /locus_tag="lpa_05005"
FT   rRNA            410803..413663
FT                   /locus_tag="lpa_05005"
FT                   /product="23S ribosomal RNA"
FT   gene            413865..413925
FT                   /locus_tag="lpa_05006"
FT   rRNA            413865..413925
FT                   /locus_tag="lpa_05006"
FT                   /product="5S ribosomal RNA"
FT   gene            414029..414101
FT                   /locus_tag="lpa_05007"
FT   tRNA            414029..414101
FT                   /locus_tag="lpa_05007"
FT                   /product="tRNA-Thr"
FT   gene            414177..414258
FT                   /locus_tag="lpa_05008"
FT   tRNA            414177..414258
FT                   /locus_tag="lpa_05008"
FT                   /product="tRNA-Tyr"
FT   gene            414282..414352
FT                   /locus_tag="lpa_05009"
FT   tRNA            414282..414352
FT                   /locus_tag="lpa_05009"
FT                   /product="tRNA-Gly"
FT   gene            414408..414480
FT                   /locus_tag="lpa_05010"
FT   tRNA            414408..414480
FT                   /locus_tag="lpa_05010"
FT                   /product="tRNA-Thr"
FT   gene            414516..415706
FT                   /gene="tufB"
FT                   /locus_tag="lpa_00521"
FT   CDS_pept        414516..415706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufB"
FT                   /locus_tag="lpa_00521"
FT                   /product="GTPases translation elongation factor"
FT                   /note="COG0050, TufB, GTPases - translation elongation
FT                   factors [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00521"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23612"
FT                   /protein_id="ADG23612.1"
FT                   /translation="MAKEKFERKKPHVNVGTIGHVDHGKTTLTAAITTIMAKKYGGTAK
FT                   AYDQIDAAPEERERGITISTAHVEYESASRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFMNKADMVDDPELLELVEMEVRDLLSSYDF
FT                   PGDDIPIVVGSALKALEGEDSDIGVKAIEKLVETMDSYIPEPVRNIDKPFLLPIEDVFS
FT                   ISGRGTVVTGRVESGIVKVGEEVEIVGIRDTQKTTCTGVEMFRKLLDEGRAGDNVGVLL
FT                   RGTKRDEVERGQVLAKPGTIKPHTKFEAEVYVLSKEEGGRHTPFFNGYRPQFYFRTTDV
FT                   TGTCDLPSGVEMVMPGDNVQLVVSLHAPIAMDEGLRFAIREGGRTVGAGVVAKIIE"
FT   gene            415770..415842
FT                   /locus_tag="lpa_05011"
FT   tRNA            415770..415842
FT                   /locus_tag="lpa_05011"
FT                   /product="tRNA-Trp"
FT   gene            415899..416228
FT                   /gene="secE"
FT                   /locus_tag="lpa_00522"
FT   CDS_pept        415899..416228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="lpa_00522"
FT                   /product="preprotein translocase SecE subunit"
FT                   /note="COG0690, SecE, Preprotein translocase subunit SecE
FT                   [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00522"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23613"
FT                   /protein_id="ADG23613.1"
FT                   /translation="MSWLAIILATAGAFVCTYYYTFTGPIQSIIWLAWLILILFLGYLT
FT                   TTGKRVFVFAQEAKVELLKVVWPTRQETIQTTTIVMVMVGLTGFILWGVDSIMMWAIAK
FT                   LTHLG"
FT   gene            416231..416779
FT                   /gene="nusG"
FT                   /locus_tag="lpa_00523"
FT   CDS_pept        416231..416779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="lpa_00523"
FT                   /product="transcriptional antiterminator NusG"
FT                   /note="COG0250, NusG, Transcription antiterminator
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00523"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23614"
FT                   /protein_id="ADG23614.1"
FT                   /translation="MVEENKAKQWYVVHAYSGYENFVMREITSRAKHHNLEDKIGEVVV
FT                   PSEEVVEMRSGQKRKSTRKFFPGYVLVHMVMDDQTWHMVRGIPRVLGFIGGTSQTPTPI
FT                   SDKEAQAIMQRVEDGVTKPRPKILFEPGEVIRVKEGPFVDFNGVVEEVNYEKNRLRVAV
FT                   LIFGRSTPVELEFSQVEKT"
FT   gene            416889..417323
FT                   /gene="rplK"
FT                   /locus_tag="lpa_00524"
FT   CDS_pept        416889..417323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="lpa_00524"
FT                   /product="large subunit ribosomal protein L11"
FT                   /note="COG0080, RplK, Ribosomal protein L11 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00524"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23615"
FT                   /protein_id="ADG23615.1"
FT                   /translation="MAKKVEAYIKLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNAA
FT                   TQQMEQGLPIPVVITVYSDRSFTFITKTPPASVLLKKAAGIQSGSGTPNTKKVAKLNVS
FT                   QLEEIAKVKKPDLTAADLAAAVRSIAGTARSMGIEVEGLE"
FT   gene            417333..418028
FT                   /gene="rplA"
FT                   /locus_tag="lpa_00525"
FT   CDS_pept        417333..418028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="lpa_00525"
FT                   /product="large subunit ribosomal protein L1"
FT                   /note="COG0081, RplA, Ribosomal protein L1 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23616"
FT                   /protein_id="ADG23616.1"
FT                   /translation="MSKLTKKQKKIAEVIKPNQLYTVADAVAILKQFASKKFRESLDIS
FT                   INLGVDPRKSDQVVRSSTNLPKGTGKTVRVAVFAQGDNAAKATAAGADIVGFEDLADKI
FT                   KAGEMNFDVVIATPDAMRIVGQLGQILGPRGLMPNPKVGTVTTNVEAAVNDAKSGQVRY
FT                   RTDKNGIIHCTVGKADFAPEDVLENVVALINDLKKAKPASSKGQYLKKISLSTTMGPGL
FT                   PIDISSIPV"
FT   gene            418201..418734
FT                   /gene="rplJ"
FT                   /locus_tag="lpa_00527"
FT   CDS_pept        418201..418734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="lpa_00527"
FT                   /product="large subunit ribosomal protein L10"
FT                   /note="COG0244, RplJ, Ribosomal protein L10 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00527"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23617"
FT                   /protein_id="ADG23617.1"
FT                   /translation="MTLNLAAKKAVVEEVTAVASKAISAVVADYRGLTVNQMTQLRSEA
FT                   RKSGVYLRVVRNTLTRRAFKNTEFECLNDLLVGPVFIALSLEAPSDAARLLKDYAKTFE
FT                   KLEIRALSVGGKVYNANQIDAVASLPTRDEAISKLMYVMKAPIEKFVRTLAEPHAKLAR
FT                   TLAAVKDKKAGNPA"
FT   gene            418765..419145
FT                   /gene="rplL"
FT                   /locus_tag="lpa_00528"
FT   CDS_pept        418765..419145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="lpa_00528"
FT                   /product="large subunit ribosomal protein L7/L12"
FT                   /note="COG0222, RplL, Ribosomal protein L7/L12
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00528"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23618"
FT                   /protein_id="ADG23618.1"
FT                   /translation="MAVSKNEILETISNMTVMEVVELIEAMEEKFNVSAAAAAVAVAAP
FT                   AAGAGAAAAEEQTEFTVVMTSFGSNKVNVIKAIRGITGLGLKEAKDLVEGAPSTVKEGV
FT                   SKDEAASIKKELEEAGATVEVK"
FT   gene            419237..423343
FT                   /gene="rpoB"
FT                   /locus_tag="lpa_00529"
FT   CDS_pept        419237..423343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="lpa_00529"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG0085, RpoB, DNA-directed RNA polymerase, beta
FT                   subunit/140 kD subunit [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00529"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23619"
FT                   /protein_id="ADG23619.1"
FT                   /translation="MAVAEAKPQYSHAEKKRFRKSFGKQTDIMPIPNLLEIQLKSYRDF
FT                   LQTDTKLSEQLNTGLHAAFSSVFPIESFSGNARLEYVGYKLGEPAFDVRECKLRGLTYS
FT                   APLRVKIRLVVLDKDASDDPKPIKDIREQDVFMGEIPLMTDVGTFVVNGTERVVVSQLH
FT                   RSPGVIFEHDKGKTHSSGKLLYSARIIPYRGSWLDFEFDPKDCVYVRIDRRRKLPVTIL
FT                   LRALGYEAEDILSEFFETTRCHLKNGEYHIDLIPQRLRGEIASFDIHVPETGELIVEQG
FT                   RRITARHIKQMEKSQMQDLVVPRDYLTGKTLAKNIIDTSTGEFLAQANDEITEELLDAM
FT                   ANHGILQIDMIYTNDLDHGSYISDTLKIDPTGSQLEALVEIYRMMRPGEPPTKEAAEAL
FT                   FKNLFFVEERYDLSAVGRMKFNRRVGIKSDEGPGTLTKEDILSVIKTLIDIRNGIGMVD
FT                   DIDHLGNRRVRSVGEMTENQFRVGLVRVERAVKERLSLVESENLMPQDLINAKPVSAAI
FT                   KEFFGSSQLSQFMDQVNPLSGVTHKRRVSALGPGGLTRERAGFEVRDVHTTHYGRVCPI
FT                   ETPEGPNIGLINSLSVYARTNEYGFIETPCRKVVNGRVTDEVEYLSAIEEVDQYIAQSN
FT                   VELDAQGNILADLVPCRHQNEFSLTTPDKINYMDVSPKQIVSVAASLIPFLEHDDANRA
FT                   LMGSNMQRQAVPTLRSEKPLVGTGMERIVASDSGVSVVAKRGGVIDLVDASRIVVRVND
FT                   DETTAGETGVDIYNLTKYFRSNQDTCINQRPIVSTGDRIQRGDVLADGPCTDMGELALG
FT                   QNLLVAFMPWNGYNFEDSILISERIVHDDRFTTIHIEELTCIARDTKLGTEEITADIPN
FT                   VGESALSNLDESGVVYIGAEVKAGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKD
FT                   SSLRVPSGMNGTVIDVQVFTRDGLEKDARAKSIEEEHLARVRKDLIDERRIREEDIYHR
FT                   VSHLLLDKVATGGPGSLKPGSKITQDYLDKVEREKWFDIRIEDDAVSQQLEQLSKQLEL
FT                   LTKEMEKRFNDSRKKIIQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISIV
FT                   VPVEDMPHMEDGTAVDIVLNPLGVPSRMNIGQVLETHLGLAAKGLGRKIAQMLDERQTP
FT                   EAIKAYLEKIYNHDGVQRVNLKCLNDDELMTLADNLRAGVPMATPVFDGATEQEIKSML
FT                   QLADLPADGKTVLIDGRTGNKFDNPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQP
FT                   LGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVGGRTKIYKNIVDGDHRMDP
FT                   GMPESFNVLLKEIRALGIDIELEHD"
FT   gene            423414..427637
FT                   /gene="rpoC"
FT                   /locus_tag="lpa_00530"
FT   CDS_pept        423414..427637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="lpa_00530"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG0086, RpoC, DNA-directed RNA polymerase, beta'
FT                   subunit/160 kD subunit [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23620"
FT                   /protein_id="ADG23620.1"
FT                   /translation="MKKAPVMSDLLGILKQQGQSEEFDAIKIALASPELIRSWSYGEVK
FT                   KPETINYRTFKPERDGLFCAKTFGPVKDYECLCGKYKRLKHRGVICEKCGVELALAKVR
FT                   RERMGHIELASPVAHIWFLKSLPSRIGLLLDMTLRDIERVLYFEAFVVVDPGMTELERG
FT                   QLLNDEAYLDAMEQYGDEFDARMGAEAIRDLLRQIDLEDEIRNLREELPTTNSETKIKK
FT                   ITKRLKLLEAFYESGNKPEWMIMDVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINR
FT                   NNRLKRLLDLNAPDIIVRNEKRMLQESVDALLDNGRRGRAITGTNKRPLKSLADMIKGK
FT                   QGRFRQNLLGKRVDYSGRSVIVVGPTLKLHQCGLPKKMALELFKPFIFSKLEFRGLATT
FT                   IKAAKKMVEREESVVWDILDDVIREHPILLNRAPTLHRLGIQAFEPVLIEGKAIQLHPL
FT                   VCTAYNADFDGDQMAVHVPLTLEAQLEARSLMMSTNNILSPASGEPIIVPSQDVVLGLY
FT                   YLTREKVNALGEGKIYSSAQEAQNFYEAGHLDIHAKIKIRMPKEDGETGYHLVETTVGR
FT                   AILAEILPKGMPFDYINRTMTKKVISKVIDSCYRKFGLKETVIFADQLMYTGFKYATRS
FT                   GASIGIEDMEIPDDKASIIEHADNEVREIESQFRSGLVTNGERYNKVIDIWSRTNELVA
FT                   KSMMSKIATEEVTDAKGNKVRQESFNPIFMMADSGARGSAAQIRQLAGMRGLMAAPDGS
FT                   IIETPITANFREGLNVFQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDVVITED
FT                   DCGTDTGILMQPLIEGGDIVEPLHERVLGRVVASDVYIPTQTEPVVKAGTLLDEEWVEK
FT                   LEKHGVDQVMVRSPITCQTRFGLCAKCYGRDLARGHLVNTGEAVGIIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRATAANNIQIKTKGVIRLHNIKTVTHENKNLVAVSRSGEVTIVDEFG
FT                   RERERYKVPYGAVISAQDNSPVEAGQVIATWDPHTHPVISEVSGRLKFVDLIDGITMNR
FT                   QTDELTGLSNIVIIDAKQRSAAGRDLRPMVKLVTDEGDDIYLAGTNVPAQYYLPVDAIV
FT                   NFEDGSLVGIGDVIARIPQERSKTRDITGGLPRVADLFEARKPKDSAVMAEVSGLVNFG
FT                   KETKGKRRLIINVSEDQCHEELIPKWRHISVFEGEHVERGEIIAEGALNPHDILRLLGV
FT                   GALANYIVNEVQDVYRLQGVKINDKHIEVIVRQMLRKRVITFAGDSKFLVGEQVEESAM
FT                   LQENDKLLAEGKQIARGTPILLGITKASLATESFISAASFQETTRVLTEAAVSGKVDEL
FT                   RGLKENVMVGRLIPAGTGYTYHQSRKAKRARAAAGGDSSATHTVTASDVEHALSEALNA
FT                   DNHEH"
FT   gene            427913..428131
FT                   /gene="rpsL"
FT                   /locus_tag="lpa_00531"
FT   CDS_pept        427913..428131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="lpa_00531"
FT                   /product="small subunit ribosomal protein S12"
FT                   /note="COG0048, RpsL, Ribosomal protein S12 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00531"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23621"
FT                   /protein_id="ADG23621.1"
FT                   /translation="MRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVR
FT                   GSLDTSGVNDRKQGRSKYGTKKPKDKK"
FT   gene            428152..428679
FT                   /locus_tag="lpa_00532"
FT   CDS_pept        428152..428679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00532"
FT                   /product="small subunit ribosomal protein S7"
FT                   /note="COG0049, RpsG, Ribosomal protein S7 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00532"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23622"
FT                   /protein_id="ADG23622.1"
FT                   /translation="MPRRREVPKREILPDPKHHSELLAKFINVLMVSGKKSIAEKITYG
FT                   ALSVMEERVKKIKKNEEDGSETGSSGSAGAVLRYFEEALDNVRPSVEVRSRRVGGATYQ
FT                   VPVEVRHDRSIALGMRWIVQAARTRGEKGMMLRLAGELMDAYENKGSAVKKREDTHKMA
FT                   KANQAFAHFRWN"
FT   gene            428694..430778
FT                   /gene="fusA"
FT                   /locus_tag="lpa_00534"
FT   CDS_pept        428694..430778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="lpa_00534"
FT                   /product="Translation elongation and release factor
FT                   (GTPase)"
FT                   /note="COG0480, FusA, Translation elongation factors
FT                   (GTPases) [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00534"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23623"
FT                   /protein_id="ADG23623.1"
FT                   /translation="MATPLKLYRNIGIAAHVDAGKTTTTERVLYYTGMSHKIGEVHDGA
FT                   ATMDWMVQEQERGITITSAATTCYWSGMDKQFESHRINIIDTPGHVDFMIEVERSLRVL
FT                   DGAVVVFDSVAGVEPQSETVWRQANKYGVPRIVFVNKMDRMGANFLRVVSQIKQRLGST
FT                   PVVLQLPIGAEEEFKGVIDLIKMKAIHWDEENKGMTFKYVDIPADLKATCEEYRAHIIE
FT                   AAAEYSEELMEKYLEGEEFTEAEIKKALRHLTITNKVVPVFCGSAFKNKGVQAVLDGVI
FT                   EYLPSPTDIPDIQGVDEHGDEIHRKTSYDEPFSALAFKIATDPFVGTLTYFRAYSGILK
FT                   SGDTVYNSVKGKKERIGRLLQMHANSREEIKEVRAGDIAAAVGLKTVTTGDTLCDQDKV
FT                   VILERMDFPDPVIAVAVEPKTKADQEKMGIALGKLAQEDPSFRVHTDEESGQTIIQGMG
FT                   ELHLEIIVDRMKREFNVEANVGKPQVAYRETLKQAVEQEGKFVRQSGGRGQYGHVWLKI
FT                   EPQEPGKGYEFINAIVGGVIPKEYIPAVDKGIQEQMQNGVIAGYPVVDVKVTLFDGSFH
FT                   EVDSSEMAFKIAGSQCFKQGALKAKPVLLEPIMSVEVVTPEDYMGDVMGDLNRRRGLVQ
FT                   GMEDSPAGKIVRAEVPLAEMFGYSTDLRSATQGRATYTMEFCKYAEAPTNIAEAIIKKQ
FT                   "
FT   gene            430880..431989
FT                   /gene="tufB"
FT                   /locus_tag="lpa_00536"
FT   CDS_pept        430880..431989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufB"
FT                   /locus_tag="lpa_00536"
FT                   /product="GTPase-translation elongation factor"
FT                   /note="COG0050, TufB, GTPases - translation elongation
FT                   factors [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00536"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23624"
FT                   /protein_id="ADG23624.1"
FT                   /translation="MTAAITTIMAKKYGGTAKAYDQIDAAPEERERGITISTAHVEYES
FT                   ASRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLSRQVGVPYI
FT                   VVFMNKADMVDDPELLELVEMEVRDLLSSYDFPGDDIPIVVGSALKALEGEDSDIGVKA
FT                   IEKLVETMDSYIPEPVRNIDKPFLLPIEDVFSISGRGTVVTGRVESGIVKVGEEVEIVG
FT                   IRDTQKTTCTGVEMFRKLLDEGRAGDNVGVLLRGTKRDEVERGQVLAKPGTIKPHTKFE
FT                   AEVYVLSKEEGGRHTPFFNGYRPQFYFRTTDVTGTCDLPSGVEMVMPGDNVQLVVSLHA
FT                   PIAMDEGLRFAIREGGRTVGAGVVAKIIE"
FT   gene            431995..432312
FT                   /gene="rpsJ"
FT                   /locus_tag="lpa_00538"
FT   CDS_pept        431995..432312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="lpa_00538"
FT                   /product="small subunit ribosomal protein S10"
FT                   /note="COG0051, RpsJ, Ribosomal protein S10 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00538"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23625"
FT                   /protein_id="ADG23625.1"
FT                   /translation="MSSNQNIKIRLKSFDHRLIDLSTREIVDTAKRTGAQIRGPIPLPI
FT                   RKEKFTVLTSPHVNKDARDQYELRTHKRLVVIVHPTEKTVDALMKLDLAAGVDVQISLD
FT                   D"
FT   gene            432350..432997
FT                   /gene="rplC"
FT                   /locus_tag="lpa_00539"
FT   CDS_pept        432350..432997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="lpa_00539"
FT                   /product="large subunit ribosomal protein L3"
FT                   /note="COG0087, RplC, Ribosomal protein L3 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00539"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23626"
FT                   /protein_id="ADG23626.1"
FT                   /translation="MIGLLGRKIGMTRVFTPEGVSVPVSVVEVQPNRVSQVKTAANDGY
FT                   SAVQLTGGTKKSSKVSKPVAGHFAKAQIDAGDMQVEFRIDSEDAFTPGQVISVADVFTA
FT                   GQYVDVSGLTKGKGFAGTVKRHNFRTQDASHGNSRSHRVPGSIGQNQTPGRVFKGKKMA
FT                   GHMGNARCTIQSLELVKVDSERNLLLIKGAIPGAPGSRVEIKPAVKKQARGE"
FT   gene            432997..433602
FT                   /gene="rplD"
FT                   /locus_tag="lpa_00540"
FT   CDS_pept        432997..433602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="lpa_00540"
FT                   /product="large subunit ribosomal protein L4"
FT                   /note="COG0088, RplD, Ribosomal protein L4 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23627"
FT                   /protein_id="ADG23627.1"
FT                   /translation="MEITTIDTKSKLKLNKEIFAYTYNEGLVHQAVVAFMNNARSGNSA
FT                   QKTRSEVSGGGKKPWNQKGTGRARAGTIRSPLWRSGGVTFASKKRDYSQKLNKKMYKRA
FT                   LRSIISELCRTGNLVVVSDFQCDNHKTKDFLKKMNQMEISNALIIMSEVGENEYLGSRN
FT                   LIDYDICDVTTIDPVSLLRFEKVVVTEAAIKKIEEQLQ"
FT   gene            433599..433895
FT                   /gene="rplW"
FT                   /locus_tag="lpa_00542"
FT   CDS_pept        433599..433895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="lpa_00542"
FT                   /product="large subunit ribosomal protein L23"
FT                   /note="COG0089, RplW, Ribosomal protein L23 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00542"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23628"
FT                   /protein_id="ADG23628.1"
FT                   /translation="MNAERLMMVLREPHTSEKATVMADKFKQFTFKVLKNATKTEIKLA
FT                   VEHIFNVKVKSVSVVNVKGKSKRFKQTSGKRSDWKKAFVSLHADQDIDFTVTE"
FT   gene            433907..434734
FT                   /gene="rplB"
FT                   /locus_tag="lpa_00543"
FT   CDS_pept        433907..434734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="lpa_00543"
FT                   /product="large subunit ribosomal protein L2"
FT                   /note="COG0090, RplB, Ribosomal protein L2 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00543"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23629"
FT                   /protein_id="ADG23629.1"
FT                   /translation="MALLKSKPTSPGKRGEIRVVHHDIYKGKPHAALVEKLKKTGGRNN
FT                   QGRITVRHIGGGQRQKYRIIDFKRNKDGILGRVERLEYDPNRTALIALISYKDGEKRYI
FT                   IAPSNLEVGATIQSGADSPISVGNCLPLKNIPVGTTIHCVEMKPGKGAQMLRSAGCSGQ
FT                   LVAKEGVYATLRLRSGEMRKIHVLCRAVIGEVSNSEHNLRALGKAGAKRWRGIRPTVRG
FT                   VAMNPVDHPHGGGEGRTSGGRHPVSPWGLPTKGYKTRSNKRTDTFIVRGRKKK"
FT   gene            434753..435031
FT                   /gene="rpsS"
FT                   /locus_tag="lpa_00544"
FT   CDS_pept        434753..435031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="lpa_00544"
FT                   /product="small subunit ribosomal protein S19"
FT                   /note="COG0185, RpsS, Ribosomal protein S19 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00544"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23630"
FT                   /protein_id="ADG23630.1"
FT                   /translation="MARSIRKGPFIDHHLISKVEAAIESKSKKPIKTWSRRSTIVPEMI
FT                   DLTIAVHNGKDHVPVFITDNMVGHKLGEFAMTRTFKGHSGDRKAKGK"
FT   gene            435041..435376
FT                   /gene="rplV"
FT                   /locus_tag="lpa_00545"
FT   CDS_pept        435041..435376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="lpa_00545"
FT                   /product="large subunit ribosomal protein L22"
FT                   /note="COG0091, RplV, Ribosomal protein L22 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23631"
FT                   /protein_id="ADG23631.1"
FT                   /translation="MEVTAKLKGAPLSAQKGRLVADMIRNMNVSGALDVLKFTPKKGAK
FT                   LMLKLLESAIANAENNNGADIDDLKVGMVCVDEATTLKRISPRAKGRANRICKRTCHIT
FT                   IKVSDEE"
FT   gene            435379..436035
FT                   /gene="rpsC"
FT                   /locus_tag="lpa_00546"
FT   CDS_pept        435379..436035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="lpa_00546"
FT                   /product="small subunit ribosomal protein S3"
FT                   /note="COG0092, RpsC, Ribosomal protein S3 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00546"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23632"
FT                   /protein_id="ADG23632.1"
FT                   /translation="MGQKVNPIGIRLGIIKDWNSKWFAGKRYAEFLIQDIKLRNDLKKK
FT                   LMAAAVSKILIERPANNAVVTILTARPGVIIGKKGGGIETLRKEISDNLGVPVHLNIEE
FT                   VKKPELDATLVAEGIAQQLEQRVMFRRAMKRAVTSALKAGAKGIKICVSGRLGGAEIAR
FT                   SEWYREGRVPLHTFRADIDYGTAESKTTYGIIGVKVWIFKGEILPQKKRSTESAQ"
FT   gene            436052..436465
FT                   /gene="rplP"
FT                   /locus_tag="lpa_00547"
FT   CDS_pept        436052..436465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="lpa_00547"
FT                   /product="large subunit ribosomal protein L16"
FT                   /note="COG0197, RplP, Ribosomal protein L16/L10E
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00547"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23633"
FT                   /protein_id="ADG23633.1"
FT                   /translation="MLQPKRTKYRKQMKGRNRGLALRGSKISFGEFGLKAVERGRLTAR
FT                   QIEAARRAMTRHIKRGGKIWIRVFPDKPITQKPLEVRQGKGKGSVEYWVAQIQPGKVLF
FT                   EMEGVSKELAMEAFDLAKAKLPFKVMFEERTVM"
FT   gene            436465..436659
FT                   /gene="rpmC"
FT                   /locus_tag="lpa_00548"
FT   CDS_pept        436465..436659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="lpa_00548"
FT                   /product="large subunit ribosomal protein L29"
FT                   /note="COG0255, RpmC, Ribosomal protein L29 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00548"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23634"
FT                   /protein_id="ADG23634.1"
FT                   /translation="MKKIDELRNMSVEELQNELLSLRKDQFNLRMKKASGSLDKTHLIT
FT                   MVRKSVAKVKTILTEKAGK"
FT   gene            436661..436915
FT                   /gene="rpsQ"
FT                   /locus_tag="lpa_00549"
FT   CDS_pept        436661..436915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="lpa_00549"
FT                   /product="small subunit ribosomal protein S17"
FT                   /note="COG0186, RpsQ, Ribosomal protein S17 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00549"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23635"
FT                   /protein_id="ADG23635.1"
FT                   /translation="MSTNSESNARTMIGKVVSDKMDKTIVVMIERTVKHPKYGKIMKRR
FT                   TKLHAHDENQVCRVGNTVKIRESRPLSKTKSWVLVEVIS"
FT   gene            437004..437369
FT                   /gene="rplN"
FT                   /locus_tag="lpa_00550"
FT   CDS_pept        437004..437369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="lpa_00550"
FT                   /product="large subunit ribosomal protein L14"
FT                   /note="COG0093, RplN, Ribosomal protein L14 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23636"
FT                   /protein_id="ADG23636.1"
FT                   /translation="MIQMQTVLEVADNSGARKVMCIKVLGGSHRRYARVGDVIKVSVKD
FT                   AIPRSKVKKGAVMRAVVVRTAQGVRRDDGSLIRFDDNAAVLLNNQNEPIGTRIFGPVTR
FT                   ELRERFMKIISLAAEVL"
FT   gene            437382..437711
FT                   /gene="rplX"
FT                   /locus_tag="lpa_00551"
FT   CDS_pept        437382..437711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="lpa_00551"
FT                   /product="large subunit ribosomal protein L24"
FT                   /note="COG0198, RplX, Ribosomal protein L24 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00551"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23637"
FT                   /protein_id="ADG23637.1"
FT                   /translation="MKRIKSGDEVIVIAGKSKGHIGKVLRVIDDAVVVEGGNLIKKHIK
FT                   PNPQKPENKGGIITREAPLHVSNVAHYNPVTKKADKVGFKYLESNGVSKKVRYYKSNNE
FT                   IIDRI"
FT   gene            437727..438278
FT                   /gene="rplE"
FT                   /locus_tag="lpa_00552"
FT   CDS_pept        437727..438278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="lpa_00552"
FT                   /product="large subunit ribosomal protein L5"
FT                   /note="COG0094, RplE, Ribosomal protein L5 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00552"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23638"
FT                   /protein_id="ADG23638.1"
FT                   /translation="MARLKEFYKKDVVTMMMKRFNYSSVMEVPRILKITLNMGVGEAVG
FT                   DKKVMNHAIEDMTLISGQKPVVTKARKSIAGFKIREGWPIGCKVTLRRERMYEFLDRLI
FT                   SITLPRVRDFRGLNPKSFDGTGNYSMGIHEQIVFPEIDYDKTDGIRGLDICITTSAKTN
FT                   EEAKALLEAFNLPLKDKDRK"
FT   gene            438291..438593
FT                   /gene="rpsN"
FT                   /locus_tag="lpa_00553"
FT   CDS_pept        438291..438593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="lpa_00553"
FT                   /product="small subunit ribosomal protein S14"
FT                   /note="COG0199, RpsN, Ribosomal protein S14 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00553"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23639"
FT                   /protein_id="ADG23639.1"
FT                   /translation="MAKKSMLMRESKRAKLVEKYRQRRNELKQLIKSSDDFQVIMESQA
FT                   KLAKLPVNSNPVRYVTRCKQCGRPHAVYRKFNLCRICLRQQLMVGNIPGGRKSSW"
FT   gene            438622..439011
FT                   /gene="rpsH"
FT                   /locus_tag="lpa_00554"
FT   CDS_pept        438622..439011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="lpa_00554"
FT                   /product="30S ribosomal protein S8"
FT                   /note="COG0096, RpsH, Ribosomal protein S8 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00554"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23640"
FT                   /protein_id="ADG23640.1"
FT                   /translation="MHDPIADMLTRIRNGQQAKHQQVTLVSSKLKEEIARVLKEEGYIQ
FT                   DFFIETLPNGLKSITLKLKYYHGRPVIEFIKRISRPGLRVYKSYKDLHSIPGFGVAILS
FT                   TSKGIMTHVSAKVKGVGGEVICEVA"
FT   gene            439029..439568
FT                   /gene="rplF"
FT                   /locus_tag="lpa_00555"
FT   CDS_pept        439029..439568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="lpa_00555"
FT                   /product="large subunit ribosomal protein L6"
FT                   /note="COG0097, RplF, Ribosomal protein L6P/L9E
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23641"
FT                   /protein_id="ADG23641.1"
FT                   /translation="MSRVAKAPVIHSANVEVTFVDGVITVKGPKGILTQKINKLVNIQH
FT                   SKESNKLEFSPASNDPMGWAQAGTARALVRNMVQGVTEGYTVTLELVGVGYRAQSKDKS
FT                   ISLSLGYSHSIEYDLPKGVTVETPNNTTILLKGVDKQVLGQIASEIRAFRPPEPYKGKG
FT                   VKYAGEQIVRKEAKKK"
FT   gene            439579..439938
FT                   /gene="rplR"
FT                   /locus_tag="lpa_00556"
FT   CDS_pept        439579..439938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="lpa_00556"
FT                   /product="large subunit ribosomal protein L18"
FT                   /note="COG0256, RplR, Ribosomal protein L18 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00556"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23642"
FT                   /protein_id="ADG23642.1"
FT                   /translation="MNKQNARHRRGLKAKALIRKTGRSRLVVYRSGVHIYSQIVKSDQL
FT                   GDKVLVASSTIDKELRSSLTGKSKVEQASLVGQLLGKRAKAAGITQVAFDRAGYKYHGR
FT                   VKALAEGAREAGLDF"
FT   gene            439948..440454
FT                   /gene="rpsE"
FT                   /locus_tag="lpa_00557"
FT   CDS_pept        439948..440454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="lpa_00557"
FT                   /product="small subunit ribosomal protein S5"
FT                   /note="COG0098, RpsE, Ribosomal protein S5 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00557"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23643"
FT                   /protein_id="ADG23643.1"
FT                   /translation="MSFDELPKSDGYQEKLVSVTRTAKVVKGGRVFGFAVLVVVGDGKG
FT                   KVGFGRGKAREVPIAIQKAMDQAKKNMVYIPLSGTTIFHEITWNYGASKVFMKPASEGT
FT                   GIIAGGAMRAVLEVLGVQNILAKSIGSTNPSNIVRATIGALTHIGTPDYVAAKRGKTVE
FT                   EVMAG"
FT   gene            440457..440642
FT                   /gene="rpmD"
FT                   /locus_tag="lpa_00558"
FT   CDS_pept        440457..440642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="lpa_00558"
FT                   /product="large subunit ribosomal protein L30"
FT                   /note="COG1841, RpmD, Ribosomal protein L30/L7E
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00558"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23644"
FT                   /protein_id="ADG23644.1"
FT                   /translation="MGKKIKITLVKSTIGRKPKHVAIAKQLGLGKTNSSVVHSDTPAIR
FT                   GLVNEINYLLLVEESA"
FT   gene            440642..441076
FT                   /locus_tag="lpa_00560"
FT   CDS_pept        440642..441076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00560"
FT                   /product="large subunit ribosomal protein L15"
FT                   /note="COG0200, RplO, Ribosomal protein L15 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23645"
FT                   /protein_id="ADG23645.1"
FT                   /translation="MNLNTLSPDPGSRPSRRRVGRGIGSGLGKTCGKGHKGQKSRAGGY
FT                   HKINFEGGQMPIQRRLPKMGFKSRVGRTIDEVSLGELAKLNDEVIDLVALRKAGLINNS
FT                   IKDVKVILSGELTAAIKLKGLRVTKGARSAIESLGGSIEE"
FT   gene            441079..442407
FT                   /gene="secY"
FT                   /locus_tag="lpa_00561"
FT   CDS_pept        441079..442407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="lpa_00561"
FT                   /product="preprotein translocase SecY subunit"
FT                   /note="COG0201, SecY, Preprotein translocase subunit SecY
FT                   [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00561"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23646"
FT                   /protein_id="ADG23646.1"
FT                   /translation="MKNQKHNGSKPRGGLAELKSRLLFVVLGILVYRLGAHIPVPGLDP
FT                   AKLANFFSEQQNTIFGLFNMFSGGALSRVTVFAIGIMPYISASIIIQLFSVVSPKLEQL
FT                   KKEGESGRRKINQYTRYLTLLLSIFQSMGMARWLASQQIAMQPDFSFYFTAVVTLVTGT
FT                   MFLMWLGEQITEKGVGNGISLIIFSGIVSSMPNAIGSVLQQVKEGQMQALTLVIIAAVV
FT                   IVVTGFVVFMERAQRRIRVNYAQRTQGRKVYAAQTSHLPLKINMSGVIPPIFASSIILL
FT                   PATLAQFFSQTKGLGWLSDVGMALSPGQPLYLIVYAAAILFFAFFYAALVFNPKDTADN
FT                   LKKSGAYIPGIRPGEQTTKYIDSVMTRLTLVGAIYLVLVCLLPQILMYTWHVPFYFGGT
FT                   SLLIIVVVIMDFVAQVQAHLMTQQYDSLLKKANFRGTKLPGLL"
FT   gene            442615..442971
FT                   /gene="rpsM"
FT                   /locus_tag="lpa_00562"
FT   CDS_pept        442615..442971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="lpa_00562"
FT                   /product="small subunit ribosomal protein S13"
FT                   /note="COG0099, RpsM, Ribosomal protein S13 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00562"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23647"
FT                   /protein_id="ADG23647.1"
FT                   /translation="MARIAGVNIPDHKHVVIALTAIYGIGKTTSLKLCKTVDIDPSVKV
FT                   SQLSDAQLESLRTEIAKITVEGDLRRVVTMNIKRLMDLGCYRGLRHRRGLPLRGQRTKT
FT                   NARTRKGRRKGTSS"
FT   gene            443049..443393
FT                   /gene="rpsK"
FT                   /locus_tag="lpa_00564"
FT   CDS_pept        443049..443393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="lpa_00564"
FT                   /product="small subunit ribosomal protein S11"
FT                   /note="COG0100, RpsK, Ribosomal protein S11 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00564"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23648"
FT                   /protein_id="ADG23648.1"
FT                   /translation="MSDGIVHIHASFNNTIVTFTDRQGNALCWATSGGSGFRGSRKSTP
FT                   YAAQVATERAAAVAKEYGMKSVAVFVHGPGPGRESTIRELITQDFKIVEITDVTGIPHN
FT                   GCKPPKKRRV"
FT   gene            443410..444030
FT                   /gene="rpsD"
FT                   /locus_tag="lpa_00565"
FT   CDS_pept        443410..444030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="lpa_00565"
FT                   /product="small subunit ribosomal protein S4"
FT                   /note="COG0522, RpsD, Ribosomal protein S4 and related
FT                   proteins [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00565"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23649"
FT                   /protein_id="ADG23649.1"
FT                   /translation="MARYLGPKCKLSRREGCDLLLKSGVRDHKSKCKSEKLPGQHGDKK
FT                   PRLNSYGIQLREKQKIRRLYGILEKQFRNYYKKAARQKGSTGENLMALLERRLDNVVYR
FT                   MGFASTRAEARQLVAHKAILVNDKVVNVPSFLVNPGDTVSVRQKAKNQGRIQAALALSE
FT                   QRAPCDWITVDTGSFKGTFSTAPTLMDLSSDYNVNLVVELYSK"
FT   gene            444049..445041
FT                   /gene="rpoA"
FT                   /locus_tag="lpa_00566"
FT   CDS_pept        444049..445041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="lpa_00566"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG0202, RpoA, DNA-directed RNA polymerase, alpha
FT                   subunit/40 kD subunit [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00566"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23650"
FT                   /protein_id="ADG23650.1"
FT                   /translation="MYTEINEMLTPKVLKVQAESPYKARIVLEPLERGFGHTLGNALRR
FT                   ILLSSMPGSAITEASIDGVLHEYSTIEGVQEDVVDLLLNLKSVAIKLTVGNEAQVTLNK
FT                   EGPCQVTAGDIQLTHGQEIINPELVIANLNEKGKLNMTLKVERGIGFHNTDAFVRYHED
FT                   EIEKKTVGKLKIDNSFSPVKKVAYFVDSARVENRTDLDKLTIELETNGTIDAEEAIRIS
FT                   ASILQRQLHAFVDMKFEESRADNKERNDFDPVLLRSVDDLELTVRSANCLKAENIHYIG
FT                   DLVQRTESELLKTPNLGKKSLTEIKDVLASRSLSLGMKLENWPPASLGE"
FT   gene            445129..445443
FT                   /gene="rplQ"
FT                   /locus_tag="lpa_00567"
FT   CDS_pept        445129..445443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="lpa_00567"
FT                   /product="large subunit ribosomal protein L17"
FT                   /note="COG0203, RplQ, Ribosomal protein L17 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00567"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23651"
FT                   /protein_id="ADG23651.1"
FT                   /translation="MCCSLIEHELIRTTLPKAKDLRRYIEPLITVSKSDSVASRRRAFD
FT                   ILRSKSAVGKLFTDLGPRFAKRPGGYIRIIKCGYRDGDNAPMAIVELMDRPVSSDDTEE
FT                   "
FT   gene            complement(445517..445996)
FT                   /gene="ssb"
FT                   /locus_tag="lpa_00569"
FT   CDS_pept        complement(445517..445996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="lpa_00569"
FT                   /product="single-strand DNA-binding protein"
FT                   /note="COG0629, Ssb, Single-stranded DNA-binding protein
FT                   [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00569"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23652"
FT                   /protein_id="ADG23652.1"
FT                   /translation="MARGINKVILVGNVGADPDVRYLPNGNAVTTLSVATSETWKDKTT
FT                   GEKQDRTEWHRVVCFNRLGEIAGEYIRKGSKLYVEGSLRTRKWQDQQGQDRYTTEIVAS
FT                   DIQMLDSKGSGATNYDDMPSFQGTSTPQQASTKNQATPTSTAQDAFDELDDDIPF"
FT   gene            complement(446080..447447)
FT                   /locus_tag="lpa_00571"
FT   CDS_pept        complement(446080..447447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00571"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00571"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23653"
FT                   /protein_id="ADG23653.1"
FT                   /translation="MKYSWNKTVFPIAAIFSFRLLGLFLLIPVFTLYATNLKGATPTLI
FT                   GLALGSYGLAQGLLQIPFGMLSDKLGRKPMIAIGLLLFAGGSLLGAVTHSIAGMITARI
FT                   LQGAGAIGSVLIALLADLTLDEQRTKAMAIVGITIGTSFSLAMIISPALTHYYGLSGVF
FT                   YLTAALAVLGIMILYLIIPNPSKEQFHADSEPSLSLIKPVVTDQHLQRLNFGIFCQHFI
FT                   LTATFFAIPMLLKYQIETGHLHQQWHFYLPLMLFSFILMVPFIIISERKKRLKTVFVIS
FT                   VLLTTFTQGLLVFTSQNWYWFCILMFVYFVSFNVLEATLPSLVSKLASPGSKGTAMGIY
FT                   STSQFLGIFFGGSLAGILYQWYDNQAIFLINMILSCLWLIISLSMKSNVYFSTLILPFT
FT                   ANNEESKLVVNQLLKVTGIKEVILSKDENTLYVRVDNEEYSTGSAEKILHQSTIYQ"
FT   gene            447609..448367
FT                   /locus_tag="lpa_00572"
FT   CDS_pept        447609..448367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00572"
FT                   /product="glucose-1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00572"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23654"
FT                   /protein_id="ADG23654.1"
FT                   /translation="MSSLVFSGKVGLITGGARGIGKATALKLAHSGCDIAIVYYNSSDE
FT                   AQSLVNEITSMGRKAIALQADVADCQSVKEMFSQFREHFKHLNFLVSNAASGVLKPALK
FT                   MSTKHWRWCLETNALALNHLVTEGLDLMPKNSRVIALSSLGASRAIPNYAFIGASKAAL
FT                   EALVRSLSLELASYGITVNTVSAGVVDTDALKHFPNREQLLDEYQAHALADRALTPEDV
FT                   ANAIYLLCLPEAAMINAHTLYVDAGYSQVG"
FT   gene            448438..448851
FT                   /locus_tag="lpa_00573"
FT   CDS_pept        448438..448851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00573"
FT                   /product="Acyl carrier protein"
FT                   /note="COG0236, AcpP, Acyl carrier protein [Lipid
FT                   metabolism / Secondary metabolites biosynthesis, transport,
FT                   and catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00573"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23655"
FT                   /protein_id="ADG23655.1"
FT                   /translation="MNVAEVYPKVREIIADVLVIDEEEISLNSSLIEDLGAESIDFLDL
FT                   VFQLEKEFKIKIPRGQLEKNARGDLAEDEFEKGGILTTSGLQALKNYLSEVPADRFKEN
FT                   MKVNEIPVLFTVETFCKLVISAIAQQQATETVA"
FT   gene            448851..449747
FT                   /gene="fabA"
FT                   /locus_tag="lpa_00574"
FT   CDS_pept        448851..449747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabA"
FT                   /locus_tag="lpa_00574"
FT                   /product="3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="COG0764, FabA,
FT                   3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
FT                   dehydratases [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00574"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23656"
FT                   /protein_id="ADG23656.1"
FT                   /translation="MRFLFVDRIVQLSPGEWIKGIKHVTRDDAYLTTDDQGRLCFMPSL
FT                   IGETLGQLAAWNVMQHNHFTSRPVAGVVSSARLYRPAYVGETILLESNIDSLDEKAVQY
FT                   HSIAKVGNDIIFTIDGALGPMLPMTEFISTEVIRQQFAEIYRPGEWSSVLALSSPVLIE
FT                   ENCSDCGMINSSMQFDRVLASEPGISLIAEKRITRSASYFPDHFPNRPVLPMTVLLECK
FT                   LNLAKEFIARAKYDRAYRISELRKIKMNEFVHPGDVVVCQVKVKQQMDDELILSYRCEV
FT                   DGKRVCVVDIVLIPKGK"
FT   gene            449752..451044
FT                   /gene="fabFc"
FT                   /locus_tag="lpa_00575"
FT   CDS_pept        449752..451044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabFc"
FT                   /locus_tag="lpa_00575"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase"
FT                   /EC_number="2.3.1.41"
FT                   /note="3-oxoacyl-(acyl-carrier-protein) synthase [Lipid
FT                   metabolism / Secondary metabolites biosynthesis, transport,
FT                   and catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23657"
FT                   /protein_id="ADG23657.1"
FT                   /translation="MKRRVAITGLGVVSPLGNDVSTTWNNLIAGYSGIDSIKQFDASAF
FT                   PTTIAAEVKNFSPDTSISGKHTRFIMSFTHFALEAARQAFEDASIFPTKQTSDRWGIVT
FT                   GSGMMTAEFEYLTRFQQTCAADGEIDWGKLQSNSRDFYNLVDFGKTTSNSGLSLLIQQY
FT                   GITGYASSVHTACASGGQALGLAMQVIRRGEADFMLAGGFDSMINPLGLSSFCLLGALS
FT                   TYNETPQTASRPFDATRNGFVLGEGAAFLILEEWSKAKARGAKIYAELAGEGNSLSSYR
FT                   ITDSHPNGDGAIQAIKRALEDAGVQPRDVDYINAHGTSTKMNDLSETNAIKVVFGDRIA
FT                   NLPVSSTKSQTGHLIAAAGALEAVLSVKSIEQAQVPKTANLKTPDPECDLDYVVDGPRE
FT                   KSLGVVLSNSFGFGGSNSCLLFKHPEFEEAK"
FT   gene            451045..452322
FT                   /gene="fabFn"
FT                   /locus_tag="lpa_00576"
FT   CDS_pept        451045..452322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabFn"
FT                   /locus_tag="lpa_00576"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase II,
FT                   N-terminal"
FT                   /EC_number="2.3.1.41"
FT                   /note="3-oxoacyl-(acyl-carrier-protein) synthase [Lipid
FT                   metabolism / Secondary metabolites biosynthesis, transport,
FT                   and catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00576"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23658"
FT                   /protein_id="ADG23658.1"
FT                   /translation="MSQANRVFITGRSALTASGATADETWNAIISGQCGIDEINFWELS
FT                   EWSHRLGGEIKDFQPSKMLPDRKLIKVISRQDIMGINAAVQAVEHSKMIAYRDSLADAD
FT                   LFNEQTAIYVGSPGNKYFQQYDFIPLLAKTHGDMRSFANQLFDEVHPMWLLRILPNNVL
FT                   AYTGITYGFKGPNHNVTNHAVGGTQAILEAYHAIRSGQAERAVVVAYDIGTEPQGLFYY
FT                   EKLGVVSNRHLKPFDKEHDGTILAEGAAALVLESEASVKSRAATCYGEIVGGLSASEAT
FT                   GLFSIEADGQHLASLMRQTLSTSGISSEEIGLIVTHGNGNSKSDDSEALAIKSVFKQEE
FT                   VPATAFKWSMGHTLCASGVLDAVLTTYALETKCVPGIANFQQIAPTCEGLSVSREHRET
FT                   ISNSYAMMINRGFASMNVCLVIKACE"
FT   gene            452315..453160
FT                   /gene="htrB"
FT                   /locus_tag="lpa_00577"
FT   CDS_pept        452315..453160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrB"
FT                   /locus_tag="lpa_00577"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="COG1560, HtrB, Lauroyl/myristoyl acyltransferase
FT                   [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00577"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23659"
FT                   /protein_id="ADG23659.1"
FT                   /translation="MNNLAQQIEALPITLAGRFIYRFLPYRRRLIFSNISQVYNDQLNE
FT                   SQKKRLAKAYYSHLAKSLKEALQLRFMSEKKLRAQVEVIGHEKMLAVVAQKKGVLVVTG
FT                   HFGNWEFAPLGGVLNFKEFKGQFHFIRRTLRFKFIERIMFKNYYQAGLNVIPKKNSLEQ
FT                   VCVALEQNHAVIFVLDQHASLVNRDGIAVEFFGKKAGTYRSLATISRHTGIPVIPAASY
FT                   RLPNGKHVLEFHDPIPWKDYDTTQESLYRNTLAYNQALEKIILAHPEQWNWMHKRWKLS
FT                   "
FT   gene            complement(453269..453574)
FT                   /locus_tag="lpa_00578"
FT   CDS_pept        complement(453269..453574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00578"
FT                   /product="putative conserved protein"
FT                   /note="COG4021, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00578"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23660"
FT                   /protein_id="ADG23660.1"
FT                   /translation="MDERRKYFRLKNHGEINASLDNNPIEIVEISSNGAVVVKQKTDIP
FT                   KEGVLKLQIHNFIMELCYEVIRAEDNNIVLHFTKEDETNKLFLVLKRLRDERKNKT"
FT   gene            complement(453760..456450)
FT                   /locus_tag="lpa_00580"
FT   CDS_pept        complement(453760..456450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23661"
FT                   /protein_id="ADG23661.1"
FT                   /translation="MVDFDKPVSKNDILASLLLIADLNRPSLNQTLSWEQALKSFLSLN
FT                   DPLIKTEIFIKWLSQLNPDQLQSSPEIVLILKHIVEQKLLPYTLKKILIQRENFTTSQI
FT                   NWLCNHCLIVAPDQTTLPDIIKLGSWSWLENHMKRNELLNFDLLKIAILNKDYLASINN
FT                   SKESQLDFIYALNANKFNYQQILELIALAQDSQIKSLLITCLLSKKEYLDNLKEKSFLA
FT                   HLNQSEFHSPPRLNALVHQLNLSCLTVAQIELLQPEACVTLLCSIPHFHQLSEKQVEKI
FT                   LLKYPKPDMIAYWLNHYSSRPNAHFILAHLMNLVDVHVVDELNKMDSTKKETIIMNMVE
FT                   HLELFDPTHPLLINQNEEKRLITAIQRYLYGQHHDAYVTYIKLLVYKLLNRNYQFSPQA
FT                   MQLLICLNNLEEFKELNNKIAYLTNYYLRASAQSGDSSLFYNDSRINITSMTQLVQLAP
FT                   KIPTKSKEKSLLSSLFCGIKISESSVMTPTNDIPEHPLINKLIKSKRTVKSIDYFLMHY
FT                   KGDKQVLSKIINDYLSYYVQEGCTEIHRRSIYHLIVLMSLSDISASVREAIYTAFLNYP
FT                   ELHDEQINFSLFIYDAKRTIRHFGAQASEDSYARVIDLCEGALKKLNPNKHKEIISIAT
FT                   QALTEAKIELSFGENTGFIAQLISRLKRCWYYGWTGFFSPNLPAFVAAIDSPIKQSEKK
FT                   ASPLLQQRKYFTTKLETNLSIILDDIKSGYTQQKLNELIEALSIFSLQSNPKNELKIRQ
FT                   KLHRLFHYLLLESKNDLTLDAWLIKNQQLLIANRFRLLEMQLMKGARNEVESLLKEFDE
FT                   DSTHFSPIIKEFTHSLPEQNPYRCESVSSNQTPGITILDSATELATSLKSTLGNLGVFF
FT                   SNNIMSAIYPNNKSTPQSTSTMISP"
FT   gene            complement(456763..457596)
FT                   /gene="dapF"
FT                   /locus_tag="lpa_00581"
FT   CDS_pept        complement(456763..457596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="lpa_00581"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="COG0253, DapF, Diaminopimelate epimerase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00581"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23662"
FT                   /protein_id="ADG23662.1"
FT                   /translation="MGIKFTKMHGLGNDFIVLDGVNQSIQLTVKQIQKLANRHTGIGFD
FT                   QCLLIESSQTEGIDFNYRIFNADGQEVGQCGNGARCIALFARYYGLTAKNKLTVATKTT
FT                   LMDLIINEDNSVSVNMGVPRLAPGEIPLLADRQSPEYSLELNNGNTVNLHAISVGNPHA
FT                   VLLVENIDTAPVNSLGQQISFHPQFPEQVNVGFMQIVNHEKINLRVYERGCGETIACGS
FT                   GAVAAAAIARLFYNLSDKITVHLPGGDLCIQWPCPTAPIILTGPAAFVYEGTLLS"
FT   gene            complement(457606..457734)
FT                   /locus_tag="lpa_00582"
FT   CDS_pept        complement(457606..457734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00582"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23663"
FT                   /protein_id="ADG23663.1"
FT                   /translation="MRHIYFALLLIVVTLTSLCLSACGQKGPLYLPEQEKKATTNQ"
FT   gene            complement(457893..458255)
FT                   /locus_tag="lpa_00583"
FT   CDS_pept        complement(457893..458255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00583"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23664"
FT                   /protein_id="ADG23664.1"
FT                   /translation="MSILFLARKLASDYGFIEQIQQSHNRNQINYRFYSPRTDLHGSNT
FT                   NRLYGNPGKGVISQNTIFIYWYRDGKNSYFIECSNRLPKKELEVLHQLLMDNQHSLEEI
FT                   LEASNNRFLSFQTRHT"
FT   gene            458445..459092
FT                   /locus_tag="lpa_00585"
FT   CDS_pept        458445..459092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00585"
FT                   /product="carboxylesterase/phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00585"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23665"
FT                   /protein_id="ADG23665.1"
FT                   /translation="MKEPLEKAQACVIWMHGLGADASDMMGLADQLTVEDTALRHVFLD
FT                   APRRPVALNGGMVMPAWYDIYGLGFVDEEDKSGIEQSELLIRKVVDAQYNCGFKPHQIF
FT                   LAGFSQGGAMALHTALHMTERLCGVIALSAYLPLAKHNKPQLDKNTPIFMGAGQFDPLV
FT                   LPKWTLQSKDWLLANGYNEVSFHQYPMEHSICFEEIKDLSLWLNKQVQGVLQ"
FT   gene            459089..459523
FT                   /locus_tag="lpa_00586"
FT   CDS_pept        459089..459523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00586"
FT                   /product="Oligoketide cyclase/lipid transport protein"
FT                   /note="COG2867, Oligoketide cyclase/lipid transport protein
FT                   [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00586"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23666"
FT                   /protein_id="ADG23666.1"
FT                   /translation="MTIVKRSRTVPYSCEQMYGLVNDVEHYSEFLPYCAESKILHRDND
FT                   EVQATLVIAAAGMSKSFTTRNRLQTNKMIEIRLVDGPFSHLEGFWRFDQEEKGCRISFD
FT                   LEFEFAGKIFSMLLGPIFDQITDKMVDAFCERAEVIYGKG"
FT   gene            459510..459782
FT                   /locus_tag="lpa_00587"
FT   CDS_pept        459510..459782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00587"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23667"
FT                   /protein_id="ADG23667.1"
FT                   /translation="MVKVELVYIADSKNCLHYKMDLKQGATVEEALIESNIYSTCPETR
FT                   ELPVGVYGKRVSVDQVLKEGDRIEIYRPLILDPKEKRRKLAQFKK"
FT   gene            complement(459870..460214)
FT                   /gene="smpA"
FT                   /locus_tag="lpa_00588"
FT   CDS_pept        complement(459870..460214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpA"
FT                   /locus_tag="lpa_00588"
FT                   /product="small protein A"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00588"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23668"
FT                   /protein_id="ADG23668.1"
FT                   /translation="MAKFFMVGKKMRIMTFFICFILTLTLTQCASYDFSRRITQQGNLL
FT                   PQSKIARLKTGMSKNDVAILMGTSLMSPTFNNDRWDYAYTWRRGKGNLEIRNVVLYFSK
FT                   GSLVKIEHKP"
FT   gene            460412..460822
FT                   /locus_tag="lpa_00590"
FT   CDS_pept        460412..460822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23669"
FT                   /protein_id="ADG23669.1"
FT                   /translation="MEESQQLKDAGLKITLPRIKVLQILEQSRNHHLSAEAVYKALLES
FT                   GEDVGLATVYRVLTQFEAAGLVSRHNFEGGHSVFELSQGEHHDHLVCVKCGRVEEFVDE
FT                   IIEQRQKAIAERAHFKMTDHALNIYGICPQCQ"
FT   gene            460960..461103
FT                   /locus_tag="lpa_00591"
FT   CDS_pept        460960..461103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00591"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23670"
FT                   /protein_id="ADG23670.1"
FT                   /translation="MEFDYIIVSDGSPGWAFASRLSANPANKLLLLEAGDSVFLEMPIR
FT                   LQ"
FT   gene            461262..462332
FT                   /locus_tag="lpa_00593"
FT   CDS_pept        461262..462332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00593"
FT                   /product="components of sensory transduction system"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00593"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23671"
FT                   /protein_id="ADG23671.1"
FT                   /translation="MHQKKRSSLELEALLSLFEGSLRTIPFNILAVMVLSLGFIYTNQI
FT                   PIKLVIICFFLILILSVVRWVTSRIIISKEFYITKGKQALIGFLLLNFFMGLAWSLSYF
FT                   IFSPYLNDTSEFIFVFILGGLSTGAIASLSIYLPAYYAYVLPMNFPIIAYNLYLFQFDK
FT                   AIFAVMYSLFLIIVLLTARLNSKLLSKVRVLSITDSLTGLFNRRHFDVVFRNELSRAKR
FT                   NKYPISLVFIDIDNFKYINDTFGHSVGDSFLIHVSNILKQTLRRSSDSLFRIGGDEYAA
FT                   ILINMPPSEAITVCALLQEQFNKKNQYKNVSLSMGVISIDSIRVIDQQSAITAADKTLY
FT                   QAKKAGKNQIKSKSLG"
FT   gene            complement(462650..463036)
FT                   /locus_tag="lpa_00594"
FT   CDS_pept        complement(462650..463036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00594"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00594"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23672"
FT                   /protein_id="ADG23672.1"
FT                   /translation="MKKWTVLAASSLLMVNAYANESFCGYKDFFHLGDKTHPGIYVVSG
FT                   YNDSDVVLQIVGPRSFVIRDGFDCRAGYAHVTVAYDNANWCVLDINDGPFMNHPVVSAS
FT                   CNGLRYINTTYDGFGSYSYSINIE"
FT   gene            463292..463891
FT                   /locus_tag="lpa_00596"
FT   CDS_pept        463292..463891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00596"
FT                   /product="Predicted RNA-binding protein containing a
FT                   C-terminal EMAP domain"
FT                   /note="COG2517, Predicted RNA-binding protein containing a
FT                   C-terminal EMAP domain [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00596"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23673"
FT                   /protein_id="ADG23673.1"
FT                   /translation="MYSSLFLKKDLGCLPEKVIFLDFDGTVALPARKGNGEYDIQPDGS
FT                   IGATHLNKEKFRRLVQFAIQTDIPLYFLSGRPDLQSCVDLMTDFIASVDGFHSGIGGFK
FT                   KDSLFFISKMIIEEGKLVRKEITTKAQVIQSVHHEKYSYLPKESILLVDDIQEYLDPAQ
FT                   ELGYNTLLANPESLEHFDEVEKFIGVTLQKTIAFNT"
FT   gene            complement(463931..468220)
FT                   /locus_tag="lpa_00597"
FT   CDS_pept        complement(463931..468220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00597"
FT                   /product="SdhA, GRIP coiled-coil protein GCC185"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00597"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23674"
FT                   /protein_id="ADG23674.1"
FT                   /translation="MISEKIKLLESFKQNQFSKLIEKINSKILATLKSGHFNPRLAPYL
FT                   EKMNKDGVPFTDFDLDPENISQIKKLINALYHARLAFLDLENIDIGNIKRTIPDLKLLY
FT                   SNTIHQAYQAGYLITNLDVDLQEMFKEEIDLILPVIGKLQAFAGEHQECTKHLAESLKD
FT                   FPISYKAGEVTGIALEQMQPRTGDWDYQFLTQFSAVLPGYIEKLTQYIQQYSSQIKEKE
FT                   PTLNNEKLEELQNASLKLLNDLEHLKGNDFFISLKVLKYIHIIRNIITLATSSVEQMGH
FT                   FSDSSQDVIRDNLAQLKYVVLPTLFGLVDKIEDNAMLKPGTLSIPLMEKIKPLYQLLIY
FT                   YASKPVNFKEKGEELLSIEDSRFLALRLERTYQRIDEANKALFKIQKAQEALDNFYKIL
FT                   DTPPYNKQPIHQLPKEIKNQLITYYKIISPYMMDVNPDLNILLIDSFQGPESWSSYLKK
FT                   PWRWLRGTLPADHASFVLAQKEALQTLISKKKATQQFHIELNRDLIESVHKQTNLVLFP
FT                   YSEKTNVFLLDETKALNPANGATDKLKFRPEKGHNILVNPEDLTSEQALDLYQWYRNKR
FT                   EKFRVASKAYNEFITLLKKQTKTIAETEGRILHLNNLDKETKTRCRNLYNIFQPYFIDG
FT                   IPPELRASAISFDKFLVHSFSNESSTYDAPAVDLFEKLDEHFQIYFTEIDLQWGKKSNQ
FT                   YLKWAQEKFASENNSTELEHDEKLESRAHHLIKHTNFSKCIHEFRTELNQVISFFNNAM
FT                   RAQLKQQPNGIPYPELQDQNKELAQSEQVVAIKRIFNSLYHVEKIVVELEKLDTRSYES
FT                   IYVYHLIQAYDHINEIKKLALKLAVDPHFKLIASELLEKAQTLIATIQEHSDAYQVSPL
FT                   EVPYNQDIKYNALWYTLNAFYISPKHIRSLRNTNYLTTEELNDLHLKAKKATVTVENII
FT                   KSSNSYFKLFLQTPAMYSLYREMTNKLNEFISTSHDAVMNNLDQFRSKIFTPMLMEADA
FT                   WEDKLGLVPGTISGPLKTITDEYYKGLLHPLALHSKAHIRMICDKTPIDQRIKTTNKKL
FT                   ENATQHLDKIEKNYKHIIKLYEIIKTKGGKTTDDELIETYKKALYKLVKLQKRLPQNTD
FT                   HDPKDYELDTLLNSELKEYEPKLTLIKPLIISSYHHYEGLKATYLMKANTAREKLSYLK
FT                   ELRSTQEQEDLLYIEEYTTESFNKQLDAFCNRHIGLQYTDKEYRTKLREYLLTFKESII
FT                   QRSKSAEDINLTIKNLLKEKIKNFERDNFEKYYHLDAVRVALAQFKNYFSLSTAAIEQN
FT                   NSTFESEETLAKKTELINKLVDISEDGTLTPKERVDQISFHVKNPNFERIIMDYKQESY
FT                   FSFTYLKQCILSLLEALCLYTPERRKLFNNLESSVKTQPKINELTKRFGLFAGNESAIS
FT                   TESRAITPVSSVENNGTIELNQLAPST"
FT   gene            complement(468383..469126)
FT                   /locus_tag="lpa_00598"
FT   CDS_pept        complement(468383..469126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00598"
FT                   /product="Predicted N-formylglutamate amidohydrolase"
FT                   /note="COG3931, Predicted N-formylglutamate amidohydrolase
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00598"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23675"
FT                   /protein_id="ADG23675.1"
FT                   /translation="MNNLPPDIMKNIALLISCEHAVNTVPYEYQTLFEPHKDVLESHRG
FT                   IDFGALEIAQSIHKNNHCSLFQATCTRLLVDCNRSINHPHCFSEITKNLSSDKKKKILD
FT                   EFYLPFRNRVMDHIHQLISQGLQVWHLSTHSFTPVMNNIIRTTDIGLLYDPRSNSEKIL
FT                   ARQWQKEIKILHPQLKVRMNYPYKGISDGFTTSLRKKYSHHEYIGIELEVNQKLVFHNH
FT                   SLDTLKNTLSLSVSNTIKAYQKSER"
FT   gene            complement(469107..470327)
FT                   /locus_tag="lpa_00599"
FT   CDS_pept        complement(469107..470327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00599"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23676"
FT                   /protein_id="ADG23676.1"
FT                   /translation="MSDFPIFSVLGIEIEYMLVDKESLNVQPKSDLILRTLAGHQVNEI
FT                   ELGDIAISNELVLHVLELKNNGPKPLHVPVAEHFQKTIRELQPLLAQHNLLLLPTGAHP
FT                   WMDPNTETIRWPHGNHDIYNQFNSIFNCQGHGWANLQSMHVNLPYSNEEEFCQLHNAIR
FT                   LILPLLPAIAASTPFLDGQATGLLDSRLYFYSRNQQRIPSISGDIIPEFIRTEREYQEQ
FT                   ILEPMYRDISPYDPKGILQYQWLNSRAAIPKFDMKAIEIRILDSQECVEADIAIAKAIN
FT                   AILKYWQSTSNFYLDNPCDTKSLKYVFDETIKNGLSCHIDNKKLLEQWQLPLQGMSVNT
FT                   IWSLLIERISHELDRKQQLALELILKQGNLSERILKACSSSINHDSLKQVYTQLAHCLL
FT                   RNEQFTP"
FT   gene            complement(470320..471774)
FT                   /gene="rimK"
FT                   /locus_tag="lpa_00600"
FT   CDS_pept        complement(470320..471774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimK"
FT                   /locus_tag="lpa_00600"
FT                   /product="Glutathione synthase/Ribosomal protein S6
FT                   modification enzyme (glutaminyl transferase)"
FT                   /note="COG0189, RimK, Glutathione synthase/Ribosomal
FT                   protein S6 modification enzyme (glutaminyl transferase)
FT                   [Coenzyme metabolism / Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23677"
FT                   /protein_id="ADG23677.1"
FT                   /translation="MQTVIVTDDLDSWSFLSELAPIVHALEYLSGDEYHQNKSFRVINL
FT                   CRSYNYQSIGYYVSLLAQARDHKALPSVHSIQDVLNVSLSKLISQDTHEEIQHSLHDIK
FT                   GNEFVLSLYFGQNLAKRYATLAKQLHGLFPLPLIRFYLEKKKQWRIKTVVPLSLSDVPE
FT                   HHLEFMRQSAENYLSKKRVHQWRKKQRFHDLAILVDPSEPNAPSNKKALELFVSCGEEL
FT                   GLNVDIIDKNEAKAIAEYDALFIRATTSVNHYTYRVSRRAAQENLVVIDDPQSIIKCSN
FT                   KVYLAELLSSHQIMTPDTLFISKYDKELPKIEFPCVLKKPDSAFSHGVVKIDDEKSLQK
FT                   SLNQFFKNSDLVVVQPFIPTEFDWRIGILDNKALFACRYFMAKGHWQIYDWHCQEENKE
FT                   GDSETLPLHEVPEQIIKIALKSTRLIGDGLYGVDIKSHGNKYYVIEVNDNPNIDHGLED
FT                   KILGQNLYEQIMSVFLQRIRRKHGYV"
FT   gene            complement(471778..472491)
FT                   /locus_tag="lpa_00601"
FT   CDS_pept        complement(471778..472491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00601"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23678"
FT                   /protein_id="ADG23678.1"
FT                   /translation="MIDLIIQTQPDDETCGPTSLHAIYLYYGLDLPLNEIIQGVDKSLS
FT                   GGTLTPMLGKHALLHGFRTTVYIYNLNIFDLTWFHNGEVNNSFLMDKLEAQMKYKNDPY
FT                   ITKASLAYLDYLKLGGTIRSKSLNVDLLKNYFNKKIPILTGLSATYLYRSAREYFTPEG
FT                   KSVYDDIRGEPCGHFVVLCGYDVKKRLVIVADPHAENPLSHNNYYKVSINRLINSIMLG
FT                   VLTYDANLLIIEPKE"
FT   gene            complement(472686..473159)
FT                   /locus_tag="lpa_00602"
FT   CDS_pept        complement(472686..473159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00602"
FT                   /product="putative protein, possibly involved in aromatic
FT                   compounds catabolism"
FT                   /note="COG2050, PaaI, Uncharacterized protein, possibly
FT                   involved in aromatic compounds catabolism [Secondary
FT                   metabolites biosynthesis, transport, and catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00602"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23679"
FT                   /protein_id="ADG23679.1"
FT                   /translation="MSPLTQFKFFLWFFSHFKVALIGYLKPKLIQLTDNEIVVRLPLTR
FT                   RSRNHLHSMYFGALAVGADIAGGLHGFYHAKQAKCKVSLAFKSFQAQFLRRPESDVYFI
FT                   CTEGEVVKKMIEESKKSGERINKPIHIKAYINYLTHPEEIADFILELSLKVIK"
FT   gene            complement(473156..473707)
FT                   /gene="osmY"
FT                   /locus_tag="lpa_00604"
FT   CDS_pept        complement(473156..473707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmY"
FT                   /locus_tag="lpa_00604"
FT                   /product="osmotically inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00604"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23680"
FT                   /protein_id="ADG23680.1"
FT                   /translation="MPKCMHFILATALIFVTSTFYASNLREIEQEVSDSVITAKITAKF
FT                   AESRHLNPLKISIDTEKGIVTLSGYAPDKQAFIDALQIAKNTKGVKAVHAKDLHIKKVN
FT                   TAFTDAFITAEVETAVLKAKILDDESIPLVGINASTTNGEVTLSGHVKSARSIAAIIKR
FT                   VNEIPGVKKIVTNLEIQENA"
FT   gene            complement(473966..474424)
FT                   /locus_tag="lpa_00605"
FT   CDS_pept        complement(473966..474424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00605"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23681"
FT                   /protein_id="ADG23681.1"
FT                   /translation="MKSLIKNLLFIVVFSINSSALYAANGNTRVIQWAQQTLMDTLSVS
FT                   YTSKAQDFVTVRKNYSLNAWSGITGFLGGNMQTIREKQLTLHPVLLPDTQILSTGLYSG
FT                   MSYWIIRQSVAIDELNTKLTFTLTILGRSGAAGYPYIVHSLSILLNAL"
FT   gene            474519..477374
FT                   /gene="uvrA"
FT                   /locus_tag="lpa_00606"
FT   CDS_pept        474519..477374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="lpa_00606"
FT                   /product="excinuclease ABC subunit A"
FT                   /note="COG0178, UvrA, Excinuclease ATPase subunit [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00606"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23682"
FT                   /protein_id="ADG23682.1"
FT                   /translation="MHTITIRGARTHNLKNLDLELPRDKLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSMMEKPDVDSIEGLSPAISIEQKATSHNPRSTVGTITEI
FT                   YDYLRLLYARVGEPRCPTHHTSLHAQTISQMVDQVLALPEDSKVMILAPVIRERKGEHV
FT                   QFLQQLQAQGYVRARIDGELYELDSPPKLGLRTKHTIEVVIDRFKVRPDLAQRLSESFE
FT                   NALNLADGLAIVSSMDGHFKELLFSSRFACSECGYSLSELEPRLFSFNNPVGACSSCDG
FT                   LGVDQFFDPSRVVHDATASLAEGAIRGWDRKTTYYFSMLESLARHYGFDTSTPFCDLSE
FT                   AMQQIVLYGSGREIIEFQYHRPHGGYMVKRHSFEGIIPNMQRRYRESDSGMIREELAKY
FT                   LSSRPCQSCQGARLREEARHVFIDNKNLPEITSYSIEQAYQFFKELKLSGYRGEIAAKI
FT                   NKEIVERLGFLVNVGLDYLSLARSAETLSGGEAQRIRLASQIGSGLVGVMYILDEPSIG
FT                   LHQRDNDRLLSTLMHLRNQGNTVIVVEHDEDAIRSADFVLDIGPGAGVHGGEVVASGSP
FT                   QEVMNNPASLTGQYLSGKEAIEIPKARIPVNHDRMIHLKGVSCNNLQNVDVSIPLGLLT
FT                   CITGVSGSGKSSLINDTLYPIAANALNRASLMTTGEVQDISGLHLCDKVIDIDQSPIGR
FT                   TPRSNPATYTGLFTHIRDLFSGTPESRARGYQPGRFSFNVKGGRCEACQGDGLIKVEMH
FT                   FLPDIYVSCDVCQGKRYNRETLEIHYKGKNIHEVLDMTVEDACAFFAAIPVIARKCQTL
FT                   MDVGLSYIKLGQSATTLSGGEAQRIKLARELSKRDTGNTLYILDEPTTGLHFHDTKQLL
FT                   TVLTRLREQGNTIVIIEHNLDVIKTADWIIDLGPEGGSKGGKIIATGTPEMVAENPQSF
FT                   TGQFLKQILSKSNEFLLQKCK"
FT   gene            477558..478139
FT                   /gene="lemA"
FT                   /locus_tag="lpa_00608"
FT   CDS_pept        477558..478139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lemA"
FT                   /locus_tag="lpa_00608"
FT                   /product="putative conserved protein"
FT                   /note="COG1704, LemA, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00608"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23683"
FT                   /protein_id="ADG23683.1"
FT                   /translation="MKTFFIAILIIIALAFIWAISIYNTLIGLIEAINNNKKQIDIQLD
FT                   RRFKVFESLIEAVKKYMDYEKTTLKDVVALRNQAQAAKEAGDEQGRIAAENGISKIASN
FT                   LNLVFEQYPDLKASQNVMQLQEEIVNTENKLAYAKQAYNDGIERYNAKKKSFFESMVVA
FT                   MFSSALDKEFIYWGLPEEQIQAKENYTVKL"
FT   gene            478150..479169
FT                   /gene="htpX"
FT                   /locus_tag="lpa_00609"
FT   CDS_pept        478150..479169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="lpa_00609"
FT                   /product="Zn-dependent protease with chaperone function"
FT                   /note="COG0501, HtpX, Zn-dependent protease with chaperone
FT                   function [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00609"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23684"
FT                   /protein_id="ADG23684.1"
FT                   /translation="MGIADYHATAGDWRAQLRRNEKKTRRVIAVFFLVYILVGLIVDAF
FT                   VLQGMYPHASLENIIRALITFKVVPIATLLMIAFAGISLLITYALYDRIMLLGTEYYQI
FT                   TPETARSLQEKQLYNVVEEMKVASGLQYMPKVYIIEASYMNAFASGYSEKSAMVAITRG
FT                   LMEKLDRAEMQAVMAHELSHIRHHDIKLTLMVAVLSNILLIVIDILFYSVIYKRDRRGD
FT                   NRLLMVIIILRYVLPIITVLLALFLSRTREYMADAGCVELMRDNEPMARALLKINQDHV
FT                   QNAEQYAKAYGDTPHEQVRQASYLFDPSHIDPVKSLNNAFSTHPSIEQRLEALGFKRK"
FT   gene            complement(479196..479969)
FT                   /locus_tag="lpa_00610"
FT   CDS_pept        complement(479196..479969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00610"
FT                   /product="ABC transporter, permease protein"
FT                   /note="COG1682, TagG, ABC-type polysaccharide/polyol
FT                   phosphate export systems, permease component [Carbohydrate
FT                   transport and metabolism / Cell envelope biogenesis, outer
FT                   membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23685"
FT                   /protein_id="ADG23685.1"
FT                   /translation="MGFKYQLIALYTLVRREVVRMFRISSQVFLPPVITTTLYFLIFGS
FT                   LIGPRIGDIEGVDYSQFIAPGLIMMSVIINSYGNVSNSLFSVRFQKSIEEMLISPMHNG
FT                   LLLLGYVIGGVLRGLIVAILVFVISTFFLPVELDHLPMTLLVVVLVAAIFSLAGFTNAM
FT                   VARNFDDIMLIPTFILTPLTYLGGVFYSINMLPPFWQKISLFNPILYMVNALRHTMIDQ
FT                   EEVSITLAMIIIFLMLIALTVGNMILLKKGVGFRE"
FT   gene            complement(479959..480873)
FT                   /gene="ccmA"
FT                   /locus_tag="lpa_00611"
FT   CDS_pept        complement(479959..480873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /locus_tag="lpa_00611"
FT                   /product="antibiotic transport system ATP-binding protein"
FT                   /note="COG1131, CcmA, ABC-type multidrug transport system,
FT                   ATPase component [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00611"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23686"
FT                   /protein_id="ADG23686.1"
FT                   /translation="MHALEINQLSKTYSNGVEALKGIDLTVNTGDFFALLGANGAGKST
FT                   TIGLITSLVNKTSGNIKIYGFDLDAYPEKAKSCLGLVPQEVNLNIFENCEQILLNQAGY
FT                   YGISRKKALPRAEALLEQLGLWDKRRSIVRHLSGGMKRRLMIARALIHQPKLLILDEPT
FT                   AGVDIEIRHSMWDFLARTNAEGTTIILTTHYLEEAEQLCKNIAIIDKGQIIKNTSMKAL
FT                   LQTLRHQTFIFNTENPIDYLPDIHPFNVTPIDPTTFELRVDNNFSLNEVFAVLTKQGIK
FT                   IHSMRNKTNRLEELFMDLIKNGI"
FT   gene            480933..481046
FT                   /locus_tag="lpa_00612"
FT   CDS_pept        480933..481046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00612"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23687"
FT                   /protein_id="ADG23687.1"
FT                   /translation="MDFNSSLTSNGLILGMKEELTLAMSHRHEDISLLLHF"
FT   gene            complement(481104..482162)
FT                   /locus_tag="lpa_00613"
FT   CDS_pept        complement(481104..482162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00613"
FT                   /product="VipA"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00613"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23688"
FT                   /protein_id="ADG23688.1"
FT                   /translation="MKHYDSMDQELITMPISNAFLKLFSEFVDNYARNGTPSFYHWAKE
FT                   QNHEVINKFFHELLEIIKSNTETFHDVSIIEHLNATVLLSAKTNPYLLDCWISFITKYN
FT                   AETNSFTPIGASMHIKIGPEGTPSERIIRELKESLVMTQQAFILAQKANATEVDSLKRQ
FT                   LERTKLENERLVTQNQFLKDQVRAEKTFADINPQINNARHQLSALTELIQTLSEITNAK
FT                   PKIETVSSLSIPAVTENKSELLKENSCSVAPVSKEVTPAISQEPKKRPVPPPPNDMDSQ
FT                   ALFPNIPPKEDVSIKVTIPSMPKPNSTQPVAKNSGFFSGDGFLKELNAKIKERKERPKD
FT                   EPHTTPVEKKNL"
FT   gene            complement(482249..482887)
FT                   /locus_tag="lpa_00614"
FT   CDS_pept        complement(482249..482887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00614"
FT                   /product="SM-20-like protein"
FT                   /note="COG3751, EGL-9, Predicted proline hydroxylase
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00614"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23689"
FT                   /protein_id="ADG23689.1"
FT                   /translation="MFNPDLIAHNICTQGFHIIDEFLEEAHYYSLRDMAYELKQQNLFR
FT                   NAKIGQNLQAQQNDKIRSDQIFWIDADSPYPPIQAYLKKLISLGNVLNQTMYLGLAEFE
FT                   THFAIYLPGTFYRKHIDQFESTKTRKISFVYYLNDTWQKEFGGELLLYNIEDELIQNIS
FT                   PLGNRFVCFDSQLPHEVHPTQRTRFSMTGWMKTRSTSVLADNKLTQITQ"
FT   gene            complement(482973..483680)
FT                   /locus_tag="lpa_00615"
FT   CDS_pept        complement(482973..483680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00615"
FT                   /product="Predicted metal-dependent hydrolase"
FT                   /note="COG1451, Predicted metal-dependent hydrolase
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00615"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23690"
FT                   /protein_id="ADG23690.1"
FT                   /translation="MHIQIDGIPIEILRKPIKNLNLRIYPPDGLVKVSVPLKYSEQLIK
FT                   QQLQEKSEWIRAQCERIRARSFYREPSLQTGATIPFKGKNYLLIVEEHHGPSQILIKDE
FT                   LIYCYTKPDLTPQQKQNILERWYRKEMNLVIPRLIQQWEAIMKVKINQWGIKKMKTRWG
FT                   SCNPRAQRIWLNLNLIKKPLECLEYVLVHEMVHILEASHNKRFYALMAQFMPKWQEYQR
FT                   ILEGTPNANTFAR"
FT   gene            483733..483870
FT                   /locus_tag="lpa_00617"
FT   CDS_pept        483733..483870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00617"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23691"
FT                   /protein_id="ADG23691.1"
FT                   /translation="MILIVECIETPKIQRFLILNKQLAGNNNIPFHFLIVYCKSLLQKF
FT                   "
FT   gene            complement(483867..484148)
FT                   /locus_tag="lpa_00618"
FT   CDS_pept        complement(483867..484148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00618"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23692"
FT                   /protein_id="ADG23692.1"
FT                   /translation="MKNKLAISTLLFLLPTAAAMANCDLTKFRWDCDLPVQVKPSPGAS
FT                   SLVYCGSSYGYITKQQYDILARYQRASVNMVLDINGEYIDSPCIGAER"
FT   gene            484297..485160
FT                   /locus_tag="lpa_00619"
FT   CDS_pept        484297..485160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00619"
FT                   /product="putative protein conserved in bacteria"
FT                   /note="COG2990, VirK, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00619"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23693"
FT                   /protein_id="ADG23693.1"
FT                   /translation="MLSSTKEYLQALRDGKYLLFLQWPKFIAEYYGKNDKNQEADEMVS
FT                   LLIFEWLNNGFCLDDIKKFAILYAVHEMESRPLREGLSYALTTISIALFPCMVYLTNNL
FT                   QERYITSKKLSSKEVLQLMTMNNAYLEKQRFVEFLGQEQDKFFTWVKEADSSAVSKAFD
FT                   QIYSVTYLKYLIEDYLNLLESAHLPNDQLKSSRISLVIRLAKYLNEQTELTQDVHDEIA
FT                   VYVKKLWEMQPAEFEEEFLKKISPLPFIDNTVRILTGLSARFFSILQPPSPPLNINSDA
FT                   DKNPKV"
FT   gene            complement(485261..485728)
FT                   /gene="ada"
FT                   /locus_tag="lpa_00620"
FT   CDS_pept        complement(485261..485728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="lpa_00620"
FT                   /product="Methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /note="COG0350, Ada, Methylated DNA-protein cysteine
FT                   methyltransferase [DNA replication, recombination, and
FT                   repair]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23694"
FT                   /protein_id="ADG23694.1"
FT                   /translation="MNGKMLLVSIFNTPVGNLEVTHDEHFIFNASFTDKSGTPAQNQLS
FT                   HLIASELKAYFDDPHHRFQLPLKPQGSLFQQKVWNTLLVIPVGRTVTYGELATKLQSSP
FT                   RAVGQACKRNPLALFVPCHRVVGKHDLGGYMGNPNAISYKKNLLAHEAKII"
FT   gene            complement(485732..486097)
FT                   /gene="rplS"
FT                   /locus_tag="lpa_00622"
FT   CDS_pept        complement(485732..486097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="lpa_00622"
FT                   /product="large subunit ribosomal protein L19"
FT                   /note="COG0335, RplS, Ribosomal protein L19 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00622"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23695"
FT                   /protein_id="ADG23695.1"
FT                   /translation="MTNIIDQINAEQMQGKEIPDFNPGDTVLVQVKVIEGNRERLQAFE
FT                   GVVIAKRNRGLNSAFTVRKISHNVGVERVFQTYSPIVDSITVKRRGDVRRAKLYYLRNL
FT                   AGRAARIKEKLSGKKGD"
FT   gene            complement(486124..486876)
FT                   /locus_tag="lpa_00624"
FT   CDS_pept        complement(486124..486876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00624"
FT                   /product="tRNA (guanine-N1-)-methyltransferase"
FT                   /note="COG0336, TrmD, tRNA-(guanine-N1)-methyltransferase
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00624"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23696"
FT                   /protein_id="ADG23696.1"
FT                   /translation="MALHLGVITLLPEIIQGIHYGVTGRAIEQGLVKIDCWNPRDWSSR
FT                   PYKQVDDKPYGGGPGMVMMYEPLHAAIKHAHSEMKENCKTIYLSPQGKVVRQNDLKQIA
FT                   TQKQSLLFVAGRYEGIDERIINHHIDEEWSLGDFVLSGGELAAMVFIDAIIRLIPGSLG
FT                   HLGSAEQDSFMNGLLDCPHYTRPATINGLGVPDVLLGGNHKEIERWRRKQSLGKTWLKR
FT                   PDLLEKIQLSETDKQLLAEFKCEHGDSC"
FT   gene            complement(486876..487385)
FT                   /gene="folK"
FT                   /locus_tag="lpa_00626"
FT   CDS_pept        complement(486876..487385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="lpa_00626"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="COG0806, RimM, RimM protein, required for 16S rRNA
FT                   processing [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00626"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23697"
FT                   /protein_id="ADG23697.1"
FT                   /translation="MNNKTNWVIIGRFGRPHGIKGFVTVHSFTDPADNILRYNDWHVFL
FT                   NKQWQPLKLLTIEVRSKAIIAQIEGYPERELVSALTNLDIGVQESQLAALAPGEYYWYQ
FT                   LIGMSVINSKGDLFGKVVEIMPTGSNDVLVVEGEKRHLIPYLPGQFVINIDESQQVITV
FT                   DWDMNF"
FT   gene            complement(487391..487651)
FT                   /gene="rpsP"
FT                   /locus_tag="lpa_00627"
FT   CDS_pept        complement(487391..487651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="lpa_00627"
FT                   /product="small subunit ribosomal protein S16"
FT                   /note="COG0228, RpsP, Ribosomal protein S16 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00627"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23698"
FT                   /protein_id="ADG23698.1"
FT                   /translation="MVVIRLSRAGAKKRPFYHMVVTDSRKRRDGNYIERIGYFNPVARG
FT                   QEVKLHIDMDKMTHWQKVGAQLSDRVSALLKEHSKKSETAA"
FT   gene            complement(487738..489114)
FT                   /gene="ffh"
FT                   /locus_tag="lpa_00628"
FT   CDS_pept        complement(487738..489114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="lpa_00628"
FT                   /product="signal recognition particle, subunit SRP54"
FT                   /note="COG0541, Ffh, Signal recognition particle GTPase
FT                   [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00628"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23699"
FT                   /protein_id="ADG23699.1"
FT                   /translation="MFENLTERLTRTFKNLRGQGRLTEDNIQHALREVRLSLIEADVAL
FT                   PVIKEFIEQVKQKSLGQEVLTSLNPDQAFIKIVHDELIHVMGDERVELDYKTQPPAVFL
FT                   MAGLQGSGKTTSTAKLARYLKETENKKIMMASVDVYRPAAIHQLKVLAEQIDVAFFDSD
FT                   PNEQPIKIAQKALESARKQYVDVLILDTAGRLHVDEDMMSEIKSLHKAVNPIETLFVVD
FT                   SMTGQDAANTAKAFHEALPLTGVILTKTDGDARGGAALSVKQITGKPIKFIGSGEKIEA
FT                   LEPFHPERIASRILGMGDILTLIEEVERKADKQASEKLAKKLKKGKGFDLEDFKQQLLQ
FT                   MNNMGGISGMMSKLPGMGQLPKQAMQQVNDKAMAQTIAIINSMTPKERRIPKIIVGSRK
FT                   KRIALGSGTQIQDVNRLLKQFEQMQKMMKKFTKPGGMQKMMRGIGGMAGLKGMFPDDLK
FT                   "
FT   gene            complement(489372..490037)
FT                   /locus_tag="lpa_00629"
FT   CDS_pept        complement(489372..490037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00629"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23700"
FT                   /protein_id="ADG23700.1"
FT                   /translation="MPKAFTHLCKKVNLSLYNDTLTVYPKSSVLPKPIQIRSELDLLMV
FT                   LLFSQMDCNSAQVDQFFMMRSNELGVYRFIHRDDTDHDLYHQDEFSMDDNHYHAQFDKA
FT                   IDESKLENILGILEKHSLISSEEHVSFIEAYHKANTLPEDMPKLETTLPSPLPVSSPSV
FT                   HTTKKQPVVKQKEVDPPTTFAGLRVGFFLTSTKTTTKPLSRSHDDDEKKIGTNGHGFH"
FT   gene            490367..491818
FT                   /gene="arp"
FT                   /locus_tag="lpa_00630"
FT   CDS_pept        490367..491818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arp"
FT                   /locus_tag="lpa_00630"
FT                   /product="Ankyrin repeat protein"
FT                   /note="COG0666, Arp, FOG- Ankyrin repeat [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23701"
FT                   /protein_id="ADG23701.1"
FT                   /translation="MPKLLSYSTSLISKKQDTSELTHDGITNVLTQLGHPKFEGVCYGF
FT                   TLNWALAVAQGKESFFYRQLHHLRTHQFGLPKTLQQIKEKKERNQSLSNDEMVIDTLPQ
FT                   LGKKICVAQDPLQYKEKYRKLVWQPDINSILKAINADSSVAKHIFYKTHSFLNQDEATE
FT                   YLELLKRTGIREDVAVIISTADHAMGFKLAGNVWRFININDLYQQDKNKPYFEFSSRNL
FT                   VKELYRVCAENLQGSRLTVNTDFVSVNPEEKLSRALQNVFPVFPVRTKTSYPERLAFFS
FT                   MAATQGDMNSVKKCIHSGWSIFSRQRLSDDSPILTAIYLGRRDVVRAMLSTSRHRVNQK
FT                   RKSDSSTLLHIACRYGGSGIVEDLLNIRGIKIDPQDNKGRTPLMYACKKSVVTEDKKLF
FT                   NLLFAKGASLSIKDNDGLTALDHALKNEHTLAIQMIEERLEKEACAKENSTSRRFKFSE
FT                   TKGTLFQRGVKTISYQSQQPGFGMK"
FT   gene            492155..493558
FT                   /locus_tag="lpa_00632"
FT   CDS_pept        492155..493558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00632"
FT                   /product="Amino acid transporter"
FT                   /note="COG0531, PotE, Amino acid transporters [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00632"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23702"
FT                   /protein_id="ADG23702.1"
FT                   /translation="MSNKKHSLTIFSLTMITVGSVDSIRNLPATALFGSQLIFYFILGA
FT                   LFFLIPTALVSAELASGWARQGGVYIWVKEAFGKKSGFLAIWLQWIENVIWYPTILSFV
FT                   AGTIGYLINPSLTTNPYFLWAVIVSCFWGATIVNLRGMKSSAMFSNICSLAGLLLPMSL
FT                   IIGLGAVWIAQGNPLQISFDMPSIVPHLSDKGMWVSLTAIILSFCGIEIATVHANDVKD
FT                   PQHAFPKALVYSVGIILSTLILGSLAIAVVLPQKDINLVAGIMQAFSAFFLKYHMDWMM
FT                   PVVAVMLVLGGLGGVSNWIIAPTKGLLVAAEEGNLPEVFQRTNGKGAPAMMLYTQATIV
FT                   TVLSALFLFMPSVNGSYWLLTALAAQLYMLMYLIMFVAAIKLRISQPYHPRPFKIPGGM
FT                   AGMLFVAGIGIIGVVTTLAVSFIPPEGINVGSATRYELTLIIGLLLMCAPPFITSWLQA
FT                   KEADLEPAV"
FT   gene            493614..494138
FT                   /locus_tag="lpa_00633"
FT   CDS_pept        493614..494138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00633"
FT                   /product="putative protein conserved in archaea"
FT                   /note="COG4016, Uncharacterized protein conserved in
FT                   archaea"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00633"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23703"
FT                   /protein_id="ADG23703.1"
FT                   /translation="MGYIDELLEELSARLPELEWKINGLSSSISIHNLPKGIFSSVIEF
FT                   NGPACIKEIRDDIHALQKHKDESIACFLAERIQKKINVLVILCQMDKKNNKPESKISFD
FT                   LTTLSTRQQWIKTMEENICALEEQHQAMRKTLEQMKSCSNPATILHLQTELGNVEKRLT
FT                   LAKETLNRAIS"
FT   gene            494342..494683
FT                   /locus_tag="lpa_00635"
FT   CDS_pept        494342..494683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00635"
FT                   /product="putative gamma-carboxymuconolactone decarboxylase
FT                   subunit like protein"
FT                   /note="COG0599, Uncharacterized homolog of
FT                   gamma-carboxymuconolactone decarboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00635"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23704"
FT                   /protein_id="ADG23704.1"
FT                   /translation="MSDKFSHITKDITTQLAKFRKEMPELMTGFSSLAQAATKDGALDK
FT                   KTKELIAMALAVAKQCPGCIGFHSQTLVKLQATREELLETLGMAVYMGGGPSLMYAAEA
FT                   LEAFEEFSK"
FT   gene            complement(494897..495340)
FT                   /locus_tag="lpa_00638"
FT   CDS_pept        complement(494897..495340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00638"
FT                   /product="Predicted phosphatase"
FT                   /note="COG3211, PhoX, Predicted phosphatase [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00638"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23705"
FT                   /protein_id="ADG23705.1"
FT                   /translation="MRLLFISLILASGYLQADTINNYMNIANNIPQMEMKADPQAQAWA
FT                   RSARHVLTITSESIAETLIQANEAAKTQGKPIFCLPQGVQLNSFVMNELIQQTYKEISS
FT                   QQSDKDKMTVSQVALLGLSKKYPCEPSPQEKQIQHVASLLSPQ"
FT   gene            complement(495359..495907)
FT                   /locus_tag="lpa_00640"
FT   CDS_pept        complement(495359..495907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00640"
FT                   /product="inner (transmembrane) protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23706"
FT                   /protein_id="ADG23706.1"
FT                   /translation="MNKQMQWHLFGNTSGLLIICCLLILAFLDQFIFYELPCPICILQR
FT                   ICFVAVGLCFVMNLMLGIRASHYGLMLLASLLGLSISVRQMYIHLTPGDPGYGGLFLGL
FT                   HLYTWSAIIFLVIILLIAGALILDKGFMPDYKVRSKSAKVMIWVFFILILANGISTFLE
FT                   CGPHECPDNPSKYYLLNNN"
FT   gene            complement(496324..496527)
FT                   /locus_tag="lpa_00641"
FT   CDS_pept        complement(496324..496527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00641"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23707"
FT                   /protein_id="ADG23707.1"
FT                   /translation="MFTKIFIIFVMILIVASLASGLFYLVKDTDKSKRTVKALTVRIAI
FT                   SLSLFVFLFIAFKLGLIQPHGI"
FT   gene            496643..497323
FT                   /locus_tag="lpa_00643"
FT   CDS_pept        496643..497323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00643"
FT                   /product="putative conserved protein"
FT                   /note="COG3346, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00643"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23708"
FT                   /protein_id="ADG23708.1"
FT                   /translation="MLILTAVCFFLFISLGFWQIHRADEKTEMITAQQALAKKEPIIWQ
FT                   PGQKLPEQYQRISIEGAFLPKLFLLDNQHYQHQFGYDVVSPMLLDDGSIVMVDRGWVSG
FT                   DITRRTFPNVQTPNGKFKLFGMVYFPSKKQWILGPSFEEKENKVTLLELIDEEILKQLL
FT                   QKKVYPFIIRLDKNEPFGFVREWEIVSMPPQRHFAYAIQWFAMALVILIIFVIFNLKKN
FT                   EKTI"
FT   gene            497328..497852
FT                   /locus_tag="lpa_00644"
FT   CDS_pept        497328..497852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00644"
FT                   /product="Predicted membrane protein"
FT                   /note="COG3162, Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00644"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23709"
FT                   /protein_id="ADG23709.1"
FT                   /translation="MTLLLLVVIFAAPGITAYLFYKNPSWLGTSKVNKGILLSPPIALK
FT                   PLDSSAKWRIIYWNPNGCDKTCLKQLNMLGRVRLSFGRKLYQVDEWLLLSNKDSLIAEE
FT                   LKPILKEQDIHVAALSLTEMSKLSTLYPEAKIFIANPDNYLILSYQPGCNPGDIYKDLK
FT                   LLLNTTEIKSG"
FT   gene            497857..498864
FT                   /gene="ctaA"
FT                   /locus_tag="lpa_00645"
FT   CDS_pept        497857..498864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaA"
FT                   /locus_tag="lpa_00645"
FT                   /product="cytochrome c oxidase subunit XV assembly protein"
FT                   /note="COG1612, CtaA, Uncharacterized protein required for
FT                   cytochrome oxidase assembly [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00645"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23710"
FT                   /protein_id="ADG23710.1"
FT                   /translation="MSNSSIRLAATLAVFLAFFVVMLGAYTRLTDAGLGCPDWPGCYGR
FT                   MVLPGADKGLQEAQSQYPDLPIESKKAWTEMAHRYAAGTLALLIFFIAFQVWFKRRQDQ
FT                   DLPWHLPLALFMLVVFQAALGMWTVTLKLLPVVVMGHLLGGMLIVACLCRFRLQIAQLK
FT                   GQNLPEWRPWLRLGIVIILLQIALGGWVSANYAGISCIGFPLCNGTWFPELHFAKGFNL
FT                   FSTIGANYQGGVLESEVRASIQFIHRIGAILTATYLLALSLIIVFKTHSIYLRATAVIM
FT                   AMLVLLQFTLGIMNVIHLLPLKVAVAHNGVAALLLAVAFCSLHFTQDREVSHAY"
FT   gene            498854..499738
FT                   /locus_tag="lpa_00647"
FT   CDS_pept        498854..499738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00647"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="COG0109, CyoE, Polyprenyltransferase (cytochrome
FT                   oxidase assembly factor) [Posttranslational modification,
FT                   protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00647"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23711"
FT                   /protein_id="ADG23711.1"
FT                   /translation="MRTEYAARLPVDWRDYVELCKPRVVLLMLLTVIVGMYLAAPGWVS
FT                   LRLIAFTLLGIGLCAGSAAAINHLVDRHIDSIMARTKKRPVAYGRVSVKQALWFAVIIG
FT                   LMGLSLLILFVNQLTALLTFVTLIGYAGVYTGYLKRATSQNIVIGGLAGAAPPLLGWTA
FT                   VTDQLDPQALLLVLIIFTWTPPHFWALAIYRYKEYQDAEIPMLPVTHGIQFTKLNIYLY
FT                   TVLLLVVSLLPFVVSMSGWIYLLGALVLGIRFLVWAHKLYFTDKPVVAMQTFRFSILYL
FT                   MLLFVFLLVDHYF"
FT   gene            499748..500389
FT                   /locus_tag="lpa_00648"
FT   CDS_pept        499748..500389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00648"
FT                   /product="putative protein SCO1/SenC/PrrC, involved in
FT                   biogenesis of respiratory and photosynthetic systems"
FT                   /note="COG1999, Uncharacterized protein SCO1/SenC/PrrC,
FT                   involved in biogenesis of respiratory and photosynthetic
FT                   systems [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00648"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23712"
FT                   /protein_id="ADG23712.1"
FT                   /translation="MNIKIKGGAVTITVLALVSLLAGIYISQNFHFKKKINVADFHGTY
FT                   LENPRTVNNFSLTGTDQKAFNNSSLQGRWTLVFFGFTNCGYLCPTTMAELGKMYRILEK
FT                   KGVKNLPQVVMISIDPQRDSLDKLGSYVTSFHKSFYGARGEEDSIKSMTHEMGIAYAKI
FT                   NNKESSEPENYDIQHSGAVMLFNPQGELNAFFTTPHHADLLAKDYVLLVS"
FT   gene            500755..501663
FT                   /gene="rimK"
FT                   /locus_tag="lpa_00649"
FT   CDS_pept        500755..501663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimK"
FT                   /locus_tag="lpa_00649"
FT                   /product="ribosomal protein S6 modification protein"
FT                   /note="COG0189, RimK, Glutathione synthase/Ribosomal
FT                   protein S6 modification enzyme (glutaminyl transferase)
FT                   [Coenzyme metabolism / Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00649"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23713"
FT                   /protein_id="ADG23713.1"
FT                   /translation="MKIAILATNPHLYSHKRLKAEAEAAGHEVKIINPLYCYMNVAASN
FT                   PKVHYRGGAPLPHFDAVIPRIGASITYYGTAVLRHMETMGMYTLNESIAISRSRDKFRS
FT                   LQLLARKGIPMPLTSFAQSPDDTEDLIHMVGGAPLVIKLLEGTQGKGVILADSHQSAVS
FT                   IINAFKEMHANILVQEFIEESRGTDIRCFVIGEKVVAAVKRQAKDGEFRANVHQGGKAV
FT                   KVKLSPQERAIAVSAAKTMGLRVAGVDLIRSNHGPLVLEINSSPGLEGIEKATNINLAG
FT                   KIIEYIEKKAKPISSNHRFHG"
FT   gene            complement(501667..501912)
FT                   /locus_tag="lpa_00650"
FT   CDS_pept        complement(501667..501912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23714"
FT                   /protein_id="ADG23714.1"
FT                   /translation="MLNKRFSERLNKELDNIGVPEATAERIEILSKLIKIPKFKAEALL
FT                   NGITIPDEAVLKTLAQELEVNVDWLIGKSDSKSGAH"
FT   gene            502230..503720
FT                   /gene="zwf"
FT                   /locus_tag="lpa_00651"
FT   CDS_pept        502230..503720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="lpa_00651"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="COG0364, Zwf, Glucose-6-phosphate 1-dehydrogenase
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00651"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23715"
FT                   /protein_id="ADG23715.1"
FT                   /translation="MLLKAESKYPCDLILFGTLGDLSCRKLLPALYQLELANLLHEKTR
FT                   IIGCAREELDFSAYADLIKNKIQQFLFDEIDEAVWLRFIKKLAYCKLDLNQSDDYQKLT
FT                   DYVNPSERVVISYLAIPPSLYSQTCRSLARLNLTQKPSRVVLEKPIGHDLPSSVATNEQ
FT                   VACFFSEDQIYRIDHYLGKETVLNLLVLRFANSIFSTNWDNRVIDRVEISVAEEIGVEG
FT                   RWEYYDKSGQVRDMLQNHLLQILSLVAMEPPLSLSAESIRSEKLKVLKSLRFINKSNAH
FT                   DHTVRAQYVANNLANGKKIPGYLEEVGANQASTTETFVAIKAYVDNWRWSGVPFYMLTG
FT                   KRLPKKQSEVVIYFKPQPYNIFHPLNEELYPNQLIIRLQPDEGVEVRIMNKIPGLGERM
FT                   MLHDSKLDLNFHHSFKTQRIADAYERLLLEVMLGNQYLFVSREEIEQAWQWIDSIVSAW
FT                   EEDNIPLYTYPACTWGPKEVIRLFNGQAHVWGDHNAVS"
FT   gene            503707..504420
FT                   /gene="pgl"
FT                   /locus_tag="lpa_00652"
FT   CDS_pept        503707..504420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgl"
FT                   /locus_tag="lpa_00652"
FT                   /product="6-phosphogluconolactonase"
FT                   /EC_number="3.1.1.31"
FT                   /note="COG0363, NagB,
FT                   6-phosphogluconolactonase/Glucosamine-6-phosphate
FT                   isomerase/deaminase [Carbohydrate transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00652"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23716"
FT                   /protein_id="ADG23716.1"
FT                   /translation="MQFHSFRDAKQLIHDMVEKLRTILSDAIKRRGQAFLVVSGGRTPI
FT                   DLFKELALADLPWEKVVITLADERCVNLFDPHRNELLVREFLLQEKAKKAKFISLFDEK
FT                   EEPLGHLNEVSSQIDSLPTFDAVVLGMGEDGHTASLFPCSDELSAGLDDKANAVLIVKP
FT                   RTASFQRVSLSKRRLLNSSTIFLHLVGQRKRVVLEQAMATNNPEILPICAILNAPDANV
FT                   QVMYAPSDEEKECIL"
FT   gene            504408..506246
FT                   /locus_tag="lpa_00653"
FT   CDS_pept        504408..506246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00653"
FT                   /product="phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /note="COG0129, IlvD, Dihydroxyacid
FT                   dehydratase/phosphogluconate dehydratase [Amino acid
FT                   transport and metabolism / Carbohydrate transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00653"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23717"
FT                   /protein_id="ADG23717.1"
FT                   /translation="MHPVINQVTENIQNRSASRRAAYLNQIDKARTKGPQRSILHCGNL
FT                   AHGFAACAKQDKAILRGNAKANIAIISAYNDMLSAHQPYAVFPDLIKEAISAAGGVAQF
FT                   AGGVPAMCDGITQGQPGMELSLLSRDVIALSTAVALSHNMFDGGLLLGICDKIVPGLLM
FT                   AALAFGHLPFIFVPAGPMPSGISNQEKARIRQLYAAGQVDKNALLDVEAASYHTAGTCT
FT                   FYGTANSNQLVIELMGLQLPGSSFVNPNTPLRNELTKAAACQILSLTDLNSDYMPIGQM
FT                   LDVKNIVNGIIGLLASGGSTNHTMHLVAIAAMAGYWVNWDDFAQLSAIIPLIARIYPNG
FT                   QADINHFQRAGGMAYFVKTLLEADLLHPDVNTVVGFGLDKYTQQPQLIDNRVVWVNGPD
FT                   SSSNNDVLTSAADPFKPQGGLQVLSGNLGRAIIKTSSLYDEHYVIEAPAVVCSSQEEFE
FT                   YLFNQGLLNKNCVVVVRFQGPKACGMPELHQLTPKLGVLMDKGFHVALVTDGRMSGASG
FT                   KVPAAIHVTPEAVDGGGIAKIETGDMILIDCERGILQLLVSDEELAGRSPVAIEGYSSV
FT                   LGMGRELFGNLRLHFTGAEQGACSLFKGNEFFYDAS"
FT   gene            506233..507228
FT                   /gene="glk"
FT                   /locus_tag="lpa_00654"
FT   CDS_pept        506233..507228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glk"
FT                   /locus_tag="lpa_00654"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="COG0837, Glk, Glucokinase [Carbohydrate transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00654"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23718"
FT                   /protein_id="ADG23718.1"
FT                   /translation="MMPHDLAQYAIVADIGGTFARFSRVNLVNLQMDKIEISPCAEFIS
FT                   LESALLTYKNRHSLQEIKHIAIAIACPVIDDLVSMTNCHWQFSITELKQRLGLEVLEVM
FT                   NDFTAIAMSLPVLSTQDLVQIGNGYLDASKVRVVLGAGTGLGVAYLIPHQHHYSAFAGE
FT                   GGHADWGAKTEQEWFIYRYLKSKYSHVSYERLLSGQGLENLYQALAAYHSKKVEFLSAA
FT                   QIISLALNQECFIAHKAVAQFFSSLGSFAGDLALTYGAFGGVYIAGGIMPRLLSLVHQS
FT                   DFRIQFEDKGRFSDFNALIPTYVIAAAQPGILGASVSLKQILTGASHVLF"
FT   gene            507215..507877
FT                   /gene="eda"
FT                   /locus_tag="lpa_00655"
FT   CDS_pept        507215..507877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="lpa_00655"
FT                   /product="multifunctional-2-keto-3-deoxygluconate
FT                   6-phosphate aldolase/(4-hydroxy-2-oxoglutarate aldolase)"
FT                   /EC_number="4.1.3.16"
FT                   /note="COG0800, Eda, 2-keto-3-deoxy-6-phosphogluconate
FT                   aldolase [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00655"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23719"
FT                   /protein_id="ADG23719.1"
FT                   /translation="MSFSEWKTQPGAVFAASPVIPVIVIKELEDVLPLAEALFAGGIHV
FT                   LEVTLRTPVAIKALELLINTFPDELIGAGTVITPGQLHDVAAAGARFAISPGQTRELLI
FT                   AGQKSEIPLIPGVASVSELMEGLGMGYNHFKFFPAAAAGGIPMLQAISGVFPQVKFCPT
FT                   GGINSKNYEEYLCLPNVVCVGGSWIVPEEAIKNHNWSLITELCMAVSSQKRELCSQN"
FT   gene            507991..509412
FT                   /gene="ywtG"
FT                   /locus_tag="lpa_00656"
FT   CDS_pept        507991..509412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywtG"
FT                   /locus_tag="lpa_00656"
FT                   /product="D-xylose (galactose, arabinose)-proton symporter"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00656"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23720"
FT                   /protein_id="ADG23720.1"
FT                   /translation="MAWIVAIIGSIAGFLFGYDEGIIAGSLGLVKNHFNLNATHIGVMA
FT                   SALPFGALFGSLLIGAFMASKCVKRFGRRSLLSFAGFLFFVGALGAGFAETISVLILSR
FT                   LILGLAIGMASVLTPLYLAETAAMQSRGAVVAIYQLALTVGIVCSYSVNYLLIEQQAWR
FT                   AMFASSAIPALLLTLGILFMPESPRWLCSVGRHDAAANSLRKLRGKQSVEQELKDIEAT
FT                   LANEPKQGNWLLLFQKPLLPVLMLGTILFCLQQLSGINVVIYFAPEIFKNLGLGSTTGQ
FT                   ILATMGIGLVNLLVTIIAILYVDKLGRRKLLLLGFAGTSLSLFALSLFSLNHVAWLSYL
FT                   SVICLMVYIFSFAISVGPIPHIAMAEIFPLHVRGAGMGMSSMSNWSFNTIVIFSFPVLH
FT                   QMFGIEVTFVLYAVICFLGFIYAYIYMPETRNISLEQIETYIMSGKPLRFLGREDEEVN
FT                   AVSTKSESSLLASTN"
FT   gene            complement(509502..510785)
FT                   /locus_tag="lpa_00657"
FT   CDS_pept        complement(509502..510785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00657"
FT                   /product="glucoamylase"
FT                   /EC_number="3.2.1.3"
FT                   /note="COG3387, SGA1, Glucoamylase and related glycosyl
FT                   hydrolases [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00657"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23721"
FT                   /protein_id="ADG23721.1"
FT                   /translation="MIFFVSQTMASVFTHEEVQILKKHFLNNFQTNGAIVASPSQYNPN
FT                   YYYDWIRDSAIAMGLVETWYEASQSARYKKLLLEYVSWTEKIQHQADPIAGQDILGEPK
FT                   FYINGNPFDGEWGRPQNDGPALRASVLIRFAQQLLDHNEIDYVKSHLYNNTMDPQSMGT
FT                   IKMDLEYIAHHWQDANFDLWEEVYGHHFFTAMAQQKALTDGAILARQLHDRQAAVFYEM
FT                   QANLINSRLQQHLDHQNKIIQATLLPHPGPQKTLELDSSVMLGILTNPQKEGVFAPHHT
FT                   FVRNTAKALHEQFNLMFPINKNRSGAILFGRYPGDTYDGYQTNSIGNPWFILTATMAEY
FT                   YFTMAHNLSLNSSNKLHIQNYLKKGDNYLRLIKQYGPDLNLSEQINLNTGVQQGATSLT
FT                   WSYVSVLRAIHLREQLENRIKTMGWNTY"
FT   gene            complement(510961..511212)
FT                   /locus_tag="lpa_00659"
FT   CDS_pept        complement(510961..511212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00659"
FT                   /product="transcriptional regulator, cro family"
FT                   /note="COG3655, Predicted transcriptional regulator
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00659"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23722"
FT                   /protein_id="ADG23722.1"
FT                   /translation="MSIIVNLDVMMAKRKCRLRDLAEAIGITEANLSILKNGKAKAIRF
FT                   ATLEAICAYLHCQPGDLLEYQSTEDITLSKTGLNLRKL"
FT   gene            complement(511299..511838)
FT                   /locus_tag="lpa_00660"
FT   CDS_pept        complement(511299..511838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00660"
FT                   /product="putative protein conserved in archaea"
FT                   /note="COG4079, Uncharacterized protein conserved in
FT                   archaea"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23723"
FT                   /protein_id="ADG23723.1"
FT                   /translation="MKKIKSVSHLLFLLFKTLAYGLPLVTTYFILFHFESMLNWGGWHS
FT                   LLSTPVKDPSHFSLLHRFIILLIEALPLSINVLICHQLAKLFRLYEHGYLFEEENIRLI
FT                   KNISIYLISGELIQLLYQPLITAALTFTNPSGQRIASITLGTANLSTLITAFIILIASW
FT                   IIKEAHKLKTDALLTI"
FT   gene            complement(511966..512961)
FT                   /gene="hemH"
FT                   /locus_tag="lpa_00661"
FT   CDS_pept        complement(511966..512961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="lpa_00661"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="COG0276, HemH, Protoheme ferro-lyase
FT                   (ferrochelatase) [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00661"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23724"
FT                   /protein_id="ADG23724.1"
FT                   /translation="MRRGLLLLNLGTPDNADIRAVKLYLREFLTDKRVIDLPTIPRYIL
FT                   VYCLILPFRSPKSAQAYQSIWTEKGSPLLYHSQNLVTKLQSALKDEYKIALGMRYGTPS
FT                   ITTALAELKDCHSLTILPLFPQYSSAATGSAIEKTLSYLANQEIIPSIKIIRDFYQRPE
FT                   YIQAQAKIMKPYIKDNFHVLFSYHGIPERHIHKSGCDTLCPQTCTPIYDKNQACYRAQC
FT                   YQTSLLLAKELQLGTHQYTTAFQSRLGKTPWIKPYTDEIFAELISKGIKNIVVSCPSFV
FT                   ADCLETLEEIGIRAKEQWEKLGGEQFILTPCMNDHPEWIKAIHSIVNEQI"
FT   gene            complement(513072..513305)
FT                   /gene="cspD"
FT                   /locus_tag="lpa_00662"
FT   CDS_pept        complement(513072..513305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspD"
FT                   /locus_tag="lpa_00662"
FT                   /product="cold shock protein CspD"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00662"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23725"
FT                   /protein_id="ADG23725.1"
FT                   /translation="MARGEVKWFNNAKGWGFIIPEGGGEDIFVHFSSIHGTGYKTLVPG
FT                   QAVTYDVVNGERGLHASNVVALSENAEQEEIA"
FT   gene            513542..513973
FT                   /gene="hit"
FT                   /locus_tag="lpa_00663"
FT   CDS_pept        513542..513973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hit"
FT                   /locus_tag="lpa_00663"
FT                   /product="Diadenosine tetraphosphate (Ap4A) hydrolase-like
FT                   HIT family hydrolase"
FT                   /note="COG0537, Hit, Diadenosine tetraphosphate (Ap4A)
FT                   hydrolase and other HIT family hydrolases [Nucleotide
FT                   transport and metabolism / Carbohydrate transport and
FT                   metabolism / General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00663"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23726"
FT                   /protein_id="ADG23726.1"
FT                   /translation="MFCIDDRIKSSSFILGEWPLSTVLLKNDASYPWFILVPRKMDIQE
FT                   IYQLEKSERFLLIEEINQLSLLVRDYFKPDKLNIGALGNIVPQLHIHIVIRSKNDPLWP
FT                   QGIWQSSMPSIPYPESELKSLLPTLGDLVRAYDKPQSLC"
FT   gene            complement(514187..514546)
FT                   /locus_tag="lpa_00664"
FT   CDS_pept        complement(514187..514546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00664"
FT                   /product="hypothetical protein"
FT                   /note="COG3324, Predicted enzyme related to
FT                   lactoylglutathione lyase [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00664"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23727"
FT                   /protein_id="ADG23727.1"
FT                   /translation="MIKKIAFTMYPVQNMDRARQFYEKTLGIKVGKISAEGAWVEYDLP
FT                   QGGCFAITTLAQGVIPSANSGGSVAFEVDNLDELVFQLKSKGVQFKIDLFASPVCRMAI
FT                   AVDSEGNAFTLHQLT"
FT   gene            514642..515985
FT                   /locus_tag="lpa_00665"
FT   CDS_pept        514642..515985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00665"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00665"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23728"
FT                   /protein_id="ADG23728.1"
FT                   /translation="MLKKLMFLLLLGAGLLSCGQSTDQQISNIITPKQFPSSPRDYRPV
FT                   QELPYLAWWKQFQDPELDRLIDTGLKTNMDIHIAMANLQQAQGELQQVKLSWIPNVQIL
FT                   GGYSTNPALGVPGGFYGIWPSYILNIMQLYTQQKRAQYQVQYHQAAIDGLRLTLIGQVA
FT                   AAYFTLIAQLEQLKLLYKLDRDLKSLIALSRKEINIGLKNDIDLAQLQSNERLIAAQIK
FT                   PIKHNIVVSQNALRYLINENPGLIKSKNNFAQLDFTRFKPGSLPASVLSNRPDMKMAEY
FT                   SLKAARAGIFVAYSDFFPVMQLDDFIGEAHLPDSTFEQATDAYVNWTINPNTLGKISVS
FT                   KGVYNAKLAEYVKTIRLILKEVDNAFSANKRMREQFLSYRHAQEDYQHKYKLQNGLLKS
FT                   GLMSYKELLESKVYLDTLALSTNQAKLELAMSLVMLYQDLAGGYACSD"
FT   gene            516125..517162
FT                   /locus_tag="lpa_00666"
FT   CDS_pept        516125..517162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00666"
FT                   /product="multidrug resistance efflux pump PmrA"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00666"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23729"
FT                   /protein_id="ADG23729.1"
FT                   /translation="MKKLMEYGGKIKEYLLRLKPKRWLTLTNVIIFIGFLTAIIYVFSY
FT                   LIPFTDNAFVVNNVRPVAALTSGYITELYVKNGDAVRKGQKLFTVFKKPYEYTVEQLSA
FT                   DLAGAQAKLAVLKATYERDLKLSENEQKIYKKLAQDDQKYLKGYAIKSVSLITLQNSQQ
FT                   ETKAAKDKWQASLKQLEIDQHQITVQENEIKSIQARLKNAKVNLDLTDVYAQGNGVIQN
FT                   LFFTIGTPVNINQPLFSLVDQDNIYIQANFNETDLRDVRKGSKVLIFPRMYLGRKIFHG
FT                   VIDSDYWSANRQLVDDRTQLQNVINENQWILLPQRLPVIIKVTDPDPKYPLRVGASAYV
FT                   YVEVY"
FT   gene            517140..518072
FT                   /locus_tag="lpa_00667"
FT   CDS_pept        517140..518072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00667"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00667"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23730"
FT                   /protein_id="ADG23730.1"
FT                   /translation="MSMSKFIEWIDKVDPYAVQRIALYKSLFIATVMAYVYWVFRPTNF
FT                   TAFFSPFLLVRFYESPSLTSFKEKEHFLIFIGVVVVLLSTSFYLVYPFRVVFFFFSIIA
FT                   LASVYFYVLKNYLPLRNVTMLIIASGATILSTEPPANWQIVYDIVGSSALSMIAIFICL
FT                   RFFPNQYLSVWKRALAKFIQSLEQDIEGSFSHRGPRFMQEEMTHLGMLRQYRRLIPKKY
FT                   MIYTQRISINIRNIQFSLDNLYYEAKNEAFWHGVKENLYTLRCAIKTNTSCDTPKMSIV
FT                   PESKLQQYVMRCLQQAFSHWNRLCMILQH"
FT   gene            518051..518938
FT                   /locus_tag="lpa_00668"
FT   CDS_pept        518051..518938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00668"
FT                   /product="Predicted membrane protein"
FT                   /note="COG1289, Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00668"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23731"
FT                   /protein_id="ADG23731.1"
FT                   /translation="MHDTSALKKKLDYARFIHLVIMFMVAMLIFLFSTFPEKWWVLITV
FT                   LSVSAGIEPGLIIRRAKHRIGGTLLALIILIPLLYLLQLNYRLISILFVLAIVGLSVAT
FT                   LNTRRYDISVFFITLVVFFLMAQTEEATSPRGPFEMVLNRGICTLFGVFIVLAGDYFLF
FT                   QAYRYSHRLYFFHQVMVYDFLNDIVRKIDESNTEKINTLLFVEKLRGQFTEHYLPISIS
FT                   SENLKLDFKTSEHTKKRIDIFQETIWEIRRLVFALCISEFVLHSSTASEQHLQRFKLLM
FT                   NKARTHFIQFEGRY"
FT   gene            518960..519340
FT                   /locus_tag="lpa_00670"
FT   CDS_pept        518960..519340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00670"
FT                   /product="Predicted transcriptional regulator"
FT                   /note="COG1733, Predicted transcriptional regulators
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23732"
FT                   /protein_id="ADG23732.1"
FT                   /translation="MPHPDYSVYNEKCPSHNVLEGISDKWSILVISLLSQKIYRFGELK
FT                   REIGGISPKMLTQTLLKLERYGFVQRQSYPVLPMKVEYSLTRLGKELSAILVLLTRWTE
FT                   TNMDKIIKAEKTFCEQKLGCQA"
FT   gene            complement(519342..519773)
FT                   /locus_tag="lpa_00671"
FT   CDS_pept        complement(519342..519773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00671"
FT                   /product="putative conserved protein"
FT                   /note="COG4278, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00671"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23733"
FT                   /protein_id="ADG23733.1"
FT                   /translation="MHPDLKDLLDYRNHKIITRYNMDYPTAAMQAEEALHELMKFIWLC
FT                   HKHKADKLLYPDDKNLDFSCVIHAEMADIDKMWHTFLLFTRDYHEFCDTCLNGIFFHHD
FT                   PLIGENIPVSEEDYALELTRYLTYIHDHLGSETLIKWFQ"
FT   gene            520035..520646
FT                   /gene="smtA"
FT                   /locus_tag="lpa_00672"
FT   CDS_pept        520035..520646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smtA"
FT                   /locus_tag="lpa_00672"
FT                   /product="SAM-dependent methyltransferase"
FT                   /note="COG0500, SmtA, SAM-dependent methyltransferases
FT                   [Secondary metabolites biosynthesis, transport, and
FT                   catabolism / General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00672"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23734"
FT                   /protein_id="ADG23734.1"
FT                   /translation="MNKRNWTAYYNSTKQNTLPRKSLLKAIANFEKEKINLSKSAIDLG
FT                   CGAGIDVMELLRCGWSVIAIDSQLSAIDSMLSSAQELTCANKLKTIVSSFEALDSLPKV
FT                   NLINASFSLPFLKPVYFYKFWNIILKGLKPDGRFSGSFFGFNDFWNTRTDMTFLNREMI
FT                   CHLFSQFKIEYFQEEEKDEMDALGYYKHWHKFFIVAKKIA"
FT   gene            complement(520801..521601)
FT                   /locus_tag="lpa_00673"
FT   CDS_pept        complement(520801..521601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00673"
FT                   /product="ankyrin repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00673"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23735"
FT                   /protein_id="ADG23735.1"
FT                   /translation="MGRSEMKIASAKLRELMKAVSEGHYETVNTILDKDPELVNQYVPP
FT                   TYDSPLARVLNKKYIDYKMLDILVKHHVDFDYPINHHKETPIELACKNQDLQLFKYLVQ
FT                   HNAPISEHAPHFLLVNSTNIKYLTEDKIKNTCEIIKLMGGLEAVSSKCNAEGNRFEELA
FT                   RKSQLINRFGGVVRYDYMQLLQSVYPIVDREVDTPTINASTEKLTNLLNKIRDQHISKE
FT                   GYDQQNLKDSISLFFMTGGEIPPSRKVPESRFEEAGIDTPKNTL"
FT   gene            521872..523872
FT                   /locus_tag="lpa_00674"
FT   CDS_pept        521872..523872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00674"
FT                   /product="putative conserved protein, contains RING
FT                   Zn-finger"
FT                   /note="COG5219, Uncharacterized conserved protein, contains
FT                   RING Zn-finger [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00674"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23736"
FT                   /protein_id="ADG23736.1"
FT                   /translation="MQNLDEILKKLGEDLKKTSKETANKLSVLSRKVAEDVVKVSDETV
FT                   QKINEVTKKLSVDTTVSTIDTQRILDDFMKNIRFSRFKQIWQAIEETPKSKHILLKSLF
FT                   LKGLLTHNKPLLEEIIRQIELIPYSSDLEMLGAFSQDKAHPLSPELLEFVQEMLANESE
FT                   KVLLTILMNAFQSIPELSLDSKTGTLSMKTKKELLPLLIANADTSIAKSIMSQLTDISF
FT                   DSVLPAFRPSIGDPSYQKTNINLSKYLSLVGDKTDISEFLILTIGLFTSLKIGDKGFLQ
FT                   ELSADYLFVRYDDCLHKIIEKLKEKEVIEQLGEEKIQKIMKAVESLQIFNPTSNDPRRF
FT                   FETRLAQYINGLSHSEKTIEIDSIGEDKEPEDEELRDNTLKACNKILQFFLGDCGRVDT
FT                   PREMEQKICIFANGYKDTSKFTKKEVEFITGVLHHAEAHKGRDRVERDKLTGIKERKFE
FT                   TDSEKVGSDVWNCGGGVMKGCSPVFYDAQRDPMRNMLVDSSTVAPDNKEGKQWFWNNNR
FT                   QYSSYVGSISGHTCNIVGMLAKYMENYKEDPDLPNDINLFLIQVIGVYAKRGFHAMLEV
FT                   IDVLHDPYVQDIFKGYGVQVNLYSYFKENPELAGFLQHAMNDATTYTQALVNKKHVKEA
FT                   LKSNSFFSKKDEESGDKKNDHTPKDGTVYGC"
FT   gene            complement(524298..524450)
FT                   /locus_tag="lpa_00676"
FT   CDS_pept        complement(524298..524450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00676"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00676"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23737"
FT                   /protein_id="ADG23737.1"
FT                   /translation="MNMFKALVYTLPEWHLLALSLWHNLFILFQDKGQTSLNKHHRKVH
FT                   NAAVK"
FT   gene            complement(524691..525467)
FT                   /locus_tag="lpa_00678"
FT   CDS_pept        complement(524691..525467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00678"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00678"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23738"
FT                   /protein_id="ADG23738.1"
FT                   /translation="MRGKREFLKHEYSPSHWSIDYTRAGTSIAVITVRNKYHYSVILNP
FT                   TDCRGYRIIIRYLNEGDSSLSSAFNRPYTVSEQRGLNDVASLMTQVYEKLGLIVQFSQL
FT                   GNNSQSFDKETGVTLIGSEEEPSMLHLHMWGRGDPDMEYIAGVPLRGPEPGLMFDLIAK
FT                   NKTHPINQHAIKWNEEELQACLAMFKLKLAEYVNSPEFTEEFGDTLKVTIHDKKDLGEA
FT                   KESGFGFFHKMKSASDGITTLEKTLALEDDKINPFV"
FT   gene            525833..526045
FT                   /locus_tag="lpa_00680"
FT   CDS_pept        525833..526045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00680"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23739"
FT                   /protein_id="ADG23739.1"
FT                   /translation="MDIHSTYKMLAKMQGNKELSSHKIAETEQAEAETVPQLKLQAEPE
FT                   AKPDMQNILSNMLGISSNKKHSPMD"
FT   gene            complement(526187..526378)
FT                   /locus_tag="lpa_00681"
FT   CDS_pept        complement(526187..526378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00681"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23740"
FT                   /protein_id="ADG23740.1"
FT                   /translation="MPKKIAETKTKTPVHTLICIRNKNIGNAALASTTKNRALLAESRQ
FT                   WLVAENPPAIFKPQKIIL"
FT   gene            526476..526820
FT                   /locus_tag="lpa_00683"
FT   CDS_pept        526476..526820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00683"
FT                   /product="IcmS"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00683"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23741"
FT                   /protein_id="ADG23741.1"
FT                   /translation="MERDISKCMAKIAASMNAKFYLNDRFVSFDEVFSETGLLPAIAKR
FT                   ADQLCSLCLGYGLGATYDESEGALLGIRVVFDEVTPNVLRLLCMTDVMNELIQGGPSRD
FT                   YTPLDELMYD"
FT   gene            526920..527282
FT                   /locus_tag="lpa_00684"
FT   CDS_pept        526920..527282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00684"
FT                   /product="IcmR"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00684"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23742"
FT                   /protein_id="ADG23742.1"
FT                   /translation="MGNNTDDSARNPFGFYTPPRVKEIGESDVTDATLGSVYSEIISPV
FT                   KDCILTVAKAVSFNPGGKDNTDAVDVLTELNTKVERAALNQPILTAKTERMFGAAESEK
FT                   SSEQPSHEERGFKLSS"
FT   gene            527373..527948
FT                   /locus_tag="lpa_00685"
FT   CDS_pept        527373..527948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00685"
FT                   /product="IcmQ"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00685"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23743"
FT                   /protein_id="ADG23743.1"
FT                   /translation="MKDQLSDEQKETILKALNDAIEKGPWDKSNFLRVIGKKLIAIRDR
FT                   FLKRIGAASQAKLKAESHLANRIALRSGQQEIYVSLYSSDGSNLQSWEKIVGSLPRQMI
FT                   SRPIYADEEDIKAILKTKENKQNEAYVAIYISQSDILHLSADKAPVDKLGKPLLTLKDK
FT                   SISLENISRFVHVSGVYRYSNGRLIKNA"
FT   gene            528135..529265
FT                   /locus_tag="lpa_00686"
FT   CDS_pept        528135..529265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00686"
FT                   /product="IcmP (DotM)"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00686"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23744"
FT                   /protein_id="ADG23744.1"
FT                   /translation="MAQQQQQSGSDNSMAPVWIVILLFITAYFVWALAHQYIVSFVFTI
FT                   NIWQARLVNLFLNNQLLANQIYLMQTLDPNTVNWDQMVTVMRAVGDYMRYPVICILVVL
FT                   AFVLYNSNVTLKYRKTYDMKSLRAQEQFNWPAIMPIVKEDLVSQDVNKGPWAMALTPME
FT                   FARKYNLLRKDDALLDNPVPGQEMTAGIRRGDAKRVFTMQLGPYWDGFERCSPQAYALS
FT                   AVFMARMNRDRDAANNILKVLDKTFVDGKPDFSVARPVMKKYQNSELVQEVVAKHAYVL
FT                   TVIASLLEAAREDGVVPSSEFLWLKPVDRRLWYMLNCVGRQTPYSEVAGPFAHWKAEKE
FT                   MGRRSLVPMIDEAIRALEIAVKEVRLTPRQMEELEP"
FT   gene            529262..531613
FT                   /locus_tag="lpa_00687"
FT   CDS_pept        529262..531613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00687"
FT                   /product="IcmO (DotL)"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00687"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23745"
FT                   /protein_id="ADG23745.1"
FT                   /translation="MMRGIDSRHELDPTLLLRDTRTFTQRLADFFADPTNISIVLISLA
FT                   AVSYYFSEAATFLLIMGSIFFLYSYTRKQKLPFRLPQISRAKDYNDLKPGINKPNIARG
FT                   ITFFGNDRKTGEELWFANDDMRTHALIFGSTGSGKTETLVSLSYNALVQGSGFIYVDGK
FT                   GDNSLYAKVFSMVRSMGREDDLLLINFMTGARDIVGPQEKRLSNTLNPFCQGSSSMLTQ
FT                   LVVSLMGSSGQSSDGDMWKGRAIAFVEALMRLLVYMRDEGAILLDANTIRNYFDLQRLE
FT                   SIVIDKVFPRDDQESVNIETIPKLVTDPLRNYLNTLPGYNKEKKGKQVSQVLEQHGFIT
FT                   MQLVRSFSSLADTYGHIIRTNLAEVDFKDVVLNRRILVVLLPALEKSPDELSNLGKIIV
FT                   SSLKAMMAAGLGEEVEGDYRDVILRKPTNAPTPYMCILDEYGYYAVQGFAVVPAQARSL
FT                   GFSAIFAGQDLPAFQKASKEEAASIGANTNIKICMKLEDPTETWDFFTKTAGEAYVTKV
FT                   DSFQTKETSIANSYMDTKSSSFEKRARVDLLDLKEQTEGEAHIFFKSKIVRARMFYANP
FT                   KPVKQLKINQFLKVEPPPDDYLMKLQKQLASFQSILESGDLSINKAVENEEITLISKAL
FT                   KESTIVEPIERGVAALIAFHGQNEPEPVEDIVEEEVEGALTIFSKLRIDPNAPPILVAD
FT                   KEVFSEPLLPINETRNQMITIECLAGAKDKYAGTVANELIKDFQIATSYPPEERDVIDV
FT                   QELTGIIRDLSAKISAEREKANKKAAEELT"
FT   gene            532017..532586
FT                   /gene="lphA"
FT                   /locus_tag="lpa_00688"
FT   CDS_pept        532017..532586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lphA"
FT                   /locus_tag="lpa_00688"
FT                   /product="LphA (DotK)"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00688"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23746"
FT                   /protein_id="ADG23746.1"
FT                   /translation="MRSLRTNYIYVLFKTTGLLFLLLLSACNRSGYIPENEVPKLPCRV
FT                   DGACDATIIKMMTDLNKKGIKVASVGQNYLISIPASALFADQSPRLNWASYSLLNEIAA
FT                   FLKQFRKIAITVTSYSSKYVSVKRERALTLARSRVVSEYLWSQGVDSRIIFTQGLGSDK
FT                   PITSYTLGGDRSPNARVEITFRRAVA"
FT   gene            532598..532882
FT                   /locus_tag="lpa_00689"
FT   CDS_pept        532598..532882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00689"
FT                   /product="IcmM (DotJ)"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00689"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23747"
FT                   /protein_id="ADG23747.1"
FT                   /translation="MSRETWALIKRNKNFNVHIYRRGLTLLILSLGLSCGLSGLIYYVH
FT                   IHEPERDFYATSGITPPIQLKPMSTPNMSSEALLPPDPPDEDSQRIIPQ"
FT   gene            532898..533536
FT                   /locus_tag="lpa_00690"
FT   CDS_pept        532898..533536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00690"
FT                   /product="IcmL (DotI)"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00690"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23748"
FT                   /protein_id="ADG23748.1"
FT                   /translation="MAEDALTVVALRNKFYKDSQRKVILALLIAIVVNVVLASLVVYMI
FT                   THPPAPKYFATSINGRITPLFPLDEPNQSDSAVLQWANQAAIAAFTYNFVNYRDELQAS
FT                   SGFFTAEGWDQFLGALEQSNNLDAVKAKKLVVSAVATRAPIILQKGVLNGRYSWRVQMP
FT                   ILVTYQSASEFTQQNNVVTMLITRVSTLNSPRGIGISQFVVGPASGGVS"
FT   gene            533539..534621
FT                   /locus_tag="lpa_00691"
FT   CDS_pept        533539..534621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00691"
FT                   /product="IcmK (DotH)"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00691"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23749"
FT                   /protein_id="ADG23749.1"
FT                   /translation="MKKYDQLCKYCLVIGLTFSMSCSIYAADQSDDAQQALQQLRMLQQ
FT                   KLSQNPSPDVQLGAGDGGDNAASDSTQQPNQSGQANAPAANQTANAGGDGQIISQDDAE
FT                   VIDKKAFKDMTRNLYPLNPEQVVKLKQIYETSEYAKASTAGTPPKPTATSQFVNLSPGS
FT                   TPPVIRLSQGFVSSLVFLDSTGAPWPIAAYDLGDPSSFNIQWDKTSNTLMIQATKLYNY
FT                   GNLAVRLRGLNTPVMLTLIPGQKAVDYRVDLRVQGYGPNAKSMPTEEGIPPSANDLLLH
FT                   VLEGVPPPGSRRLVVSGGDARAWLSNEKMYVRTNLTILSPGWLASMTSADGTHAYEMQK
FT                   SPVLLVSWHGKVMQLKVEGL"
FT   gene            534626..537772
FT                   /locus_tag="lpa_00694"
FT   CDS_pept        534626..537772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00694"
FT                   /product="IcmE (DotG)"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00694"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23750"
FT                   /protein_id="ADG23750.1"
FT                   /translation="MASKKENLKSLFSNTRTRVIIIFTAALLIIAVVIGFFKIRSATTS
FT                   SIAAAEVSTVPGGIQSIPGVLDPTAQYAKLQEEQNITQAQVAEKTGGSAIPTIIRTQAL
FT                   GEGVGVIGSQSGVGFAALAQEELGGPQRSLWIQELQDGGCSKSVITKVVNQGAQLTDLK
FT                   AACSCVQLKDSGYGLQELEQVCECKELKAAGYNARQLKEAGYSAGRLRNCGFDACELRN
FT                   AGFTAQEMKDGGFSDGELKGAGFSDAEIAKASGLPDGITADDVRKAGCGAAALAKLRQA
FT                   GVSASAIRKISGCTAEQLKAAGYTAKELKDAGFSAADLKRAGFSAAELKDAGFTARDLL
FT                   NAGFTPADLAKAGFSNAQIKAAQAELPPGITPQDVKNAGCDVEALKKEREAGVSAALIR
FT                   QYAGCSAQALKAAGFTDADLASAGFTPAQISAATPLSDAEIKAAGCDPDKLKKLFSAGV
FT                   SAKRIKELNGCSAEALKAAGYDAQSLLAAGFTPQELLAAGFTPKQLEDAGLNPASIIAD
FT                   GRVADCSVESLKKARAAGVSALTIKQTLGCSAAALKAAGYTAKELKDAGFTAAELKAAG
FT                   FSAKDLKDAGFTAKELRDAGFSAQELKDVGFSAKDLKDAGFSAAELKAAGFTAAQLKAA
FT                   GFSAKDLKDAGFSAAELKAAGFSAKELKDAGFSASDLKNAGFSAKELKDAGFSASDLKN
FT                   AGFSASELKNAGYSADELKKAGYTSAELRNAGFSPQESAVAGLQGPDLQQLDSSITGIP
FT                   SIPGATPRPTTSDAASSAEQLQAILQKQNEQLAEQKYQQEIQQRTSDMLSAATQLVQDW
FT                   KKVETQVYTEGTEETKTSGGESSVPGAGTGAGANNQPVEQGASGAQNQAIIKTGDIMFA
FT                   VLDTAVNSDEPGPILATIVTGKLKGSKLIGSFNLPSNADKMVITFNTMSIPGAEKTISI
FT                   SAYAIDPNTARTALSSRTNHHYLMRYGSLFASSFLQGFGNAFQSANTTITIGGTGGGNN
FT                   ITVANGVGRSTLENAVIGLATVGKAWSQQAQQLFNTPTTVEVYSGTGLGILFTQDVTTI
FT                   "
FT   gene            537787..538596
FT                   /locus_tag="lpa_00697"
FT   CDS_pept        537787..538596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00697"
FT                   /product="IcmG (DotF)"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00697"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23751"
FT                   /protein_id="ADG23751.1"
FT                   /translation="MMAEHDQNNDEYKFAELDSYDMDQAGESDLDSEASFQSGKEGLTK
FT                   KKDIKRNALIAIGAVVFIMVMYKIIGWMFFSDKSSQVTTKPAIPPVTQVATPQPVQTIP
FT                   TTTPIQQVQPTTIIEDDPDLKKKVSAIELTQQSLRSEVNALGEQINAVNNNIKNLNAQI
FT                   VNLNQIIGNMSNQIARQSEVINVLMARTTPKKVVKVSRPTVPVRIIYYIQAVIPGRAWL
FT                   IGSNGSTLTVREGSKIPGYGMVKLIDSLQGRILTSSGQVIKFSQEDS"
FT   gene            538604..539188
FT                   /gene="icmC"
FT                   /gene_synonym="dotE"
FT                   /locus_tag="lpa_00698"
FT   CDS_pept        538604..539188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmC"
FT                   /gene_synonym="dotE"
FT                   /locus_tag="lpa_00698"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00698"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23752"
FT                   /protein_id="ADG23752.1"
FT                   /translation="MADPTCTGGTVACWIVSQANILANIANQLEPVQRLITGGAYLIGC
FT                   AFIFKAIYSLKVYGEARTMMSSNTSMKEPVMYLMVGALLIYFPSLVSSVLQTTFGYSNP
FT                   LAYSGGVSSGSDTISALFGSGSLVGRPLVMIIRVIGLIAFVRGWVLIARSASQGQPPGG
FT                   TGKGLIHVFGGILAINIVGTVDMINNTLYGT"
FT   gene            539214..539612
FT                   /gene="icmD"
FT                   /locus_tag="lpa_00699"
FT   CDS_pept        539214..539612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmD"
FT                   /locus_tag="lpa_00699"
FT                   /product="IcmD (DotP)"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00699"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23753"
FT                   /protein_id="ADG23753.1"
FT                   /translation="MNIKVIHKSGYKHWLVSAACLALLTLICQDAAAGVSLGKMASQIT
FT                   GSFTSLTKLITAGSYLAGLGFSIGAIMKFKQHKDNPTQIPIGTPIALIFIAAALLFLPS
FT                   ILGVAGVTMFGSSGGKTAGPTGTIYKTN"
FT   gene            539812..540438
FT                   /locus_tag="lpa_00700"
FT   CDS_pept        539812..540438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00700"
FT                   /product="IcmJ (DotN)"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00700"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23754"
FT                   /protein_id="ADG23754.1"
FT                   /translation="MADNQQRCELKLIASPGSWRLYSARKIDERFKSYEQKIFQRDRYT
FT                   CQFCGFQARLYQDIVNLDGDYTNNRLSNLVTACCFCAQCFFVESVGVGGYGGGTLIYLP
FT                   ELTQAELNSLCHVLFCAITNDTGYKSSAQNIYRSFKFRSQIVEEKFGEGTSDPAIFGQL
FT                   IIDSGVNSEEIREKLFKNIRLLPSRAKFRKQIEKWAASALEEIAD"
FT   gene            540474..543503
FT                   /locus_tag="lpa_00701"
FT   CDS_pept        540474..543503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00701"
FT                   /product="IcmB (DotO)"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00701"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23755"
FT                   /protein_id="ADG23755.1"
FT                   /translation="MANWSESFFEGVDTFFAWLSTSLKQTTESYIDLETADSPTVLVNH
FT                   DGSLLSVLKIEGITGLAGPEEFERLVEGLANSFQAAMGRPGHALQVYFSHDKQNIVKMI
FT                   KDIYDPAEATASRLELNLRDLFEERVNYLSQYCAEERVYFVLYTRPFNLASDQLKAANK
FT                   AKMKMIKDTKAPPFKNTQTIFAAVPEIRDTHDAYVRAILNDLDALNVIAKLLEVHDAIH
FT                   AIRMTGDPDYTADDWRATLPGDKIPVRELNNFEGDPSDLLWPPLSKQVLPRDAEIIDLR
FT                   TVRVGDKIYSSTYIDLFPKDVRPFISLFSRILPSHVPWKISFLLESEGLSTIKLKGLLA
FT                   AILSFSSAQNRLISDSVNLLKYIQLNTDEAIVRLRVVATTWAPEGNIPLLRRRSSELVK
FT                   AIEGWGSTDVSEICGDPFAGFVSSMLATTLNSSAVASVAPLSDVISMLPITRPASPWKT
FT                   GALLFRTPDGKPWPFQPGSTEQTTWIDLVYARPGSGKSVLSNALNLALCLSGGLMRLPR
FT                   IAIIDIGPSSSGLISLLKEALPASKRHLVAYHRLRMTPDYSINPFDTQLGCRYPTALER
FT                   SFLVNFMTLLTTPLGAAKPYDGMADLAGMVVDELYKSMADEFNPTPYAPGIEEFIDSIL
FT                   EEIGFVRDAKSTWWEVTDSLYSAGFVHEAMLAQRYAMPLLADAASICRTPSIEDLYEKI
FT                   TAPTGESLINAFSRMISSAVREYPILSRVTSFDIGDARVVSLDLDEVAKSGGDAADRQT
FT                   AVMYMLARYVLARHYYLTEESLNNVPEQYKEYHKQRVLEIREDHKRIVYDEFHRTAKSS
FT                   AVREQVIIDMREGRKWKVQISLLSQAVDDFDPVMIDFATAIYVMDAGPSQAVEKTSQIF
FT                   GLSETAKIALRTRVHGPRQGGATFLAQFATKTGINVQLLTLTLGPVELWAFSTTAEDAT
FT                   VRNLLYRHLGPSEARRLLAALFPNGTVTKELEARLASMKQKVGLIEDDEREGMINQLVN
FT                   DILDAYSKDPNVKSLPAKVG"
FT   gene            complement(543649..544905)
FT                   /gene="tphA"
FT                   /locus_tag="lpa_00703"
FT   CDS_pept        complement(543649..544905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tphA"
FT                   /locus_tag="lpa_00703"
FT                   /product="proline/betaine transport protein like protein"
FT                   /note="COG2814, AraJ, Arabinose efflux permease
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00703"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23756"
FT                   /protein_id="ADG23756.1"
FT                   /translation="MNQNTKHSIIAGLYGNALEWYDFLLYASFAPVFAEIFFPSKIHFV
FT                   SLIATFSLFAIGFIMRPIGGLLLGHYADHVGRRKALILSMSVMTISTALIAVLPDFNSW
FT                   GIIAPLLFSILRLIQGLAVGGELPGSTTYLIEHMFQQSRELAGSLVLSSAFLGIFIGAL
FT                   TASIFSTLFTGDALLNWGWRYAYLLGGILGILGIYLRIKSFESPTFLKDKHTAELPAKV
FT                   VFTRFKQQLFLSVIITSILAMSNYVLIAYVTTFLVKSEYFLLKDALLINLIALALLTVL
FT                   IPLMGFLSDVVGRKPIFLIGLFSLCILIFPFFWLLLSGSWWKALCSELLLAIALAPINA
FT                   TVPTIIAEMFPTSVRASGISISYNIGQALFGGTMPLVAFTLIELSSNKMAPAWYLFLWI
FT                   LIVIPITISIRESYQKELT"
FT   gene            complement(544908..547829)
FT                   /gene="icmF"
FT                   /locus_tag="lpa_00704"
FT   CDS_pept        complement(544908..547829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmF"
FT                   /locus_tag="lpa_00704"
FT                   /product="putative protein conserved in bacteria"
FT                   /note="COG3523, IcmF, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00704"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23757"
FT                   /protein_id="ADG23757.1"
FT                   /translation="MDNSLRALCDAIKKILSQLKPQANQLSFIVITGKNAQGKSALLKQ
FT                   SNMEEMPVFSEEHAKLYFNQKGIIVELGENWLTNSKTLLLTTLKQLNKCNRHLKITGLI
FT                   LCVDVNDLLIAEPAQFTEQKKSHLQLIQRLGVNLGYQAELAIIFTKMDTLAGFSEFYQM
FT                   DHVNDLSKPLGFSLDCVNQSSKKIETFSLQFNQLIEALGQQVINKMHPVRSTIKRSLIR
FT                   EFPLQLASLRAPIQSLIQGISPKLFHVHSIFFTSAEQGGVSVDRLNKKIQHEYALVVQD
FT                   TFPQATNFRSYFVEGALKTIQEQCIQVPQTTKFSQKPFIAVAVSLAGLSLLTLIYNHYK
FT                   TAHILDEASKELLAYEALNNQGTSGAQALYHLSQAANKMNHITSNSISLPTVHQLKLNL
FT                   HNNAQNRLQGEFLPSLANELEQVITSPGNTPITRYKALKIYLMLGDSKYFSSQPILDWF
FT                   QQQWQGRAPGTTQKQLALLKQTLSNPPQNIPIKSQIISDARNYLNALPTSYLYYSIAKE
FT                   YFPQEKQKIVIEGFSIPTDEVPTYFTKTGFTKIINELPKITSTLQSENWVLARQDLSQL
FT                   HNMLIQAYCFDYVTWWQTFMKKSQPLRYQDYQQGRQLTKLIQQSNSFYKFANLIQQETK
FT                   PDLTEGISTFNQFIANQFTDLNLTTLSSIKELDFRISELERFIATLSVVNDGGKTAFTI
FT                   TRSRFLNENSSDPVSLLYSQARQLPEPLSSWTKQIAGDIWVILIRDSRQYINNQWQKTV
FT                   YREFQNSIAQRYPFDSSQTAEIDIADFNRFFSTHGLLNTYSEQYIKPFLDTSSPEWKPK
FT                   AVNDFILPISNEVIDELIRANIITNMFFPDHSDESKIDFSLQKISLDPVVSNLVLEIGG
FT                   TKLMDNQTSDSLIRFTWPQNNAKLALDSIEGNHYELAEYGTWAIFKLLEKVNVLVDEQD
FT                   SSSLQILFEVNSNSGRYLLKTNNQINPFTPGILNGFTLNDHIA"
FT   gene            complement(547829..548614)
FT                   /locus_tag="lpa_00705"
FT   CDS_pept        complement(547829..548614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00705"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23758"
FT                   /protein_id="ADG23758.1"
FT                   /translation="MTTEQYPSSLVNRLAITEPALVPSGYYRSKLFIAPFSTNVLVAAA
FT                   GPILSLLERLCLSPSLPPVEDIRENIQHELRAFHSKLDASKYPLDIISIAQYLLSATID
FT                   EILGKSYLRVYNLTTEFKSFTPLSSDGAQPQQRFFEILNYIKERPNQFLDLIELAYFCL
FT                   IAGFEGEYHLKADGRQCLDNTIEDLYQIIQKYRFNKPHRLFNENPLPKTIKKNYKATWI
FT                   TTIAAVGIVILAFVTSHVLLENKAKTVLFGHTQLAMLEN"
FT   gene            complement(548899..550488)
FT                   /gene="purH"
FT                   /locus_tag="lpa_00707"
FT   CDS_pept        complement(548899..550488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="lpa_00707"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase"
FT                   /EC_number="2.1.2.3"
FT                   /note="COG0138, PurH, AICAR transformylase/IMP
FT                   cyclohydrolase PurH (only IMP cyclohydrolase domain in
FT                   Aful) [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00707"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23759"
FT                   /protein_id="ADG23759.1"
FT                   /translation="MAKKQIYSSFNPRRALLSVSDKRGIRELGQALHDHGVELIATGNT
FT                   AAILREHKLPVTDVSECTGFPEIMDGRVKTLHPAIHAGLLARGEQDSPVLKQHGIKPID
FT                   LLVVNLYPFEQVINHPDCDFNKAIENIDIGGPAMVRAAAKNHAHTYVIVDPNDYPKLIH
FT                   YLQDQKAPSHWNFALAKKAFAHTAAYDAAIANYLTTLDNDYVPTGFPDILTCQFNKITD
FT                   LRYGENPHQQAIFYADKNSHPGSLGTAALLQGKQLSYNNILDADAALDCVKSFSNEKSV
FT                   CVIVKHTNPCGIALSDTSLDAYLKAFQSDPISAYGGIIAFNGTLDSDTAKAILEKQFVE
FT                   VIIAPDANEEAKKILAAKENIRVLLTGFWQQGTNFRLNMKKVDGGLLVQEHDSLSLESC
FT                   ELQTVTQAKPTDEQLQNLMFAWLAAKHVKSNAIVYANDLATIGIGGGQTSRVMSARIGL
FT                   WQAEQMGFDPQGAVMASDAFIPFPDTIEIAAKAGISAIIQPGGSIRDEKIISCADQHNI
FT                   AMIFTGVRHFKH"
FT   gene            complement(550515..551384)
FT                   /gene="prmA"
FT                   /locus_tag="lpa_00708"
FT   CDS_pept        complement(550515..551384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="lpa_00708"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COG2264, PrmA, Ribosomal protein L11 methylase
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00708"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23760"
FT                   /protein_id="ADG23760.1"
FT                   /translation="MWFQLKIEHCPNDKIEEITEELEEYGALSITLTDKNDNPVLEPEP
FT                   GTTPLWPEVIIHALFAQAEEAQYVREQLVAKRPSLHCSLELLADKNWERAWMDDFRPQR
FT                   FGNRLWVCPTWLPPPEPDAVNLMLDPGLAFGTGTHATTSLCLTWLEQADLKNKSVIDYG
FT                   CGSGILSLAAIKLGAKHVYAVDIDNQALQATQNNAHANHITESQLSISSPEALQNPVHL
FT                   IIANILLAPLISLKERFHQLLPSGAHLVTSGILEEQAPLLIDAYDSAFTHIATEYCEGW
FT                   SLLVFTSK"
FT   gene            complement(551386..552729)
FT                   /gene="accC"
FT                   /locus_tag="lpa_00709"
FT   CDS_pept        complement(551386..552729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="lpa_00709"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase
FT                   subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="COG0439, AccC, Biotin carboxylase [Lipid
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00709"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23761"
FT                   /protein_id="ADG23761.1"
FT                   /translation="MLSKIVIANRGEIALRILRACKELGIQTVAVHSDVDKDLLHVRLA
FT                   DETVCIGPAPAQKSYLNIPAIISAAEITDAVAIHPGYGFLSENADFADIVEQSGFRFIG
FT                   PRGDSIRLMGDKVSAIAAMKAAGVPCVPGSDGPLGDDDNKNLELARKIGYPIIIKAAGG
FT                   GGGRGMRVVHSESNLLSAIALTRSEAKAAFNNPIVYMEKFLENPRHVEFQVLGDGKGHA
FT                   IHLGERDCSMQRRHQKVVEEAPAPGITPELREEIGASVIKACKELQYRGAGTFEFLFQD
FT                   GCFYFIEMNTRIQVEHPVTEMITGIDLIKEQIKIASDIPLTLTQKDIKLRGHAIECRIN
FT                   AEDPRNFMPSPGTIKLLHQPGGPGIRFDSHIYSSYVVPPNYDSMIGKLISYGATRAEAI
FT                   ARMRNALDEIIIDGIKTNIELHQRILHDKSFMEGGTNIHYLEKMLKDS"
FT   gene            complement(552742..553224)
FT                   /gene="accB"
FT                   /locus_tag="lpa_00710"
FT   CDS_pept        complement(552742..553224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="lpa_00710"
FT                   /product="acetyl-CoA carboxylase biotin carboxyl carrier
FT                   protein"
FT                   /note="COG0511, AccB, Biotin carboxyl carrier protein
FT                   [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00710"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23762"
FT                   /protein_id="ADG23762.1"
FT                   /translation="MDIRKIRKLIELLEETGISEIEIKEGEESLRLSRHSNIVAETAPQ
FT                   IHYVAPSAVKQTPSAPSSNTSTTEPHVVENKQVTSTSSGHKIRSPMVGTMYTAPSPESP
FT                   PFVTVGQSVKAGDTLCIIEAMKMFNEIEADRAGKIVEILVKNGDPVEYDQALFIIE"
FT   gene            complement(553237..553920)
FT                   /gene="aroQ"
FT                   /locus_tag="lpa_00711"
FT   CDS_pept        complement(553237..553920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="lpa_00711"
FT                   /product="3-dehydroquinate dehydratase II"
FT                   /EC_number="4.2.1.10"
FT                   /note="COG0757, AroQ, 3-dehydroquinate dehydratase II
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00711"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23763"
FT                   /protein_id="ADG23763.1"
FT                   /translation="MGITQGDICYKRFRHKLFLAQEINKNIIILKSVHSLSTIHCFLLN
FT                   IKFLAKLAEILPISSQIYRHVHKVQAKSANLRLYRCVMKKILVLHGPNLNLLGSREPSI
FT                   YGHASLTEINGDLIQEADNAGIRLSCFQSNAEAELIQAVHQAGIDKINYIIINPAAFTH
FT                   TSIALRDALSAVAIPFIEVHLSNIFSRETFRHHSYFSDIAVGVISGLGTKGYLLALQAI
FT                   IKELK"
FT   gene            553876..555666
FT                   /locus_tag="lpa_00712"
FT   CDS_pept        553876..555666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00712"
FT                   /product="oxaloacetate decarboxylase, alpha subunit"
FT                   /EC_number="4.1.1.3"
FT                   /note="COG5016, Pyruvate/oxaloacetate carboxyltransferase
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00712"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23764"
FT                   /protein_id="ADG23764.1"
FT                   /translation="MSKTFITDVTLRDAHQCLIATRMRTEDMLPICNKMDDVGFWAMEV
FT                   WGGATFDACLRFLKEDPWSRLRQLRQALPNTQLSMLLRGQNLLGYRNYADDVVRAFVKL
FT                   AVNNGVDVFRVFDALNDARNLKVAIDAIKSHKKHAQGAICYTTSPVHTLDNFLELGKKL
FT                   AEMGCDSIAIKDMAGLLTPTVTVELYAGLKQATGLPVHLHSHSTSGLASICHYEAVLAG
FT                   CNHIDTAISSFSGGASHPPTEALVAALTDTPYDTELDLNILLEIDDYFKAVRKKYSQFE
FT                   SEAQNIDPRVQLYQVPGGMISNLYNQLKEQNALDKMDAVHKEIPRVRKDLGYPPLVTPT
FT                   SQVVGTQAVINVLTGERYKTITNEVKLYCQGKYGTPPGKISSALRKKAIGRTEVIEVRP
FT                   GDLLPNELDQLQNEISDLALSDEDVLLYAMFPEIGRQFLEQRKNNQLIPEPLLTQSSAP
FT                   DNSVMSEFDIILHGENYHVKVAGYGMIEHGQQSCFLWVDGVPEEVVVQHSELHDKIERS
FT                   SVNNKIGPGDITVAIPGSIIAIHVSAGDEVKAGQAVLVIEAMKMETEIKAPANGVVAEI
FT                   LCQKGDKVTPGQVLIRVEVS"
FT   gene            556232..557863
FT                   /gene="lasB"
FT                   /locus_tag="lpa_00713"
FT   CDS_pept        556232..557863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lasB"
FT                   /locus_tag="lpa_00713"
FT                   /product="Zinc metalloprotease (elastase)"
FT                   /note="COG3227, LasB, Zinc metalloprotease (elastase)
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00713"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23765"
FT                   /protein_id="ADG23765.1"
FT                   /translation="MHPNYYLSPLAVAIALGIASPVKAADPIPLQKSSFSEVTQKFQLT
FT                   LPGVMKGAVVSTNSLQFIRQHTDGNKVTHVRMQQQYAGFPVFGGYAILHSKNATPSLAT
FT                   AKSDVKMNGVIYDGLQAELGQPKPSFVKNASMALQQFKDKYANKQVSEDQVTPMIYIDE
FT                   KHQAHWAYKVSVLVIHDDRIPERPTAIIDAETNKPFVQWDDVKTEKVQAKGMGFGGNRK
FT                   IGEYQFGKDLPLLEITRDSSVEMCFMENTDVKVVDMGHKYYSNNKPMQFTCKETPDTQS
FT                   TKTYYTGYSADGYDRDNGAASPTNDALYAGYVIKHMYHDWYGVEALTKSDGSPMQLVMR
FT                   VHYGQGYENAYWDGKQMTFGDGDTMMYPLVSLGVGGHEVSHGFTEQHSGLEYFGQSGGM
FT                   NESFSDMAAQAAEYYSVGKNSWQIGPEIMKEDSGYDALRYMDKPSRDGMSIDVADDYYG
FT                   GLDVHYSSGVYNHLFYILANQPNWNLRMAFDVMVKANMDYWTPYSTFDEGGCGMLSAAK
FT                   DLGYNLDDIKKSLSEVTINYQSCYVD"
FT   gene            complement(557865..558713)
FT                   /gene="mhpC"
FT                   /locus_tag="lpa_00714"
FT   CDS_pept        complement(557865..558713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpC"
FT                   /locus_tag="lpa_00714"
FT                   /product="Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00714"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23766"
FT                   /protein_id="ADG23766.1"
FT                   /translation="MKTKILSIPGLSIACKVWGNPDNPPILALHGWLDNANSFDDIAEH
FT                   LQNDYYFIAVDLPGHGHSSHLPPGCIYHFTDGIFTVVEIINALGLNKLHLLGHSMGACL
FT                   GSLVAGVAPDRFLSLSLIEGLGPFSHPAETACQQLSKYLDYLSQKQSKKAKGYNKFEHA
FT                   ALARSVKGYVSLDIAKSLCERGIQQENGLYYWRHDRRLLAPSPLQMTEAQVLSCLTEIK
FT                   AQTYLIWASKGFSFDSDKMKARIQAVKNIKIEKLDGGHHIHMEKPEVISRLLAEFYQSI
FT                   K"
FT   gene            559182..559937
FT                   /locus_tag="lpa_00716"
FT   CDS_pept        559182..559937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00716"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00716"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23767"
FT                   /protein_id="ADG23767.1"
FT                   /translation="MQPEVRSVSLITYNIHKGFGVGAVRFLLPEMRDAIAGLNPDFVFL
FT                   QEVQGKHRKREKRIVSWPDSPQCEYIAENIWPHYVYAKNAVYQSGHHGNAILSKYPFES
FT                   FESINLSNMNRASRGILHTQLKLDNNIIHLLCVHLGLFKAERTEQCKALIQRIKDVVPK
FT                   NEPLIMAGDFNDWRHVISKILAENLGIEEAFVALEGQHARSFPAIKPALCVDRVYFRGM
FT                   KVQEVACLQGKPWRMLSDHLPLYARFELL"
FT   gene            complement(560116..561126)
FT                   /locus_tag="lpa_00720"
FT   CDS_pept        complement(560116..561126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00720"
FT                   /product="fructose-bisphosphate aldolase, class I"
FT                   /EC_number="4.1.2.13"
FT                   /note="COG3588, Fructose-1,6-bisphosphate aldolase
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00720"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23768"
FT                   /protein_id="ADG23768.1"
FT                   /translation="MSYEELSNTMEQMLHEGKGILAADESNSTIGKRFASINTENTEEN
FT                   RRDYRLLLATTPDLEQYINGVILFEETFTQTDEHGTPIPELFANKGIIPGIKVDKGLVD
FT                   LANTEHEKVTQGLDGLTERLLHFKKLGAKFAKWRNVYSISEYTPSLTAIKTGAENLGRY
FT                   AAACQSVGIVPIVEPEVLMDGNHSIEHCAEVCEMVLHELFHTLFIHQVELEHIILKPSM
FT                   VTCGKEVTPFSDPEEVADYTISVFRNNVPASVPTINFLSGGQTPQQATANLNAINQIGH
FT                   QPWLLSFSFGRALQEDCLKEWCGNKANIAKAQEALIKRARLNSMACLGEYQNDME"
FT   gene            complement(561276..561968)
FT                   /gene="poxF"
FT                   /locus_tag="lpa_00722"
FT   CDS_pept        complement(561276..561968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="poxF"
FT                   /locus_tag="lpa_00722"
FT                   /product="phenol hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00722"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23769"
FT                   /protein_id="ADG23769.1"
FT                   /translation="MISPKVKHFIFNCELSPPFEYLPGQFITIHFEHDGKNLKRSYSIA
FT                   NEPKKDNRIEFAAGYFEGGPGTELLYNLKPGDVIHINGPFGRLIFKDETPGRYILVATS
FT                   TGTTPYRAMLNELGQRIEKHPDLQVVILQGVQRSEEILYPDDFQAFAKKYPQASFRPYL
FT                   SRVQKQDLKDNEYSGYVQHAFPELNLNPTRDMVYLCGNPGMIDEAFNYLKEHGFPMQHI
FT                   VREKYISR"
FT   gene            562094..562636
FT                   /locus_tag="lpa_00724"
FT   CDS_pept        562094..562636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00724"
FT                   /product="IcmC (DotV)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00724"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23770"
FT                   /protein_id="ADG23770.1"
FT                   /translation="MNTIDLITILGNISQSLYPVQKLITGGAYILGVLFFLTAIGKLKK
FT                   IGDHRAQSSSQEKMFTPMMYLLVGALLIYLPSGMDLMANTAFGVGNVLTYSNYNPANIY
FT                   SSMGFLIRTAGVLWFIRGCVLVAHSSQPGTQQGLKGLVFLIAGVFAMNFDNTIAMINSA
FT                   LDYFVKATLSVKAAAGF"
FT   gene            complement(562838..563122)
FT                   /locus_tag="lpa_00726"
FT   CDS_pept        complement(562838..563122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00726"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00726"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23771"
FT                   /protein_id="ADG23771.1"
FT                   /translation="MSNRKNKTIVIEGVTSQGKTFRPSDWAERMSGSLAVFKNSRIYYS
FT                   PLLQPSVNSEGYKCVLLDPKLKESSPQVYQAIMDFAKANNLKICGEEDL"
FT   gene            563352..564089
FT                   /locus_tag="lpa_00729"
FT   CDS_pept        563352..564089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00729"
FT                   /product="CDP-diacylglycerol-serine-O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /note="COG1183, PssA, Phosphatidylserine synthase [Lipid
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00729"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23772"
FT                   /protein_id="ADG23772.1"
FT                   /translation="MNKENHSGIYLLPNLLTTVSLFAAFYSIVASTKGQYEAAIVAMFI
FT                   GMIADSLDGRIARLTNTQTEFGAQYDSLSDMVTFGVAPSLLLYNLTLHQLGKFGWLVAF
FT                   IYTAAVALRLARFNTQIGKSDKRYFQGLPCPPAAAVMASFAWICFQNEWANLIVSLFTA
FT                   VLALIVSVLMVSNLRYYSFKEVDYKGKVPFLYVLVMILLFVAIAANPAIVLFASSGIYA
FT                   LSGPMLTVISLHKMRKQRRNMSK"
FT   gene            complement(564331..564600)
FT                   /gene="ptsH"
FT                   /locus_tag="lpa_00730"
FT   CDS_pept        complement(564331..564600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="lpa_00730"
FT                   /product="sugar transport PTS system phosphocarrier HPr
FT                   protein"
FT                   /note="COG1925, FruB, Phosphotransferase system,
FT                   HPr-related proteins [Carbohydrate transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00730"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23773"
FT                   /protein_id="ADG23773.1"
FT                   /translation="MIKTKIKIINRLGLHARASAKFVSTAAKFQSHIDVTKDTQTVNGK
FT                   SIMGVMMLAANKGSELTLEIDGPDEERMNEALVELINNRFGESE"
FT   gene            complement(564791..565090)
FT                   /locus_tag="lpa_00731"
FT   CDS_pept        complement(564791..565090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00731"
FT                   /product="putative sigma-54 modulation protein"
FT                   /note="COG1544, Ribosome-associated protein Y (PSrp-1)
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00731"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23774"
FT                   /protein_id="ADG23774.1"
FT                   /translation="MQINITGHGMDVTPALRAFTEEKFDKLERHFDHIRAINVVFDVEK
FT                   VRQIAEATVLVTKGELHASSESEDMYAAIDTLVDKLNRQLIKHKEKLLAHRDRD"
FT   gene            complement(565117..566511)
FT                   /gene="rpoN"
FT                   /locus_tag="lpa_00732"
FT   CDS_pept        complement(565117..566511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="lpa_00732"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /note="COG1508, RpoN, DNA-directed RNA polymerase
FT                   specialized sigma subunit, sigma54 homolog [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00732"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23775"
FT                   /protein_id="ADG23775.1"
FT                   /translation="MKPTLQIGIGQHLTLTPQLQQAIRLLQLSTFDLQQEIQLVVESNP
FT                   LLEATPVEEKEDAQINTNQDQDEYSDFQWSQLYNNLNKRNNFEENDYNFDNLHCTTTNL
FT                   QDHLNWQLDLTPMSDIDRVIATTIIDAINDDGFLTIPVAEIHASLNSDDFPLDIEEIEA
FT                   VRHRLQLFDPVGCASVNLAETLVLQLEQLPLEPKLLATAKKVILEDIELLGQHNYRQLM
FT                   KNHQISEKTIHEILQVIHKLNPKPGSLIHQDNIEYVIPDLTVKKIDNQWKVFLNQDILP
FT                   RLSINSQYAALIQRANNSLDNQFLKHNLQEARWFLKSIQSRQETLLKVATCIMEYQHGF
FT                   LEFGEEAMKPLILNDVASALDMHESTVSRVTTQKFINTPRGVFELKYFFSSHVNTDSGG
FT                   ECSSTAIRAVIKKLISAENRKKPLSDSKIAQLIGEQGIKVARRTVAKYREAMGIPPSNE
FT                   RKVISS"
FT   gene            complement(566723..566887)
FT                   /gene="rpmG"
FT                   /locus_tag="lpa_00733"
FT   CDS_pept        complement(566723..566887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="lpa_00733"
FT                   /product="large subunit ribosomal protein L33"
FT                   /note="COG0267, RpmG, Ribosomal protein L33 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00733"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23776"
FT                   /protein_id="ADG23776.1"
FT                   /translation="MAAVTIKVKMESTAGTGYYKTTTKNPRNHPEKMELMMYDPKVRKH
FT                   VLFKEKKVK"
FT   gene            complement(566902..567102)
FT                   /gene="rpmB"
FT                   /locus_tag="lpa_00734"
FT   CDS_pept        complement(566902..567102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="lpa_00734"
FT                   /product="large subunit ribosomal protein L28"
FT                   /note="COG0227, RpmB, Ribosomal protein L28 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00734"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23777"
FT                   /protein_id="ADG23777.1"
FT                   /translation="MVGHKVSHANNKTKRRFLPNIQNHKFWVEEENRFVTLRLSTKGMR
FT                   IIDKLGIKAVLDKIRAKGEKI"
FT   gene            567236..567397
FT                   /locus_tag="lpa_00736"
FT   CDS_pept        567236..567397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00736"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00736"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23778"
FT                   /protein_id="ADG23778.1"
FT                   /translation="MKYKSGFITKKPKYCNIFTLFSLKTDFSGLLSKQVSGKSRIFNQN
FT                   QYNPEILY"
FT   gene            567407..568084
FT                   /locus_tag="lpa_00737"
FT   CDS_pept        567407..568084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00737"
FT                   /product="S-adenosylmethionine-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00737"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23779"
FT                   /protein_id="ADG23779.1"
FT                   /translation="MQRKIKSYVLRAGRISNRQQQGLDLWLEDYELKFDSPSPWNFAKE
FT                   FGRHDADTIVEIGFGMGTSLFTMAMNNPQCNYLGIEVHKAGVGSLVADLHEHQITNVRV
FT                   VVHDAVDVLQTKIPENSLAGVQIFFPDPWHKKRHHKRRLIQSEFIQMLVKKIRPSGFIH
FT                   CATDWEDYAEHILNVLSSESALFNQQKEGGYSPRPDSRPLTKFEQRGERLGHGVWDLVF
FT                   IKK"
FT   gene            568096..569220
FT                   /locus_tag="lpa_00738"
FT   CDS_pept        568096..569220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00738"
FT                   /product="endo-1,4 beta-glucanase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00738"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23780"
FT                   /protein_id="ADG23780.1"
FT                   /translation="MIKHAILISGLIVSFLASAAEMSFLAQLTEVPGASGYEKNVRHLV
FT                   QKQWQSYMAELKIDGMGNLIGQRKDNQKGPKLLFMAHLDETGFMVESITPDGFLKVIPL
FT                   GGIANSVIYAQRWTVSTPKGPVLAYSGMDSPHLLGDKKMLGSPDINALFLDIGAENKKQ
FT                   AQKEFAIQPGLEVTPVSEFSQLSKNRFLGKALDDRIGLAVISDALRAVKQQPNQLYLAA
FT                   TVQEEVGMRGASTVYKATHPDIAINVEVGIADDYPMLLADRKGRIGLGKGPSLFVYDKS
FT                   MIPNQELINWIMELANKNNIPLQLEVEPGYGEDGSKVQASGMGVPVVNIGIPIRYAHQH
FT                   AGIFDKRDYDNTVKLLRLIAENLNQEVVDKIKKS"
FT   gene            569298..570785
FT                   /locus_tag="lpa_00739"
FT   CDS_pept        569298..570785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00739"
FT                   /product="ankyrin repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00739"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23781"
FT                   /protein_id="ADG23781.1"
FT                   /translation="MDFVSEMNKILQMELEQFKEFIQKKLEEDKNYLEKLFWLPNGSQM
FT                   TVLNYLIEQYSEPKLGIDDANRDLLAKIDFVLHEAKDVNVGEPLHQAIVAGKISLALHL
FT                   LGVDENNFTPGESEKTDVLSILSKVKKKIEESFNHVKRCFFDVDKRDGYGRTLLSLALD
FT                   AKRQELLIAILARNPIVHATTLRSSAYVPFQPIHQAVVLDYAEGITLLASMGAQLTNPL
FT                   GSMRDTPVILAARLGKINALAALLELPTQSLSLESENNHLFEDKQTGHTAVEELCERMA
FT                   NENDKAEALRGIAMLICRGAEPPRNEKMRNLLSSNRVAFLKAVSTYLADKPQLVDAFVE
FT                   RCHLRESALHNIVYADHSWGSSIRHLLGVPSEAALIVEELVTRKYSDPSFASENVSSLS
FT                   TTATENLRSERNPLKLYAEFVRRYTQAYDSQMITNRWSTMRWMIAEGNCDWDTVVRYSK
FT                   NHPTSRTRIVLNEMFNPIPRVHEDIESQQNSPRVVLK"
FT   gene            570994..572136
FT                   /locus_tag="lpa_00740"
FT   CDS_pept        570994..572136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00740"
FT                   /product="membrane protease subunit HflK"
FT                   /EC_number="3.4.-.-"
FT                   /note="COG0330, HflC, Membrane protease subunits,
FT                   stomatin/prohibitin homologs [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23782"
FT                   /protein_id="ADG23782.1"
FT                   /translation="MGWNEPEKGKDPWSGKNQPPDLDEALKRIQDKLKKTFFGGTGKSN
FT                   NNSSGGSSGGLLAVTVLLIAFILWALSGIFIVDPAEQAVILRFGKYAETVGPGPHWIPR
FT                   FISSKIVMNVDRVLDYSYSAQMLTSDENLVSVSLAVQYRINDLSEYLFNVANPEESLQQ
FT                   ATSSALRQVVGTTTLDQIITEGREVWGGRVQETLTKTLESYKTGILIVNVSPQPARAPE
FT                   SVQDAFDDAIKAQEDEKRFKEQAYAYAAKVVPIAEGKASRIQQEAEAYSKQVVLRAQGE
FT                   VAEFLALLPQYNAAPQVTAKRMYLEAMQKVMNKSSTIIVDSKAGNLLYLPLDKLLGNQY
FT                   VQQSGNLKAIKNGANVSNEEDNLILSGRDLTRPTYSQGRD"
FT   gene            572139..573053
FT                   /locus_tag="lpa_00741"
FT   CDS_pept        572139..573053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00741"
FT                   /product="membrane protease subunit HflC"
FT                   /EC_number="3.4.-.-"
FT                   /note="COG0330, HflC, Membrane protease subunits,
FT                   stomatin/prohibitin homologs [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00741"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23783"
FT                   /protein_id="ADG23783.1"
FT                   /translation="MNAFKTTLGVLIFLVLVLLFTSMFTVTQGQQGIILRLGRLVKDPQ
FT                   TDAVKVLNPGLHFKTPFIESVRIFDTRIQTMDIKSTRIVTKEKKDVMVDYYVKWRISDL
FT                   AQYFKSTGGNEFKAETLLEQQLNTLLRAQFGKRTISDAVSGGRDDVMEILRNAAEKQAG
FT                   ELGIKVVDVRIKGIELPSNTSNAIYQRMRADMQKIANRHRADGQAAAEQIQAKADADVT
FT                   VLLAKTNSNAQRIRAVGEAEAAAIYSKAYTQNPDFFALYKSLLAYEASFHSKKDILILD
FT                   QSSSFFDYFKQAMPKNDGTAAKK"
FT   gene            573188..574483
FT                   /gene="purA"
FT                   /locus_tag="lpa_00742"
FT   CDS_pept        573188..574483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="lpa_00742"
FT                   /product="adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="COG0104, PurA, Adenylosuccinate synthase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00742"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23784"
FT                   /protein_id="ADG23784.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKIVDLLTQDAQVVVRYQGGHNAGHTLK
FT                   INGVKTVLRLIPSGMLRPNVTCYIANGVVLSPQALLSEIKELEGNGVNVRERLRISLAC
FT                   PLILPYHIALDKARETHMGKSAIGTTGRGIGPAYEDKVARRALRVGDLFHRDRFANKLT
FT                   ELLDYHNFVLTQYFKQPAVDLESLLDESLQWVEELRPMVCDVSACLHEHRKQGENILFE
FT                   GAQGVYLDIDHGTYPYVTSSNTCVGSVINGAGFGPRYIDYVLGITKAYTTRVGGGPFPT
FT                   ELLDDVGKRIAERGQEFGAVTGRPRRCGWFDAVLLKRSIELNSISGLCVTKLDVLDGLE
FT                   VLRIAVAYKDRDGNILSRPPLAADDFNDLLPVYEELPGWQESTADVTLMSDLPANARAY
FT                   LKRIEEILGIPIDMLSTGPERDSTITLRGPFL"
FT   gene            575037..575273
FT                   /locus_tag="lpa_00744"
FT   CDS_pept        575037..575273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00744"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00744"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23785"
FT                   /protein_id="ADG23785.1"
FT                   /translation="MDDGSKPGYAEIIREKTAVIRPAGGVIGFLPNDIHSVMNESDDVA
FT                   ISLHVYGKNLNYTGRHQYDPVNNLMQPFIVNYS"
FT   gene            complement(575473..575931)
FT                   /gene="argR"
FT                   /locus_tag="lpa_00745"
FT   CDS_pept        complement(575473..575931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /locus_tag="lpa_00745"
FT                   /product="argR arginine repressor"
FT                   /note="COG1438, ArgR, Arginine repressor [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00745"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23786"
FT                   /protein_id="ADG23786.1"
FT                   /translation="MTHDAFLDDLILSIVQTESIAEQSDLQNSLRKRGYEIPQATLSRR
FT                   LKKMKIAKVSGYYKIIDYNQPGLPLVLNVQISDFGLIILQTHPGNANSLAYYIDRKYVS
FT                   FSIKDSSNSGILGTIAGDDTVLLIIKSKSDQQKVLDILMKEFPYLFAS"
FT   gene            576062..576796
FT                   /locus_tag="lpa_00746"
FT   CDS_pept        576062..576796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00746"
FT                   /product="amino acid (glutamine) ABC transporter,
FT                   periplasmic amino acid binding protein"
FT                   /note="COG0834, HisJ, ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain [Amino
FT                   acid transport and metabolism / Signal transduction
FT                   mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00746"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23787"
FT                   /protein_id="ADG23787.1"
FT                   /translation="MRKVFSLLLISSIIVISSCSEQKNQNTLRFSTSAEYPPFEYIENG
FT                   EIKGFDIDLAKLIAKELGKEAVFDNMQFSAVLPAVNSGQDDVAIATITITEERKKNFDF
FT                   SKPYYFEGMAAVFDNSQPVKEISQLTGKKIAVQLGSVMEIWLHQNFPKAEIMALDNNNQ
FT                   AIEALIAGHVDVVLMDGAQGGVYSKKYPGLSYSILAKANEGYGLVLKKGSPLRDEINSA
FT                   LENLKAKGEIQKLESIWIKGSI"
FT   gene            576847..577440
FT                   /locus_tag="lpa_00747"
FT   CDS_pept        576847..577440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00747"
FT                   /product="amino acid (glutamine) ABC transporter, permease"
FT                   /note="COG0765, HisM, ABC-type amino acid transport system,
FT                   permease component [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00747"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23788"
FT                   /protein_id="ADG23788.1"
FT                   /translation="MQLLTGGMLIGVLLGTLLSICRHQGVACFVINRFISILRGTPLIL
FT                   QLSFIYFAVPVLLGMRPSILVAGIVAFGLNSSAYFAEILRAGIESLPKGQFEAALTLQI
FT                   PTFYLWKDIILPQVIKNIFPAMINEMIALLKETALISTIGGMDLMRQAQTLAAQQFTYF
FT                   MPLCITGFYYYSLVLLLEALGKKIEKRGHYAASH"
FT   gene            577424..578092
FT                   /gene="glnQ"
FT                   /locus_tag="lpa_00749"
FT   CDS_pept        577424..578092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ"
FT                   /locus_tag="lpa_00749"
FT                   /product="polar amino acid transport system ATP-binding
FT                   protein"
FT                   /EC_number="3.6.3.21"
FT                   /note="COG1126, GlnQ, ABC-type polar amino acid transport
FT                   system, ATPase component [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00749"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23789"
FT                   /protein_id="ADG23789.1"
FT                   /translation="MLQVINASKKIGNAQVLNEINLSIQANSIVGLVGPSGSGKTTLLR
FT                   CIQQLESIDSGSIQCEGKSGFMFQDFQLFPHMTVLNNLIYAPYLHDKTADHMANAWALL
FT                   AMLGLSDKAHSYPQGLSGGQKQRVALARSLMMKPDLLLCDEPTSGLDMATTNDVIALLN
FT                   TVKTLKITMLIASHDLFFLSNIAERLLVVKQGQLIADFKTQEVSDPILYLQQFYQGEIL
FT                   "
FT   gene            578089..579306
FT                   /gene="argG"
FT                   /locus_tag="lpa_00750"
FT   CDS_pept        578089..579306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="lpa_00750"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="COG0137, ArgG, Argininosuccinate synthase [Amino
FT                   acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00750"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23790"
FT                   /protein_id="ADG23790.1"
FT                   /translation="MKKVIKKIALAYSGGLDTSIMIPWLKEHYEHAEVIAVICDLGQQE
FT                   DLDTIKNKALKSGASKAYVVDVKNEFAIQYLWPLVKSGALYEDQYILGTISRPLIAQKL
FT                   VEIALTEQVNAVAHGATGKGNDQVRFEYSIKALAPQLEIIAPWRTWDIKSRQEAIVYAK
FT                   AHGIEVPVTPKAPYSRDHNIWYISHEGGVLEDPSQEMPDDVLLMTAPVSQTPDEEEVVV
FT                   LDFKKGVPVALNGQELSPVDLLNSLNQKAGQHGIGVADIVENRLVGMKIRGIYEAPAAA
FT                   VLYKAHKLLESLCLTRSTLHLKQSLQQTYANLVYEGRWFSQTKQALDAFIDVTQQHVTG
FT                   CVKLKLFKGNIIPAGMHSPYSLHHPELATFEEDNVYNQKDAEGFINLFSLSAKIYSQVH
FT                   QEGNYD"
FT   gene            579299..580534
FT                   /gene="argH"
FT                   /locus_tag="lpa_00751"
FT   CDS_pept        579299..580534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="lpa_00751"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="COG0165, ArgH, Argininosuccinate lyase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00751"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23791"
FT                   /protein_id="ADG23791.1"
FT                   /translation="MTNKTWGGRFKKSLDSGVNQFNASLSFDHVLFDQDINGSQVHVKQ
FT                   LAKQKILTEVESQAIYSALEEIRSEIKQGQYSFNVRDEEDIHMFIEQLLIQKIGDLGKK
FT                   LHTGRSRNDQVALDLRLYTRDKGCLINELLTRLIDCLDDLTSKHQQDLMPGYTHLQQAQ
FT                   PVTLGAYFNAYQCMFGRDKSRLEDWFKRMNYSPLGAGALAGSTLPLDREWVAESLGFAG
FT                   IIPNTLDAVSDRDFVIELCSVAAMIMMHLSRLCEDLILWSTQEFNFVILDDAFATGSSL
FT                   MPNKKNPDVPELIRGKSGRVYGHLMAILTVMKGLPLAYNKDMQEDKEGLFDTINTIIAC
FT                   LQMITPFLQSLTFNTLLMKTKAQSGYLDATAILESLVMKGMPFRDAHHQVGAWIAEAIE
FT                   KQCSLNELLKGG"
FT   gene            580537..581652
FT                   /gene="argF"
FT                   /locus_tag="lpa_00752"
FT   CDS_pept        580537..581652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="lpa_00752"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="COG0078, ArgF, Ornithine carbamoyltransferase [Amino
FT                   acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00752"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23792"
FT                   /protein_id="ADG23792.1"
FT                   /translation="MSFSTSTNLTPIEMQDDDLEKIQSQNSPSAINEVKTNTFVINLQQ
FT                   AIFGLETGSEAVDFDSHKNTGFPFPAGEYKPRHFLTGTELAREEIQFVLSQARSLKQNP
FT                   GLYNQALANKSLVMIFEKPSFRTRLSFALAIQSMGGIVVESIANSRKQETPADMARVLN
FT                   GYADFVMVRTHEDSFLQEMAEYSKIPIINGLSALHHPCQTLADLLSLEEQFGALEGLTL
FT                   TYIGDGNNILHSLMLLAPQLGVTVHYCCPKSNQPNEAIIKEAQSKTGKQMIYCFDKPEE
FT                   AVKQADAVYTDVWTSMGFDNPEAGKIFKGFQVNETLMSHAKPDSVFMHCMPMERGKEVS
FT                   ATLPDSASSIIFRQSENRMHVQKALMLFLDQ"
FT   gene            complement(581742..583217)
FT                   /gene="add"
FT                   /locus_tag="lpa_00753"
FT   CDS_pept        complement(581742..583217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="lpa_00753"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="COG1816, Add, Adenosine deaminase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00753"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23793"
FT                   /protein_id="ADG23793.1"
FT                   /translation="MNITRLLAFFTSFFLLCPIYASVDSYFSHIKKDSSALYAFFKTMP
FT                   KGGELHYHLAGGAYPETMLALAANGNYCLDKHSFAVSKDSSHCEGVNVKEVFNNPELYS
FT                   NIIKDWSMKDFIPGKESGHDHFFNGFVKYMPIVFDYRPQLLADIVQRAAQQKEQYMEIM
FT                   IIPDNAHSLTYGDLIKDIPSYDQKRHLLLANKDFQSNIKNTVLESDRILTKASQELGCK
FT                   DNPSSDSCHVKIKFIYYVLREQPVDNVFAQALNAFEAVSKSKGNLIGVNLVQPEDGIIS
FT                   LRDYHKHMSIFEYLHRIYPNVPITLHAGELSPQAVTPENLSNHIRDALLIGHAQRIGHG
FT                   VDIGYENNAEDTLKYMASHHIPVEINLISNLKILNISGRNHPLNYYLTHNVPVVLSTDD
FT                   EGVLRTDLTQQYVEAAKEHGLNYQQLKQINRNTLTYSFLPGKSIWANADKAELIPDCHD
FT                   LGSKSCQKFIEHNEKAKLQWSLEQQLIAFEKNY"
FT   gene            583392..584507
FT                   /locus_tag="lpa_00754"
FT   CDS_pept        583392..584507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00754"
FT                   /product="branched-chain amino acid transport system
FT                   substrate-binding protein"
FT                   /note="COG0683, LivK, ABC-type branched-chain amino acid
FT                   transport systems, periplasmic component [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00754"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23794"
FT                   /protein_id="ADG23794.1"
FT                   /translation="MPYFYTRSAPLFFVFVIALIFINFSYAHEFQTDSKNKHKVDVHIG
FT                   IYAPFSSHSAFIGRNILAAMEMGSERIQSSDIHYSFYTLDQLPKNKNAGLVLQKFIDTH
FT                   HINVLVTGGKETGLIAAPIAKKNNLIHFSLTNNTEVADGRNNFIVWSPAYDQAKVLVNE
FT                   LKRQQVHHLGIITANQPSSTALTHSVIKQLQADSHIDVAASEYFEPGNKDFSRLANRIK
FT                   RKNADMYLVMASPEDIKLIQEQMEADKQHVPITSIVERATPEVVKVFEGQWYVDSHEMQ
FT                   PDFINEFKKNYLNYPVTEAGYAFDLFQLLNKSIVMAIKTQGSPTSQEVVHQLHDIANGT
FT                   GVMGTMVLDSKGSLFTKSEVKTVKNGEIHTV"
FT   gene            complement(584579..585916)
FT                   /locus_tag="lpa_00755"
FT   CDS_pept        complement(584579..585916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00755"
FT                   /product="carboxy-terminal protease"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00755"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23795"
FT                   /protein_id="ADG23795.1"
FT                   /translation="MVIKKLFSSTLALVYALTLMLPLTAFSAEETNSNYSNTKRIPLED
FT                   VQRFSNAIGEIKKYYVKPVDDKELFDNAIRGMLTGLDPHSSYLNEEEFKELQTSTSGEF
FT                   GGLGIEVTMEEGVVKVITPLVDTPAFKAGIKSGDYIIKLGKESVQGLSLKDAVNLMRGK
FT                   PGTTIELTILRKGVNKPLTFDLIREVIQIKSVKSKMLSEGYGYIRLTQFQALTGKDMIK
FT                   AIEQLKQQAGGKLKGLVLDLRNNPGGLLDSAIQVSDAFLGNDKAGKQEMIVYTEGRLPG
FT                   SKFTALANPGDVLDNAPIVVLINNGSASASEIVAGALKDNKRAIILGTKSFGKGSVQTV
FT                   LPLDGKTGIKLTTALYYTPSGVSIQAKGIIPDIVVEEVDVPKNAVKKDTLAGFTEADLN
FT                   GHLINKDNSENTESKNNQIQTGDLIHEDYQLYAALTVLEGMALANR"
FT   gene            complement(585997..587139)
FT                   /locus_tag="lpa_00756"
FT   CDS_pept        complement(585997..587139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00756"
FT                   /product="peptidase, M23/M37 family"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00756"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23796"
FT                   /protein_id="ADG23796.1"
FT                   /translation="MRMSSLSNYLSNAPLGLALMVILFFCNGLEAKTAPNSITQAQTKL
FT                   KQLDAKINKLKQVLANAQDKRTVLNQELGSTEKQIGEGIRKLRIIQANMSAKEKSIAEL
FT                   QGKINHLNERLQTQQEMLANHVRARYQMGEYQPLKWLINQDEPFKINRILTYYQYIIRS
FT                   RQQLIDEIARTRQNLNDSKTKLGNELAENKQLQFKLSQNQKQLEQNKRYHSTLIQSIDN
FT                   DIQNNQQSLKDFQKDRDNLSHLMKSLSQQSVIQSGKPFTGMRKKLPLPVQTTRRSLRRM
FT                   NQGVTFFADEGSIVTAVYPGKVVFSDWLKGYGLLLIIDHGQGFMTLYAHNQSLFKRKGQ
FT                   IVQQNEQVASVGHTGGIKQNGLYFEIRQRGKAVNPLDWLS"
FT   gene            complement(587126..588670)
FT                   /gene="gpmI"
FT                   /locus_tag="lpa_00757"
FT   CDS_pept        complement(587126..588670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmI"
FT                   /locus_tag="lpa_00757"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="COG0696, GpmI, Phosphoglyceromutase [Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00757"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23797"
FT                   /protein_id="ADG23797.1"
FT                   /translation="MSHNAPLVLMILDGWGYNENDRYNAIAKANTPQWDEWWQTCPHIL
FT                   LKASGLPVGLPDEQMGNSEVGHMHIGAGRVIQQDFTRINEAINNGKFAKNAVFHEVIDQ
FT                   LKKTEKSLHIMGLLSPGGVHSHEQHLFALLALCNQKKFRSVHLHLFLDGRDTPPQSALD
FT                   SLKCLNEELVKHPVATINSICGRYYAMDRDKRWERVEPVYNLLTQGKSEHQFPDAETAI
FT                   HFYYKNKISDEFVPPTLIGKEHSIQDGDAVLFFNFRADRARQLTSTFLDPLFKGFERKT
FT                   LPKLSYFVSMTQYDKNLITTIAFPPVPLNNTLGEVLSSHGLSQLRIAETEKYAHVTFFF
FT                   NGGCESVFTNEERIMVPSPQVATYDLQPEMSAPELTKTLIAAINSRDYHVIICNYANAD
FT                   MVGHTGNFEATVQAIECLDQCMHQVWQALKNNGGKLLITADHGNAEEMFSEATNQAHTA
FT                   HTSEPVPFLYVGGGWHFTHAEGSLIDIAPSLLALLGITPPPEMTGRILLEKNHAHV"
FT   gene            complement(588773..589069)
FT                   /locus_tag="lpa_00758"
FT   CDS_pept        complement(588773..589069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00758"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00758"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23798"
FT                   /protein_id="ADG23798.1"
FT                   /translation="MSRDTKNLILKAIILFVSLTALVNHAMAFNLLGIGPNPKNLPKDN
FT                   DVRATFNHCKSCDKSTTPPLIITTPVPIIYYPGCRPIQSCDAYGHCEQKEDCY"
FT   gene            complement(589146..590417)
FT                   /locus_tag="lpa_00759"
FT   CDS_pept        complement(589146..590417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00759"
FT                   /product="phosphatidylcholine hydrolyzing phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00759"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23799"
FT                   /protein_id="ADG23799.1"
FT                   /translation="MKKSIHRLIKPRLFAMSISLLAFSSITYGESNGSFALSEHWSMGQ
FT                   QIKLRFDINEIPQSGVVLHLKNGLALTAGDIISLGDLYGIVGKPISHGLTKLEKQTRFK
FT                   EVFNSFARNAIAVSEVEDLNSVIRAEMREVESGIAKGETAEAIYKRIGNEVGRQINCIT
FT                   GGGCNSLTWWLNPGRYLKLAMENYDHFTPNNLIAYKSGHHVALQQALKAKRTGKRSDLE
FT                   IAYAMDAFACHYLSDHFAAGHLRTPREELSAIITPTVLGALLSNYMHNEENKYGIHVTN
FT                   NLGEQWMVYGDYSYFNPFNQTNQQMLLKALQASADEIFEAYYSGVLPEKNQIEDMIPHI
FT                   TKLNDENNMDIAPMFYWDKENKQLLRRTNLTNPYDRHWTNSWWGWSTLLLLKTQYGITS
FT                   TVQLSLSKYLSQYVPEELQDNPLV"
FT   gene            590767..591483
FT                   /gene="uppS"
FT                   /locus_tag="lpa_00760"
FT   CDS_pept        590767..591483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="lpa_00760"
FT                   /product="undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /note="COG0020, UppS, Undecaprenyl pyrophosphate synthase
FT                   [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00760"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23800"
FT                   /protein_id="ADG23800.1"
FT                   /translation="MNHKLPQHIAVVMDGNGRWAESRGLPRVEGHKAGLDSVKKIINCC
FT                   LEKKISCLSLFAFSSENWSRPVTEVNFLMELFLEALRKEIDDLNQHGIRLKFTGDREPL
FT                   SQVLQKQMCDAEALTKNNQQLILNVVVNYGGKWDIVTAAKKLIHAVLDGKLACDEINEA
FT                   VFAQFLDTSGMPEPDLFIRTSGELRISNFFLWQLAYTELYFTDVHWPDFNEHEFELALT
FT                   SFAKRARRFGQISQSE"
FT   gene            591494..592291
FT                   /gene="cdsA"
FT                   /locus_tag="lpa_00761"
FT   CDS_pept        591494..592291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="lpa_00761"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /note="COG0575, CdsA, CDP-diglyceride synthetase [Lipid
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00761"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23801"
FT                   /protein_id="ADG23801.1"
FT                   /translation="MFMQRLITTLILAPLVLLAIFYAPSWILWGIVLVILLLAGLECFK
FT                   LIPVDNLTVQACFLIFLLMCFWASGYFYPYWLSVGLLVWLLNGLAILTYPRSQNYWGYP
FT                   IVVAIASLILLPLFTQSLIQISFLQQGKELLVYLLFLIWASDIGAYLAGKQWGKHKLIP
FT                   KVSPGKSWEGVTGGVILAMIVATLGYYYFIPYSIYIWFGLALSTVVISIFGDLFISILK
FT                   RRCQLKDTGNIIPGHGGILDRLDSLIAALPWFYFGLTYIPLGI"
FT   gene            592423..593676
FT                   /locus_tag="lpa_00762"
FT   CDS_pept        592423..593676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00762"
FT                   /product="membrane associated zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00762"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23802"
FT                   /protein_id="ADG23802.1"
FT                   /translation="MLRFSFGFGKILARFYDKKGTEYAWSLFPLGGYVKMLDETEGEVS
FT                   EKEKPFAFNNQSVLVRIAIVVAGPLFNFIFAFVALWLVLVIGMHSLAPMIESVKPNSIA
FT                   ARAGLLPKQEILALNGVKINSWRDFQYEIMPLIGSQETVSLTVKSMINGEESTLYLPLD
FT                   KWQLDDKKPDPIKSLGIVPFIPTIPPIVGEVVPDSPAEKAGLKIGDEIISVNGQHFNDW
FT                   LYLVSYVRERPNSQINLDIKRQGKLLKITVHTGSQDNNGKLEGLIGVRSQKVDWPAHWL
FT                   RLEQQPPISALGTAFKQTIQLTGTTFILMGRLVTGKLGLNSISGPVGIAQGAGDSGRGG
FT                   LVSYLFFLALVSISLGALNLLPIPMLDGGHLLYYVLEIIRRKPLSDGVKSVGIYFGLLL
FT                   LVALMFVALSNDISRLTS"
FT   gene            593847..596159
FT                   /locus_tag="lpa_00764"
FT   CDS_pept        593847..596159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00764"
FT                   /product="Outer membrane protein/protective antigen OMA87"
FT                   /note="COG4775, Outer membrane protein/protective antigen
FT                   OMA87 [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00764"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23803"
FT                   /protein_id="ADG23803.1"
FT                   /translation="MKKVSNKLILGVCCSTLLAWSSQSFSSDTFIVKGIRVNGLQRVST
FT                   GTVLNYMPVQVGEEISSSSTAQIIRALYETGFFQSVSLERQGNVLVVNVIERATIGSIT
FT                   VVGNKEIPSDKMKAFLKEMGLVKGRVFQRSSLERLEKELKQAYTARGKYNSRIETKVTP
FT                   LTENRVAISITVSEGRVSRIKEIKIIGNHDFKANELLPELTLSTSNLFTYFTKKDQYSK
FT                   PGMDASLEALRSFYLDRGYLKFNVVSSQVLLSPDKKDVYINIHIEEGPQYHFSGYDVVG
FT                   KTILPKEKIDSLIQVKKGDVFSRKKVTESISAIGLALGDVGYGFPAINAEPRIDENNKT
FT                   VFITFVVQPGRHVYVRRINFHGNTKTGDYVLRNVIRQDEGGLLSLHNIKESERQLRMLG
FT                   YLKNIDVKTTPVPGTNNQVDLDVNVEEAPSAEASASMGYGTNGYQFNASVNQRNFMGSG
FT                   RSMGAAFNASQWGQDYSFNYYNPFYTDTGVGRGGSLYYSRIDPKNLNVSTYSSNRYGGD
FT                   ISYNFPLGEKSSFQLGYGYQDINIKSVGYVLPIINFVALNGNHFQEIRLTSGWSRNSYD
FT                   QMPYPNQGFNQQAIAMVALPATSQSLSYYKSSYQAHLYYPLTRGWIFSVLGNVGYGNTF
FT                   DNFGLPFFENYYAGGPVQPGQVRGYDSYSLGPQDNFGNAMGANFLVNGSVGLILPYPLS
FT                   RDNVRTTIFADAGNVFASGTPPALRGTPAGPMRYSAGVSLEWRSPFGPLSFSLAKALNP
FT                   QPLDQTQLFQFALSSGF"
FT   gene            596273..596773
FT                   /locus_tag="lpa_00765"
FT   CDS_pept        596273..596773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00765"
FT                   /product="outer membrane protein OmpH"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00765"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23804"
FT                   /protein_id="ADG23804.1"
FT                   /translation="MKRLGAVLVALFLGLFGTTVFADWAKIGVVDLQKIMQTSNQMKEI
FT                   QQKLEKEFKPRRDKLVAMEASLKSDMEKFKRDSAIMSASQKKELEKKIVASQQQFERDG
FT                   QQYQQELSTAHNEAMEGLYNKVRTAITKIAKDEKYDIIVQKDAAPFSSESLDVTDKVIK
FT                   AIN"
FT   gene            596775..597806
FT                   /gene="lpxD"
FT                   /locus_tag="lpa_00766"
FT   CDS_pept        596775..597806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="lpa_00766"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl) glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00766"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23805"
FT                   /protein_id="ADG23805.1"
FT                   /translation="MADALLTLEELANYLNGVWHGNANHAIFSLSSLARASSKDLAYFD
FT                   NPLLQSVLNSTRAGAVLLKPEHKDWCPVNCIVVPNPSEAMFKAAKSLPHLATNVCGIHP
FT                   TAQIHKSAQIGQYVSVGANSVIGENVQLDDYVTIGSNTTIESSVLIGRGSQLGSGAIIH
FT                   SGTVLGQSVIIDSGCIVGAAPFNCYKEHGVWQQAPNFGGVVIGQRTQIGANTVIHRGSI
FT                   GDTYLGDGVCIDSLVLIAHDVYIGNNTAIAGSAAIGALVQIGSDCIIGGASCLAANIRL
FT                   TNDVVITGMSTVTKSIARPGIYSSGTTVHDHRKWRRNTARFRHLDDYITKLITIEKKLN
FT                   NNN"
FT   gene            complement(597807..597950)
FT                   /locus_tag="lpa_00767"
FT   CDS_pept        complement(597807..597950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00767"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00767"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23806"
FT                   /protein_id="ADG23806.1"
FT                   /translation="MIYIYRFVHTLVLINRLLHYKMAHYLGLAHSNQLKISKIMLLQID
FT                   KT"
FT   gene            597924..598376
FT                   /locus_tag="lpa_00768"
FT   CDS_pept        597924..598376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00768"
FT                   /product="3R-hydroxymyristoyl ACP dehydrase"
FT                   /EC_number="4.2.1.-"
FT                   /note="COG0764, FabA,
FT                   3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
FT                   dehydratases [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00768"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23807"
FT                   /protein_id="ADG23807.1"
FT                   /translation="MNESIDINQIFTLLPHRYPFILVDRVIDYKVMEYLIAIKNVTINE
FT                   NFFTGHFPGNPIMPGVLMLEALAQACGILANLSRQPKEGYEFLHYFAGIDNARFKQVVI
FT                   PGDQLRLEVRLAGQKRDFWRMHGEAYIGDKLACSADLLSAAKEIKK"
FT   gene            598373..599143
FT                   /gene="lpxA"
FT                   /locus_tag="lpa_00769"
FT   CDS_pept        598373..599143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="lpa_00769"
FT                   /product="acyl-(acyl carrier
FT                   protein)-UDP-N-acetylglucosamine acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="COG1043, LpxA, Acyl-[acyl carrier protein]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00769"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23808"
FT                   /protein_id="ADG23808.1"
FT                   /translation="MIDERAMIHPSAKLASGVSIGPGTVIGADVEIGENTWIGPHVVIE
FT                   GPTVIGKNNKIFQFASVGDEPQDITYKGEPTRLEIGDNNVIREYCMISRGTVKGGGVTR
FT                   IGNSNYLMAYSHIGHDCMVGNHIIMVNYAALSGHVTINDYAIIGPYAAVHQFCQVGAYA
FT                   FIARATYVTKDVLPYVMIAGHTTSACGINTVGLRRRGFSSAAIDCLRRAYKIIFRKGLT
FT                   VQQAVSELELIQNECPEIIPMIDALNQSTRGIVR"
FT   gene            599147..599551
FT                   /gene="crcB"
FT                   /locus_tag="lpa_00770"
FT   CDS_pept        599147..599551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="lpa_00770"
FT                   /product="camphor resistance"
FT                   /note="COG0239, CrcB, Integral membrane protein possibly
FT                   involved in chromosome condensation [Cell division and
FT                   chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00770"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23809"
FT                   /protein_id="ADG23809.1"
FT                   /translation="MVVAPYLAVAIGGSLGAMSRYLVTIMAQNAWGIKFPYGTLLVNTL
FT                   GSFLAGFFLIVLVGRFSAEESFRLFLFTGFLGAFTTFSSFAAESLFMFEQGYWFKLITN
FT                   ILVNNVGSLSMVFIGTLVAKYVLLGHQGSN"
FT   gene            599573..600853
FT                   /gene="serS"
FT                   /locus_tag="lpa_00771"
FT   CDS_pept        599573..600853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="lpa_00771"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="COG0172, SerS, Seryl-tRNA synthetase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00771"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23810"
FT                   /protein_id="ADG23810.1"
FT                   /translation="MLDNQLLRENPQYVATQLLKRGFQFDAVTFSQLEEKRKALQVSTQ
FT                   SLQNERNLRSKAIGEAKSRGENIEPMREEVNKLGAKLEQQKTELDEVLKQIEVISLSLP
FT                   NIPHESVPVGKDELDNQEIRKWGDVPAFSFPVKSHDELGEALGQMDFALAAKITGSRFV
FT                   VMKGHLARLHRALIQFMLDIHIQQHGYQEIYVPYIVNADSLLGTGQLPKFEADLFKLTG
FT                   DNGYYLTSTSEIPVTNTVREMILSAEQLPIRYVCHSPCFRSEAGSYGKDTKGMIRQHQF
FT                   EKVELVWITKPEDSYNALEQLTQHAEVILQRLNLPYRVVALCTGDIGAGSAKTYDLEVW
FT                   LPSQNTYREISSCSNMEAFQARRMKARFRNPDTNEIQLVHTLNGSGLAVGRTLVAIMEN
FT                   YQDEHGNIHIPDALKPYLGGIDIISVK"
FT   gene            600992..601216
FT                   /locus_tag="lpa_00772"
FT   CDS_pept        600992..601216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00772"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00772"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23811"
FT                   /protein_id="ADG23811.1"
FT                   /translation="MKHFDFSLRIWPKIIDINGKEKYFFRDYLLSHPEAAEKYQQLKIK
FT                   LAQEHKYDREQYTDAKSEFINQILKLAQN"
FT   gene            601387..601650
FT                   /locus_tag="lpa_00773"
FT   CDS_pept        601387..601650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00773"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00773"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23812"
FT                   /protein_id="ADG23812.1"
FT                   /translation="MADQPPKSKWHEIKRLSEGDNKVDNNQAPVSTADRIKKLYLDTQV
FT                   GSPIDTVEEADAQRNNLGPKDTKIENSSPENDEPNPDIPTPG"
FT   gene            601845..602009
FT                   /locus_tag="lpa_00775"
FT   CDS_pept        601845..602009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00775"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00775"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23813"
FT                   /protein_id="ADG23813.1"
FT                   /translation="MASLFFIKEVITVSDKPDSPYILSLQADGNLFPSILQSNLAMTLV
FT                   WSCYGQFIE"
FT   gene            601990..602922
FT                   /locus_tag="lpa_00776"
FT   CDS_pept        601990..602922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00776"
FT                   /product="phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00776"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23814"
FT                   /protein_id="ADG23814.1"
FT                   /translation="MDNLLNEKKLTIFTSNEIQDNLNRVLKNYEQNGIIGLNGYLNQAN
FT                   RISLLNELEIIQKDAEQDIVRYWNNKIIHFYSKDPLKPESVDREYVTEPYFQASSNKAH
FT                   VFYEVIDNMRVVNRIGHGMHLINRYPMMQRAVYDSPVLLDLLKGIGFKKPICHLSVYIP
FT                   KYPNGIGSEVKPHQESTFAFTEPQSVVVLWVALEDALIENACMYGVLGSNHWPLKWVSK
FT                   VDRETKTRHFEQVHQLHIPDFMTEREFYTALEVKAGDALLFHGNFVHCSPMNTSKNSRK
FT                   ALSFQFIETYEVDYPETNWLYPPNKVYLY"
FT   gene            602958..603770
FT                   /locus_tag="lpa_00777"
FT   CDS_pept        602958..603770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00777"
FT                   /product="Trans-aconitate methyltransferase"
FT                   /note="COG4106, Tam, Trans-aconitate methyltransferase
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00777"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23815"
FT                   /protein_id="ADG23815.1"
FT                   /translation="MSMYDKRQFFKTYFSSASEKSILVKLLDKRFHPPFHTANILDLGC
FT                   HDGALMKNIVNAYAKRLPEKLVITGVDPSLQAIKEYAKADFPIPVQTNTFAGTAEDYFD
FT                   VCTDHFDWIFASQCLYWSPDLPKIIKQIHEAGDSALIVIRGCHGIYEIQSQFRHYIGNH
FT                   LEKFYTDKEVEMALRTQKILFQKESLSTSIRLPDKDSIELKWLILFFLQMEEESLGDKI
FT                   FCEVRDWITSRASGSIHHEVHFFWLGNAIFTGDYNRNFPVKSKKNSMG"
FT   gene            complement(603760..604590)
FT                   /gene="ara1"
FT                   /locus_tag="lpa_00779"
FT   CDS_pept        complement(603760..604590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ara1"
FT                   /locus_tag="lpa_00779"
FT                   /product="Aldo/keto reductases like protein"
FT                   /note="COG0656, ARA1, Aldo/keto reductases, related to
FT                   diketogulonate reductase [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00779"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23816"
FT                   /protein_id="ADG23816.1"
FT                   /translation="MDLGFPTFIYGTAWKEKRTSELVELALTTGFRGIDTANQRKHYYE
FT                   EGVGYALQQYYKKSGILRDDIFLQSKFTYAHGQDHRKPYDDTASLTIQVQQSFASSLEH
FT                   LNTDYLNSYILHGPYYQYHFSDEDKEVWNKMESLHKDGKVKHLGISNVSYEQLIELISF
FT                   ASVKPKFVQNRCFARLLWDKQIRNYCQAHGIIYQGFSLLTANQYELRHPKLENLSKKYE
FT                   KSIEQIIFRFSQQIGMLPLTGTTNLDHMKEDLAIHQFRLTDDEINFIENITFIP"
FT   gene            complement(605029..605877)
FT                   /locus_tag="lpa_00781"
FT   CDS_pept        complement(605029..605877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00781"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00781"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23817"
FT                   /protein_id="ADG23817.1"
FT                   /translation="MTDLRTEIESLIHEGLLPDREYVSAKRFINHYATTSKFWDGLALV
FT                   GITPIINGLYAGYYASRAVWATLRTVGNLLILKPGLAFDAIKDVGCHLTLSTCLLLMAP
FT                   IHALTHAVELLTRVISSWFVGQEQRYDLLETGLMAKWANRANGYQMVNELPSSNYFNKA
FT                   RFFSSYNNAWDCLEQMASPITSLAKSGFHSLVEALYGVDSAIECIVNLAICKPLHAKEN
FT                   FYNLQVHFGLALSLAVMAPINALVEGIAFMTRLGTTWVSACLKPEVTETEQENTTAYQF
FT                   N"
FT   gene            complement(605864..606091)
FT                   /locus_tag="lpa_00782"
FT   CDS_pept        complement(605864..606091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00782"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00782"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23818"
FT                   /protein_id="ADG23818.1"
FT                   /translation="MADWSIRHNKENLFNDLYSIRVLLILWPLICVQKTLENRCKHQIQ
FT                   HGPILVIYVFFSYTLPACLINIERDHNDRP"
FT   gene            complement(606214..606681)
FT                   /locus_tag="lpa_00783"
FT   CDS_pept        complement(606214..606681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00783"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00783"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23819"
FT                   /protein_id="ADG23819.1"
FT                   /translation="MNAENNVLNTLNSLSKEINKLYGYVTIAGDNFGEPAINSGPCGPF
FT                   ANAFYKIWNQKFTEKVNIAFIMMKNSDECWHILIRLPNGLLFDGGFGVHNEDKWNKDTF
FT                   DIEDMLEYDLQLLEKHSGGLNRTYPRCCPDFSIDVITNLIHKHLELVEKNK"
FT   gene            complement(606665..607387)
FT                   /gene="ubiG"
FT                   /locus_tag="lpa_00784"
FT   CDS_pept        complement(606665..607387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiG"
FT                   /locus_tag="lpa_00784"
FT                   /product="methyltransferase, ubiE/COQ5 family"
FT                   /EC_number="2.1.1.-"
FT                   /note="COG2227, UbiG,
FT                   2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol
FT                   methylase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00784"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23820"
FT                   /protein_id="ADG23820.1"
FT                   /translation="MCTEVYDLSKPNPPEEDYAFYRSYVINVKGPILEPMCGTGRFLLP
FT                   LLEEGFEIHGFDASEYMLEALNIKAKAKNLKPTVWRGFVENLTRPEKYNLIFIPSGSFC
FT                   LLIDPATVRLALQTFYNHLSDEGILLFEGETLKAVPQLDVWRGSVWHKPNGQMIMLSQL
FT                   ATLKDQVCHSIGKYELVHDNSIIHTEVEELRVRIYDPQELTAILKSCGFKNVRLIKAFD
FT                   SAATPDAQDETIVYECRK"
FT   gene            complement(607389..607997)
FT                   /locus_tag="lpa_00785"
FT   CDS_pept        complement(607389..607997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00785"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00785"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23821"
FT                   /protein_id="ADG23821.1"
FT                   /translation="MTPHIIGISGITGAGKSTLAKALSLDLKATLISWDDFDDISLEPE
FT                   DYIEWYHKGCNYSEFQREDLAKVLAELKAKREIMHPVLRTLLNPAEYIIFDAPLGKLHV
FT                   QTGEYIDTCVHIEVPLDISLCRRILRDFKDKLQTKENLLEEISFYLNHSRPLFFDDELK
FT                   QNATIVIDGLLSTEVQIQIVKNFLIGKQDDKIKKPGYLS"
FT   gene            complement(607994..608461)
FT                   /locus_tag="lpa_00786"
FT   CDS_pept        complement(607994..608461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00786"
FT                   /product="Predicted acetyltransferase"
FT                   /note="COG3153, Predicted acetyltransferase [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00786"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23822"
FT                   /protein_id="ADG23822.1"
FT                   /translation="MITIDLLKNHPQSIARCATIWHEILGKIWVPEIPVEQVIQRFSEH
FT                   LNADKLPITFIALDTGKPVGMCSLRENDGIRPEISPWLGSLVVDPAYQRQGIGNRLIEA
FT                   TKNKARDLGFNKLHLFAFDPTIPNYYSRLGWAIIGMDKFKGHPVTVMEILL"
FT   gene            complement(608458..608616)
FT                   /locus_tag="lpa_00787"
FT   CDS_pept        complement(608458..608616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00787"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00787"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23823"
FT                   /protein_id="ADG23823.1"
FT                   /translation="MITGINHITLAIKDLNKSFAFHAKILVLKQMLPTTILRLKSLIPE
FT                   LVNAGKA"
FT   gene            complement(608613..609176)
FT                   /locus_tag="lpa_00788"
FT   CDS_pept        complement(608613..609176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00788"
FT                   /product="aminoglycoside N (6')-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00788"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23824"
FT                   /protein_id="ADG23824.1"
FT                   /translation="MNINFEKANASHIELIFSWLKEPFVQEFWDNTQAHKDDILNFING
FT                   RTEPSSYADGKYVYWIASGNGHPFAMLMTIQETSEDEIDEIKLINLSKTGHSYGIDYMI
FT                   GDKNYFGIGYGARTLIEFIDFFIKEVDPKADTFLIDPASDNPRAKHVYIKAGFEYVADF
FT                   LMSGDVSGAGKLHHLLIKRIGLIK"
FT   gene            609678..610412
FT                   /locus_tag="lpa_00789"
FT   CDS_pept        609678..610412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00789"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00789"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23825"
FT                   /protein_id="ADG23825.1"
FT                   /translation="MKEYISALSIDRLTSYEILCPSKVDTDIIGAYHWNLLISQAFYPF
FT                   IHSVEVALRNSIHHAATKKFENEFWFDIVVTDGKSRSILEDTKNDLHRRFGQVTASDIV
FT                   AGLTFGFWTNLIKQKTYTDQFNPNRLWPDLIPSVFPHYARGHDDRKNISKRFEEIRLIR
FT                   NRLFHHEPIWKFKNAQTPQECIAELRRKFNDTFKAIGWISKYKRNCLREFGFVESFKNN
FT                   CTLETLESYKVKGAEILQQLAD"
FT   gene            610415..611638
FT                   /gene="xerD"
FT                   /locus_tag="lpa_00790"
FT   CDS_pept        610415..611638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="lpa_00790"
FT                   /product="Site-specific recombinase XerD"
FT                   /note="COG4974, XerD, Site-specific recombinase XerD [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00790"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23826"
FT                   /protein_id="ADG23826.1"
FT                   /translation="MKAKINNTLIKKLLPRDKEYEVHDLDLKGFMIRVFPSGTMRYVCQ
FT                   YKRGKKINLGTVGVMTAAQAREKAIEVLSNANKGIEPTAQKGINKPKTLQEFIESDYKP
FT                   WVLSTHKRGQETLAGLIRCYKAFFSKPLGEITPALVEQWRVKRLNEGTSQATLNRNISM
FT                   LKSLMTKAVEWGFLKENALGKLKPYKIDRSPKIRYLSFAEEARLREALIERDNQLRLMR
FT                   KNGNLWREKRGYDLLPELSEDNACDYLMPMVLLSINTGLRRGELFHLTWDMVNLSEGSL
FT                   ILSGEITKNKHSRYIPLNDEAYKILDNLHKKAERKEGLVFPSKNNQPFNHVKRSWGSLL
FT                   KKANITQFRWHDLRHHFASKLVMAGVDLNTVRELLGHSDIAMTLRYAHLAPEHKVNAVR
FT                   KIDWSMQG"
FT   gene            611643..612062
FT                   /locus_tag="lpa_00791"
FT   CDS_pept        611643..612062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00791"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00791"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23827"
FT                   /protein_id="ADG23827.1"
FT                   /translation="MNSHTSKYAERNRPIRRIERFILKIMIFVVIPISCILGIVYPTSK
FT                   ISNSLPVLFSLAGLIQLEVAGLFEYIDYLGNELEKIYDKSGRVPSNITRAIYEYYNPEP
FT                   TVKAFINNQLYLNKRVGFYLLLIGGLIQLFTIWLE"
FT   gene            complement(612164..612838)
FT                   /locus_tag="lpa_00792"
FT   CDS_pept        complement(612164..612838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00792"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00792"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23828"
FT                   /protein_id="ADG23828.1"
FT                   /translation="MKNATKVKKDSSAMGQRIKRARMLAGLSRKDLEEKHGISIHTLQS
FT                   WELGRNPLNKAKAASLVGILNQYDVSCSIDWLLEGIGKGPSVIENEFQNYPFLADTVGN
FT                   LLASEQAIQKEIDFFKTNNPNAVVITVSDDAMEPEYKVGDIVGGIKFINQNKKNQCVGH
FT                   NCIVETTEGTFFRRLIKSEDKYLLVCNNNRTSVSDPVMSADSILSIAPVIWHRWKFDAL
FT                   SN"
FT   gene            613023..613904
FT                   /gene="lvrA"
FT                   /locus_tag="lpa_00794"
FT   CDS_pept        613023..613904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lvrA"
FT                   /locus_tag="lpa_00794"
FT                   /product="Legionella vir region protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00794"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23829"
FT                   /protein_id="ADG23829.1"
FT                   /translation="MDMLINQDELAAMSGLPHIQQLAYLRGIRPYMDVKTGITGIKRRI
FT                   SYQSISEQLYIEPHQGIKSQSFSRDQVRRAVSGLVRAGMIEVQSDGMQLILKCPLASRH
FT                   YSAQNKAAINPPQKATIKPHVETLVNNEFSEGEAIKADIAEPQKAAIPLKDNNYIYLLS
FT                   RFEQFWNLYPEKKSHERAFEAFRKISPDEHLLRMMLQALENQIKARNVKIAHGEWVPPW
FT                   KYPSNWLVQKCWEDEVKIEVTQEKRNAKRHPNTELTTVDPFWNPEGEDTASTSEDEYEQ
FT                   SNVINLRCYRQQ"
FT   gene            613870..614229
FT                   /gene="lvrB3"
FT                   /locus_tag="lpa_00795"
FT   CDS_pept        613870..614229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lvrB3"
FT                   /locus_tag="lpa_00795"
FT                   /product="Legionella vir region protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00795"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23830"
FT                   /protein_id="ADG23830.1"
FT                   /translation="MSSTCDATDSNKKRIESLFTRFAVFYGHLWRSQFKSDGFLEFAKK
FT                   EWMAGLSKFSDDVLNQAIVECRDFCEMPPSLPQLIRICRDIKKRNNVYVTPEEVAPASA
FT                   EVAEANIKQCKAFLF"
FT   gene            614250..614516
FT                   /gene="csrA"
FT                   /locus_tag="lpa_00796"
FT   CDS_pept        614250..614516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csrA"
FT                   /locus_tag="lpa_00796"
FT                   /product="carbon storage regulator"
FT                   /note="COG1551, CsrA, Carbon storage regulator (could also
FT                   regulate swarming and quorum sensing) [Signal transduction
FT                   mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00796"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23831"
FT                   /protein_id="ADG23831.1"
FT                   /translation="MLVLTRRVGESVVISEDIYCTIVGYQNDEVRLAFDAPKSIPIHRD
FT                   EIQRRIYRDQIKDNKFVDKAANNESIVDRLINKFKSSASPTNS"
FT   gene            614527..615492
FT                   /gene="virB11"
FT                   /locus_tag="lpa_00797"
FT   CDS_pept        614527..615492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB11"
FT                   /locus_tag="lpa_00797"
FT                   /product="LvhB11"
FT                   /note="COG4962, CpaF, Flp pilus assembly protein, ATPase
FT                   CpaF [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00797"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23832"
FT                   /protein_id="ADG23832.1"
FT                   /translation="MTIDEEQLITVKDRAKEKLRRDLGGLIERALNDPKTVEIMLNADG
FT                   RLWQERLGETMRCIGSINEVRAESIIKTVAGFHGKEVTRFKPMLEGELPLDGSRFAGQL
FT                   PPVVSRPTFAIRKKALSVFTLDEYVRAGIMTDEQNEIIQQAVSNHRNILVIGGTGSGKT
FT                   TLVNAIIHEMVKSAPHERIFIIEDTGEIQCSAENCVQYHTTMDVNMTQLIKTTLRMRPD
FT                   RILVGEVRGSEALDLLDAWNTGHEGGAATLHANNCLAGLHRLKSLITRNPAAPAEIEPL
FT                   IGEAVHCVVHIARTPDGRFVKEIISVEGFKNGQYNIKKLV"
FT   gene            615504..615881
FT                   /locus_tag="lpa_00798"
FT   CDS_pept        615504..615881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00798"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00798"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23833"
FT                   /protein_id="ADG23833.1"
FT                   /translation="MNQLSSFNHKKIWMMGAVILFLFLMTHPASASTAGGGLPFDSWLT
FT                   KIQKSITGPFAFSAAIIGLVAAGATLIFGGELNGFMRTLVFFVLVLSFLVAAQNTMTAI
FT                   TGKGAEISKPSVEMTAIESQP"
FT   gene            615956..616177
FT                   /gene="trbD"
FT                   /locus_tag="lpa_00800"
FT   CDS_pept        615956..616177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbD"
FT                   /locus_tag="lpa_00800"
FT                   /product="trbD Conjugal transfer protein trbD"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00800"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23834"
FT                   /protein_id="ADG23834.1"
FT                   /translation="MFSGLLSAILVFAAQDWLAAIAGIVMWFLSLKGLRLMAKSDPYMR
FT                   AVYLRQRRYQAYYPARSTPFRENKRGYQ"
FT   gene            616174..618699
FT                   /locus_tag="lpa_00803"
FT   CDS_pept        616174..618699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00803"
FT                   /product="hypothetical protein"
FT                   /note="COG3451, VirB4, Type IV secretory pathway, VirB4
FT                   components [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00803"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23835"
FT                   /protein_id="ADG23835.1"
FT                   /translation="MIELIAFLISTTGLVILGTLFWEIRSKSCGHHVKKHRSHTAGLVD
FT                   LLNYAAVVDDGVIVGKNGSFMAAWLYHGEDNANTTDEAREMVSFRINQALSAMGSGWMI
FT                   HVDAMRRTAPGYSARGYSHFPDPISMAVDEERRQLFEQLGTLYEGYFVITLTWYPPVLV
FT                   QKRFVELMFDDSGERLSQKAKTHQLIETFKQSCRNFESRMSSAVHLERLGSDDKGDTVM
FT                   QDNFLRHLQYCVTGINHPVNLPKNPIYLDALIGGQELTPGITPKIGRKFVQCVAIEGFP
FT                   MESYPGILTALSQLPIEYRWNSRFIFMDAHEAVAHFTKFRKKWKQKVRGFFDQIFNTNS
FT                   GIVDEDALSMVNDAQSAIAETNSGMVGQGYYTSVVVLMDEDRAQVEKAALFIEKNINAL
FT                   GFAARVETINTMDAFMGSLPGHGVENIRRPLINTMNLADLLPTSSIWTGENKAPCPLFP
FT                   PLSPPLMHCVTSGNAPFRLNLHVRDLGHGIMFGPTRSGKSTHLGLLALSWRRYKDARIY
FT                   SFDKGLSMYPTCKATGGEHYTIADKDSKLAFAPLQFLESKADRAWAMEWIDTILALNGL
FT                   DTTPAQRNEIGYAIISMHQSGSKTLSEFVMTIQDEHIRETLKQYTIDGLMGHLLDAECD
FT                   GLGLSSFMTFEIEHLMGLGEKFALPVLLYLFRRIETSLDGRPTLILLDEAWLMLAHPVF
FT                   KNKIAEWLDSMAKKNCAVFMATQHLSHAAKSGILDIIVESTATKIFLPNLYARDPETCV
FT                   IYERMGLNPRQIDIIAQAQPKRDYYYVSEKGQRLYQLALGSMALAFVGATDPDSIARMK
FT                   QLELKYSDGWVSQWLTEKGIQLEQYGEAA"
FT   gene            618696..619439
FT                   /gene="trbF"
FT                   /locus_tag="lpa_00805"
FT   CDS_pept        618696..619439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbF"
FT                   /locus_tag="lpa_00805"
FT                   /product="Conjugal transfer protein trbF"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00805"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23836"
FT                   /protein_id="ADG23836.1"
FT                   /translation="MKKIKQWLNTKRPEKKNEALTENPFLNARRAWNVHTAGLMKSVQV
FT                   WQLVGLSSLLLALAAVGGLISIGSQSKFIPLVFQQDANGNTLSVTRADRVGQANIDDYR
FT                   AAAAHFIENIRMVSSDVELQKKAVFQVYSYLNQNDAALAKVQEFYSNKQQSNPFERATH
FT                   EIVSIEIRSVLQESDETWQVDWVETVRNRDGTLKEKPYVMKAMITMYQDNELNDVSSES
FT                   ILKNPHLIFIRDFNWSYELKHGEQR"
FT   gene            619436..620311
FT                   /locus_tag="lpa_00807"
FT   CDS_pept        619436..620311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00807"
FT                   /product="type IV secretion system protein VirB9"
FT                   /note="COG3504, VirB9, Type IV secretory pathway, VirB9
FT                   components [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00807"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23837"
FT                   /protein_id="ADG23837.1"
FT                   /translation="MKKIMLTFCLLMPLTGFALDNNELATRYFSENDPKLSNQEKQALD
FT                   IAERWQKGDKTSKPFPSSDGSVSFVYGSGQIRVVCAPLQVCDIALQAGEQFNDMNVGDP
FT                   RFIVEPSITGSGAAQQIHLLIKPKDVGLDSSLVVTTDRRTYHFRLKSDRTEFMPYVSFI
FT                   YPDEAKAKWQFIQNVQAERRKMDTLPETNEYLGNLNFNYRIQGHARFKPLRVYNNGVKT
FT                   IIEMPKTMAQSEAPVLLVLRSRGLFQKSESVMVNYRLQGCRYIVDSVFDRAILVIGSGS
FT                   SQEKITITRC"
FT   gene            620314..620724
FT                   /locus_tag="lpa_00808"
FT   CDS_pept        620314..620724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00808"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00808"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23838"
FT                   /protein_id="ADG23838.1"
FT                   /translation="MKELSVLLFALLLSSCASQRYGNFTQVSQGRDVYLAQDAASQLTR
FT                   VYPPAQNTFCISQKVRDAFGISLIHEMRKKGYGVIENNCPKQKANFFYVVDEIKATNLY
FT                   RVSLFIGSQTFSRIYAKTGGKIPPVSAWTHKE"
FT   gene            620730..621980
FT                   /gene="trbI"
FT                   /locus_tag="lpa_00810"
FT   CDS_pept        620730..621980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbI"
FT                   /locus_tag="lpa_00810"
FT                   /product="trbI Conjugal transfer protein trbI"
FT                   /note="COG2948, VirB10, Type IV secretory pathway, VirB10
FT                   components [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00810"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23839"
FT                   /protein_id="ADG23839.1"
FT                   /translation="MNQNNDFLSKDYSPQKLQTAGVKRVNNVPLIIVIGILTVFVVLIA
FT                   FVANKRANAQNQSPEIVKIKSQKKNTMSLAYEVVGNHKVPVVAPQTETITIKQEASLPI
FT                   LEQQDLPQKQETLDQNVTDAEIERIRQEKTQEFEEAVKAKTSIMVDNVRLNNRASVRTS
FT                   MSGNDVTFNVDPSTAFKEQLMLVQGMHNKPMPQTLGGEENEMRWHLNSRLESPNSRYEL
FT                   RAGGVIPGVMVSGISSELPGQIIGQVSQNVYDTATGKYLLIPQGTKVFGIYSSDVSFGQ
FT                   NSVLVAWQRLVFPDGKALDIGSMPGADSAGFAGFRDQVDHHYARIYGSALLMSGIVAGI
FT                   TYSQNSNQPNQFGYSQPTAGSVLSQALGQQLGEVTSQLVSKNLNVSPTINVRPGYRFNI
FT                   IVVKDLTFKQLYRQFAY"
FT   gene            621996..622736
FT                   /gene="trbJ"
FT                   /locus_tag="lpa_00811"
FT   CDS_pept        621996..622736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbJ"
FT                   /locus_tag="lpa_00811"
FT                   /product="Conjugal transfer protein trbJ precursor"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00811"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23840"
FT                   /protein_id="ADG23840.1"
FT                   /translation="MKFRIMLIYLWTLHVFASGAPVFDFANWIENGKIILNQVSQYKTQ
FT                   IDQYNNQLQQYQNMLENTKSLTSFQWDNANSVINNLLESTNTIDYYKQEAGSLQGYLDR
FT                   FQSQEYYQKTPCFNGNGHCSPEELRKIKQSRLSTSVAEKRANDAMLKGIDKQQQSLKDD
FT                   SEKLRVLQSQAQSAVGQKQALQAASQLASNQSHQLLQIRGLLLAQQNAQAVKDAANANK
FT                   EAIQAAGDEQFRAGTYHKSSGKKW"
FT   gene            622763..622975
FT                   /locus_tag="lpa_00813"
FT   CDS_pept        622763..622975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00813"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00813"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23841"
FT                   /protein_id="ADG23841.1"
FT                   /translation="MKRLSLSIMVFACLLSGCESTETKARKKSEHLASLTCDSPREGHT
FT                   KEELQAIVEACFRGGSYSKSSGKKW"
FT   gene            622980..624377
FT                   /gene="trbL"
FT                   /locus_tag="lpa_00814"
FT   CDS_pept        622980..624377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbL"
FT                   /locus_tag="lpa_00814"
FT                   /product="Conjugal transfer protein trbL"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00814"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23842"
FT                   /protein_id="ADG23842.1"
FT                   /translation="MNKKTTTSLLILCLLGFSVCCHAQGHGIDSRDLLDNILYRFSSTA
FT                   SMWSQTILSYARYLFWSLATISMVWTYGLMALRKADIQEFLAETVKFLVVVGFFYWILD
FT                   NGPAIATAIMDSMRLLAAKASGINEHVSPSDIVDVGFDIVSKAIDSSSIWSPAATTVGL
FT                   IVAGLILIILALVSINMLIILITAWILTYGGIILLGFGGGRWTQDIAINYYKTVLGIAL
FT                   QAFAMILIIGIGKSFVDQYYAAMSENIMLKEMFVMMVVAVLLLVLINKIPPVLSGIVSG
FT                   GGSGGGGGLGLGGALGAAGIAGTALAGAAGAAAVQSAGGLSALQAAFKAASHSIGASGA
FT                   GSVSGDSPGSKQGSLAQAMGQASKFAGSFGSHLASGAFDVAREKAASMKDAFSAKAADT
FT                   TGGKIADAIHQRISSNAESPTINQQVSESQNVTSMGAPEGSFSSCNINSDDEISQFVNQ
FT                   KASGDGQ"
FT   gene            624374..626263
FT                   /gene="traG"
FT                   /locus_tag="lpa_00815"
FT   CDS_pept        624374..626263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /locus_tag="lpa_00815"
FT                   /product="Conjugal transfer protein traG"
FT                   /note="COG3505, VirD4, Type IV secretory pathway, VirD4
FT                   components [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00815"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23843"
FT                   /protein_id="ADG23843.1"
FT                   /translation="MSLNKPNKAIGPQVRQKHNEKTNKQLVILVALSLFISMQVGTQFV
FT                   AYKLHFSDELGFSLNHVYFPWQSLWWSLKYHHYYPDYFNAAFGLMAMSGSLFLMLIVFV
FT                   AKHLKKENISEYLHGSARWANRDDLKNAGLFGNEEGVYVGAIEDEKGDIHYLRHNGPEH
FT                   ILTYAPTRSGKGVGLVIPTLLSWKQSCVITDLKGELWALTAGWRQKHANNKVIRFEPAT
FT                   LKGSARWNPLDEIRAGTEYEVGDVQNLATLVIDPDGKGLETHWQKTSQALLVGFILHAI
FT                   YKLKNQGEPATFPNIDRMLVDPNTNIADLLIEMTQYPHVDGKTHFVISASARDMIDRPE
FT                   EEAGSVLSTLKSYLALYRDPIVAYNVSASDFCIKDLMHHASPVSLYIVTQPNDKARLQP
FT                   LVRVMLNMVVRLLADKMEFERVDDGRGNYFVRTKKTYKHRLLCMIDEFPSLGKLDILQE
FT                   SLAFVAGYGLKFYLICQDINQLKSRERGYGPDETITSNCHIQNAYPPNRIETAEHLSKL
FT                   TGQTTIVKEHTTTSGKRFSTFLNQISKTKQEVSRPLLTVDECQRMPGPKKDENGLIKEA
FT                   GDMVVYVAGFPAIYGKQPLYFKDPVFIARASVEAPEQSDILRARLREDEEIRL"
FT   gene            626260..626805
FT                   /gene="traF"
FT                   /locus_tag="lpa_00816"
FT   CDS_pept        626260..626805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traF"
FT                   /locus_tag="lpa_00816"
FT                   /product="Plasmid transfer protein traF precursor"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00816"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23844"
FT                   /protein_id="ADG23844.1"
FT                   /translation="MKKFTSWIAVLMLSIIGMAFLFMLMGFRVNTTDSIPFGLYRITNI
FT                   KNIKNAYVIFCPDDRPVFKQGLDRGYIGSGLCPGGYGYLMKKVVATNGDQISITSDGVF
FT                   VNRQLILFSKPTLIDGRKRPLPQWRTIDYQIKEDELITMTSQSECSFDSRYYGPIRIGQ
FT                   IKGVIKPIWVNATSGEIA"
FT   gene            626802..626966
FT                   /gene="traD"
FT                   /locus_tag="lpa_00817"
FT   CDS_pept        626802..626966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traD"
FT                   /locus_tag="lpa_00817"
FT                   /product="traD Protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00817"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23845"
FT                   /protein_id="ADG23845.1"
FT                   /translation="MNKEAELMDVISEKLDDLMVPGFIAEVTPIEAEIMGAFSEDALSE
FT                   DDAKEAAYD"
FT   gene            626959..629145
FT                   /gene="traC"
FT                   /locus_tag="lpa_00818"
FT   CDS_pept        626959..629145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traC"
FT                   /locus_tag="lpa_00818"
FT                   /product="DNA primase traC"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00818"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23846"
FT                   /protein_id="ADG23846.1"
FT                   /translation="MTKLSHHQVVANQIIESLKQGTAPWVKPWEPSTGGGQIPFNPVTG
FT                   KRYRGINALYLMLNQSGDNRWLTYKQAQSIDAQVRKGEKGTTVQYWKFTDEKIKNDDAG
FT                   NPVLDEQGNPVKVQVNLERPKVFYATVFHASQIDNMPELVQKEQDWSLIERAENLLLNS
FT                   GAAIFHSEADRAFYRVSTDSIHLPPKEQFKSAAHYYVTALHALGHWSGHPSRLDRDLRH
FT                   PFGSEAYAKEELRAEIASMLLGSELGIGHDPSQHTAYIKSWIRVLEGDPLEIFRASADA
FT                   EKIVNHICSLEQAQDIQHEQSIVNRDEKNNEETLMESEKNIPEKVWLSIPFKQKELAKS
FT                   VVGKLPDGTPGIAWDKTQKCWYAKPGVSIEKIKAWLPENQDSPEDKALSPADEFKEALI
FT                   SLGAVLTGEHPIMDGKTHRIQMEGDKTGEKAGFYVAHLDGIPAGYIKNNRTGAELKWKS
FT                   KGYVLTDEQKAALKAQVLENQKNRELELVERHKSTALRLKQRLSKMSEITEPTPYLKSK
FT                   GIQVHLDVYTDDDKKLTCIPATDIEGTIWTVQYIAEDGTKRFAKDSKKEGCFHVLGGMN
FT                   KLSDAPVIVIAEGYATAATIKEACGLPAVVSAFDSGNLKSVAKALHEKYPHTPVILAAD
FT                   DDKHLELSKGINPGKEKAGEAADAVNGFIVMPTFAPHEQSLNPKKFSDFNDLANHSMLG
FT                   LDGVKRQLKPKIEKVAKRCNRLRLLQKSNVIHIA"
FT   gene            complement(629147..629605)
FT                   /locus_tag="lpa_00819"
FT   CDS_pept        complement(629147..629605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00819"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00819"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23847"
FT                   /protein_id="ADG23847.1"
FT                   /translation="MTVQLIKNFNINIDRYPNQYVGCLVLTKDNKILLQQRPHDWPTYP
FT                   DYLCEFGGRIEHNESPEQAVIRELKEELGGNVKLKELVSFGAITESLSKHKELIHTFFW
FT                   HDKEGTITGCYEGLPRFFNESAHILLQTKVTDGLRWLIDESKKLHLIK"
FT   gene            complement(629616..630383)
FT                   /locus_tag="lpa_00820"
FT   CDS_pept        complement(629616..630383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00820"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23848"
FT                   /protein_id="ADG23848.1"
FT                   /translation="MDDKKLILDAANRYGFNLEFRTKKVLEEKNFSVLMNQLMKSGDEF
FT                   VEIDIRAAQYTGKEWLIECKGSSDSSHLILIKEDSSNDPKSYNTKRHAIQDSNYRIAQF
FT                   KPDENQYFFTFTGDFFNKTGQQLKKISKNDSENNFFKAQYQILSAIKAISLTDTDKDKS
FT                   KDFPIIIPMIVTNAKIWVIDYNKSSEPGVSQHKWVLHKVKIKNNLFIVPKYEIEYDSIS
FT                   ILVLNIDYLDEFLGCYSYNINGEITIGNSELAK"
FT   gene            complement(630509..632374)
FT                   /gene="traI"
FT                   /locus_tag="lpa_00821"
FT   CDS_pept        complement(630509..632374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traI"
FT                   /locus_tag="lpa_00821"
FT                   /product="TraI protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00821"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23849"
FT                   /protein_id="ADG23849.1"
FT                   /translation="MIIRHIPMKSARLSSFSNLVKYIVDEQNKQERVGKVRISNCNSID
FT                   PTWAIQEVLATQAKNQRAKGDKTYHLLISFAPGDNPSEEILKAIENRVVSSIGFNEHQR
FT                   ISAIHHDTDNLHIHVAINKIHPKTFNMIEPYKAYRAFAEAASKLEIEYGLEITNHQTRK
FT                   SRSENLADDMEQHSGIESLINWIKRNCLEQINQANHWNEIHKILSLHGLEIHIKANGLV
FT                   FCNEAGLMVKASSVSRCFSKKNLESRLGEFKPSPFSTERSRQNIYRYEPLNRKVIGSEI
FT                   YARYLHEKEHGKTLLTEKLKHLREAKARLITKAKKRGRTKRAVLKLMKAPRTQKKYLYQ
FT                   QISKTLLKEIEKVRQNYAKERKHLLELHKNKTWADWLQQKAREGDKEALTAMRYHNRKN
FT                   QSNYSLSAASSNFSLADIKQVDSITKEGTEIYKMDKAVIRNTGKEIKISKGGSIATLKK
FT                   AIEMAQQRYGNCIQVNGSPLFKKIILQITIQHNIPITFADSEMEAQHQKMVLEQERRYE
FT                   QSRRYRFNDGGRTPRSNEAAGAAIGKRGTLSSTKPNADSIRQGPPAKSQNSLRDLSQLD
FT                   MVQLARRSKVLLPDNAHDQLERQRLKSDNYVRRKVSGLSRKVEHK"
FT   gene            complement(632371..632724)
FT                   /locus_tag="lpa_00822"
FT   CDS_pept        complement(632371..632724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00822"
FT                   /product="traJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00822"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23850"
FT                   /protein_id="ADG23850.1"
FT                   /translation="MDDKNKLPTRKHGRHLRVPVLPDEEIAIKSHAAQAGLSVAEYLRR
FT                   IGLGYQIQSSIDKDYIHQLSKINADMGRLGGLFKLWLTQDRRVAHFDHRRVKALLDRIQ
FT                   TTQDAMFEVVKKL"
FT   gene            633139..633465
FT                   /locus_tag="lpa_00823"
FT   CDS_pept        633139..633465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00823"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00823"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23851"
FT                   /protein_id="ADG23851.1"
FT                   /translation="MKKPLSERVIQNQSEKKNGRTNAKIQFIALKEDIREALDKGCSMK
FT                   AVWETLSDEGQISFGYKAFRHYVLKLIKSEQENIRDDKQSKSKTTNEIKGFTFNPIPNP
FT                   EELL"
FT   gene            633465..634190
FT                   /gene="traL"
FT                   /locus_tag="lpa_00826"
FT   CDS_pept        633465..634190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traL"
FT                   /locus_tag="lpa_00826"
FT                   /product="TraL Protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00826"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23852"
FT                   /protein_id="ADG23852.1"
FT                   /translation="MAKIHITMQGKGGVGKSFVSATTAQYKLNKAQSPLCIDTDPINAT
FT                   FHGFKSLNVERLNIMEGDEINPRHFDTLIEKIANTQNDVIIDNGASSFVPLSHYLITNQ
FT                   VPTLLKDMGHELIIHTVITGGQALLDTINGFAQLVNQFPEDVRYVVWLNPYWGKVESEG
FT                   KPFEQMKVYKETKDRIAAIINIPDLKEETFGHDLSNMLQQKITFNEAIDSPERNIMTRQ
FT                   RLKLIRDQLFSQIDNAIVI"
FT   gene            634190..634639
FT                   /gene="traM"
FT                   /locus_tag="lpa_00827"
FT   CDS_pept        634190..634639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traM"
FT                   /locus_tag="lpa_00827"
FT                   /product="TraM Protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00827"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23853"
FT                   /protein_id="ADG23853.1"
FT                   /translation="MSEKINEAIQDIAGKHGVVLGRDDPVLIFQTMNDRLLEENRKVQQ
FT                   EMLTQFREEMESISSQWKVDAIDKAEKVLNAALASSKEAMNKILREATNEFVYVMKNVI
FT                   SDSLTEAKDLTQQTRKANRFTLLASVTILTVSCAFMLYLLINFSR"
FT   gene            634665..636695
FT                   /locus_tag="lpa_00829"
FT   CDS_pept        634665..636695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00829"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00829"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23854"
FT                   /protein_id="ADG23854.1"
FT                   /translation="MKNENNKKIQNLSTFSWSIAEILRGDFKQSEYGKVILPFVVLRRL
FT                   DCILETSKDAVVKAYENLPEGIDDHTKDMMLFSAVGGGLKVYNYNTLTFSKIRNQDPGD
FT                   IHKNLLDYITSFNSSVRDIFLEKFLFTDQLKRLKDGGILWQVFDLFCQIDLHPDNVSNM
FT                   EMGYLFEDLIRRFSEISNETAGEHFTPREVIRLIVDLLLINDADALAGSGIIRTVYDPA
FT                   CGTGGMLALMEEAMKEYNSKIRVELYGQELNPESFGICTSDMLVTGHNPEQIAFGNTLT
FT                   EDAHKDKKFHYMLSNPPYGVDWKKYQDPIKQEAQEKGMDGRFGAGLPRISDGQLLFLQH
FT                   MISKMRDDEVGSRIGIVMNGSPLFTGGAGSGESEIRRWMLENDWVEAIIALPTDLFYNT
FT                   GIQTYVWMLTNKKDKNRRGKVQLIDASSERFWQSMRKSLGSKRREISDHARSEIVKIYY
FT                   EMLNGGGDWSEFSKIFDRQEFGYREIRIERPLRLNFEGSKERLELLQQEKTFLKLSEIE
FT                   QQELLTALNHNTLKQQFKNRDAFEKTLKTTLNNLSFKLTAPLKKAILTTLSEKDETADV
FT                   CCDAKGNPEPDTDLRDHELVPLKEDWREYVEREVKPFVANAWVDENHKDATDGKVGRVG
FT                   YEINFNRYFYRYVPPRPVAEIDEELKQLESEIANLLKEVIA"
FT   gene            636692..638038
FT                   /locus_tag="lpa_00830"
FT   CDS_pept        636692..638038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00830"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23855"
FT                   /protein_id="ADG23855.1"
FT                   /translation="MKQVPNAGIKMPFQKEDWHIKRFKYLFKKLNRPVMDDDGVITAFR
FT                   DGLVTLRSNRRMDGFTFADKEIGYQGVEPNDLVIHAMDSFAGAIGVSDSRGKCSPVYSI
FT                   AIPINPNAAYPKFWGYYLRNLATAGFIESLAKGIRERSTDFRWKDISNLLVNFPNYEIQ
FT                   KGIADFLDHETDRIDQLIEKKVGLISVLKEKSTALVTENVLQGHRVYPEKTSAEKYTHP
FT                   DKFWPDGLNGLLQPLKFFCEETASLSDKTDPNMEIHYIDIGNVSFADGLKGSAKYLFKD
FT                   APSRARQVLRMHDVIISTVRTYLKACAYIDKDLPNLIASTGFCVLRPNDKIHPKYLYRA
FT                   IQSDPFISGVVVRSEGVSYPAVNDKMIKALKIPVPDLGLQKSISDKIEQEIHSVTQTTR
FT                   LIEKSIDLLSSFKSSLITEAVTGKLDINSWRKRGTTDERLDNIEESMRT"
FT   gene            638035..641010
FT                   /locus_tag="lpa_00832"
FT   CDS_pept        638035..641010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00832"
FT                   /product="Putative type I restriction enzyme R protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00832"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23856"
FT                   /protein_id="ADG23856.1"
FT                   /translation="MTDITNRTYSQDTIRRENVLQYHVIDRLVKKLGYVHRRTEDFDRA
FT                   SALDKTLVMQFIKSTQLDEWKRLQEQYSDSAETEFFKQLEKALKSRGTLDVLRQGIKLI
FT                   PGIKFSLCFFKPASGINKELLQLFEANILSVIDELKYSSKHDNRIDIGVFVNGIPLATI
FT                   ECKNQSTGTTFRHAEKQYRTDRSPAGEPLLTFKQGALVHFAMDEDNVSMTTRLANGKTR
FT                   FLPFNRGHNGGAGNPDIADEFRVGYLYADQPEGKAILSRDILLDIVGRFMHLEVKDGKE
FT                   VMIFPRFQQLDAVLKLLRHAKQHGPGHSYLIQHSAGSGKSNTIGWTAHRMITLHDEKDQ
FT                   PIFNTAIIVTDRIVLDRQLQNTVAQFEQTKGVVKKIDGTSRQLKEAIKQGARIIITTIH
FT                   KFSTEHLKEISGQSKRRFAVLIDEAHGSQSGKHADNLSKTLTREESNNSPSDIEDMIAD
FT                   YQRQRGPQANISYFAFTATPRNVTLERFGTKGSDGLPYPFHLYSMRQAIEEGFILDVLQ
FT                   NYMTYKQYYKLEKAIEDDPELQGRRAHRRVARFAILHPTAIAQKVEVIVEHFRRHVMQE
FT                   INGKAKAMVVTQSREHALKYYFGIKKYIEDKQYVGVKALVAFSGELEIDGETYTEAELN
FT                   GFAETQLPEKFDKDFQLLIVAEKYQTGFDQPKLCAMYIDRKLDGLQAVQTLSRLNRTTP
FT                   GKINTYVLDFQNTIEDIQNAFRPFYEVTSLEEISDPNQVYELEGRIKSFSIIDEDEVNR
FT                   FSEVFYKGALDPHDRIALEKLVKNAVQRFEYEEDEGKREEFRQLLKSYMRFYSFVAQVM
FT                   SLQDTWLEKLFSYVSWLNRLLPNREVPPEIEITDDMIRLQAFRIEKKEQGSASLSPGTT
FT                   SPLSAIKEFGANAYTEDEERSLSEIIESFNQRHGTEFTKEDFLRFEKVNQEILSDENLK
FT                   DMLKNNPPDVVFGAFSQAFFESAIQLFQRDNQLQNIIMTDAEARNQAIKHFFTRALKEV
FT                   RE"
FT   gene            641064..642122
FT                   /locus_tag="lpa_00833"
FT   CDS_pept        641064..642122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00833"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00833"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23857"
FT                   /protein_id="ADG23857.1"
FT                   /translation="MSNFQIIKTKNELDRLLQDFLKKRDEGFVFRGHADFSWELKPKLF
FT                   RDSEVVKSWESYGLSKKHIAENWIENKNTFITLSYIFGSQNLTKTNYKSALIPYKDQII
FT                   PLARLLWFYVDIMKYNYNLYKYINENKSYYEEEYLKQITVRSLDDWISYDTFLRLLEEI
FT                   LYLVERRDVYTNNLLNNPEIFEDIAAYDETRPQHYDMATSALDWTYNPFIALFFACGSL
FT                   ANANSSRAIVIYPSTQISLFLYKQISTGDNVSVILKKPSETIVNDRAKRQEGVFTWMPK
FT                   ARSFYLTKGNYPKLEDYRELINKEFILEEYRIEINDETATYIQEKLKERNINDKTMGLE
FT                   ERVLSGCLDACQ"
FT   gene            642153..642290
FT                   /locus_tag="lpa_00834"
FT   CDS_pept        642153..642290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00834"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00834"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23858"
FT                   /protein_id="ADG23858.1"
FT                   /translation="MRYRNKNSYFSPGDLVLFMRSPFASWMNRFSLGFPDKAPEKDPKD
FT                   "
FT   gene            642294..645572
FT                   /locus_tag="lpa_00835"
FT   CDS_pept        642294..645572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00835"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00835"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23859"
FT                   /protein_id="ADG23859.1"
FT                   /translation="MEVLQNKGFQHEKLQEELFKSQRLIIKKIEADTIGLKQQLTLEAM
FT                   KNGTDVIVQGYLENQQFFGYADFLVKAPGESKFGDYHYEVWDAKLSHKAKPEFIIQLCC
FT                   YAEMLEAIQGRRPDNIIIVLGNGKNEAFNVDDYFYYYLSLKESFLLSQEQFDYRNIPDP
FT                   ADSKEWGCWSSYAEKLLIERDHLFQIANITKSQIKKLNKAGIQTMQQLIDIKLNRIPGI
FT                   NSDVLERLKAQATIQKESIGKEKTQYKIIAPAPNEKSGLALLPPHSPLDVFFDIEGYPL
FT                   EEGGLEYLWGCAYFDEKGNRCFKDYWAHNEVQEKEAFKQFIEWVYARWQRDPTMHIYHY
FT                   ANYEIAACRKLMGRYGICEYELDQLLRNEVFVDLYKIVKGCLLLGEPRYSIKNVEHLYR
FT                   DKRETEVGTGGDSVVFYEQWRDLHSRDEQGETWETSHILKNIRDYNIDDCNSTQELVAW
FT                   LREQRKTNCILYPGKTEIVEPEPKEEITQCIELRDRLLTKARQRLSDYPEYAALTENLA
FT                   WMLEFHRRELKPLFWRLFDRLGLSEEELFDDLDCLAFCKRTERAPFKPTPRAKNLAYEY
FT                   QFDPTQEFKGAADYFYLLGLEDENGKNAKVKFCSEESDLENGVIVLQAREELPSLITLI
FT                   PDEYINPDPIPQAIYQLVSDYDSDRVGKCAILDFLRRSKPRIKNHCGGAIAPSHEPNIK
FT                   LQQIIQAVKNLDNSYLTIQGPPGAGKTHTAKHIIAELIKTGAKIGIASNSHKAINHLLL
FT                   KTKEYCFEQSIKGIFACTRDTDSNLQAINISILKNSDLVNNIVASCVIGTTAWGFARDD
FT                   MVGQLDYLFIDEAGQVSVANLVAMSRSAKNLVIMGDQMQLGQPSQGTHPGESGLSILDY
FT                   LLHETPTIADDMGVFLGTTYRMHSTVNHFISKFIYDSNLEPHPDNDVRVVKVPDGYQGK
FT                   LNKEAGIIFVPVEHEGNTYASDEEVSEINLLAQELMGRTFIEKLGETRKISWNDILFVA
FT                   PYNYQVNKLKQALDEQARVGSVDKFQGQEAPIVFLSMCTSDANESPRGIDFLFDKHRIN
FT                   VAISRAQSLAIVVGNPELCAVTVNRVEQLKLVNLFNALVNQSES"
FT   gene            complement(645585..646073)
FT                   /locus_tag="lpa_00836"
FT   CDS_pept        complement(645585..646073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00836"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00836"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23860"
FT                   /protein_id="ADG23860.1"
FT                   /translation="MIHDVPKRIFLPFDEKQELLLNKQLRSLNALGCDYFYYLVSDQTS
FT                   KSKSYRFCTHEDWMAFYYEEKLIENDPLKRIVEKSNISVLPWNQASFMNKHEKQTMSGR
FT                   SAFGLYNGVSIVSKFNNKNYIFVLATEHRDHDLARYLLLEKNYELKKLMHGCIASFEG"
FT   gene            646147..647349
FT                   /locus_tag="lpa_00837"
FT   CDS_pept        646147..647349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00837"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00837"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23861"
FT                   /protein_id="ADG23861.1"
FT                   /translation="MTNLARISVFISTAIEVFDLSIFAFLIPVLSSVFFSSYSQSAAFN
FT                   FTILAYVVSYVVKPFSGMVFGYLSDSYGRKQVLSVTTLLMTVSTAVIGLLPTSLRGIDL
FT                   WIALFSCRIIQGLSISGEFSNGLIFAVEQGKDRPAFSGSMAFMGGILGLLLANLSVFIL
FT                   LNLLPYEQMIQYGWRIPFLISAIIWLALYQIRRFINEPFAQKMNDTKHFSSLVKKYRKE
FT                   LVICFVAASLSASAFYMTFVYMPTLLSSVIQNQTHHRSVWVTLIALSVYFICLPLFGSL
FT                   ADRVGITKQITAASALYLLFSYVCFDYISHFNYVVIFCSLILLALIQSLYNSALPAFMV
FT                   SLFPAIHRGKALAISYNTSLSIFGGLMPYVILSHKSFMNPGVVISICAILTLVVLRFVR
FT                   E"
FT   gene            647352..647696
FT                   /locus_tag="lpa_00838"
FT   CDS_pept        647352..647696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00838"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00838"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23862"
FT                   /protein_id="ADG23862.1"
FT                   /translation="MVVYEVNLSIDNEIYRDYKDWLDEHILEMLKFPGFLNATVMHQSM
FT                   DGDSSDNQKHLTVQYQLESAEDLQNYFEEHAPKMRGDGINRFKGRFTATRRTFEVEAVI
FT                   TAVNEYVNRV"
FT   gene            647777..647974
FT                   /locus_tag="lpa_00839"
FT   CDS_pept        647777..647974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00839"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00839"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23863"
FT                   /protein_id="ADG23863.1"
FT                   /translation="MEKRVFKEAEAANYICMSRSFLSQDRVNGTLANRTPGPKYIKIGR
FT                   SIRYLKDDLDSWLEQHRKCG"
FT   gene            complement(648037..648759)
FT                   /locus_tag="lpa_00840"
FT   CDS_pept        complement(648037..648759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00840"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23864"
FT                   /protein_id="ADG23864.1"
FT                   /translation="MCKILKSIYISLMLIVSPQIKAASDTCHPKINPRLPQYIAGYGSL
FT                   IDEQSKKTTDSKAYENIPVLIKGFKRSWCAHGNLPGFNATFLSLNENKKGTFNGVIYRV
FT                   SDPKEIELYDTRETVYCRKELSAEQIKIYTKNIPEKIQVWIYYPKSTLNDQPSREFPIV
FT                   QSYVDIFIRGCIKIEEKFNIKDFAKECILTTDNWPEQHWVNDRIYPRRPSAYEPYARKI
FT                   DALLKEHLPKQFKNITIE"
FT   gene            complement(648873..648946)
FT                   /locus_tag="lpa_05013"
FT   tRNA            complement(648873..648946)
FT                   /locus_tag="lpa_05013"
FT                   /product="tRNA-Pro"
FT   gene            649247..649873
FT                   /locus_tag="lpa_00841"
FT   CDS_pept        649247..649873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00841"
FT                   /product="hypothetical virulence protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00841"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23865"
FT                   /protein_id="ADG23865.1"
FT                   /translation="MADGDIEIKAGFVDTDLDDRKLTMIDDLNNPLAIVERVYLIWWHW
FT                   ADFHLHVISPHIDTITPAIVIEPELISGSNEHEFVYSIHDSGSKLSTSKSQDMFSAGMS
FT                   MCKLFYTIEKMVHILVDRLKSGGVSMEEEVQIAFAGHEIAQRKAFESIINLPYNVVVTN
FT                   FDPGIWGEKYLQNVKRLADKGYGYPPESPRENYKHPVSSATTARK"
FT   gene            complement(649903..650280)
FT                   /locus_tag="lpa_00842"
FT   CDS_pept        complement(649903..650280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00842"
FT                   /product="Predicted membrane protein"
FT                   /note="COG5373, Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00842"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23866"
FT                   /protein_id="ADG23866.1"
FT                   /translation="MFFIKYLGALIYDLIILFILFFAYTSVLLLFTHGQAIPPATRWYQ
FT                   FSLLSITLVYYYGSIRCGGQTVGMKAWRFKLTTDSNKTLSRQQIIARFFYFIPATLIAP
FT                   FCLKGNYVLLHQWTQTRFKKV"
FT   gene            complement(650430..651569)
FT                   /locus_tag="lpa_00843"
FT   CDS_pept        complement(650430..651569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00843"
FT                   /product="Predicted signal transduction protein containing
FT                   EAL and modified HD-GYP domains"
FT                   /note="COG3434, Predicted signal transduction protein
FT                   containing EAL and modified HD-GYP domains [Signal
FT                   transduction mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00843"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23867"
FT                   /protein_id="ADG23867.1"
FT                   /translation="MIAKRPIYNQQLKCVAFEILSCRNVILNEELTRQFYELIYHTDTQ
FT                   LPLFVPFSLKKLLEQFETPINNPIILKLPADEIESVYSLTELQDSLFSIALLINTPQQL
FT                   AWLNFAEYIGLTEQLMNKSDVTKVVQYSKAKNRKIIAYDLNQHVNFEKCRAMTMDYYCG
FT                   DFLLNYIAEEHTEIAANKLNVLQLIQELQKEDCDLNTITHIIQEDPLLSYQLLKLVNSV
FT                   GFSSGPSIESIDQAVARLGTINLKKWVMLFSMKNISDKPVEILESGLIRAHMAEELAKK
FT                   SSNIFSQSAYTAGLLSILDCLLNKPMPALVEQITLAEEIKNALTNKSGPLGNLLSLVIA
FT                   YEEGHWEEVTQLNINGIDLSQLYIDSLALVSQGTKIMSN"
FT   gene            651890..652264
FT                   /locus_tag="lpa_00845"
FT   CDS_pept        651890..652264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00845"
FT                   /product="succinate dehydrogenase cytochrome b-556 subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="COG2009, SdhC, Succinate dehydrogenase/fumarate
FT                   reductase, cytochrome b subunit [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00845"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23868"
FT                   /protein_id="ADG23868.1"
FT                   /translation="MNKKRPINLDLSSLKFPPMAIASILHRVSGVLIFLLFPFVLFILG
FT                   CSLQSEESFAQTKIILANPYYKLLLWAFGASMIYHVIAGIRHLIMDMGFGESLRAGRMS
FT                   AVSIIALAVILAIFLGIWIW"
FT   gene            652258..652605
FT                   /locus_tag="lpa_00846"
FT   CDS_pept        652258..652605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00846"
FT                   /product="succinate dehydrogenase hydrophobic membrane
FT                   anchor protein"
FT                   /EC_number="1.3.99.1"
FT                   /note="COG2142, SdhD, Succinate dehydrogenase, hydrophobic
FT                   anchor subunit [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00846"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23869"
FT                   /protein_id="ADG23869.1"
FT                   /translation="MVNNVTSLTGNGLKDWLIQRVTAVYFAAYLIFLFGFILANPDLNF
FT                   SQWHLLFANKIFQIATTIGLMALTLHAWIGIWTVTTDYMKCTVIRLSVQLLVVLWLLGQ
FT                   FIWGLMIIWGQ"
FT   gene            652607..654376
FT                   /gene="sdhA"
FT                   /locus_tag="lpa_00848"
FT   CDS_pept        652607..654376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="lpa_00848"
FT                   /product="succinate dehydrogenase flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="COG1053, SdhA, Succinate dehydrogenase/fumarate
FT                   reductase, flavoprotein subunit [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00848"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23870"
FT                   /protein_id="ADG23870.1"
FT                   /translation="MTVARNRFDAVIIGAGGAGMRAALQMTNSGLKVALLSKVFPTRSH
FT                   TVSAQGGITAALGNADEDDWRWHMYDTVKGADYIGDQDCIEYLCKTGPEAVYELEHMGL
FT                   PFSRMDNGKIYQRQFGGQSKHFGGEQAARTCAAADRTGHALLHTLYQQNLKAKTHVFSE
FT                   WYALDLVKNSQGRIAGVTAMCMETGEIVFFQTRVCILATGGAGRIFQSTTNAFINTGDG
FT                   FGMALRAGIPLQDMEMWQFHPTGIAGAGVLVTEGCRGEGGYLINKDGERFMERYAPRVK
FT                   DLASRDVVARAMALEIRAGKGFDPKGVDHVKLKLDHLGADLIMSRLPGIRELSMKFAGV
FT                   DPIVEPIPVVPTCHYSMGGIPTNMHGQVITKTDGKEHVVEGLYAVGECACVSVHGANRL
FT                   GGNSLLDLVVFGRAAGIHVEELWQSNQLPDMSYVSEDDVVASLVRYERWENSKDGESHA
FT                   VIRDEMQRVMQEDFGVFRTGEVMASGLKRLQALRDRLAHAKLDDKSQIFNTERVEAMEL
FT                   DNLMATAYATALSAIARTESRGAHSREDYPKRDDANWIKHTLYFEEGEVIDYRPVNTSP
FT                   KYVEPFEPKERVY"
FT   gene            654389..655111
FT                   /gene="frdB"
FT                   /locus_tag="lpa_00849"
FT   CDS_pept        654389..655111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdB"
FT                   /locus_tag="lpa_00849"
FT                   /product="succinate dehydrogenase iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /note="COG0479, FrdB, Succinate dehydrogenase/fumarate
FT                   reductase, Fe-S protein subunit [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00849"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23871"
FT                   /protein_id="ADG23871.1"
FT                   /translation="MADSRNVILSIYRYNPEVDAKPYMKDYEIEIPAKSDPMLLTLLER
FT                   LKAEQDPSITYRRSCREGVCGSDGMNINGTNGLACITHLSQLKTDKIVIRPLPGFPVIR
FT                   DLAVDMTQFYQQYERIEPYLQNDEVAPARERLQSPEERAQLDGLYECILCACCTSSCPS
FT                   YWWNPDKFVGPAGLLQARRFLADSRDKATQHRLDLLQDPFSVFRCRTIMNCTNVCPKGL
FT                   NPTQAIAKIRTQMLTQET"
FT   gene            655169..657979
FT                   /gene="sucA"
FT                   /locus_tag="lpa_00850"
FT   CDS_pept        655169..657979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="lpa_00850"
FT                   /product="2-oxoglutarate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /note="COG0567, SucA, 2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase (E1) component, and related enzymes [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00850"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23872"
FT                   /protein_id="ADG23872.1"
FT                   /translation="MSSSDLQKEWASSYLSGGSMAYVDSLYEDYLADPDSVSEDWRAVF
FT                   SALPKVNGATKEVSHRDIRDYFLQNADKKLNKIIQIADSQQYQVASLINDFRSLGHLAA
FT                   KLDPLEMTERMPVPRLELAYHNLADVDVNRTFFAGTSFNGPEMTLGEIYNALRETYCRS
FT                   IGIEYMHISDTEVTEWLQHKMESVRGCPEFSKQEKLNILKDLIAADGLERYLGTRYVGQ
FT                   KRFSLEGGDSLIPMMKELIRRSGVNQVKELVIGMAHRGRLNVLVNVLGKEPGLLFQEFE
FT                   GKIKYERTGDVKYHLGFSSDIKTESGAIVHLALAFNPSHLEIIGPVVEGSVRSRLGRRN
FT                   DLAKKDKVVPIVIHGDAAFAGQGVVMETFNFSQARGYCTGGTIHIVINNQIGFTTSNPL
FT                   DARSTLYCTDVAKMVQAPVIHVNGDDPEAVVFATQVAFDFRMKFKRDIVIDLVCYRRHG
FT                   HNEADEPSVTQPKMYKKIKSMPTLREKYGEQLVSANLLTKTELDKLVDSYREALDKGKA
FT                   VVDLVHEDYEGKQSLDWTPYINAKWTDKVDTTISKEELEKISSQLNKLPDGMKLHPVVE
FT                   RLLAERNKMTAGEIPMNWGYAEIMAYASLLHEGYGVRISGQDSGRGTFAHRHAALHDIE
FT                   KGDTFIPLEHISTNPKRYFTVIDSVLSEEAVLAFEYGFASSEPSFLVIWEAQFGDFANG
FT                   AQVVIDQFISSGEQKWGRLCGLVMLLPHGYEGQGPEHSSARLERYMQLCAQHNIQVCTP
FT                   TTPAQIFHLLRRQVIRNFRKPLIVMTPKSLLRHKLAVSPLEALFKGKFHTVIPEIDALD
FT                   AQKVTKVVLCCGKVYYDLLQMRRDKNLNHVAIVRIEQLYPFPKKALMAELEKYQKANEV
FT                   VWCQEEPQNQGVWFSSQHNIRDCLRSDQTLQYAGREFAAAPAVGSPGLHAEQQVALVEQ
FT                   ALLGKK"
FT   gene            658015..659244
FT                   /locus_tag="lpa_00851"
FT   CDS_pept        658015..659244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00851"
FT                   /product="2-oxoglutarate dehydrogenase E2 component
FT                   (dihydrolipoamide succinyltransferase)"
FT                   /EC_number="2.3.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00851"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23873"
FT                   /protein_id="ADG23873.1"
FT                   /translation="MSIEVKVPVLPESVADATVAAWHKKVGDKVSRDENLVDLETDKVV
FT                   LEVPSPVDGVLSDILFNTGDTVGSGDLLAKISQSVSVESQKTEKEEKPVKKEEIKISES
FT                   ESVSTKEDKSTSPVVRRMMAENDLKAGQIQGTGKDGRITKEDVLSYIESNREKSNQTAE
FT                   VQKESSMRALSFGGREEKRVPMTRLRAKIAERLLQAQHNAAMLTTFNEVNLKAVMDMRS
FT                   QYKDSFEKKHGVKLGFMSFFTKAVVESLKRFPAVNASIDGQDIVYHGFYDIGIAVSTER
FT                   GLVVPVIRDADQLSMAEIELAINDAASKARTGKLSMEEMQGGTFTITNGGVFGSLLATP
FT                   IINPPQTGILGMHKIEERPIVEKGQIVIRPMMYVALSYDHRLIDGKDSVQFLVSVKELL
FT                   EDPSRLLLNV"
FT   gene            659307..660470
FT                   /gene="sucC"
FT                   /locus_tag="lpa_00852"
FT   CDS_pept        659307..660470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="lpa_00852"
FT                   /product="succinyl-CoA synthetase beta chain"
FT                   /EC_number="6.2.1.5"
FT                   /note="COG0045, SucC, Succinyl-CoA synthetase, beta subunit
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00852"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23874"
FT                   /protein_id="ADG23874.1"
FT                   /translation="MNLHEYQAKQLFASYGLPVPRGEVAYNVEDALLVASQLSTSRWVV
FT                   KAQVHAGGRGKAGGVKLVSSKDELAAVAKSMLGTRLVTYQTDARGQPVNAILVEETCEI
FT                   DKELYLGAVVDRSTRRVVIMASTEGGVEIEKVAHETPEKIFKVVVDPLVGVMPFQCRET
FT                   AFKLGLKDDQIKQFTHLMMGLGKMFVDCDLSLLEINPLVITKSGQLICLDGKINIDGNA
FT                   LFRQPKLKNMRDVSQEDDRENRASDWELNYIPLDGTIGCMVNGAGLAMATMDVIKLHGG
FT                   EPANFLDVGGGATKERVSEALKIIVSDEKVKGILVNIFGGIVRCDLIADGILAAVKEVD
FT                   VKIPVVVRLEGNNAQLGAEILNKSNLNVIAATSLTDAAKKIVAAVSE"
FT   gene            660545..661420
FT                   /gene="sucD"
FT                   /locus_tag="lpa_00853"
FT   CDS_pept        660545..661420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="lpa_00853"
FT                   /product="succinyl-CoA synthetase alpha chain"
FT                   /EC_number="6.2.1.5"
FT                   /note="COG0074, SucD, Succinyl-CoA synthetase, alpha
FT                   subunit [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00853"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23875"
FT                   /protein_id="ADG23875.1"
FT                   /translation="MSVLVDKHTKVLCQGFTGKQGTYHTEQALAYGTKMVGGVTPGKGG
FT                   QMHLGLPVFNTMREAVEETQADASVIYVPAPFCKDSIIEAAEAGVKLIVCITEGVPVLD
FT                   MLQVKVYIENNTQARLIGPNCPGIITPGECKIGIMPGYIHLPGKVGIVSRSGTLTYEAV
FT                   KQTTDKGFGQSTCIGIGGDPIPGTSFIDALSLFEKDPKTEAIIMVGEIGGSAEEEAAEF
FT                   IKSHVKKPVVSYIAGVTAPAGKRMGHAGAIISGGKGTAAEKYAALEAAGVKTVRSPADL
FT                   GDAIAEVTGW"
FT   gene            661842..662489
FT                   /locus_tag="lpa_00854"
FT   CDS_pept        661842..662489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00854"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="COG0259, PdxH, Pyridoxamine-phosphate oxidase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00854"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23876"
FT                   /protein_id="ADG23876.1"
FT                   /translation="MSKFRSLADIRRDYGELQLSEESAENDPISQFKLWFDDVLLNEKN
FT                   DPTAMVLSTVDEKGYPDSRVVLLKGLENGNFIFYTNYQSAKAMQIQKNPYAALNFYWPQ
FT                   MARQVRVRGRVKKISSEQSDAYFSSRPLKSQFSAIVSPQSQEILDRISLEDALNQLIEE
FT                   YGQKPVVRPENWGGYMIIPDEIEFWQGRDNRLHDRIHYYRHGHEWTHRRLAP"
FT   gene            663102..663473
FT                   /locus_tag="lpa_00855"
FT   CDS_pept        663102..663473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00855"
FT                   /product="transmission trait enhancer LetE"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00855"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23877"
FT                   /protein_id="ADG23877.1"
FT                   /translation="MNDTTSLLSHLRLRFNIEHPSYEECYIFGYECALAEVPEEDNPFR
FT                   EGSQEAEQWLEGWWAGIYGEKPLFDLNNIEEDILLDKTTAANDQQYHHKNSFLSLVFEI
FT                   GGAIAASAIVGYQLLELVA"
FT   gene            complement(663544..663933)
FT                   /locus_tag="lpa_00856"
FT   CDS_pept        complement(663544..663933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00856"
FT                   /product="putative Fe-S center protein"
FT                   /note="COG2768, Uncharacterized Fe-S center protein
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00856"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23878"
FT                   /protein_id="ADG23878.1"
FT                   /translation="MNKLNIAIKEAFESSGSSKEANKVYLEFIKANFIIPIESNSDDSE
FT                   PRVLFLEENNHAFLPVFTDMKYLDAWASEISQHIKLLKLSGVDLLKGLGEKVTVCLDIG
FT                   SELYKEFNPSEIERMRSMVLKLFKD"
FT   gene            664583..665866
FT                   /gene="uhpC"
FT                   /locus_tag="lpa_00857"
FT   CDS_pept        664583..665866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uhpC"
FT                   /locus_tag="lpa_00857"
FT                   /product="Sugar phosphate permease"
FT                   /note="COG2271, UhpC, Sugar phosphate permease
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00857"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23879"
FT                   /protein_id="ADG23879.1"
FT                   /translation="MGISKVEIYKRKNYLGFAWLVWGLAAAFYFSDYLARVAPGVMHRY
FT                   LQMDFGINEAGFGILTASFYVPYILMQIPVGLTVDRLSIRWLLTIMSLVTAFGCCVFGL
FT                   ADGLLTASIGRMLIGFSAAFAFICSLRLATSWFPPTMLGLLSGLTQALGMLGAAAGEAP
FT                   VSFLVSNVGWRHSMLIIAFLFIALSGLLYQFVQDKPGEHRNEIRSVNRISILDSLKIIL
FT                   SNKQTWLNAMYAGFLFGPTAVIGEAIGPAYLQFGRGLGAHAAAFATGLIFIGWGISGPL
FT                   SGWISDKMGRRKPLMIISAVCGVILSSLFVFIPEMSQTTAYILFFVFGLTNTGVAISYA
FT                   VSTEIHDRSVVGTSIAFTNMTSIFVGALFQPLVGRIIDMVSGPRAYNVETLLLSDFQAG
FT                   LKLLPLCSLVALILAFTVKETYCKPIRH"
FT   gene            666094..667551
FT                   /locus_tag="lpa_00859"
FT   CDS_pept        666094..667551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00859"
FT                   /product="putative protein conserved in bacteria"
FT                   /note="COG5339, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00859"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23880"
FT                   /protein_id="ADG23880.1"
FT                   /translation="MKKLTGLVIILAVLILGGYYGMGILTERTVKKTVEVINQSNGLFA
FT                   DIQQYKRGWFCSDALVKWRLHVPERVVKDDDGKLQTTPAQDYQMEMPIKIYHGPIIYAN
FT                   KQLRFGMGFAQTVFPFPEKYNQQFNELFSQDSEKPQLDLSIFVNYLNKSTVELSIPSFK
FT                   LTAKDGNGKFNWMGMDSTTSMSSNLDKVEGEIEFDGAEFSKDDTKLSLGKVISEYDLHK
FT                   TTTGLYLGQASFSLPSLAVVVKDQKMFEISELTLSSSSDIDDNLFSTHFSAALKSLFAN
FT                   GQNYGPGEVEMSLRNLDAEVLAKINEQANAMQRGTDQERQQALMAMLPELPKLFSKGAE
FT                   FEISKLSLKLPQGMIDGNLLITLPKGDNSNPFELIQKTQGNAKLKMPIEVVKQLMQQSI
FT                   MQQMAKQPEMQQALIQQLQSSQGQSNQAEPTPEQIAAMQVDKQINELEQSGLITVDGKD
FT                   YVIEMSLSEGKFTVNGKPFDPSMMKFQ"
FT   gene            667741..668022
FT                   /gene="fis"
FT                   /locus_tag="lpa_00860"
FT   CDS_pept        667741..668022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fis"
FT                   /locus_tag="lpa_00860"
FT                   /product="DNA binding protein Fis"
FT                   /note="COG2901, Fis, Factor for inversion stimulation Fis,
FT                   transcriptional activator [Transcription / DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00860"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23881"
FT                   /protein_id="ADG23881.1"
FT                   /translation="MTTISNDAGDTTASLAESVTQSVQKYFSELKGTDPVDLYQFVLEE
FT                   IETPLFRAVMEHCKYNQSRAAIMLGISRGTLRTKLRRYFDDKYVGTRD"
FT   gene            complement(668084..669031)
FT                   /gene="prsA"
FT                   /locus_tag="lpa_00861"
FT   CDS_pept        complement(668084..669031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="lpa_00861"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="COG0462, PrsA, Phosphoribosylpyrophosphate
FT                   synthetase [Nucleotide transport and metabolism / Amino
FT                   acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00861"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23882"
FT                   /protein_id="ADG23882.1"
FT                   /translation="MSTMMIFTGNANPELALKISSHLQIPIGKATVGTFSDGETMVEIL
FT                   ENVRGKDVFVLQSTCAPANNNLMELLIMADALRRSSAGRITAVVPYFGYARQDRRVRSA
FT                   RVPITAKVVADMMASVGICRVLTVDLHADQIQGFFYMPVDNVYSTPVLLEDITKQKLNN
FT                   IMIVSPDVGGVVRARAVAKRLNDAELSIIDKRRSGPNKSEVMHIIGEPANKNCIIVDDI
FT                   VDTAGTLCTAAQELKKNGAKSVRAYITHPVLSGPAVNNIKHSGLDEVVVTDTIPLSAEA
FT                   QNCEKIRVVSLADMLAQAIKRVNVEESVSSMFAE"
FT   gene            complement(669216..669287)
FT                   /locus_tag="lpa_05014"
FT   tRNA            complement(669216..669287)
FT                   /locus_tag="lpa_05014"
FT                   /product="tRNA-Gln"
FT   gene            complement(669413..670012)
FT                   /locus_tag="lpa_00864"
FT   CDS_pept        complement(669413..670012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00864"
FT                   /product="outer membrane lipoprotein LolB"
FT                   /note="COG3017, LolB, Outer membrane lipoprotein involved
FT                   in outer membrane biogenesis [Cell envelope biogenesis,
FT                   outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00864"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23883"
FT                   /protein_id="ADG23883.1"
FT                   /translation="MNAIKRLTIILICFLTACAPPRPSEEPPANREIPLEERKAETATV
FT                   SSWEIKGALAAKTKAKGWSATMNWVQQGANSYQIRLMGPLGGGAVLISKKGNTITFQDG
FT                   SKITTSTNADELLLKQTGIRLPVNNLYYWVRGLPAPGGVQSEKHDQFNHLIQLKQNGYT
FT                   IDFTKYTSVKGIDLPSMIRLEGNGVMVKVVIKNWVV"
FT   gene            670075..670587
FT                   /gene="coaD"
FT                   /locus_tag="lpa_00866"
FT   CDS_pept        670075..670587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="lpa_00866"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="COG0669, CoaD, Phosphopantetheine
FT                   adenylyltransferase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00866"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23884"
FT                   /protein_id="ADG23884.1"
FT                   /translation="MQMVINEMKQKAIYPGTFDPVTNGHIDIITRASTIFPELIVAVAS
FT                   NKNKRPYLSWESRISLLEESVGHLTGVRVVGFDNLLIDFVLEQNAGIILRGLRAVSDFE
FT                   YEFQLAGMNRKLSKKVETLFLTPAEHLMYISSTLVREIAALNGDISQFVPPNVVRELKK
FT                   RQNERSL"
FT   gene            670571..672295
FT                   /gene="ggt"
FT                   /locus_tag="lpa_00867"
FT   CDS_pept        670571..672295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="lpa_00867"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /EC_number="2.3.2.2"
FT                   /note="COG0405, Ggt, Gamma-glutamyltransferase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00867"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23885"
FT                   /protein_id="ADG23885.1"
FT                   /translation="MKDHYKWLSCLFFLICNIYQVNAKTFPQHPPGYAVASAHPLATHA
FT                   GLEILAAGGNAFDAAVAVAAALAVVEPYHSGLGGGGFWLLHQEKEHLNLFIDGREVAPL
FT                   AASKDMYLAPDGQVIPGLSLNGGLSAAIPGQPAALVYIAKNYGRLPLSKTLAPAIKLAE
FT                   EGFPVDPQFRYFSTLDDRLENLKKYPDTAAIFLKNGQPFEIGEKLVQKDLAKTLRLIAK
FT                   YGNAGFYSGETASLLVQGVNAAGGIWSLDDLAQYKIKVRPPLISAYHNMLIITAPLPSA
FT                   GGVALVTMLNILSKFPLSSFPKLKWVHYVVESMRLAYWQRDQFLGDPDFIKVPLDKLIS
FT                   SDNAKQLSRLISPNKAIDSKVLQGSVPTGKHSNTSHISIIDTEGNRVAATMTINYIFGS
FT                   SVVAKGTGVLLNDEMDDFSTKVGEQNVFGLVGSERNAIEPRKRPLSSMAPTFLEMPGRV
FT                   AILGTPGGSRIPTMVLLASLLFYDGYGAISMVSAMRFHHQYLPDVLQFEPDTFPSSIQQ
FT                   GLQAMGYHLMPLKQYYGDMQAITWDKESNVLTAASDPRHIGLAAAISNMAYGYGVNY"
FT   gene            complement(672393..674609)
FT                   /locus_tag="lpa_00868"
FT   CDS_pept        complement(672393..674609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00868"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00868"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23886"
FT                   /protein_id="ADG23886.1"
FT                   /translation="MSINKIEEDRDTSSDLEMKAKMYLVHRMDKARPLTVKDVHILINK
FT                   LSKDLQKNQLTLIDCQLIINLVESRFTLVKQATRYLQFFLNKLDGKSINPILIPLSNIP
FT                   FWQNEPHPFDHYRSTDQLPEKADIVIIGAGLTGASTAYHLIDAVKKRNLTVVLLDKGNP
FT                   ATEASGRNGGNFELLPENSVGIYSGLVSERFRFLKRCYPLVHPSILQIESEYHASLVFQ
FT                   FALKNRNRFKEIVRKERIYCDLAAKGWLYIAHTEEEEQAICDEVTLAAQHGERIYIWSR
FT                   KKIREQFGINSKFIGRFIPDDGTYNPFKYTCCLIKAAIKGGIKLYTFVKVQQIQSMDTE
FT                   YHQLKTNMGLLKARQVIVATNAFTSELLPELSAIKPHQSQIAITDSTPDYCKGRLITSE
FT                   DGPLYLNQPRVRSKNGLVPLLIGAGDDRPMKNPYYRKRSKKVHDLIVQQRDKYFPDLKG
FT                   KPFSTEWVGALAFTPDQLPAIGYLSPGIIIVMCCNGYGGSYTTAAGFAAAEIALTGQNP
FT                   PWLPADVFSPKRLLSDKPLFLEDSDSLWRIGKTLCTTLNNLNQLLAESLSYQSMYQPYF
FT                   TISSLPHGHQEKTCNLDPLRVMHQLAIFRTFAYQELEMLIRYTSPVCLNKGEILFKQGD
FT                   AGHSCFILIQGKINLYYEHAEGFTSMVAELEAGSVFGQMALFLENKRMATCQATENCSM
FT                   LEIMVEPCKSLFIQQQALGIKLLRLLNQGVIDALHKLNKRLKYT"
FT   gene            complement(674819..675550)
FT                   /gene="acd"
FT                   /locus_tag="lpa_00869"
FT   CDS_pept        complement(674819..675550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acd"
FT                   /locus_tag="lpa_00869"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="COG0204, PlsC, 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00869"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23887"
FT                   /protein_id="ADG23887.1"
FT                   /translation="MKISRLKTFWIITRLFYYTGVACTRSIFKYLFSTPTRPWVDKVIH
FT                   HWVDQLLNAVKVEYKVINPHNVQPQPGKATILMCNHSSAYDIPLGFKAFPNNSIRMLAK
FT                   RELSKIPLLGKGMAAAEFPFIDRKNRFQAIKDLEFAQQLMESGIILWVAPEGTRSKDGK
FT                   LAPFKKGGFITAIQAKATIIPIGIRGAFDILPARTFNIHLNQKAEIHIGEPIDAAQYTI
FT                   ENKEELIEKTHQSIKKLVGEN"
FT   gene            complement(675619..675939)
FT                   /gene="sugE"
FT                   /locus_tag="lpa_00870"
FT   CDS_pept        complement(675619..675939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="lpa_00870"
FT                   /product="suppressor of GroEL"
FT                   /note="COG2076, EmrE, Membrane transporters of cations and
FT                   cationic drugs [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00870"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23888"
FT                   /protein_id="ADG23888.1"
FT                   /translation="MLLPWLYLIIAGLLEVCWAVGLKYTDGFSKWQPSLFTVTMLIISM
FT                   FLLAKAAQTLPIGTAYAVWVGIGSLGTAIMGILLFQEHLSVFRLLYLVLMLISIFGLKY
FT                   TA"
FT   gene            complement(676081..676395)
FT                   /locus_tag="lpa_00872"
FT   CDS_pept        complement(676081..676395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00872"
FT                   /product="Predicted aminoglycoside phosphotransferase"
FT                   /note="COG3173, Predicted aminoglycoside phosphotransferase
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00872"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23889"
FT                   /protein_id="ADG23889.1"
FT                   /translation="MWVHGDISAGNLLVKNGKLCAVIDFGQLSVGDPACDLAITWTLFA
FT                   GDSRKIFREMLALDKGTWFRGQAWALWKALIVAAGIVNTNAMELQKSCRIINELFLTEL
FT                   "
FT   gene            complement(676779..677846)
FT                   /locus_tag="lpa_00876"
FT   CDS_pept        complement(676779..677846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00876"
FT                   /product="DNA-damage inducible protein P"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00876"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23890"
FT                   /protein_id="ADG23890.1"
FT                   /translation="MNPIRKIIHIDMDCFYAAIEMRDFPELANKPIAVGGDAKRRGVIA
FT                   TCNYAARQFGIRSAMPTAHALKLCRELILRPVRMDVYQKESQYIRSLLTEYTDLIEPLS
FT                   LDEAYLDVTESTQCQGSATWIAEEIRARIYQTRQLTASAGIAPNKSLAKIASDWHKPNG
FT                   QMVIRPEDVSAFVLDLPVRKLFGVGPKMEEKLGALNIKTCADLQRYSVEYLLQKFGTMG
FT                   QRLYELARGIDNRPVNPERIRKSISVEETYPKDLPNSEACLAVLPELMARLEARIQRAG
FT                   KISGIHNLFVKLKFNDFQQTTIERVMDKLDLIVLRQLIQEGFARRGMPVRLLGIGIKLK
FT                   QENTYQSVQLPLLDL"
FT   gene            678160..678230
FT                   /locus_tag="lpa_05015"
FT   tRNA            678160..678230
FT                   /locus_tag="lpa_05015"
FT                   /product="tRNA-Gly"
FT   gene            complement(678286..678906)
FT                   /locus_tag="lpa_00877"
FT   CDS_pept        complement(678286..678906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00877"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00877"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23891"
FT                   /protein_id="ADG23891.1"
FT                   /translation="MDIKKLKKAASNFLERYPGGFYHPEMIEMGKKHKMDKMVALAQGS
FT                   FAKQNFKNPDEITNSMLKIVTQSSLISIFEKPKFRDFIKRTPPNDKVLIAKGLKELLYG
FT                   NEQEGFEELLFQFQREKLAKWTLMTIFQAYFNPEVDVFIKPTTTKNIIKELNLDIVYNP
FT                   PPSWEFYESYRNIINQMKTKIEKSLAPSNAAFCGFLMMSLDDR"
FT   gene            complement(678981..679805)
FT                   /locus_tag="lpa_00880"
FT   CDS_pept        complement(678981..679805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00880"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /note="COG0266, Nei, Formamidopyrimidine-DNA glycosylase
FT                   [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00880"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23892"
FT                   /protein_id="ADG23892.1"
FT                   /translation="MPELPEVETTKQGIKPHLEGRMITAVQVRNRKLRLPVPLNLNELC
FT                   QGKHITAITRRGKYILLHMDKGYLLIHLGMSGHLRIVSQTANPQKHDHIDLHINNGLAL
FT                   RFCDPRRFGLFIYIDENPYQHPLLAHLGPEPLSDDFNSEYLLRKAANKSQSIKSFIMDS
FT                   QIVVGIGNIYAAESLFLAKIHPNTSAKKITTEEFNALTGHIKKILESAIEAGGTTLRDF
FT                   YSSDGKPGYFRFALKVYGRKNLPCLVCENKIETVVIAGRHSAFCPHCQPIIT"
FT   gene            complement(679805..680035)
FT                   /locus_tag="lpa_00881"
FT   CDS_pept        complement(679805..680035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00881"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00881"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23893"
FT                   /protein_id="ADG23893.1"
FT                   /translation="MSDKVQKLIENIVPFIVIGVGIAIVVALLFMFFYVAIWGVIIGGI
FT                   LWLGALAKEYFFPSKSSQKEQGRIIEHDDKK"
FT   gene            680216..681403
FT                   /gene="oLE1"
FT                   /locus_tag="lpa_00882"
FT   CDS_pept        680216..681403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oLE1"
FT                   /locus_tag="lpa_00882"
FT                   /product="stearoyl-CoA desaturase"
FT                   /EC_number="1.14.19.1"
FT                   /note="COG1398, OLE1, Fatty-acid desaturase [Lipid
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00882"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23894"
FT                   /protein_id="ADG23894.1"
FT                   /translation="MVFGFLNLSFWGYVLATFILTQITIASVTIYLHRNQTHRALTLHP
FT                   VISHFFRFWLWLTTGMVTADWVAIHRKHHATTDVEGDPHSPVVEGIRKVFWQGAELYRE
FT                   ARKDRDMVAKYSHGTPTDWIERNVYSRHSSKGILLMLLLDLFFFGIPGITVWAIQMMWI
FT                   PLFAAGVINGIGHYWGYRNFECPDAATNIIPWGFWIGGEELHNNHHTFASSAKFSVKWW
FT                   EFDIGWMYIRILSFFGLAKVKKLPPKLAMDEGKFHVDLDTVRAVISNRFQVMSYYYKNV
FT                   IRPILKYEKNTSIETKEDKKLFQRAGRLLRREDKLLSTKAKTRLQKLLDAREQLRVVYS
FT                   YKQSLQNVWLKTATTQKELVEALQQWCRQAEESGLDVLKQFAQQLKGYVPVYTRE"
FT   gene            complement(681444..681842)
FT                   /locus_tag="lpa_00884"
FT   CDS_pept        complement(681444..681842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00884"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00884"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23895"
FT                   /protein_id="ADG23895.1"
FT                   /translation="MFNKFLVTALSVVTLTLSPYGFAKDDSCEVQVAVSTPPVQFDQSV
FT                   AFNVTNDDGISKSIILQGGSSPKTIGKLICSPLPYTISATQYFTPTGLTNRHAQPVGQC
FT                   VLKAGNVILNGSNNSVAVVFPNDFICHH"
FT   gene            682108..682848
FT                   /locus_tag="lpa_00885"
FT   CDS_pept        682108..682848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00885"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /EC_number="1.1.1.36"
FT                   /note="COG1028, FabG, Dehydrogenases with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenases) [Secondary metabolites biosynthesis,
FT                   transport, and catabolism / General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00885"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23896"
FT                   /protein_id="ADG23896.1"
FT                   /translation="MDKMIAIVTGGTGGIGSAISQRLADSYQVVACYYKDGRHEEAKKW
FT                   QDEQKQLGYDIDIVYGDIAQYSDCEKITSLVMERYGRIDVLVNNAGITKDCSLRKMTPQ
FT                   QWQQVLDANLTSVFNMTRNVVPVMLERGYGRIVSISSINGRKGQFGQCNYASTKAALFG
FT                   FTKSLALEVASKGITVNTVSPGYIETPMLAALKEDVLNSIISSIPVGRLGYPKEIADAV
FT                   AFLASPDSGFITGANLDVNGGQYM"
FT   gene            683026..683772
FT                   /locus_tag="lpa_00889"
FT   CDS_pept        683026..683772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00889"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /EC_number="1.1.1.36"
FT                   /note="COG1028, FabG, Dehydrogenases with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenases) [Secondary metabolites biosynthesis,
FT                   transport, and catabolism / General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00889"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23897"
FT                   /protein_id="ADG23897.1"
FT                   /translation="MLNNNVVLITGGTGDIGTAVAKQLDSTFKHVIALDLVSYDEGEVW
FT                   LHDLKTQGYKNINFRHMDVTDYEQCAEVIGLIIEEFGGIDVLINNAGITRDAVFTKMTK
FT                   RQWDEVLRVNLDGMFNVTKQVVESMKAQESGRIVNVSSVNAQKGQFSQANYAASKAGVY
FT                   GFTKSLAQELMIKNITVNSISPGYVNTRLMKGIRPDILEGIINLIPAKRLAEPQEIAWA
FT                   IEFLISEKSRYITGANLSVNGGLHMY"
FT   gene            683902..684300
FT                   /locus_tag="lpa_00890"
FT   CDS_pept        683902..684300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00890"
FT                   /product="putative protein conserved in bacteria"
FT                   /note="COG5394, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00890"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23898"
FT                   /protein_id="ADG23898.1"
FT                   /translation="MTRLIKKYKNRRLYDTEISQYITVEQLQKYVVDGIDFKIEDSETG
FT                   KDLTNSVLLQIIVEMEAGPTQFLSSEILRQIISLANHPMHVSFKEMMEQMFHAMDKPLQ
FT                   NNPYQQATEVWNKQMQQMVHQWQKMFKV"
FT   gene            684507..684800
FT                   /locus_tag="lpa_00892"
FT   CDS_pept        684507..684800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00892"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00892"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23899"
FT                   /protein_id="ADG23899.1"
FT                   /translation="MTQYNFERWSEMAKKIQEPFQAIAELNVKTLQGLSYLKPDELAQV
FT                   KKPEEMLEKQINLAVENGHKALDYMQKSFQIIEKAMLGFVQEAKKTTAEVKK"
FT   gene            complement(685042..686112)
FT                   /locus_tag="lpa_00895"
FT   CDS_pept        complement(685042..686112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00895"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00895"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23900"
FT                   /protein_id="ADG23900.1"
FT                   /translation="MKHTHNPFRYLIYFVFFITSLSSYSSQTTNIKEQTDTGLAPPAPS
FT                   ITTNSAAIEEQANSSIRKLYHTLNTMPNTSMADRISQISAYFKGTKYILGSLGEGPNAR
FT                   YDQFPRYRVDGFDCDTYVNTVLSLALANSLESFQECLKHTRYKNGKRSYINRNHFTSID
FT                   WNNYNQKRGLLKDITFSIRNEKKQPVALYANALINKPQWYNHKTIDTIRLQKQDKNEQE
FT                   KRLVELKAKGKTLETSLSNVPYIPFTALFSENKPNLHLFSQIPNGAVIEIIRPNWDLRQ
FT                   QIGTELDISHLGFAIWINNELFFRQASSQYGKVVDVSLIDYLDKARSSPTIKGINIQIV
FT                   LPEKPVSNGCQLFDIR"
FT   gene            686182..686787
FT                   /gene="spmA"
FT                   /locus_tag="lpa_00896"
FT   CDS_pept        686182..686787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spmA"
FT                   /locus_tag="lpa_00896"
FT                   /product="spore maturation protein A"
FT                   /note="COG2715, SpmA, Uncharacterized membrane protein,
FT                   required for spore maturation in B.subtilis. [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00896"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23901"
FT                   /protein_id="ADG23901.1"
FT                   /translation="MLNLIWLGMILISVVVGVIEGRIDEVVRAVTDSAKLGFELALGLA
FT                   GIMTFWLGIMSVATESGLVSILGKVLKPVLKRLFPDIPVEHPAMGAMVMNIAANMLGLA
FT                   NAATPFGLQAMKELQSLNQNLKVATNSMCTFLAINTSSVQLIPVTAIAFLAANGSTNPS
FT                   SVVFTSLIATTVSTLVAIVAVKQLAKLPRFKIERTDSL"
FT   gene            686784..687317
FT                   /gene="spmB"
FT                   /locus_tag="lpa_00898"
FT   CDS_pept        686784..687317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spmB"
FT                   /locus_tag="lpa_00898"
FT                   /product="spore maturation protein B"
FT                   /note="COG0700, SpmB, Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00898"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23902"
FT                   /protein_id="ADG23902.1"
FT                   /translation="MNGFANHLSNWLFLTFIVGIPLYAAIKKVNVFDAFIIGAKQGFDV
FT                   SVKLIPYLVAMMVAIGMLRASGFFSLMSQILSPALTMIGMPSELLPLALIRPFSGSAST
FT                   GVMAELIHKYGGDSFIAKTAATMMGSTETTFYVIAVYFGSVGIRRTRHAIPAGLLADLA
FT                   GIIASVLICRYLFT"
FT   gene            complement(687448..688881)
FT                   /locus_tag="lpa_00900"
FT   CDS_pept        complement(687448..688881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00900"
FT                   /product="peptidase, M23/M37 family"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00900"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23903"
FT                   /protein_id="ADG23903.1"
FT                   /translation="MDKRPNIPKRKSGNSSKLLAFFALVFAFSLPYLLVKNFSHPKRSS
FT                   YAEQTDLYPELSDELSRDIPAEASTEIPHEKPDIKSATKPMQTKQDQQDKPINTSHVKK
FT                   DNEWQIVNPHSGDSMATIFHRLGLTAQNLNDVIKNNPHAKMLTRIKPNQKLQFLIKKNK
FT                   LEKLIVPVNTIQTLTVYRAGKIYKTKIDSKKTTTQNRYVTATVQGSLYTTAQRFNIPSK
FT                   LVRQMTTIFNKEIDFSRSLRSGDQFSIIYDAYYIEDKMVGVGDILVVTYTNRGKTYQAI
FT                   RHTNAHGEQDYFTPQGTSFKKAFTRYPIKFSHISSTFALSRYHPILHYRRAHKGIDLAA
FT                   PIGTPIHATGDGVITIIDRHNGYGNMIKIKHDKTYSTVYGHLLKFQKGLSKGSRVKRGQ
FT                   VIGYVGQTGLATGPHCHYELHVNNQPRNPTTISLPTAAPVPAREMAAFKAKASTLLARL
FT                   KLFEQAQLASKGKKKINVG"
FT   gene            689138..690343
FT                   /gene="tyrS"
FT                   /locus_tag="lpa_00901"
FT   CDS_pept        689138..690343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="lpa_00901"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="COG0162, TyrS, Tyrosyl-tRNA synthetase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00901"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23904"
FT                   /protein_id="ADG23904.1"
FT                   /translation="MIVQDSVCSELMRGCEEILPVPELEKKLQKGIPLKIKAGFDPTAP
FT                   DLHLGHTVLLNKLRQFQQFGHEVIFLIGDFTAMIGDPTGKNVTRMPLSQETVLENAKTY
FT                   QHQVFKILDPDKTTVAFNSQWLNKFDAVDLIRLAATHTVARMLERDDFNKRYTTGQPIA
FT                   IHEFLYPLLQGYDSVALKADVELGGTDQKFNLLMGRELQKHYGFEPQVVMMTPLIEGLD
FT                   GVKKMSKSLDNYIGINETPEQMFGKIMSVSDELMWRYIDLLSFKTGKEIQQLKQSVLEG
FT                   KNPRDVKIDFAKEIVARFHDQTQAEFAHNKFIERFQKGNIPEDLEELSLVIAEPIALVQ
FT                   LLKQIDLTASTSESIRMVKQGAVKVDGDKISDPSLKLPIGKSYIIQVGKRRIAKLSIQQ
FT                   AD"
FT   gene            690527..692040
FT                   /locus_tag="lpa_05016"
FT   rRNA            690527..692040
FT                   /locus_tag="lpa_05016"
FT                   /product="16S ribosomal RNA"
FT   gene            692145..692218
FT                   /locus_tag="lpa_05017"
FT   tRNA            692145..692218
FT                   /locus_tag="lpa_05017"
FT                   /product="tRNA-Ile"
FT   gene            692400..695260
FT                   /locus_tag="lpa_05018"
FT   rRNA            692400..695260
FT                   /locus_tag="lpa_05018"
FT                   /product="23S ribosomal RNA"
FT   gene            695403..695528
FT                   /locus_tag="lpa_05019"
FT   rRNA            695403..695528
FT                   /locus_tag="lpa_05019"
FT                   /product="5S ribosomal RNA"
FT   gene            695869..697392
FT                   /locus_tag="lpa_00907"
FT   CDS_pept        695869..697392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00907"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00907"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23905"
FT                   /protein_id="ADG23905.1"
FT                   /translation="MLSKYELIKPDIGSSHGNITKVYEIVGGKPLRGQVKVSGSKNAAL
FT                   PVLAASLLCKEPLQLTNLPKILDVTNMIQCMEALGKRFEFINTNTIKIGNREMDTLTIP
FT                   KEAARQIRASIILLGPLVAQYPKVILPLPGGCSIGKRPIDLHISALNALGVDIVELPDC
FT                   LVCSRRYARLQGNTINFSIKTVTGTENAMMAAVLAEGTTIINNAAMEPEIVDLANFLNR
FT                   LGAKIDGAGSDRITISGVDKLNSCGSYSIMADRIEAGTYLVAAAMTRGSISVKGINPDY
FT                   LVAVLSELKCAGAKITCDSDSIQLDMGEEYGESLNITTKPYPGFPTDLQSLFLSLTCVL
FT                   RGNSYLCETLFEDRFQIVQELKKMGANISLKDNTAHIKGVSRLRGSQVNATDLRSGAAL
FT                   VCASLAAEGITQIFAIEHIERGYEDLILKLKALGANIKLIENTHVTSTELSDSHFKEAT
FT                   SSETRIQRASLIETVVTPSITTFGQFKRVPTGEVTELEKQQTPYLHHIM"
FT   gene            complement(697385..697918)
FT                   /locus_tag="lpa_00908"
FT   CDS_pept        complement(697385..697918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00908"
FT                   /product="Carbonic anhydrases/acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00908"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23906"
FT                   /protein_id="ADG23906.1"
FT                   /translation="MNYSIRKFEDKYPELGERVYIDPQSTVIGNVTLGDDVSVWPMAVI
FT                   RGDVNYIQIGHSCSIQDGAVLHVTHDGPYTSGGRPLILGQGITVGHKALLHACTIDDYC
FT                   LIGMGSIILDSAHIQKHVMIAAGSIVPPGKILKSGHLYLGSPAQAIRKLTTKEIEQIEY
FT                   SAGHYIRLKDRYLT"
FT   gene            complement(697925..699283)
FT                   /locus_tag="lpa_00909"
FT   CDS_pept        complement(697925..699283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00909"
FT                   /product="glutathione reductase (NADPH)"
FT                   /EC_number="1.8.1.7"
FT                   /note="COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide dehydrogenase (E3) component, and
FT                   related enzymes [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00909"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23907"
FT                   /protein_id="ADG23907.1"
FT                   /translation="MKTKHFDLIVLGGGSGGIASAVRAAQYGAKVAVIEQSHLGGTCVN
FT                   LGCVPKKIMYNASSIAETLHKSPDYGFFLENNAKLDWKRLVNKRNAYIERLRENYAKRF
FT                   SQHKITLIQGKGIFHDQSSITIDHTIYQAEHIIIATGGEPALPAINGIKHAIDSDGFFS
FT                   LTKLPAKVAVIGSGYIGVELAGILNSLGSETHLLMRGTRPLSRFDHMIGDTLMEIMQKQ
FT                   GICIHQNHKAQAIHLHSDGRKSILCQSGSIIENIDVIISAVGRKPRTGNLNLDKINVNM
FT                   DDKGLILVDAFQNTSVKGIYAIGDVTNAPALTPVAIAAGRRLADRIFGNQPDACLNYDN
FT                   ICSVVFSHPPSGSVGLTEHEAIEKYGKNKIKIYQTRFIPMYDALSIDKTPTAMKLVTLG
FT                   KKEKIIGLHVVGYSADEMLQGFGVAIKMGACKKDFDNTIAIHPTSAEEFVTMV"
FT   gene            complement(699514..700494)
FT                   /gene="add"
FT                   /locus_tag="lpa_00910"
FT   CDS_pept        complement(699514..700494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="lpa_00910"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="COG1816, Add, Adenosine deaminase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00910"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23908"
FT                   /protein_id="ADG23908.1"
FT                   /translation="MNLKKAELHVHLEGTISPDLAKKLAKRNHLTLPDGLIAFDEKSYL
FT                   SKDFLDFLKVYDTLASVIKNPQDYYDITFDYLKSNAQEHAIYIEMMYSPDHAEQSSGIP
FT                   SKEHLAAIQQAIDDAKSQFDIVGRIIITAVRHFGVEACERVAKQASIDKFPCVTGFGLG
FT                   GDEAKFPPQLFAKTYQIAADSGLECTVHAGEFDSAKGMEEAMKTLPIKRIGHGVRVIDS
FT                   PDIMAMVKDQGIALEVCPTSNIFLGLFKDMNSHPFPKLYEAGIKVSINSDDPPFMSTTL
FT                   AQEYKRVQKAYGYSNDTMNNITRMAIEAAFVDEKTRKELLTKLEQ"
FT   gene            700592..700777
FT                   /locus_tag="lpa_00911"
FT   CDS_pept        700592..700777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00911"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00911"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23909"
FT                   /protein_id="ADG23909.1"
FT                   /translation="MNTDDINKAYVSPYDKFLYEFDATHKKSASQLQEIKKHERIFKMR
FT                   DDKDYKIDQSEIWEEF"
FT   gene            700876..701322
FT                   /locus_tag="lpa_00912"
FT   CDS_pept        700876..701322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00912"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00912"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23910"
FT                   /protein_id="ADG23910.1"
FT                   /translation="MKNPYILQLNNPALLNKAMQLKSIGKVAISQNQLTYLKIHDEWIY
FT                   ELFPLLQNEQIRKPDYFGNESIGAHISIIYPEENTTINPKELDQEHRFKIKNIIKANLE
FT                   LKKYYAIIVEAPSLARLRKAYGLPENLYFKGYSTHFHITVGVEY"
FT   gene            complement(701363..702616)
FT                   /gene="pitA"
FT                   /locus_tag="lpa_00913"
FT   CDS_pept        complement(701363..702616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pitA"
FT                   /locus_tag="lpa_00913"
FT                   /product="inorganic phosphate transporter, PiT family"
FT                   /note="COG0306, PitA, Phosphate/sulphate permeases
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00913"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23911"
FT                   /protein_id="ADG23911.1"
FT                   /translation="MDYSIYLLFAALILCFLMTWGVGANDLANVMSTTMGSKAVTVRQA
FT                   MLIAIIFEFAGAFLGGEGVTETMRDGIINTSQLSNEPLILIEGMLCVLFACTIWMNLAS
FT                   YLGVPVSITNALVGSMVGFGTIVLGPDAIHWNQVARIAIGWVSSPLISGITAYALFISI
FT                   QQTIFVKSNPLTKAKLYIPIYLFLIGFILSFITVFKGLNHFDIHLNLKQDLAVTLATSI
FT                   IITILGMIFIKRIPEYHKIRRRERFIQVEKYFAVLMAMTACAMAFAHGSNDVALAVGPL
FT                   SIVHSLVMHSNQIFDADNYPSWIILLGCVGVVTGFLMYGRKVIETVGSSITALTPSRAF
FT                   AATLSAATTVVVATSTGIPVSATQTLVGAVLGVGLARGIGALNLIVIRNIFMSWVLTLP
FT                   AASMLTILSYKLLHALLG"
FT   gene            complement(702626..703279)
FT                   /locus_tag="lpa_00914"
FT   CDS_pept        complement(702626..703279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00914"
FT                   /product="Phosphate transport regulator"
FT                   /note="COG1392, Phosphate transport regulator (distant
FT                   homolog of PhoU) [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00914"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23912"
FT                   /protein_id="ADG23912.1"
FT                   /translation="MFGPSPIKPIEQHIRKAHQCAKQLYPFFEAVLKNDWDTANKIKDK
FT                   IIAIEKEADLIKRDLRLHLPTGLFLPVARTDILELLSAQDRIANKAEDIAALIISRQMS
FT                   IPKKLIPSFMPFLSRCLDASKQACTAINELDELLETGFRGSEVKIVEEMIVKLDEIEHD
FT                   CDERLADIRHKIFELEKELPAIDVIFLYKLVQWIGELADHAQTVGGRLQILIAR"
FT   gene            703488..704252
FT                   /locus_tag="lpa_00916"
FT   CDS_pept        703488..704252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00916"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00916"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23913"
FT                   /protein_id="ADG23913.1"
FT                   /translation="MIKRWLLVILLISGNAFSQQMITKVIELNYLQADKVIQLIQPLLQ
FT                   TDEKVSGSGQTLIVNVSPQTLTQIRNVLHKIDVPPVVFNITVYQGDPEWLSSQDGNDVV
FT                   YSTQPQYEVQRSQSVKVMSGESAFVATGEQVPVVTSVGVGLLATGVSYEQHNIQNGLLV
FT                   HPVLQGSQVKLTVRRVREQENVESDQQFDNQQIDTTIMAPLNKWVPLGTAEGVQNTDSS
FT                   STSYTAGRPFSQNSTLYIKISVVKSTPSGTTK"
FT   gene            704545..705108
FT                   /locus_tag="lpa_00917"
FT   CDS_pept        704545..705108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00917"
FT                   /product="Putative transcriptional regulator"
FT                   /note="COG1678, Putative transcriptional regulator
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00917"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23914"
FT                   /protein_id="ADG23914.1"
FT                   /translation="MAIISSLANHLLIAMPSLKDPNFERSVVYLCEHNEQGSVGLIINR
FT                   PLQFPLSIVFEQLQIEPIRVEKNGLPLLFGGPVQPERGFVIHKQMGGWRSSLFLQDEVT
FT                   VTTSNDIIRAIAYDEGPKDVLITLGYAAWTEQQLEREIMSNTWLICPYKSEILYEVPFE
FT                   ERWEYAGLTLGIKMNQLSSDAGHA"
FT   gene            705092..705520
FT                   /locus_tag="lpa_00918"
FT   CDS_pept        705092..705520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00918"
FT                   /product="putative ribonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /note="COG0816, Predicted endonuclease involved in
FT                   recombination (possible Holliday junction resolvase in
FT                   Mycoplasmas and B. subtilis) [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00918"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23915"
FT                   /protein_id="ADG23915.1"
FT                   /translation="MLAMPRGVYLGFDFGYKRIGVAVGQRLTCSASPLSTIEAKAGIPD
FT                   WNTIQKVITQWNPQALIVGLPTCIDDRELYTTSAARRFAKQLHKRFSLPVHLVDERLST
FT                   VEARGYLFEQGGYRQIKKAEVDSIAACVILEQWLQQSE"
FT   gene            705570..706463
FT                   /gene="pyrB"
FT                   /locus_tag="lpa_00920"
FT   CDS_pept        705570..706463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="lpa_00920"
FT                   /product="aspartate carbamoyltransferase catalytic chain"
FT                   /EC_number="2.1.3.2"
FT                   /note="COG0540, PyrB, Aspartate carbamoyltransferase,
FT                   catalytic chain [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00920"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23916"
FT                   /protein_id="ADG23916.1"
FT                   /translation="MKHFLEISQLSSEQIESLLQRALYFKHTKQYPSYSQSIIANLFYE
FT                   NSTRTRISFELAERHLSMSVVNLDLQTSSETKGEAIEDTIRTLAAMGIQYFVIRHKQDG
FT                   LQQNLANKLGDTVHIINAGDGTHAHPSQAILDMVTIVEQKKQLDKLKIAILGNIKHSRV
FT                   ANSFQCICSKLGVGELVLISPEIWQPSQVHFGRVTDNLNEGLEGADVIICLRVQRERLL
FT                   QDDHLDLDFYRNNFALTQKSLSYAKPDAMVMHPGPMNRGVEIDSEVADGKQSCILQQVT
FT                   NGVYARMAILESLIGS"
FT   gene            complement(706519..706653)
FT                   /locus_tag="lpa_00921"
FT   CDS_pept        complement(706519..706653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00921"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00921"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23917"
FT                   /protein_id="ADG23917.1"
FT                   /translation="MINNKGIMLYCIGTAGEKLKINACASDVGKPLTPEQELSIEGFF"
FT   gene            706846..706998
FT                   /locus_tag="lpa_00922"
FT   CDS_pept        706846..706998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00922"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00922"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23918"
FT                   /protein_id="ADG23918.1"
FT                   /translation="MDKILKKINRIVLIFAYIVFYLIYMIDYRIVWEILDNNFLNFYLT
FT                   FSLLI"
FT   gene            complement(707118..707465)
FT                   /locus_tag="lpa_00923"
FT   CDS_pept        complement(707118..707465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00923"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00923"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23919"
FT                   /protein_id="ADG23919.1"
FT                   /translation="MIPWQFATANRPTDNALAIIKSCYDESVNLSNDFTPCVTKKLKTM
FT                   PNAEDFQLIMNFKTDEKGTNERIPVFMVDKTGYMYYCIVTTGKTLIINACAGEQGKPLT
FT                   QGQMLSIDLPE"
FT   gene            complement(707608..709119)
FT                   /gene="comM"
FT                   /locus_tag="lpa_00924"
FT   CDS_pept        complement(707608..709119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comM"
FT                   /locus_tag="lpa_00924"
FT                   /product="ComM, competence-like protein"
FT                   /note="COG0606, Predicted ATPase with chaperone activity
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00924"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23920"
FT                   /protein_id="ADG23920.1"
FT                   /translation="MNLAFTKTRSTIGIVAQPVSVEVHLSNGLPSFTMVGLAETAVKES
FT                   KDRVRSAIINSQFEFPCRKITVNLGPANLPKTGSGFDLPIALGILAASEQIPLTNLANH
FT                   EFIGELALSGELRGVSAIIPAVLAAHKDNQYLIIANANAAEASLTGHPKVFTANNLREV
FT                   CDYLCQGTSLQNLPPKPDLLLNNHELDWSDIKGQHHAKNAMVIAACGGHSILLSGAPGS
FT                   GKTMMAKRFSTLLPELSETQALECAAINSIRGKLPDFREWRLPPFRAPHHTASPVALVG
FT                   GGNPPKPGEISLAHHGVLFLDELPEFNRQVLETLREPLESGHICISRAAAQIEFPAKFQ
FT                   LIAAMNPCPCGQWGNSQANCLCTPDRISRYLAKLSAPLLDRIDMQVTIHALSQEELIKP
FT                   NTHLEKQSPAIREKVTKMHEIQMARQDSLNANLNSKTCEMVCELGSEEQLFLREVMSKL
FT                   KLSARGYHRLLKVSRTIADMSECNKVMLNHLQQALSYKQILHLPK"
FT   gene            complement(709191..709445)
FT                   /locus_tag="lpa_00926"
FT   CDS_pept        complement(709191..709445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00926"
FT                   /product="putative protein conserved in bacteria"
FT                   /note="COG2960, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00926"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23921"
FT                   /protein_id="ADG23921.1"
FT                   /translation="MFDPKQFDELANKLFATLPTSLQNFEKDIQQKFKEVLQSTFSRMD
FT                   LVTREEFDVQCKVLARTREKLEQLQHQLEDFIKRQEIKK"
FT   gene            709554..709928
FT                   /gene="glnK"
FT                   /locus_tag="lpa_00927"
FT   CDS_pept        709554..709928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="lpa_00927"
FT                   /product="Carbamoylphosphate synthase large subunit"
FT                   /note="COG0347, GlnK, Nitrogen regulatory protein PII
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00927"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23922"
FT                   /protein_id="ADG23922.1"
FT                   /translation="MGGSAFNVMEKNMKMITAIIKPFKLDDVHEALMEIGVPGITISET
FT                   RGFGRQKGHTELYRGAEYVVDFLPKIKIELALPDNMVEAAIEAICKSAYTGKIGDGKIF
FT                   VYALEQVVRVRTGEVGTDAL"
FT   gene            complement(709938..710519)
FT                   /locus_tag="lpa_00928"
FT   CDS_pept        complement(709938..710519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00928"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /EC_number="6.3.3.2"
FT                   /note="COG0212, 5-formyltetrahydrofolate cyclo-ligase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00928"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23923"
FT                   /protein_id="ADG23923.1"
FT                   /translation="MSDQYKVALRNTIKQVRSKLSVSYRTASSNQICTRIRSLEQYRQA
FT                   KRIALYFAVNGEVDLTFLWKSAPLQGKYCYFPVLNNDSTLSFLPATPSTPFKTNKYDIL
FT                   EPDVDIELALPVDELDLIIMPLVAFDAHCTRLGMGSGYYDRTLANKSKAHLLGVAYQFQ
FT                   RVDYIEPRPWDVPLDAVITQKAIYWRNPLA"
FT   gene            710766..710951
FT                   /locus_tag="lpa_00929"
FT   CDS_pept        710766..710951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00929"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00929"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23924"
FT                   /protein_id="ADG23924.1"
FT                   /translation="MSDLFEEDEEEVIEVVDDFDDVEVDTEIIEAPGVSLDARRRLENM
FT                   LEEKRLRDELDDFVDY"
FT   gene            710965..711780
FT                   /locus_tag="lpa_00930"
FT   CDS_pept        710965..711780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00930"
FT                   /product="4-amino-4-deoxychorismate lyase"
FT                   /EC_number="4.1.3.38"
FT                   /note="COG0115, IlvE, Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase [Amino
FT                   acid transport and metabolism / Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00930"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23925"
FT                   /protein_id="ADG23925.1"
FT                   /translation="MPTRVIEDKGDMTPSFGIDDRIFLGEGLFETIRVNSSKPSFAYMH
FT                   WERLGNSARQLGIPFEISFDDWFEHLIQKIQKDNLYHGGIKAILSGGPASRGLAERGQV
FT                   SQLIFQTFNYSIQKHPVRLISINWLRDKANPLYQLKSVNYLEAIIAQRQAIAVGADDAL
FT                   FFNTENHVTETTCANLFLIENNILYTPRIEDGILPGITRARLISHCQQHKMSVQEISLT
FT                   KKRIEDADAVFLTNSLQGIRRVLSLDNIIFEVNHPIIDKLIFLLNQDES"
FT   gene            complement(711807..712379)
FT                   /locus_tag="lpa_00932"
FT   CDS_pept        complement(711807..712379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00932"
FT                   /product="putative conserved protein"
FT                   /note="COG0398, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00932"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23926"
FT                   /protein_id="ADG23926.1"
FT                   /translation="MVFHNHSLEIIDYIDDLGWLAPVLFLLTYCLATLLLLPTMVLTLA
FT                   GGAVFGPVFGTLLNLLGATSGAAFAFLITRHLVYDWFSTKKGEKLNKLIAGVDEKGWVF
FT                   VAFLRLFPIVPFNLVNYGLGVTGISFRLYLLTTFIFLIPAEIIYTYFGYVGMDALTRPG
FT                   HLYRNGGVFLTGLAIFFLLVIRIMKKR"
FT   gene            712648..713367
FT                   /locus_tag="lpa_00934"
FT   CDS_pept        712648..713367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00934"
FT                   /product="2-acylglycerophosphoethanolamine acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00934"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23927"
FT                   /protein_id="ADG23927.1"
FT                   /translation="MTKTNEENLTWKGKQKQRARRWIKIFLEKWFRIEVKGQYQANSHS
FT                   VIIANRASIIDVLLLSVFLPERLTLALHPDMFKKIWVKTLLFFADVIVVDPGSAQATRI
FT                   LIRAIRAGKRCLLFPQGLLRQQEDSLKAFAGPGLILQKVGAEVIPVRIEGAEHSIFSNS
FT                   KNKYLIRIFPKITLHILPAQKLSQSENTGVDREGISLRLFQLISDLSFANSFKPYVLFS
FT                   ALIEGVSIGTKNKTKIT"
FT   gene            complement(713383..714258)
FT                   /locus_tag="lpa_00936"
FT   CDS_pept        complement(713383..714258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00936"
FT                   /product="Predicted membrane-associated, metal-dependent
FT                   hydrolase"
FT                   /note="COG2194, Predicted membrane-associated,
FT                   metal-dependent hydrolase [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00936"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23928"
FT                   /protein_id="ADG23928.1"
FT                   /translation="MDKLIELFCVVDDFCQKYMPRFEQHLINISGKTRRKPCSMSMSEI
FT                   MTIVIHYHQSNYRNFKSYYLFVLQKNLHPYFPSLVSYSRMTELMSSCLVPLMAFCHHQT
FT                   KTPTGIYFVDSTPIEVCNVKRASQNKVFKGLAEKSKSTMGWYFGFKLHLIVNDKGELMA
FT                   FKITSSRTDDRFVVPNLSENLFGKMIGDKGYISQNLTDKLAERGLQLLTKARKNMKQKV
FT                   LNTFDKALLRKRAIVESVIDQLKNISNIEHSRHRSIFNFMVNILAGLAAYALKPKKPSL
FT                   NIQRSFMAVV"
FT   gene            714331..715872
FT                   /locus_tag="lpa_00938"
FT   CDS_pept        714331..715872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00938"
FT                   /product="hypothetical protein"
FT                   /note="COG0318, CaiC, Acyl-CoA synthetases
FT                   (AMP-forming)/AMP-acid ligases II [Lipid metabolism /
FT                   Secondary metabolites biosynthesis, transport, and
FT                   catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00938"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23929"
FT                   /protein_id="ADG23929.1"
FT                   /translation="MLPFLSLFFRQLYRIHVKIEDNNRIPLTYRQFLTRCFILGRQIKK
FT                   QTAIGETVGVMMPTTIAGMVTFFALQAYRRIPAMLNFSMGFYNLYSACNTARIKSIYTA
FT                   RQFIETAKLEPLVEELQQAGIRIHYLEDFKSTIHLGNKLSGIFKGFFPTLSYRFLGDKI
FT                   SPDTTGIILFTSGSEGKPKGVALSHANILANCWQMTSRVDFTPRDVLFNSLPIFHCFGL
FT                   TAGSVLPLVNGLNCFFYPSPLHYKVIPGLVYQTGATILFGTDTFLTGYARAAGKHDFNS
FT                   VRYIFAGAEKVKPETIRYWSEAFGARIYEGYGATEASPVISLNCPLASVPGSVGMILPF
FT                   MDFKVEPVEGIVQGGRLKLCGPNIMLGYLDEDKPGVIIEPEDGWHDTGDIVTVNADGFI
FT                   TIAGRAKRFAKIAGEMVSLTAVEGIAASIWPELLHAAVVQKSPRKGEQIFLFTEAEYAD
FT                   KVSFIKKVKERGQSELLVPHMIYPACQIPVLPSGKIDYITLEKQFLEQKETMETV"
FT   gene            715873..716292
FT                   /locus_tag="lpa_00939"
FT   CDS_pept        715873..716292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00939"
FT                   /product="putative protein conserved in bacteria"
FT                   /note="COG4446, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00939"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23930"
FT                   /protein_id="ADG23930.1"
FT                   /translation="MKLIWIVLALILALVVILYLFPQINFREMPKGLVEGQLPDDKPNW
FT                   VSSLVNESDSHYIAPLKVESMPQLVACIERKIPELKIQKQEASFLVGYRQSPFFHFVDW
FT                   ICIHADGNVISSATMGYSDFGKNRELVEKIRSLCL"
FT   gene            complement(716379..716762)
FT                   /locus_tag="lpa_00941"
FT   CDS_pept        complement(716379..716762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00941"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00941"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23931"
FT                   /protein_id="ADG23931.1"
FT                   /translation="MRKKNRILLASLFSLGSLNAFAAQDLTVVNTSDDLGYVTIGSYSC
FT                   ELTSSCAIPPDNSIRINSDIVEAACANTPADCEIVFGVDSIKARIATGSFSLNEGIQYI
FT                   AQSRWLNYSAKRLSKTVAEIYKR"
FT   gene            complement(716811..718553)
FT                   /locus_tag="lpa_00942"
FT   CDS_pept        complement(716811..718553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00942"
FT                   /product="polyhydroxyalkanoate synthase"
FT                   /EC_number="2.3.1.-"
FT                   /note="COG3243, PhaC, Poly(3-hydroxyalkanoate) synthetase
FT                   [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00942"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23932"
FT                   /protein_id="ADG23932.1"
FT                   /translation="MTHDTELSELMQAVAKKSLQIMTDFKEKPIPISSLVSQYIDLTEH
FT                   FQNLIAVILKNPEKVWQMQLNYLEDALSLAQAQFNYWLEGKPLPINDQRFNGEDWINNP
FT                   FFNLLSQHYLLANEHMNSLLENMEYGDENLAKRVRFFTRQYLDALSPANFIHTNPQLMA
FT                   ETLQSHGKNLLRGLHNLLSDVEAGSSRLIIKMTDTEAFKIGENLATTPGKVIFRNSMME
FT                   LIQYCPRTTKVKSIPLLIVPPWINKYYILDLSPHNSLIRWLVEQGITVFIISWVNPDET
FT                   YANKSFYDYLNEGPREAISVIQKQLRVKQVNTLGFCIGGTLLASLLAYNKATKDLSIRS
FT                   ATFLAAMIDFSDPGDIAVFIDEQQINKLEEEMKSKGYLAGKFMASSFNSLRANDLIWSF
FT                   FIKNYLRGKSPVPFDILYWNADSTNMPATMHSQYLRWMYLHNDLIKPGKIRLNHTPIDV
FT                   TNIDIPTFFLSTQKDHIAPWKTTYKGFELMKGPKRFVLGGSGHIAGIINPPTQQKYGYR
FT                   TNNSMDLSAEQWFEKSKEHSGSWWPEWLNWLKLHSGRLINSPDINHLPFAPIMDAPGSY
FT                   VLKK"
FT   gene            719036..719455
FT                   /locus_tag="lpa_00943"
FT   CDS_pept        719036..719455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00943"
FT                   /product="rrf2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00943"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23933"
FT                   /protein_id="ADG23933.1"
FT                   /translation="MVYLAKHSQELCNARDIALHTHLTVPTVSKILKRLTSAGLLTSVR
FT                   GVSGGYRLQRPAAEISVSQIIFALEEHRGFTECSMQPNDCFLQGVCTIQGNWRLISHAI
FT                   ETALDSVSLEALAKPTLPTRDVERVRQLASGVNRG"
FT   gene            719448..720896
FT                   /gene="ycf24"
FT                   /locus_tag="lpa_00945"
FT   CDS_pept        719448..720896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf24"
FT                   /locus_tag="lpa_00945"
FT                   /product="ycf24 ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00945"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23934"
FT                   /protein_id="ADG23934.1"
FT                   /translation="MAKSSEQLNSLLDREYQHGFITDIEVETFPPGLDEDVIRRLSAIK
FT                   GEPEFLLEWRLKAFRHWLTMPHPEWSSVHYPPIDYQSVSYYSAPKSKKDAPKSLDEVDP
FT                   ELLKTYEKLGIPLREQEMLAGVAVDAVFDSVSVATTFKAKLAEKGVIFCPLSEAVHQYP
FT                   DLVKKYLGSVVPYRDNFYAALNSAVFSDGSFVYVPKGVRCPMELSTYFRINAASTGQFE
FT                   RTLIIADVDSYVSYLEGCTAPMRDENQLHAAVVELIALDGAQIKYSTVQNWYPGDKEGK
FT                   GGIYNFVTKRGACRGKKSKISWTQIETGSAITWKYPSVILQGDDSVGEFYSVALTNNFQ
FT                   QADTGTKMIHLGKNTRSTIISKGISAGHAHNAYRGLVRIAPTATNARNYTQCDSMLMGS
FT                   QCSAHTFPYIEVKNPTAQVEHEATTSKISEEQLFYCQQRGIDTEDAVSMIVNGFCKQVL
FT                   KELPMEFAVEATKLLGISLEGAVG"
FT   gene            720898..721650
FT                   /gene="sufC"
FT                   /locus_tag="lpa_00946"
FT   CDS_pept        720898..721650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufC"
FT                   /locus_tag="lpa_00946"
FT                   /product="Fe-S cluster assembly ATP-binding protein"
FT                   /note="COG0396, SufC, ABC-type transport system involved in
FT                   Fe-S cluster assembly, ATPase component [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00946"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23935"
FT                   /protein_id="ADG23935.1"
FT                   /translation="MLNIKELNVAVNGQSILKGINLEVKPGEVHAIMGPNGSGKSTLSK
FT                   VLAGHPSYEVTRGDISYLGQDLLPMSPEERARAGIFMSFQYPVEIPGVTNINFLKASVN
FT                   AVRKGQGRNTLDAIEFLSFIREKCQLLDMDESFLYRSINEGFSGGEKKRNEILQMAALE
FT                   PRLAILDETDSGLDIDALRIISQGVNAMRSPERSIILVTHYQRLLDYIEPDFIHVLANG
FT                   RIITSGDKSLALELEKKGYSWLEEVEQL"
FT   gene            721647..722933
FT                   /locus_tag="lpa_00948"
FT   CDS_pept        721647..722933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00948"
FT                   /product="ABC transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00948"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23936"
FT                   /protein_id="ADG23936.1"
FT                   /translation="MSDILDYYQQQAQSGVSQIPWLAQLQSKALTDLKRRGFPTRYDEE
FT                   WKYTLVDSLLQQHFVLPDPTVKPALKTAFDDSPVKNLFLIQNGFISQEQEWIKNLPEGV
FT                   LILPLSLALIHYADLVKPYLGKIVEQEHGFHYLNTAMLQCGVFIYIPAGICLEEPIVLK
FT                   HIQDQTNQAMHLRHLILMEKESQATLIEEYQGEENICYFTNSITEVFLGAGAKLNHYKI
FT                   QKESKSAYHLGHLSVRQSAASQFSSHSLSLGGKLVRSDISVSMQEEQAQCLMNGIYAPG
FT                   DGQHIDHHTVVHHLVPNCRSDQDYKGILKGHSRAVFNGKVIVAKNAQHTDAKQQNKNLL
FT                   LSANAEIDTKPQLEIFADDVLCSHGATVGQLDEEAIFYLATRGISRDEASHYLIQAFAN
FT                   DNLRLIPNRDLADWMGNLLTQQLGYANEY"
FT   gene            722923..724167
FT                   /locus_tag="lpa_00949"
FT   CDS_pept        722923..724167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00949"
FT                   /product="aminotransferase"
FT                   /EC_number="4.4.1.16"
FT                   /note="COG0520, CsdB, Selenocysteine lyase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00949"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23937"
FT                   /protein_id="ADG23937.1"
FT                   /translation="MSTNPSLMTSFDVNKIRKDFPVLHQKINEYDLVYFDNAATTQKPK
FT                   AVIDAIAQFYEKDNSNVHRGVHALSVRATEMYEAARAKVKRFINARSPRECIFVRGTTE
FT                   AINLVAQSLVAPRILPDEEILITYMEHHSNIVPWQMVCKKMGCKLQVAPISLNGEVILE
FT                   EFERKLNENTKMVAINYASNSLGTINPVKTMIKMAHEVGAKVLLDGAQATAHLIVDVQD
FT                   LDCDFYAFSGHKMYGPTGIGVLWGKEELLNSMTPYQGGGEMINSVSFEATEYAAIPHKF
FT                   EAGTPNIAGAIGLAAAIDYIWSLDLDAIAEYETQLLNYATKAIEAVKGYNIIGTAANKV
FT                   PIISFVHGKIHAHDIGTILDSEGIAIRSGHHCTMPLMDFYDVAATSRISMSFYNTFKEI
FT                   DYCMEALQRVKEVFA"
FT   gene            724164..724613
FT                   /gene="nifU"
FT                   /locus_tag="lpa_00950"
FT   CDS_pept        724164..724613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifU"
FT                   /locus_tag="lpa_00950"
FT                   /product="nitrogen fixation protein NifU"
FT                   /note="COG0822, IscU, NifU homolog involved in Fe-S cluster
FT                   formation [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00950"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23938"
FT                   /protein_id="ADG23938.1"
FT                   /translation="MSMELRELYQEIIIDHNRNPRNHHAMEDATTEAKGFNPLCGDKLT
FT                   VYLKLQGDLIRDVSFIGCGCAISQASASLMTDALKGKSIKEAHELFHRVHRMLTQEEED
FT                   SLVSMDKLTVLAGVKAFPARVKCATLAWHTLEAALNKETEVVKTE"
FT   gene            724685..725020
FT                   /gene="paaD"
FT                   /locus_tag="lpa_00951"
FT   CDS_pept        724685..725020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaD"
FT                   /locus_tag="lpa_00951"
FT                   /product="Predicted metal-sulfur cluster biosynthetic
FT                   enzyme"
FT                   /note="COG2151, PaaD, Predicted metal-sulfur cluster
FT                   biosynthetic enzyme [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00951"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23939"
FT                   /protein_id="ADG23939.1"
FT                   /translation="MFGFKKKQSNESIKEGVITALRGVFDPEIPVNIYDLGLIYDIAVN
FT                   DEGHVHIQMTLTTPGCPVAQTFPGTVEQAVNQVEGVSDCTVELVWEPPWSQDRMTEAAR
FT                   LELGIFY"
FT   gene            725023..725976
FT                   /locus_tag="lpa_00952"
FT   CDS_pept        725023..725976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00952"
FT                   /product="lysyl tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="COG2269, Truncated, possibly inactive, lysyl-tRNA
FT                   synthetase (class II) [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00952"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23940"
FT                   /protein_id="ADG23940.1"
FT                   /translation="MSDNSWLPSASIQLLRARAELIGKIRQFFTERQYLEVETPVMARH
FT                   GVTDVYLSNIKAIFRGETCYLQTSPEYHMKRLLAAGSGPIFQLARVFRDDELGRWHNPE
FT                   FTLLEWYQLHIDHHVLMDEVDLLLQIILKSQPMIRKTYQQAFEEACGIDPFSTSIEQFT
FT                   KILAQHGLDGVLSPHEQDRDQYLFLLMSHVVEPFLAEESTPVAVYHFPASQAALAQVNE
FT                   GVAERFEVYYQGVELANGFHELTDVEAQKKRFMLDQQHRKQKGLTAMEADAYLLKALEY
FT                   GLPPCSGVALGVDRLLALALKQPNIANVFSFDFSRS"
FT   gene            complement(726048..726962)
FT                   /locus_tag="lpa_00953"
FT   CDS_pept        complement(726048..726962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00953"
FT                   /product="Predicted SAM-dependent methyltransferase"
FT                   /note="COG2933, Predicted SAM-dependent methyltransferase
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00953"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23941"
FT                   /protein_id="ADG23941.1"
FT                   /translation="MELPYHFSTVYVSKPEFIEALSEELGEVSNKIGSLVFSPHQKLDV
FT                   CFALDVWLEPEIVTFQSISEAAKILRQAGKFWYLHPVTEIRRSRLIEEQLRKCPSLMSH
FT                   FPVTSDIPPIGVFSLLDRNTLLFSAKRLKKWPDGQCYFIEDKVNPPNRAYLKLWEALFL
FT                   LNKYPLPGETVLDLGASPGGWTYVMQSLGTQVTSVDKAELDTKIMALPRVSFLKQSAFA
FT                   LDPEQLTESYDWVLSDVACYPDRAYTLIKKWIASKKAKQLIFTIKLQGQTDLNTIKRFQ
FT                   SIPNSKVINLFYNKHEVTFFYPV"
FT   gene            complement(727209..727853)
FT                   /locus_tag="lpa_00954"
FT   CDS_pept        complement(727209..727853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00954"
FT                   /product="Predicted metal-dependent hydrolase"
FT                   /note="COG2872, Predicted metal-dependent hydrolases
FT                   related to alanyl-tRNA synthetase HxxxH domain [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00954"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23942"
FT                   /protein_id="ADG23942.1"
FT                   /translation="MEKIFWSNPYQHTLDTKIISVNGNEILLEKTIAFSFSGGQESDRA
FT                   FINGLEVLSSRIDGNLIYYTLPDDHNLAPNDVITITIDWPRRHRLMRLHFAAELILELV
FT                   TRTSMLEKVGAHISESKARIDFKANFNISSIFSQLLDEYNAIIRQDLVIHKGYHDVTNQ
FT                   RRFWKIDGFAEVPCGGTHVHSTSEVGFIRLKRSHPGKAIERIEITLMDDSR"
FT   gene            complement(727856..729151)
FT                   /locus_tag="lpa_00955"
FT   CDS_pept        complement(727856..729151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00955"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00955"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23943"
FT                   /protein_id="ADG23943.1"
FT                   /translation="MNQNSFKPKNNFVSLVMWALPLSFFTFQFLLRLWPGLTMQDIMAQ
FT                   FSIDAASFGLIAAFYYYGYAGMQIPVALLLDKFGARFVVFAFAMLCGIGTLVFIGTNNF
FT                   YLALSGRFLIGVGSAAGFLGVSKVVSEWFSHSQYSRMIGFSFSVGLLGAIYGGKPLAHL
FT                   IQNFSGQQVGLALAVFSILLGCCALLILRSPPNNTHSVTKTMNLSHCSSLFSSWIIWAL
FT                   ALANLLMVGALEGFADVWGVPYLIAKYALNKTDAAFLISFIFMGMIFGGPLLAFLSQKL
FT                   GNYFVIALCGAGLAFLFLILLYTSTLHWWQLGTLFFAIGLLCCYQVIVFAAGSTLVPYE
FT                   GLGVTIAFLNCINMLGGSFFHTLIGKLMNSSWRGQMSANGLKLYEIESYQWALSLIPFC
FT                   ALCGSLLIVLIHIKTRAYAAPGFIKKTSLTGV"
FT   gene            complement(729426..729587)
FT                   /locus_tag="lpa_00957"
FT   CDS_pept        complement(729426..729587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00957"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00957"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23944"
FT                   /protein_id="ADG23944.1"
FT                   /translation="MLIEYRSPGEFKMTQPELKDTIIIIRFNDKLFNQSNRIEMTPNTS
FT                   KWRPPIDK"
FT   gene            729805..731124
FT                   /locus_tag="lpa_00958"
FT   CDS_pept        729805..731124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00958"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00958"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23945"
FT                   /protein_id="ADG23945.1"
FT                   /translation="MYNILLIFIAFLLVLLNAFFVSAEFGMVKLRATRIQAIKENYGLR
FT                   GRILEQVHQNLDAYLSACQLGITLASLGLGWIGEPAFAELLGPLFVALGISSVHIVTIS
FT                   SFFIAFFLISFLHIVIGELMPKSIAIRQSELISIWTAVPLYWFYWIMYPAIWLLNTCSN
FT                   FFLKLSGMDIKNEYEGFYSSEELKLILSGQHLQSELKEDEREILEHTLDLAELNVTEVM
FT                   RPEDEMIIIDINEPFETIKDKILKYRYSRYPVYDSGTREMIGVIHVKDLFADLLLQKNI
FT                   NTLKPYVRPVLKVSHKLPAMDLLRKFRAGMPHFALVYKHKSSLLGFVTLDNLLHILIGR
FT                   IKDEFHKTHEDWVKNSDGTITTKGDCSLYSLERALDCDITLSPDEEELNTLYGLIITRH
FT                   GKLPNEGEIIQFVEFDALIEKVQDSFITKIKVFPKIKNQE"
FT   gene            complement(731178..732224)
FT                   /gene="adhP"
FT                   /locus_tag="lpa_00960"
FT   CDS_pept        complement(731178..732224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhP"
FT                   /locus_tag="lpa_00960"
FT                   /product="alcohol dehydrogenase (NADP )"
FT                   /EC_number="1.1.1.2"
FT                   /note="COG1064, AdhP, Zn-dependent alcohol dehydrogenases
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00960"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23946"
FT                   /protein_id="ADG23946.1"
FT                   /translation="MSETIGYAAHKAGAPLKPFTFERRPVGAHDVAIDILFCGICHSDL
FT                   HQVNNDWAGAFYPMVPGHEIIGRVKEVGHQVRRFKAGDLVGVGCMVDSCRQCTYCHQNE
FT                   EQYCKSGATFTYNSQDNHLGGVTYGGYSKHIVVTEDFVLKIDESLDPAAAAPLLCAGIT
FT                   TYSPLKRAKVGKMSKVGIVGLGGLGHMAVKLARAMGAYVTVFTTSINKIKAGKDLGAHD
FT                   VVLSTDNNVMQTLANQYDFILDTVSAKHDLGQYLNLLKVDGQLTQVGLPSDPLEVTMFP
FT                   VILKRLSINGSLIGGIKETQEVLDFCARHGITADIELIKMHEVNSAYERLLKGDVKYRF
FT                   VIDMSTLD"
FT   gene            732957..733361
FT                   /locus_tag="lpa_00963"
FT   CDS_pept        732957..733361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00963"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00963"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23947"
FT                   /protein_id="ADG23947.1"
FT                   /translation="MHKLIELQGVGPKYAEMLKRVGIESQEDLLRVCSGRRGRFRVAEQ
FT                   TGISHKLILKWTNQADLARVNGINEEYAELLEQAGIDSIPELAHCNPEQLYSSLKEKNE
FT                   QCHLAQHVPGLSQVVTWVEQAKKLPRAVYH"
FT   gene            complement(733397..733999)
FT                   /locus_tag="lpa_00964"
FT   CDS_pept        complement(733397..733999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00964"
FT                   /product="polypeptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00964"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23948"
FT                   /protein_id="ADG23948.1"
FT                   /translation="MALEIITIEKKENYHMLKTRAENIQFPLNREDKDLIEAMKKKLYA
FT                   LGGVGLAAPQVNSAKQIIAVYIPEEAQLLRDNAKIFPMHILINPNYEPLPHTRIISDFE
FT                   GCYSVSSKAGKVPRYDEIQLKYYDEEGNVHQQIENGFYARVLQHEIDHLNGVLITDRLT
FT                   PDCVQGTIEEMMTIRRAELPVEKRKLFDQIMAKKLKK"
FT   gene            734329..735516
FT                   /locus_tag="lpa_00966"
FT   CDS_pept        734329..735516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00966"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00966"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23949"
FT                   /protein_id="ADG23949.1"
FT                   /translation="MIDVGKIITDLAWPISLLIAWFAGELGYRWAKLPHISIYAIVGFS
FT                   LASTQIGLLPSIQPPSILLLANIGFGLILFESGYRINLRWLSYNPWVAASSITEATLTF
FT                   CLVYILVKSFGLQTSTCLLLASLSMATSPATVVRVINEQRSSGQVTERVLHLSVINCVL
FT                   AVFLFKVIIGLVVFRTSGNLWEAAYASLTVTAISTIWGIIFGVIMPILLKTVKSTCQDN
FT                   TLAFACAVILLVILTHNLKLSPVLATLTFGLVSRHGRMVFSPSQPGFGTLGDLLSVLLF
FT                   VFIAATIEWQRVVTGVWIGLSIITVRFVAKIIGISLFAHISGISLKKGILTGLAMTPIS
FT                   VFVILILEQSRYIGINLVDTLAPLAMVALTLEILGPIMVQRALIKANEISAIKEF"
FT   gene            735518..736639
FT                   /locus_tag="lpa_00967"
FT   CDS_pept        735518..736639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00967"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00967"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23950"
FT                   /protein_id="ADG23950.1"
FT                   /translation="MPLQPFKTSNLLTMGVELELQLISLSNFDLTAASPDILELLGRSS
FT                   FPGSFTPEITESMLEIATDVHEEYDQLLKQLFHIRDALVTVGDRLNIGICGGGTHPFQM
FT                   WSDQRIFNKTRFIEVSELYGYLTKQFTIFGQHIHIGCEDGNQALFLLHSLNRYIPHFIA
FT                   LSASSPFVQSKDTLYNSARLNSVFAFPLSGRAPFVLNWDEFSLGYFEKMEHTGIVKSMK
FT                   DFYWDLRPKPEFGTIEMRVCDSPLTVERAAALACYMQALCSYLLENKEPLPHEDDYLVY
FT                   NYNRFQACRFGLDGTLVHPKTYEQILLREDILTTLRRLKPYANQLNSTMALEHIYEITH
FT                   KGSDASFLREKYAEHRTLESVVNESLKQFRRSK"
FT   gene            complement(736704..737105)
FT                   /locus_tag="lpa_00968"
FT   CDS_pept        complement(736704..737105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00968"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00968"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23951"
FT                   /protein_id="ADG23951.1"
FT                   /translation="MINQQIEVFLKSPAFAVVGASSNREKYGNKVLRCYLRNGKKVYPV
FT                   NPHETLIESLPVIHSVNDLPDDVHSISIITPPSITEEVVKEAVKKGIQHIWMQPGAESD
FT                   SAIQYGLDHKLNVISGGPCILVVMGYEEN"
FT   gene            737250..738107
FT                   /locus_tag="lpa_00970"
FT   CDS_pept        737250..738107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00970"
FT                   /product="GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00970"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23952"
FT                   /protein_id="ADG23952.1"
FT                   /translation="MNKELESIYQNIANQSELGQTANYDSYYNPKRLYPIPRAPKRQEI
FT                   NLDPNSTTFYGFDCWNHYEVSWLNSKGKPVVAMAVISYDCHSPCIIESKSLKLYFNSLN
FT                   NSTFPDVETVVQTISKDLSYCIGSEVAVNVYPLSDIPNQTIYAAFDGVCLDKLDIECSV
FT                   YHVMPDFLSTSSELVEEVLYSDLLKSNCLVTNQPDWGSVQIIYKGKKINHEGLLKYLIS
FT                   FRNHNEFHEQCIERIFADIMRFCQPESLTVYGRYTRRGGLDINPIRSTEPCAFDGQNIR
FT                   LIRQ"
FT   gene            738501..739592
FT                   /locus_tag="lpa_00971"
FT   CDS_pept        738501..739592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00971"
FT                   /product="major outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00971"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23953"
FT                   /protein_id="ADG23953.1"
FT                   /translation="MKKYHQLLMGISLLLFGVCNYAGDTGPVENSDLFRVFIPNLKPGY
FT                   EFSATAFYLQPGADNLGWGVITTVLPIPSPNWQVVTFNPDYQVGFNLGGRYVFANSGSD
FT                   LQLNWSHLRTNDTDNVFVNPSSQWISPFSQTGTPPTPSGQITGVALLKLAHASLDFSYD
FT                   AVSLDVGKFINFGSKLQTRLFTGLSSAWIKEELISTFRGFSLPILSLNNTSTYKGVGPR
FT                   LGFNNSYNISHGFNLVGQLAGSVLYGRMQPAQYQFTGTSQQLIIAGIFVNREGLANPSV
FT                   NQLVPALDAKIGLSYLYSLKQNWDLNFEAGYMGALYFNPLSSYETNTNVIALDTGSLST
FT                   SSAKHTQSNFSVGGPYITVSLRT"
FT   gene            complement(739752..740324)
FT                   /gene="tag"
FT                   /locus_tag="lpa_00972"
FT   CDS_pept        complement(739752..740324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="lpa_00972"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="COG2818, Tag, 3-methyladenine DNA glycosylase [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00972"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23954"
FT                   /protein_id="ADG23954.1"
FT                   /translation="MSQNIILNRCEWVGQNKPHYELYHDTEWGIPVHDDEKHFEMLILE
FT                   GAQAGLNWETILKKRDGYRRAFKQFNPQAVAQMTDDELNALLINPEIIRNRLKIFSTRK
FT                   NAKVFLSIQQEYGSFDSYVWQFVNGAPILNRPENIRAIPATSKESDALSKDLKKRGMSF
FT                   VGSTIIYAYMQAIGMVNDHIVTCFRAK"
FT   gene            740639..741019
FT                   /locus_tag="lpa_00973"
FT   CDS_pept        740639..741019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00973"
FT                   /product="glycoxylase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00973"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23955"
FT                   /protein_id="ADG23955.1"
FT                   /translation="MTQAAFGEFCWNELATSDVKKAKDFYGKVFGWQFREIESKEMTYT
FT                   LIQCNDKEMAGIWQIPKDQQSHIPPHWMAYIYVQDVSEALKKAKQHGAQEVKGITQAGE
FT                   MGRFAIIVDPTGAHVALWESFE"
FT   gene            complement(741125..742099)
FT                   /locus_tag="lpa_00974"
FT   CDS_pept        complement(741125..742099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00974"
FT                   /product="putative conserved protein"
FT                   /note="COG5579, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00974"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23956"
FT                   /protein_id="ADG23956.1"
FT                   /translation="MKSREKFMARNKRLDRFHNAQNSNTCGYDQAFSEIQGGRKRSHWI
FT                   WYIFPQLENLGKSPSAKLYGIKDFNEACDYLKDPVLFKRYFELIKLIEEKLKNIPLPHL
FT                   MGGFPDDRKFISSLTLFQATSNYLSSKDTDSQNKYHELYETCNRVFKQIAPQGYSPCQQ
FT                   TELLVKHQSNSPVKKTTEKSSQPPQVTIFSPKRSKPNTAHPILKDLAQYINKRGNEWSY
FT                   HYNFLGLVAFVYFIQDLILGTDYLNDKARQVKLTAASKLQKILDPQCHERCNLNPSERK
FT                   ALSDGRLGEIINKHGGLDKILTEAPRKPPKTGHDQEINISPFS"
FT   gene            complement(742189..743613)
FT                   /locus_tag="lpa_00975"
FT   CDS_pept        complement(742189..743613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00975"
FT                   /product="SidA"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00975"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23957"
FT                   /protein_id="ADG23957.1"
FT                   /translation="MAKKYRTPIPLSDKMMTLKKNLQDQLTQSQSLGEQIHAGTTAAST
FT                   ITTGVSHVFNVIDSFLSAYRQIPLVGGILQLVATVAKSISIVSDPEKSIAEKIISSILI
FT                   AAIIALSITAITLGGLAAAIIGTVIASTVTIMEGLGFFGKIAEKFQLANSYKMKKEFID
FT                   LVAKRIEPDNDKYNDLLEIRAIELQHELEKSYPNQIEQQQLKEELNFINTVLRKKNITP
FT                   GNNKENDAYKLNQLYAKRAEQLKTLVDKIALINPTGKRAEQNKLLSEIKSLQKEITKTD
FT                   DSIEEIIAPLAKIERDNLKSTINLPLSYSTFAIAAASTLISIAGLLVVAGVIAAPPIMV
FT                   PIMFAVGSVMAIIGLIKWTAEKMAEIEDAQLKAEETAKHEDAVLDEALNVYEQQLNLEL
FT                   VSPANPARQVKNILTVQDKVPALSPTESTVSSLDSRFTLFGSSSREHTKIAEQKTNDTT
FT                   NEQAPTTFDSISKPTR"
FT   gene            complement(743773..745701)
FT                   /locus_tag="lpa_00977"
FT   CDS_pept        complement(743773..745701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00977"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00977"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23958"
FT                   /protein_id="ADG23958.1"
FT                   /translation="MTRAQTHPHQTTVISNLKIIPLTLGWLLKFALLIIIIAVFTPLSP
FT                   KMPAPGLDASWAVGLNQAVAQGLAFGKDIFFTLGPYSSIYTKFYHPATNFMMVGGSLYL
FT                   ALCYWIAIILLMQGIKWRWSIAFAILLFSMIYARDSLFFSYSLIIGLLIHKEIPGKETS
FT                   LKSNFFTLFALLFTPFGLFPLIKGSLLILSIITILLCSFFLSLYKQRNLVVLCLASPVV
FT                   SILFFWIASGQSVFNLPAYISNTISLASGFTEAMATEGDNKELIFFGITSSCILLSILL
FT                   QKQLSPLSKAFLFCIYFVFLFLSYKTGFTRHFGHAFIAGTSVLLASFLLPYFNSNNKVI
FT                   VPLLALSLYTANYINGHYTKISVRDNFISTYTAAYYGLQNRIQNKNWLKENFSLTMNYL
FT                   KARDDFPRLPGTTDIYSYNQTSLIASGMQWSPRPIFQSYSVFTAKMAEINTNYLLSENK
FT                   PDNIIFKVEPIDNRIPSMEDGMSWPTLINHYQPVRLENDFLFLRKKLVNKPVTSLVPLK
FT                   TEIHTFGEQVKIPDTDKPLFVEIEIQPTLWGRLATTFFKPHQLEANLELKNGTQRQYRL
FT                   ISNMAKSGFLLSPLIENSAEFGLLFSQNNYLAGKKVISFSINSKQVPSSHWQTKYTIHY
FT                   KIFASNN"
FT   gene            complement(745827..746219)
FT                   /locus_tag="lpa_00978"
FT   CDS_pept        complement(745827..746219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00978"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00978"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23959"
FT                   /protein_id="ADG23959.1"
FT                   /translation="MLTTFLATVIGWYLVIVSLFLLFHNEHAKSAMAEIIAHRGSQLIM
FT                   AIVTLITGLLLVVSHNIWIMGWPVVITLFAWLVLLGGLIRFLCPDTAVRVGQSFVDNPM
FT                   RLKIAAVIFFIIGLFLLFNVYYVYLK"
FT   gene            746356..746733
FT                   /locus_tag="lpa_00979"
FT   CDS_pept        746356..746733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00979"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00979"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23960"
FT                   /protein_id="ADG23960.1"
FT                   /translation="MMKKINLFKLLMIFVLGTSALQAAGLSTQRIEQLSNARVTVWKTI
FT                   IYPSSKQVLPMHRHDNDRVLVALTDGTLKITNNKGKVHYLKLKKGKSYYLTKDVPNELH
FT                   NDENVTNHSIQVMVIQLNDKA"
FT   gene            746934..748241
FT                   /locus_tag="lpa_00980"
FT   CDS_pept        746934..748241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00980"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23961"
FT                   /protein_id="ADG23961.1"
FT                   /translation="MHTQRGLEVTTGSIEAVDSINYFHEQVLSSGQNAIQILDSAKKHT
FT                   DNLLIQTYAAAFYLYAQEDVANEQASDYLQSASRLLTSANEREKLTFEAVTNWSKRDYA
FT                   NAISLLVTLLERYPRDTLALKFVEWLFYCTGQAFNAEYFLKVCDKCAPENQDESHFLAI
FT                   HSFALELCGQYSKAREMAEEAITMNLHTPWAHHTLAHVHLLTSDITGGINRLRDLQKTW
FT                   EDILPLLKGHNTWHLALFYLANRDEEEVKKLYPHISGALPDTVLEQLDTISLLWRMDMA
FT                   GLPQDRLLNQVVDHLSTHPLEFYTGFTNAHFIYCLVKSGYKNEADESLKRMKSYACAPS
FT                   SDALWGDVVLPLCQGIYAFADADYKTALMLMEPVIGECAQLGGSDAQIELFFQTYLLVL
FT                   IHTNQKDKALQFFTEHLKYYNNTPLSDWWFQSANKT"
FT   gene            complement(748297..750504)
FT                   /gene="comA"
FT                   /locus_tag="lpa_00984"
FT   CDS_pept        complement(748297..750504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comA"
FT                   /locus_tag="lpa_00984"
FT                   /product="DNA uptake/competence protein ComA"
FT                   /note="COG2333, ComEC, Predicted hydrolase
FT                   (metallo-beta-lactamase superfamily) [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00984"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23962"
FT                   /protein_id="ADG23962.1"
FT                   /translation="MEIYCFLIGVLYAYTYNIYLTIAIPLLFYITPRYPIVLFFIAGCG
FT                   FALIHQWIVSPKGMPDTQVITQAQLEGTIASIPMQRPNKTQFHFAIEKINNNPAQGLIQ
FT                   LNWYNKPPVLRAGQRWQLSVKLKKPRNFRNPGGFNYVRYLAARHIHWTGYIRYGNNKLI
FT                   SNQPPSFSWLTLREKIGDALTKLAPNTETAGIIEALTLNVTHHISSEHWNLFRRTGTVH
FT                   LFGISGEHIALVSCIFFIVIRWIWSMSYRCCLFLPAHTIASIGGLLAALPYAFLAGFEP
FT                   PVQRALIGCVLYTIYAIGKQRFTPWQIWRYALFLVLCIEPHAVFLQGFYFSFLAVACLL
FT                   LTHQRWPLKNYKKTLTLQLSCLIGLMPLTLHWYSYGSINGFLANLFSIPLVSFLIVPLA
FT                   LMTMITSPLHWSWILMKPLAWLVALLLQGLTYVEQIAGINITWSITSVTMMLAMTAGLF
FT                   LRVLLPVKPFKHLAILWIILPLFPPRTAIYPGEALINILDVGQGLAVAIQTQHHVLLYD
FT                   TGDSYFQGSDLGQMAIIPFFRSIGIKTIDKIVISHPDKDHKGGLNSLEKEMQVNQLIVN
FT                   DPYFYKRGSNCHSYPQWQWDGVSFRFLPIKESFTKKNNNSCILQVSNSAGRVLLTGDIE
FT                   KAAEEYLVRNYGSQLASEILVVPHHGSKTSSSYRFLLEVNPLYAIASLGFDNRFKFPHS
FT                   KTLQSMKTLDITFFRTDECGMAAIKLPASGQVHRPSCMQAN"
FT   gene            complement(750582..750995)
FT                   /gene="pilE"
FT                   /locus_tag="lpa_00986"
FT   CDS_pept        complement(750582..750995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilE"
FT                   /locus_tag="lpa_00986"
FT                   /product="type IV pilus assembly protein PilE"
FT                   /note="COG4968, PilE, Tfp pilus assembly protein PilE [Cell
FT                   motility and secretion / Intracellular trafficking and
FT                   secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00986"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23963"
FT                   /protein_id="ADG23963.1"
FT                   /translation="MKQSAFTLVEVLISMVIMGILVSIAYPSYLQYIQKSRRADAHATL
FT                   TQDQIILERCYSQNFSYAAACGALPAFPQTTPNGYYTINISNLTATTYTLTATPVGTQA
FT                   KDTECASMSINQANVKTAVDSSANAQPECWNPG"
FT   gene            complement(751043..754552)
FT                   /gene="pilY1"
FT                   /locus_tag="lpa_00988"
FT   CDS_pept        complement(751043..754552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilY1"
FT                   /locus_tag="lpa_00988"
FT                   /product="type IV pilus assembly protein PilY1"
FT                   /note="COG3419, PilY1, Tfp pilus assembly protein,
FT                   tip-associated adhesin PilY1 [Cell motility and secretion /
FT                   Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00988"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23964"
FT                   /protein_id="ADG23964.1"
FT                   /translation="MDALTFWNFTRKGSQKAIKVLPRTLMAILLSASVSLYAVPLAIPQ
FT                   IPLIIASPVHPQVLILLSNSQSMDGNLSGAIMTGSGSLSTGLSSLYNSSSPVNYTVPAG
FT                   FTPPVQGPDANGLAPYTVVQGGNKVDNSASRLNVAKAGIKAIIENYMPTTDFALGTYST
FT                   SNISSYNTWVYYMSPPGSDFVFTNTPVAGNRYVTNPCYNYGSASSTVSSNCSSIGSLYG
FT                   TTLVSSSQYLQIGDSSDDPDINDVLYAGSGFPGIFVSYNGPTPSSPFPPNYTISNYNQG
FT                   NIRISYANTRPSIGNFSSSPTNAGFVPFSQQVMYVQRGFGYYSNQSYATGNMLVNMQTA
FT                   GTNPTTTSVNNAINAFLPHLKPETNSTATTEIKAAAVQSPLAGLLTRSRSFMKTVGTTS
FT                   GNCPQKQYIILISDGLPTQDLQSRYWPPLGSAAATGYGVTATFNADGSLNSTNSQALSD
FT                   AINEIKALKNDGVLTFIIGMGAGVDPAVNPEAAATLRAMAVAGGTENYYPATSPEALVS
FT                   SLNSILSNIQNGSFSTSAAAISSTRIDSSTVEYQANFITRDTPYQDWTGNLTAIELDEN
FT                   TGQPTNIIQWSAQSTLDSLVSGTGWSTNRKIATWDPIAADGVPFRWANINATQQAQLQP
FT                   SDLLGENRLEYLRGNAALEKRNGGTFRDRSHALGDIIDSQVIYVGPPSAPYLTASYISF
FT                   AKANANRQPMLYVGANDGMLHAFNATTGEEFFAFIPNAVFNNLHQLTSPLYNQNHLFFV
FT                   NGSPESADVQFSDGSWHTILVGGENAGGKSIFALDITNPTNLSSEPGVANAVLWEFTDT
FT                   DLGLTYSKPQIGQIRSGSPSSLNFAVFFGNGYNNTNNKSVFYAVDPQTGTLLRKIDLCA
FT                   AVPSACNVNLPQGLSTVALGQKDGLQADPVTVVYAGDLQGNLWAIDVSSADPASWSARV
FT                   LFQARDSAGTPQPITTPPLVTLNPNYPRNPGLFVVFGTGQLLTTSDLVTTQRQTIYGVW
FT                   DKPLSSVPYVRANLQQQTLTLVNSATSGLSTNIITATAATINWSNKVGWFADLPIAGQR
FT                   LITTPELINGAFIATINTPPLNSCGFGFTSMLLELNFLNGGAFQYARFDISGDGGFDIA
FT                   DQYNGAYPVGIGLSNSYANSPTVLGPNKDNNLVILITQSDGTQTTVIAPNITPRKIGWW
FT                   QIQ"
FT   gene            complement(754565..755077)
FT                   /gene="pilX"
FT                   /locus_tag="lpa_00989"
FT   CDS_pept        complement(754565..755077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilX"
FT                   /locus_tag="lpa_00989"
FT                   /product="type IV pilus assembly protein PilX"
FT                   /note="COG4726, PilX, Tfp pilus assembly protein PilX [Cell
FT                   motility and secretion / Intracellular trafficking and
FT                   secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00989"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23965"
FT                   /protein_id="ADG23965.1"
FT                   /translation="MNVSSTNQYSKQRGYVLITSLVLMSMLTVLALTQISQNTSQTRIA
FT                   TNATDSEISFEKTEGAINEAINLIINGTYNPQSFLASNNGMYLFDQSATTPLWKTINWS
FT                   SGSAVINSFQGNTGAQASYYLEKLPSVIMPGQSMKKPSNVYRITARSSGASGDTSVLIQ
FT                   STIQIQQ"
FT   gene            complement(755074..756141)
FT                   /gene="pilW"
FT                   /locus_tag="lpa_00990"
FT   CDS_pept        complement(755074..756141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilW"
FT                   /locus_tag="lpa_00990"
FT                   /product="type IV pilus assembly protein PilW"
FT                   /note="COG4966, PilW, Tfp pilus assembly protein PilW [Cell
FT                   motility and secretion / Intracellular trafficking and
FT                   secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00990"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23966"
FT                   /protein_id="ADG23966.1"
FT                   /translation="MNINYRLQQGFSLVELMIATLVGLILTYSILQIYLAQTQLYKASN
FT                   SQDLIQSTENAISNLLIPVIRSAGFAGCGSIITAVSSLNAGGPRPLGILNTTPTILMGY
FT                   NGSGASFTITQSNPANSSNASHWSPALDSTLVGNAQQGSDVLVVLGSTSDSYPTGITTI
FT                   DPGSNTFVVQGTSGMSLTSGMFGAVSDCGKTVIFQITGVAGTTITHDAGAGVLQNASSA
FT                   FPVNFQTGSQFIPIQQTAFFVGQGQGGQSALMRASLVGNNWTIQPLVPGVEIMKVQYGI
FT                   GNNGVITRYVSANAVTDWAQVYAIRLGFLIAGQLGSGSLTTRQYNVLDTQITVPADNRL
FT                   RHVFELTINLRNSIS"
FT   gene            complement(756138..756677)
FT                   /gene="pilV"
FT                   /locus_tag="lpa_00991"
FT   CDS_pept        complement(756138..756677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilV"
FT                   /locus_tag="lpa_00991"
FT                   /product="type IV fimbrial biogenesis protein PilV"
FT                   /note="COG4967, PilV, Tfp pilus assembly protein PilV [Cell
FT                   motility and secretion / Intracellular trafficking and
FT                   secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00991"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23967"
FT                   /protein_id="ADG23967.1"
FT                   /translation="MINRMDTLAKDKGMTLLEVLISVVILAVGMLGIASMLIVSNKANN
FT                   SSYAKLQAVQAVYDIFDRIRANSDAASNGSYNVSNIGSNGYPTSVSAPSVLCNASVCNP
FT                   NQLAQYDTWYWLTRVVSQLPNGSGSITSALSGVAGNTVITVTVQWDDSKAQNELGASSA
FT                   SSGTANFVQFRVQSQI"
FT   gene            complement(756690..757397)
FT                   /gene="fimT"
FT                   /locus_tag="lpa_00992"
FT   CDS_pept        complement(756690..757397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimT"
FT                   /locus_tag="lpa_00992"
FT                   /product="type IV pre-pilin"
FT                   /note="COG4970, FimT, Tfp pilus assembly protein FimT [Cell
FT                   motility and secretion / Intracellular trafficking and
FT                   secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00992"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23968"
FT                   /protein_id="ADG23968.1"
FT                   /translation="MNKVITESQRFTLRNVANMLLCVDASVLPTQSNIAQKIQTKGIMY
FT                   NDLCKDSFDTEVPLNSNPLSIAGFTLVELLVTLSVFAIILTLIVPSLRTMILNSRLTSN
FT                   IDSLVSSLNYARGVALDRAVNVAVCPLGSPGSTACGANWSSGWIVVTQPVAGAPTLLKS
FT                   HQTSVNDPVITSNVSSVVFDPHGLSTTQSNFTMCDNRGNAFARSAMVLATGFVQSGTTP
FT                   GQAVWSNGALNCP"
FT   gene            complement(757620..758480)
FT                   /locus_tag="lpa_00995"
FT   CDS_pept        complement(757620..758480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00995"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00995"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23969"
FT                   /protein_id="ADG23969.1"
FT                   /translation="MKIKTVTRYLLLFSIFFLIGFNNVFAQKKAIAITIDDLPFVGEYR
FT                   NFHLNMMMNTMKDEKIPATGFIIAKEVRPDNWEILHKFRDAGFGLGNHTFSHANLNKLK
FT                   AKEYIQEIKEADSLLMPVLTEPKYFRYPYLAMSSGNKKNKILCYLEKHHYQVAPITIDS
FT                   KDFVFNQRLLSVPELGRRTYLDELKPFYLDFIWQQTLKAEEHTQYHHNPDQAQILLIHA
FT                   NLLNAYVLPDIINLYKQNGYTFVSLEDALKTFKENYHCHKTRILAKKPVGEETDLNIES
FT                   FMDWD"
FT   gene            complement(758656..759993)
FT                   /locus_tag="lpa_00996"
FT   CDS_pept        complement(758656..759993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00996"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00996"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23970"
FT                   /protein_id="ADG23970.1"
FT                   /translation="MTFVLKEFDTLKSHFNDTVKIILQREKKDKIEDLPNPRKEELQFL
FT                   TAVLNQLEAKIDELKPRSLASYVHVFYGAMLLVCKDVENNLRVMEKKENSLLFTRLMDG
FT                   MGISDENIPTSEQNIMFYRGLNKFLNFIYESNDSRKGLKKEHFLQVLSLKKIYSLAKLS
FT                   YEQEEAAENNALAKLTADGKTKANANSFHVEKPIDSSIVEQFKSWDEMKGALHQLILDE
FT                   LSDKNVAKISALSQARSAQLKFLQTMAEQLDKIPNQSLEPSEKMAILAGAMYIVRGQIA
FT                   QEYGKDPLSNDKISATVIHTGLSTILHANADCCEDKEVLIAAANKFIRHMVIERPEQSN
FT                   KKITKESIRENNMFSDIAGFQLISVLTLIQNMIKTCRTDAIEACVTKRKEELEALKPKK
FT                   EGYSIASSVTGYVGSWFKKAPSISEEDEEDDLKDQNTAEETSKPTV"
FT   gene            760295..761776
FT                   /locus_tag="lpa_00997"
FT   CDS_pept        760295..761776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00997"
FT                   /product="melitin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00997"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23971"
FT                   /protein_id="ADG23971.1"
FT                   /translation="MSFQTDKEIQQKFFSYTLFVLVVLLICRLIANYFFPLFDTTESRY
FT                   AEIARKMLETGNWVTLQQDYGVPFWAKPPLSIWLSAFFMQLLGVNEFAVRLPGLLLSVG
FT                   VLWLVWGVAKKQSGSMAALFSLLTLAGSLYFFLDAGTVMTDPALLFCTTLASVSFWHAM
FT                   VYENKIWSYAFFAGLGLGLLAKGPIAVVLVGMVVFFWVLLRNEWLNLWKRLPWFKGTFL
FT                   LLLIAMPWYVLAELRTPGFLNYFILGEHFHRFLTPGWSGDKYGIVHHVPKGTIWLYAIA
FT                   GIFPWNIIAGGWLVKHGKMLPSLCQSEDGWLSYLTLWMITPLLFFTFASNIIYPYVFPS
FT                   LPAFALLFAEILNRLNLELKHLKWVLISSLLCGVLFLAVAFVLGLKPDVVPNTHKPIIT
FT                   AWLNQNPTAGSHLVYWGYKTDFSAEFYSEGQVKSVKNQNDLCKLLSNRLENYLVINSKE
FT                   TQQIPGELLARLTLIDTFRVHRDTLILFHAPVLTC"
FT   gene            761908..762537
FT                   /gene="tdk"
FT                   /locus_tag="lpa_00998"
FT   CDS_pept        761908..762537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdk"
FT                   /locus_tag="lpa_00998"
FT                   /product="thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /note="COG1435, Tdk, Thymidine kinase [Nucleotide transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00998"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23972"
FT                   /protein_id="ADG23972.1"
FT                   /translation="MAKLYFYYAAMNAGKSTVLLQSSYNYRERGMQTLLFTPAIDTRFQ
FT                   YGTICSRIGLSEQAYAFNNSDNLYVLTQEFQLQTQKYSCVLIDEAQFLTREQVYQLTEI
FT                   TDQMSIPVLAYGLRTDFRGELFPGSQFLLAWADELIELKTICHCGRKAIMNMRIDENGQ
FT                   AVVEGEQVLIGGNESYVATCRLHYKLGEAGKTFPRNKLFNKDTNTF"
FT   gene            762642..763856
FT                   /locus_tag="lpa_00999"
FT   CDS_pept        762642..763856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_00999"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_00999"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23973"
FT                   /protein_id="ADG23973.1"
FT                   /translation="MAWVVCLSAGLFFLYEFFQLNIFDVINQSLREDFHIDATQLSWMS
FT                   STYLWADILFLLPAGLILDRFSTRKVILTAMFVCVVGTIGFAVTESFFLASFFHFLSGI
FT                   GNAFCFLSCVVLVSHWFPPRRQALVIGSLVTMAFIGGMMAHTPFAYLNDLFGWRRALLI
FT                   DGVVGAFLILWIYMIVQDRPEESPAHKLTNEGQILSSFMKALSNKQNWLAGLYTSLLNL
FT                   PIMVLCALWGASYLQVAHHLPDIAASNVVSLIFMGSVVGCPLVGWLSDTQGRRKPLMIF
FT                   GAIATLITTIPLFINVVLTQMSLSILFFALGLFTSTQVISYPLVAESNQPENTGAATGI
FT                   ASVIIMGGGGVAQVLFGWLMTHHAGTNVTAYTVSDFQFAMWMFPVAAIAGLVAVLMTRE
FT                   TYCKR"
FT   gene            763869..765152
FT                   /gene="uhpC"
FT                   /locus_tag="lpa_01001"
FT   CDS_pept        763869..765152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uhpC"
FT                   /locus_tag="lpa_01001"
FT                   /product="Sugar phosphate permease"
FT                   /note="COG2271, UhpC, Sugar phosphate permease
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01001"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23974"
FT                   /protein_id="ADG23974.1"
FT                   /translation="MQVVDEFKAFDVKASLMPWLVCFAATMFFFYEFIQGNMFASIAAN
FT                   IMQDFQIQADKMAYLSSIYYLANVIFLFIAGMVLDRFSIKNTILIAMFLCVISTFILSY
FT                   SDSFYVALFCRFVTGIGSAFCFLGPVRLASHWFPPQRMALVTGAIVTVAMTGGMLAQYP
FT                   LTKLVLHVGWRQAVQDVGILGLAMLVLMFFWIKERPQVAIKKEGKPINVLVAARKAYLN
FT                   AQNLRAALYTSLMNMAIAVFGAMMGTLYLEQRLGISPDQAAMINGMLFFGAIIGSPLMG
FT                   WISDKVGLRVLPMKGGVLASLLILLGVLYLPVSVTMMAVLFFLLGLFTSAQVISYALVA
FT                   ESSPPMMTATAVSVVSILTQGGYLIYQNLFSALLTNYGDVRLINGVPVYLLEAYQHAAI
FT                   ILPIGLLIALLLLFGLKETRCQQVGHTV"
FT   gene            765176..766372
FT                   /gene="deoB"
FT                   /locus_tag="lpa_01002"
FT   CDS_pept        765176..766372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoB"
FT                   /locus_tag="lpa_01002"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="COG1015, DeoB, Phosphopentomutase [Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01002"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23975"
FT                   /protein_id="ADG23975.1"
FT                   /translation="MDSFGIGASLDAARYGDVGANTLVHIYEACKRGECDIDGVRKGSL
FT                   MLPNLASKGLYHAAMASSGLPFIDLSALAIPSGYYGYAVEQSLGKDTPSGHWEMAGVPV
FT                   TFEWGYFPDKPYCFPEELISEFIKQCNLPGVLGEKHASGTIIIDELGEEHIRTGKPIVY
FT                   TSADSVFQIAAHEEAFGLQRLYDICKIARNLVDKYQIGRVIARPFAGKPGSFKRTGNRK
FT                   DYATPPPEKTLLDFLKEDGREVIAIGKIADIYAHQGVTQEIKADGNMALFDATLSAMKT
FT                   APQGSLVFTNFVDFDSSYGHRRDVAGYAHALEQFDARLPELEVLLQPNDMVFIAADHGC
FT                   DPTFPGSDHTREHIPVLMFGPQVNSKFIGRRDCFADIGQSIAEHLQLSSPLAHGVSFL"
FT   gene            766576..767124
FT                   /gene="hslV"
FT                   /locus_tag="lpa_01003"
FT   CDS_pept        766576..767124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="lpa_01003"
FT                   /product="heat shock protein"
FT                   /note="COG5405, HslV, ATP-dependent protease HslVU (ClpYQ),
FT                   peptidase subunit [Posttranslational modification, protein
FT                   turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01003"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23976"
FT                   /protein_id="ADG23976.1"
FT                   /translation="MEQFHGTTILSVRRGNQVVIGGDGQVTLGNTVMKGNARKVRRLYK
FT                   DKVIAGFAGGTADAFTLFERFEAKLEMHQGHLIRAAVELAKDWRTDRILRRLEAVLAVA
FT                   DSKASLIITGNGDVIEPEESLIAIGSGGPFAQAAARALMENTQLSAKEIVQKALTIAGD
FT                   ICIYTNNNLTIEELNDEGK"
FT   gene            767126..768451
FT                   /gene="hslU"
FT                   /locus_tag="lpa_01004"
FT   CDS_pept        767126..768451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="lpa_01004"
FT                   /product="ATP-dependent protease HslVU (ClpYQ), ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01004"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23977"
FT                   /protein_id="ADG23977.1"
FT                   /translation="MVMTPREIVQELDKHIIGQDDAKRAVAIALRNRWRRMKIKDPVLR
FT                   NEIMPKNILMIGPTGVGKTEIARRLANLAKAPFIKVEATKFTEVGYVGRDVDSIIRDLT
FT                   DMAIKQEREFAMKKVEHLAEDAAEERILDVLLPPARGTLTPGEKNTTARQVFRKQLREG
FT                   ELNDNEIEIEVAATPVGIEIMAPPGMEEMTSQLQSMFQQVGSYRTKTRKMTVAKAMKIL
FT                   REEEAAKLINEEDIKLKAIESVEQNGIVFIDELDKIAKRSDTVSGGDVSREGVQRDLLP
FT                   LVEGTTVSTKYGMVKSDHILFIASGAFHVAKPSDLIAELQGRLPIRVELSALSVEDFVR
FT                   ILTEPSASLTLQYSALMETEGLTLTFDETGIRRIAEVAWQVNERTENIGARRLYTVMER
FT                   LLEVVSFEATDKAGETVHVDKAYVDKNLGQLIADEDLARYIL"
FT   gene            768651..770225
FT                   /locus_tag="lpa_01005"
FT   CDS_pept        768651..770225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01005"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23978"
FT                   /protein_id="ADG23978.1"
FT                   /translation="MKTQRIIHPNIDIRKFPEVNANFSMTDISMGDLHANALLFLNILV
FT                   RQGIIAISPENYAKFAEIYILPELQADYWGTEAPVFSAGNKQERLEEIKKQYNALIAQI
FT                   KIINTKKLIRLIGDELVDRGVIDYFILKLLQALHDQGADFEILLSNHGIEFVEACELFK
FT                   ENGNKLVAKRLGNIQHGNSFHALQEAIAAGSISNEEVLNIYHQVYKKHLKIISYALDPD
FT                   ANEIKVFSHAGIGLNHIRGLTRKFKVPYSEESAVDLARTIDAINKKFAEKASAGEIHTL
FT                   YTHDMMYRGYAGEYLNSTDEVVAATVWGREYGDLIRTSKKFKVTFIHGHDSYDPEKVEH
FT                   VTLNNQLGQFQNNVGDLYLYATNGMRAVPTQCLNPDKKVQSLREKNRPDKPNDYVVKVH
FT                   HTKPSFFKTAHPKMTFPDSYKRIWDSTPGHSNITKIKALLKDYTKEDSILGSFWGLIFT
FT                   LHWGRHHVKSVRQIAQTQYTSVEAILSDLKALKPREGGSLDKRIKFIESQIITQRGDNP
FT                   DLQFNLK"
FT   gene            complement(770212..770397)
FT                   /locus_tag="lpa_01006"
FT   CDS_pept        complement(770212..770397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01006"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23979"
FT                   /protein_id="ADG23979.1"
FT                   /translation="MSTCNGFSLFRWSTKQFSTTDFLSQWHIHSALDTSDKQQYASDLT
FT                   SHLKILSEKNKKTISN"
FT   gene            complement(770394..771488)
FT                   /locus_tag="lpa_01007"
FT   CDS_pept        complement(770394..771488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01007"
FT                   /product="ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01007"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23980"
FT                   /protein_id="ADG23980.1"
FT                   /translation="MSVGLAIFSSFPVFQGLAEPVQNFIFDNFVPATGKIVQSYLQQFT
FT                   SQVSKLSIWGVVFLIFTALLVMFTIERAMNKIWRVSSSRHGVSAFLLYWAIISLAPVLL
FT                   GLSLAASSYLFSMPILADHRAPYTILHYSPFFLSLIGFTFLYVVVPNCPVKIRHAFWGG
FT                   LVAAILFESAKHAFAYYLIRYNTYELLYGAFATVPIFFIWVYWVWIITLLGAEISYAFS
FT                   VHHQRRGGKSLDGFSHALLWLHQLWIAQQHGKGLSFNDLVDASKQPFAVDVDEMINALI
FT                   YHELIHATADGHYMLSRDLSHVTLYDLTQLLPYRLPTHLELQYSKASLSEQWRAAFKRH
FT                   NEELKKSLDINLEELFKKTGTILK"
FT   gene            772045..786054
FT                   /locus_tag="lpa_01009"
FT   CDS_pept        772045..786054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01009"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23981"
FT                   /protein_id="ADG23981.1"
FT                   /translation="MLAESVIGIVRAVNGLLEKVNVQGQASLVKSGARLEEGDVLTLLS
FT                   GEAYIQFINGFPEALALEKPVKLDGVSPTLQYGAEDLKEQMVQEAIAKGIDPSVILDVL
FT                   GSAAAGAEAVGSGGDAFIMDPLFGFGHVTAGYPTGPISFAYEADTQQLFWFVPEETGAI
FT                   AESELTQEPESIPQIPQFTTNQAVLTVFEDALPSGIPDSAGQARIASSSLSTLLTSSPD
FT                   VVASFAFNTNLSVLPTLKSGGIDLDYNLSSDKRTLTASIPGGAAVMQFELTADGQLTQT
FT                   LMDSIDHPTADSDDSEWMRLDLSPLIDVTFTRTSDGSVLESRTLPANAVVAGIQDDVPI
FT                   ARAQLTNNEILLDETIGMKAGDADAANDDFNPTTTVDPFNNTYGIPIGLVQNANLLDTS
FT                   TSEMGGDYKNATMTHLLKITDAVSGLQTTDGTPINLFLESNGDISGRAGDIGAPAVFAI
FT                   RMNPNTGAITVAQYGSIKQFDTNSHDEAVDLTGRISAVVRVTDGDGDVSNAEIPIGQRI
FT                   VFEDDGPIAQIAATGVKVTHDETAGVDAGSDDVASPLALFAGVSQKSTDMAGFAQSSGA
FT                   VVSSAGSLVGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGFVVGRDAGGDAVF
FT                   AIAIDADTGVLSLAQYESIKHPSGGASYDEAVDLSGKINAVVTVTDGDGDVATQAIGIG
FT                   DAIVFEDDGPVAQIAATGVKVTHDETAGVDAGSDDVASPLSVFVGVVNKSTDMAGFAQS
FT                   SGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGK
FT                   AVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAI
FT                   GIGDKVVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGF
FT                   AQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDA
FT                   SGKAVLAISIDADTGVLSVAQYESIKHPTGGASYDEAVNLSGKINAVVTVTDGDGDVAT
FT                   QAIGIGDAIVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDM
FT                   AGFAQSSGAVVSSTGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVG
FT                   RDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGD
FT                   VATQAIGIGDAIVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKS
FT                   TDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGL
FT                   VVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGASYDEAVNLSGKINAVVTVTDG
FT                   DGDVATQAIGIGDAIVFEDDGPVAQIAATGTKVIHDETTGLDAGSNDVAGPLSVFAGVV
FT                   NKSTDMAGFAQSSGAVVSSTGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLE
FT                   SGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTV
FT                   TDGDGDVATQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVASPLSVFV
FT                   GVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITL
FT                   TLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAV
FT                   VTVTDGDGDVATQAIGIGDAIVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLS
FT                   VFAGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDA
FT                   ITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGASYDEAVNLSGKI
FT                   NAVVTVTDGDGDVATQAIGIGDAIVFEDDGPVAQIAATGTKVIHDETTGLDAGSNDVAG
FT                   PLSVFAGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTD
FT                   GDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGASYDEAVNLS
FT                   GKINAVVTVTDGDGDVATQAIGIGDAIVFEDDGPVAQIAATGTKVIHDETTGLDAGSND
FT                   VAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSTGSVTGQDNEGATIKFSLAIANAASGLQ
FT                   TTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAV
FT                   HLGGKINAVVTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGLDAG
FT                   SDDVASPLSVFVGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAAS
FT                   GLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYD
FT                   EAVHLGGKINAVVTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGL
FT                   DAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIAN
FT                   AASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGA
FT                   SYDEAVNLSGKINAVVTVTDGDGDVATQAIGIGDAIVFEDDGPVAQIAATGAKVIHDET
FT                   TGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSTGSVTGQDNEGATIKFSLA
FT                   IANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPT
FT                   GGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAATGAKVIH
FT                   DETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKF
FT                   SLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIK
FT                   HPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAATGAK
FT                   VIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGAT
FT                   IKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYE
FT                   SIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAAT
FT                   GAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNE
FT                   GATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVA
FT                   QYESIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDKVVFEDDGPVASN
FT                   ITRSGLANEGADTNLMLILDTSGSMAGSGIQTLINSTLELLERYEALGNVKVRIVTFNT
FT                   SATAIGSVWMTVDAAKNALLGLTAGGNTNFDAALITAMNAFNSGTVGGADGRIGGAQNV
FT                   SYFISDGNPTVNQDWPSIPGTLAQNGIQPSEQAAWEAFLQDTNGASAGGEKIRSYALGM
FT                   GTGITVSNLEPIGFNGVNGTDIPAVVVTDISQLDSVLASTITASPISGTLISDPNPGVN
FT                   FGADGGHVQSVTVNGITYTVNANLSSLSTSGSATQGSNTHSYDNSTHVLTVTISTGESL
FT                   TIDMDNGSYTFTPPANITSSINRIINYVLVDGDGDTAAATITFNIDISGFNDPLVVRDD
FT                   LVLTNQPAVSGQDVISIPTWALLANDTGGSGVSSVSSVTQPVAEGTVVLNAGSVAFTEE
FT                   SNSAADGTYNGSTSDPFRYTNTTGSQSATAKVDLDRTQAGENRLDGTYRSEILLGRDTS
FT                   NDTIIGNDGNDILIGLGGNDTLSGGNGDDILAGGAGNDTLDGGAGNDTATYIDATAGVT
FT                   VSLNTSSAQNTVGAGTDTLTNIENLTGSKFNDTLTGNNSANTIKGLEGNDTISGLGGND
FT                   TLDGGSGDDVIIGGLGDDILTGGSGADQFVLVKGQGGASAGAAPIDTITDFEVNIDKIV
FT                   INGNNITGVSVSTPVSNTYTITVNYSDAATEHFKVTLSNGAVLNDSGKTHLNGVVISGG
FT                   TATIDGTIVGAVLYLDLNANNQEDEGERLGITNQYGHVEWVVDLSKFDVNGDGQYVIGE
FT                   ARAVQTGGFDIDTGLSYEINLYGPVGSAVISPLTSLLQAQLEAGMDYETANAALVARLG
FT                   LPEGTQIISFNPITGSGEVLAQNAGVMTAAIQFAEIAAIHYSTDEGHVSFAVFEAISKA
FT                   LLELPEGVVADFGDEGFLQSISNYLGLDALVTSDMIDYMATSQKALEASILTLAPGEDA
FT                   LTAISKIQHVTQGIYAQAIEMALIGYLPLDALKNMSAVLKAYADGDITDEQLNSFEDKL
FT                   SAVIVNWEDNNVTDTSHQATLQTERTVDDSSVKSEVNHEMAQEVNAVINDFMDEHNISL
FT                   YYYDQQAQMPQEAQQPTEDQAEETVMHDDVVQDLLLDDHSLTMLANNPELNGGNGNDIL
FT                   HGTTGNDFIRGGQGNDTMTGGGGVDTFFWLSGDDDGGVDTITDFKANPVDKSSDASVLN
FT                   LSDLLSDADLETNSLDNYLNVSTTEEGDTAIKVDPNGNGNFDAPAQTIILEDVDLTAVF
FT                   ATNNSHDIVNQMIANGNLIVEQ"
FT   gene            786233..786832
FT                   /gene="wrbA"
FT                   /locus_tag="lpa_01010"
FT   CDS_pept        786233..786832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wrbA"
FT                   /locus_tag="lpa_01010"
FT                   /product="trp repressor binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01010"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23982"
FT                   /protein_id="ADG23982.1"
FT                   /translation="MSNPYILVLYYSRTRSTAQLAQYIARGVESVSGLEARLRTVPPVS
FT                   TTCEAVDKPVPDAGAIYVSLDDLRHCHGLALGSPTRFGNMAAPMKYFWDGTTSLWLGGD
FT                   LVNKPACVFSSSASMHGGQETTLISMMIPLLHHGMILLGVPYTEPALTSTQSGGTPYGV
FT                   THVAGGDNENPLSQDEISLAKALGERLGRVAMGLKV"
FT   gene            787114..787332
FT                   /locus_tag="lpa_01012"
FT   CDS_pept        787114..787332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01012"
FT                   /product="multidrug efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01012"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23983"
FT                   /protein_id="ADG23983.1"
FT                   /translation="MVPADAKLLKQAKSLRKRSTDAENCLWYYLRAHRLKGYKFKRQVP
FT                   IGNYIVNFVCIQRKLIVELDGGQHLSK"
FT   gene            787521..788303
FT                   /locus_tag="lpa_01013"
FT   CDS_pept        787521..788303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01013"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="COG0708, XthA, Exonuclease III [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01013"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23984"
FT                   /protein_id="ADG23984.1"
FT                   /translation="MKVISFNANGIRSSARNGFYDWLVGQDVDFVCIQETKSQVEQLIP
FT                   EELYFPRDYFCDYFDAEKKGYSGVAIYSKYKPVRIVKGLGFDYCDKEGRYIQFDYPKLS
FT                   VISLYLPSGTSGEDRQEVKYAFLEQFARHLMNLKNEGRELIICGDYNIAHKKIDLKNWR
FT                   GNQKNSGFLPEERAWMDELFGSMGFVDAFRVHNQEEEQYTWWSYRARAWEKNVGWRIDY
FT                   QVITPGLTEYVADSRIFREARFSDHAPLMIEYKGDWCV"
FT   gene            788296..789066
FT                   /locus_tag="lpa_01014"
FT   CDS_pept        788296..789066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01014"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="COG0708, XthA, Exonuclease III [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01014"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23985"
FT                   /protein_id="ADG23985.1"
FT                   /translation="MFKLASWNVNSLKVRLEQVLQWLESSQVDVLAMQETKLTDDNFPV
FT                   ASFTDKGYHVIFSGQKTYNGVAIISRYPMTDIQTDIPELEDPQRRILAATVKGIRLINL
FT                   YVPNGGELTSDKYQYKLDWLKKVTRFIQHQLSIYSKVAVVGDFNIAPEDRDVHDPVEWE
FT                   GCVLVSPAERQAFMEILELGLHDSFRNFAQEEKAFSWWDYRAAAFRRNRGLRIDHVLLS
FT                   HELNALCRQSKIDKEPRKAERPSDHAPVWVELEL"
FT   gene            789203..789430
FT                   /gene="rpmE"
FT                   /locus_tag="lpa_01015"
FT   CDS_pept        789203..789430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="lpa_01015"
FT                   /product="large subunit ribosomal protein L31"
FT                   /note="COG0254, RpmE, Ribosomal protein L31 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01015"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23986"
FT                   /protein_id="ADG23986.1"
FT                   /translation="MKASVHPDYQTVKVTCSCGEVFETRSTLCKDLNIEVCSMCHPFYT
FT                   GKQKLVDTGGRVQKFRDRYNMRTGQAKSKE"
FT   gene            789557..790792
FT                   /gene="sfcA"
FT                   /locus_tag="lpa_01017"
FT   CDS_pept        789557..790792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfcA"
FT                   /locus_tag="lpa_01017"
FT                   /product="malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="COG0281, SfcA, Malic enzyme [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01017"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23987"
FT                   /protein_id="ADG23987.1"
FT                   /translation="MDNEVIKQRALDYHEFPVPGKLSVHLTKSTNSQDDLSLAYTPGVA
FT                   APVLAIAEAPENAYRFTSKGNLVAVMTNGTAVLGLGNLGPLASKPVMEGKAVLFKRFAD
FT                   LDVFDIEIDAEDPQSFIATAKRIAPTFGGINLEDIKAPECFEIEQALIQQLNIPVFHDD
FT                   QHGTAIVVAAGLLNALELQNKKLSDIKIVCMGAGAAGIASMRLLVALGAPKSNMLLLDT
FT                   KGVIHDGREDLNPYKFAFARNTLCRTLEDALVDADVFIGVARPDLLNAHLLSLMAPNPV
FT                   IFALSNPDPEIKPELAHSVRKDLVMATGRSDYPNQVNNVLCFPYIFRGALDVRATCINQ
FT                   AMQIAAVEAIRQLVHEPVPQVVKDNYPGVVNWDFGPDYIIPKPIDPRLKERVPAAVAKA
FT                   AIASGASQFNNL"
FT   gene            791288..792295
FT                   /locus_tag="lpa_01019"
FT   CDS_pept        791288..792295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01019"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01019"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23988"
FT                   /protein_id="ADG23988.1"
FT                   /translation="MFTGTTIFWVAATGRFLVGFGSAFAFVGVLKIATLWLPENRLAMI
FT                   SGMTSALGPIGAMLGDNFLELFIVKMGWVKTLNMTAAFGIVLTLVLWVGIRDRKGQHRQ
FT                   SGTVPTLKKGLVDLGIIITSRQIWVNGMYGCLVYLPTTVFAELWGIPYLHHAHGLTTQA
FT                   AGLANSVLFLGFIIGAPIMGYISDRLYRRKFPMLIGASGAAIVMMMILYLPGLNESNIQ
FT                   ALMFLLGLLYSAQAIVFAVGRELSPGEAAGTAMAVTNMIVMLGAMFLQPLVGHLLDFSL
FT                   STHLSDTTGIVVDNMSKLYTVDDYQFALSIIPLGILIAAILTFFLKETHAKAPK"
FT   gene            792297..793553
FT                   /locus_tag="lpa_01020"
FT   CDS_pept        792297..793553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01020"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01020"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23989"
FT                   /protein_id="ADG23989.1"
FT                   /translation="MTTKKQISYGVLVCFIGAVFYCYEFILRIVPGALQTELSTALGHI
FT                   SATTFGQISALYYFAYSPMQMPVGMLMDRYGPRRLLTFACLCCALGSWMFTLTWSIVLV
FT                   GIGRFLVGFGSSFAFVGVLSLALHWLPRRYFSLVAGLITTLGMLGLVYGEIKITEWSEV
FT                   IGWDHVLMHIAMIGSALCILTFFVVRDGPEGYQPNKYPWPEFFHNVLKVLTSHEVWLIG
FT                   FVGACLYTSLSVFGELWGKTYLEQAHHLTKVEAAKTVSAVFLGWAVGAPLAGYISDITR
FT                   RRLLPLVIGAIVSLICISFVLYCPGLSYLTLNILLFLYGVFSATEIIVFIMAKECSGAK
FT                   LSGTVFAVTNMIISLAGAIFQPLVGKLLDTFGDSGIVAGEHIYTVDDYQVALSILPISL
FT                   LLVTILAFFIKDKDHSNNS"
FT   gene            complement(793582..794400)
FT                   /gene="dam"
FT                   /locus_tag="lpa_01021"
FT   CDS_pept        complement(793582..794400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dam"
FT                   /locus_tag="lpa_01021"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /note="COG0338, Dam, Site-specific DNA methylase [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01021"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23990"
FT                   /protein_id="ADG23990.1"
FT                   /translation="MVKIRPFLKWAGSKYNCLNEIISSLPTGQRLIEPFAGSGVVFMNT
FT                   SYSSYLLAESNPDLVNIYRILQLNGESFIDYCQQYFTPEANCKEKYYELRTEFNNLMDS
FT                   NQKSAVFLYLNRHGYNGLCRYNSKGKYNVPFGLYEKPYFPRKEMMLFYKKCLSAQFIHD
FT                   DFRNTFALAEPGDVIYCDPPYVPLTENNQTLPYNQKLFSLEDQIELAELAQETASKGIP
FT                   VIISNHDTEFTRHHYKKAQIKSFYVPRWISCRSQMRLPVKELVAVFNCPS"
FT   gene            complement(794571..795767)
FT                   /gene="tyrP"
FT                   /locus_tag="lpa_01023"
FT   CDS_pept        complement(794571..795767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrP"
FT                   /locus_tag="lpa_01023"
FT                   /product="tryptophan/tyrosine permease"
FT                   /note="COG0814, SdaC, Amino acid permeases [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01023"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23991"
FT                   /protein_id="ADG23991.1"
FT                   /translation="MINSKLIGGILLIVGTSIGGGMLALPVSTAEVGFANSLFFLFFCW
FT                   LVMTAGALLILEVNLRLPAGSNMISMAKSTLGLPGQVIAWITYLLLLYTLLAAYISGGS
FT                   DVFSSLLHKAHIDLPNWITSVIFTAMFSLIVYSGIRSVDYVNRGLMFGKLGVYILLVII
FT                   ISPHVSAAGLTGGSAKAFTGTLMILVTSFGFASIVPSLRDYFNDDIRSLRRVILFGSLI
FT                   PLFCYIVWDAVIMGVISREGENGLLSLMNSDHATSGLTEALSQSVSSQWISGFFGFFTS
FT                   ICMVTAFLGVSLGLFDFLADGLKLKKSGNQGKYTLALTFIPPLAVVLFNPGIYLHALSY
FT                   AGVCCVILLLLLPAIMAWKGRQTCSQSPSETHLIPGGNPALSLIGFIAIGLLIIAIMY"
FT   gene            complement(795968..797158)
FT                   /locus_tag="lpa_01025"
FT   CDS_pept        complement(795968..797158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01025"
FT                   /product="tryptophan/tyrosine permease"
FT                   /note="COG0814, SdaC, Amino acid permeases [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01025"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23992"
FT                   /protein_id="ADG23992.1"
FT                   /translation="MRSRFIGGILLIVGTSIGGGMLALPVANAATGFWQSSLFLLICWA
FT                   FMTFGAFFILEANLYLSRGKHMVSMAKATLGDYGLLTAWISYLFLLYTLLSAYISGGAD
FT                   VLNSLLSKVNWHLSDWQASSLFTLIFGLVVYGGIHSVDVANRALMFGKLAVYCILVILI
FT                   APHIEFHYFQHGDYRQIGGAIMILITSFGFAIIVPNLRDYFDDDIKTLKKVIFIGSLIP
FT                   LICYIAWDAVIIGSLPSEGTSGLESLMQNPRTTSALASLLTDKVENTTISALFNFFTSI
FT                   CMLTAFLGVSLCLFSFLADGLKLRERGRHGIGLFVLTFLPPLLIVIYYPGAYIYALRYA
FT                   GIFCIILLLLLPALMCYFGRKRYKSPFWVPGGKISQFAVIIISVVLLAHEFIALFK"
FT   gene            complement(797169..797861)
FT                   /gene="ompA"
FT                   /locus_tag="lpa_01027"
FT   CDS_pept        complement(797169..797861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompA"
FT                   /locus_tag="lpa_01027"
FT                   /product="hypothetical protein"
FT                   /note="COG2885, OmpA, Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)proteins [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01027"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23993"
FT                   /protein_id="ADG23993.1"
FT                   /translation="MSRKLAKTRILGYGLMICFLAGCFHPPYNNFQPDRRAVKRVGVDT
FT                   GIGAVAGVIASGTASGTLIGAAAGGTVGLVASIYRDSKRKIIRDLQKQDIQYVEYGDTR
FT                   TLIIPTDKYFMFSSPRLNEICYPGLNNVIRLLNFYPQSTIYVAGFTDNVGSRSHKRKLS
FT                   QAQAETMMTFLWANGIAAKRLKAEGYGDKNAISDNAIIHGSAQNRRIEIQWFTSPAQPP
FT                   QPQMAYVK"
FT   gene            798092..803299
FT                   /locus_tag="lpa_01031"
FT   CDS_pept        798092..803299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01031"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23994"
FT                   /protein_id="ADG23994.1"
FT                   /translation="MKIPVQLKNIGGNIPENDIALQVSYFIKSQNDELLPQSDAYIAPA
FT                   SGKIDVSFGNNLARNKDVFFAVALKSNNILAQTSTSATQLKDEVPITMEFDYSPLVLSE
FT                   PDDQIVSPRPLFVYGRLLDKQGKKKLEDVQIIFEATRANDGGLQPIASVRTEADGYFFI
FT                   EYPQGSFIDASARVGLPLRENPIPVRLDEVRIDGDISNKVFPRNVILVAELMEAEEATV
FT                   EKECGCEVLDVHESKRILEEYSFYSVVRTTEPEILGYVLKEEDEITLDEVLTQHPIRIW
FT                   EIIDPIFQLPAFSHLANRARVNLPEVTERSINTEITTRAHGRANTAPNPPQDNELAETL
FT                   KQIKINRGVLNNFLQRETNITKDNIVNLIEMNESYRFKQKMTLGETKPLGRVVLNSENS
FT                   VDWDLEPTLYQAVSVAHGHLLHFKSEWIADGYSLGDLLYSLPLAPGQKKQIVVFDWERR
FT                   ESATNIQSLEYEESLYNSLSRDRDIFEITKGVIEENIKGKSSATTASASAGIGGVVGGL
FT                   LFGVSGGVGHSGSTASQNSLRQTSASDLQKIRDRIVQSANAVRSQRSSVIQTVSQGERF
FT                   EVSSETVANYNHCHAITIQYYEVLRHFKVRQRFAEARECLFVPLLMSQFELNKLLRWRE
FT                   SLQFALLNTNLSKGFDAAERIKNKWIGSNFPGGTFASEKILNASGNFQIKFIIRRPDDK
FT                   MVEVDDYSKPIYGGQNMIIGYQKKTVEDINEANWQSLIPFLGSDTPKGFYDHHLRDAKN
FT                   KDEVFHRLLGEKIATAFVGALTFHVADETGNEISSISFDTTLTSKYRKEGVLNVSVRFM
FT                   GPSQFSRDKVHYIKIRCGTANVLPDYSSIIVTSGFIRYKTPHYEGFLCRFQSIYDDLSP
FT                   SDGVTLYAGPSLDELRDPRKEDIALVNSLIDHLNDNLEWYHKAIWQLMPAERRFLLLDG
FT                   IVLPGSKGLGRSLASLVENELIGIVGNSLVFPVAKGLNLDPNFGASDSLTDYYMVAAGD
FT                   PVNVSIPTKGVYAEAMMGRCNSCEEKDESRFWRWEESPIPDTPTTINPISTESRRAEPG
FT                   NLQPTAFPNPMVNIQNAPNAPDPTGLAGTLSLLGKGDSFRDITGLTQNQTNALEALKAS
FT                   FDATKTFGQEAAKLEIQKMMDKRLDNAIKAINNNPNLDPKQKMELTEKALNAYLGAGAN
FT                   TTQPPKDANADKLQEGINKNLDKVNSSKSGEISVTKPDGTKVNTKFDGGTTSPAIETKI
FT                   GKGGITPMKQENSNACWATVATMMLRWKDSKNYTIEEVLTKAGSQYLNYYKQKTGLPYT
FT                   EKQNFITSLGMRGEPLANYTAQNYRDWLVEYGPLWVTTDTDQSKGFSAHALIITGISSD
FT                   LKSLEVIDPLQGRKFVQSFEEFANAFKELITDSGLLPTTQVVHFLEKIEATEGAPTPAD
FT                   IVKSLNEYNPSSSETLVINMVEFNTGISGITNYKDWKTDGSVIHNKRKNAYRDPFGIKH
FT                   LVLHETAAESGDGFDDSNNETSHMSVKRDATILQFNDLVEFENHGSGMNTTSIGIEFVN
FT                   RGWLSSSTADGGEGIPAKESSLTAAQKETYKEANGYLWAFWGYGFNIYRVPPSIDQLEK
FT                   EVELVKWLTRDFPALLQSISGISIYNLFPSIDDTWLQLVSYAEVKDIWTFKAADIPPEA
FT                   ERTEKNLFVMTTGYEYLEPSYLTDKSGIISHNAFYENHSDGSFLTLYTWLRLEKGKSKT
FT                   DALDIAKKLMKDHFIRVSLTSNTDKKIILLNVKDGNLV"
FT   gene            803693..804538
FT                   /locus_tag="lpa_01032"
FT   CDS_pept        803693..804538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01032"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01032"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23995"
FT                   /protein_id="ADG23995.1"
FT                   /translation="MSKKAIAISIVIALFFITAIWFAYSFVKQEENQNWLTLYGNIDIR
FT                   DVSLSFRVSGRILSMDVDEGAHVKKGQLLARLDKDTFIANLEMAKAQLKQAIANQKNAS
FT                   RTYKRREQLVDDGAVSKALFDDAVAMKDSSSAEVSVAKANLEKAQISLNDTEIHAPTHG
FT                   TILTRIQEPGAIVNVAEPVYTLAIDNPVWVRTYIDEPFLGRIYPGQDALVYTDSNPEKP
FT                   YKGHIGFISPQAEFTPKIVETTQLRTDLVYRIRVVIDQPDNGLRQGMPVTVKIHLKANS
FT                   "
FT   gene            804541..806283
FT                   /locus_tag="lpa_01034"
FT   CDS_pept        804541..806283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01034"
FT                   /product="ABC transporter ElsE"
FT                   /note="COG1131, CcmA, ABC-type multidrug transport system,
FT                   ATPase component [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01034"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23996"
FT                   /protein_id="ADG23996.1"
FT                   /translation="MNSSKPLVSINGVSKCFPGNTDPALDNVSATIFEGQITGLVGPDG
FT                   AGKSTLMRLICSLMLPTQGTITVDSLNTRTDSEKIHAITGYMPQKFGLYEDLTIIENLR
FT                   LYAELRNLHGEKREEQFRTLLKFTALEPFQKRLAGNLSGGMKQKLGLACALMGEPKLLL
FT                   LDEPSVGVDPISRRELWTMVQGLLGRGMGVVWSTAYLDEAEKCDQILLLNAGKPIYHGK
FT                   PGDFLQKTKDRTFQICGVSLLNRRQALMNALNTPEVIDGVIQGKNIRIVISDKKIKPSL
FT                   DGITREPGVHFQEVESRFEDAFIDSLKTKISGRSLLAEHIAEKPHSDKPIIEARKLTKR
FT                   FGSFTAVSNNEFTIKRGEIFGLLGPNGAGKSTTFKMMCGLLQPTQGQAFVMGLDLKTSS
FT                   SEARSRIGYMAQKFSLYSHLDALQNMRFFSGLYGLSGERQEAQINSMIEIFDLKKHLKQ
FT                   NSGDLPLGFKQRLALACAVMHEPDVLFLDEPTSGVDPLTRREFWTHINGMVNKGVTVMV
FT                   TTHFMDEAEYCDRIALIYRGKNIATGTPDDLKDKVRNSTLPNPTLEDAFIELIRLDELR
FT                   EPVH"
FT   gene            806301..807422
FT                   /locus_tag="lpa_01035"
FT   CDS_pept        806301..807422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01035"
FT                   /product="antibiotic transport system permease protein"
FT                   /note="COG0842, ABC-type multidrug transport system,
FT                   permease component [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01035"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23997"
FT                   /protein_id="ADG23997.1"
FT                   /translation="MNIRYLKALVIKETLQIIRDPSTILIAFVLPLILLFIFGYGVNLD
FT                   TDQVKFGLALESYDSSTVSLSQSFSSSRFLDVSISTNRQAFRYGLVNGTIRGFIDIPQR
FT                   FTADSLSGNPKPALQNIVDGSYPQVAGFAENYALGALQTWISSQAYEHGQMTLKSGINL
FT                   EPRYWYNQELKSRNFLIPGSIVIVMTLIGTLLTSLVIAREWERGTMEAMMATPISIVDI
FT                   ILGKLIPYFVLGMGSMFLCTIIATWYYGVPFQGTLLALTLVSAVFLVAALGQGLLISTL
FT                   ARDQFVASQLALMSAFLPSFILSGFIFEINSMPKWIQLLTHLFAARYFVTSLQTLFLTG
FT                   NIWSLLIRCLFAIALIGFAFFFITAHKTRKRLD"
FT   gene            807422..808546
FT                   /locus_tag="lpa_01038"
FT   CDS_pept        807422..808546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01038"
FT                   /product="antibiotic transport system permease protein"
FT                   /note="COG0842, ABC-type multidrug transport system,
FT                   permease component [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01038"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23998"
FT                   /protein_id="ADG23998.1"
FT                   /translation="MAKLSPATRIFALVIKEILTLFKDPKGRIVLIAPPLLQLLIFSFA
FT                   ATMEIKNISIGILNQDSGKHGYEVIQRFIGSPTFSKVFFIQKQSDIKPIIDNQEAMVVM
FT                   TIPQDFSRKIESNSQANIQLILDGRRSNATQIVNGYISSIIENYNQEIQKTHGAIMMPP
FT                   VMVTRSWFNENLLYLWFTVPSLICILSMLISLVVTALSVARERELGTFDQLLVSPLTPY
FT                   EILIGKTIPAIIIGLAEGLLMWVAAVWLFDVPFYGSPLLMVYILFIFIMSTVGVGLFIS
FT                   SMCKTQQQAILGVFIYMVPVVTLSGYASPVENMPEWLQDLTWFNPLKFTLIAVIGIFLK
FT                   GMSALEVFITTWPLLLVGAVTLFIAGWFFKQRME"
FT   gene            808555..809994
FT                   /locus_tag="lpa_01040"
FT   CDS_pept        808555..809994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01040"
FT                   /product="multidrug efflux MFS outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01040"
FT                   /db_xref="EnsemblGenomes-Tr:ADG23999"
FT                   /protein_id="ADG23999.1"
FT                   /translation="MDRKLVLLFSISCLFGCTVGPDYQRPDIKIQEKWPTSKVEKKISS
FT                   SAPVHLTWWKAFHDPLLDRYINEAATNNLDIKAAEARIRQARAMQQISLANFYPQINGS
FT                   ASANSLQISKGTLEGIFANSPTYTLIDRNQWIYNLGFDAQWELDLFGKTRRKVEASKAS
FT                   LEEAYESRRTILLSTIAEIARSYIELRGAQQLYGIAQKNVELQRKTLALVRQRYKAGVS
FT                   SEVDVSLAEGQLKNTESVLPNYITQIQVNAYQIAVMLGKDPQTILKDIAKIQSLPKPPQ
FT                   KVPMGLRSDILRQRPDIRATERQLASAVAEIGVAVADFFPQFNLSVSNLAFQSTSVDTL
FT                   FQSSSGFWLMGPQVSLPIFHGGQIRANVESKKAVAQQAAIQYKKIILQALQEAQSALVR
FT                   YSQSLDTNHSLRAAIIANKRAVQFAKKRFQYGEDDYLSLLQSEAALLNAETQEVNSEVS
FT                   SLTALISLYKALGGGWENFEA"
FT   gene            complement(810326..812107)
FT                   /gene="mltE"
FT                   /locus_tag="lpa_01041"
FT   CDS_pept        complement(810326..812107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltE"
FT                   /locus_tag="lpa_01041"
FT                   /product="Soluble lytic murein transglycosylase"
FT                   /note="COG0741, MltE, Soluble lytic murein transglycosylase
FT                   and related regulatory proteins (some contain LysM/invasin
FT                   domains) [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01041"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24000"
FT                   /protein_id="ADG24000.1"
FT                   /translation="MKKLLIFLCGLLCSFNLFALSGQAYMDRFNRYLAWYEQLPINPSP
FT                   EFLEFVKENTPLANKLRDKWLYELARIKDWEDYNKYYQPTNDINLRCFAQIAKFNLGLY
FT                   KEAIAGSIPIWLSGESRPQACNTLFALLLKQDNFDQKFITQRIALALDKRNVLLARYLL
FT                   KQYKTPHDTEIKNLTSVYENPSNISKLNPGKLNDYFYLYGLKRLVSINMDKAVKLWQEK
FT                   KTNIMLNERQKQDFLAHLALYKAMRNHADAQEWFAKIKPEYYTDVLVDWQIRFALKNKN
FT                   WKQVEKLINNSPNKEMPCWQYWLARSLEEQGKKAEAIKIYEPLAKNRHYYGFLASKRLK
FT                   KRPSFDNEKPTTNTEILKPYQPVIEQVKNFYNSKQLLQASRLLNDFISELPKEEASALV
FT                   YWIATELKWHGKSVYLSNNDTLNNQLALRFPLAYKDTIKVYASKYAIPPELVYAIIRQE
FT                   SGFREDVTSSAGAKGLMQVMPQTASAVSKTSKIPYSDHKQLFLSQKNINIGIAYLQHLT
FT                   KRFSNHPVLVAAAYNAGPRQVVYWLKNHPPKEIDIWIETLPWQETRNYLKNVMAFYIVY
FT                   QYRLNQQPDMNRFLTPL"
FT   gene            complement(812149..812802)
FT                   /gene="rpe"
FT                   /locus_tag="lpa_01042"
FT   CDS_pept        complement(812149..812802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="lpa_01042"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="COG0036, Rpe, Pentose-5-phosphate-3-epimerase
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01042"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24001"
FT                   /protein_id="ADG24001.1"
FT                   /translation="MTFQILPSLLSADMTRLGEEVDAVMKAGADFIHFDVMDNHYVPNL
FT                   TFGPAFCDALIKKFPNLPIDVHLMTTPVDTLIEAFAKAGAKRISIHPDATIHLDRSLQL
FT                   INNLGCEAGLVLNPATSIDTLTWCAHNLKFVLVMTVNPGFGGQKLIPEVIPKLSKIRQQ
FT                   HPNLDLCVDGGVTPQNIASLAHAGANQFVAGSAIFNSSNYSETIKHMREQLASI"
FT   gene            complement(813018..813482)
FT                   /locus_tag="lpa_01044"
FT   CDS_pept        complement(813018..813482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01044"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24002"
FT                   /protein_id="ADG24002.1"
FT                   /translation="MKALIAKTYLLADKIFDFLAPIFILLTRLYLAQVFFLSGLTKISN
FT                   WQATLSLFQNEYMVPVMSPTLAAYLGTACELGFPVLITLGLGSRLVLFGLFLFNLFAVF
FT                   SYQFLWTPDGAVGLTDHMQWGIMILMLLCTGPGKLSIDYLIRRFYLKLDN"
FT   gene            complement(813479..814258)
FT                   /locus_tag="lpa_01045"
FT   CDS_pept        complement(813479..814258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01045"
FT                   /product="putative protein conserved in bacteria"
FT                   /note="COG4765, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01045"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24003"
FT                   /protein_id="ADG24003.1"
FT                   /translation="MRNTLLETIQKEWIAQFKEEALSSPLKNRLARSNFDGISVYMESH
FT                   HATLFNHLKSTFPLCMRLVGENFWYALLHRYINNCESTQYDINQYGDSLPQFIANFEPA
FT                   KELPYLQQLCAIEWHWHTLKLLSPVNPFDFEAFSSIDEISFQSLCFHLTPNLKILCSEY
FT                   PIYQIWAMNYFQQDKQIQISGCPEKVVIYQHNDLPCIMLISEEEYIFLELLSSGNQTPW
FT                   QKVVTELSKWISEEKIGDTLTKALRYQWINHFSLEAI"
FT   gene            complement(814251..815120)
FT                   /locus_tag="lpa_01046"
FT   CDS_pept        complement(814251..815120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01046"
FT                   /product="putative protein conserved in bacteria"
FT                   /note="COG3220, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01046"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24004"
FT                   /protein_id="ADG24004.1"
FT                   /translation="MYSNHSTDQAAPYSGCSGIGLRLEHIDDILKEQPTVDYFEVLADN
FT                   YMKQSGAQFKQLLKIAEFYPMSLHSVGLSIATSSEPDYQYLQQIKNLAHCLNSKLISDH
FT                   LCWTHANQFFTHELIPFPYTEETLSFIIEKTNCIQEYLNQPIMYENVSRYVTYRQNTLS
FT                   EAEFLNELSTATGCGILLDINNLYVNWYNHGDDPDKYLHSINTKNVWQMHLGGFSKQEG
FT                   YLLDSHSDKVYQDVWQLYEKAQNLFINTPTVIEWDNDLPDFSLLYDEMCKAKAIIKRVA
FT                   ERSMNHYA"
FT   gene            complement(815126..815380)
FT                   /locus_tag="lpa_01048"
FT   CDS_pept        complement(815126..815380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01048"
FT                   /product="Predicted integral membrane protein"
FT                   /note="COG5572, Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01048"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24005"
FT                   /protein_id="ADG24005.1"
FT                   /translation="MNNISKITMAAVMAAGLSMATIPANADTPNDMEKCQGVAKAGKND
FT                   CGTAQHACAGQSKTDGSTTDWIYLPKGTCEKLVNGTVKS"
FT   gene            815718..816743
FT                   /locus_tag="lpa_01050"
FT   CDS_pept        815718..816743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01050"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24006"
FT                   /protein_id="ADG24006.1"
FT                   /translation="MAKDTKIINLALQGGGAHGALAWGIIDRLLEDGRIHFDAISATSA
FT                   GAMNAAVLAYGFATGGKEGAREALHQFWKMVSDAGQIYNPLKKTPLEELLGIGIENSMS
FT                   FFMFDLMTKILSPYQFNPLNFNPLKEILEQIVDFEKIKSCKSIKIFISATNVRTGKINV
FT                   FDNKKISADAVMASACLPFMFQAVNIGEDYFWDGGYMGNPAIFPLIYNSECRDILILHI
FT                   NPIYREHVPDTAAEILNRVNEISFNSSLMREMRAIAFVTKLIDSGWIKDEYKNNLRKLY
FT                   LHAIRADVSMESSSVASKLNPEWSFISHLYEEGRKKGEEWLKSNFKHLGKMTSIDLDEY
FT                   L"
FT   gene            816859..819075
FT                   /gene="ndh"
FT                   /locus_tag="lpa_01051"
FT   CDS_pept        816859..819075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndh"
FT                   /locus_tag="lpa_01051"
FT                   /product="NADH dehydrogenase, FAD-containing subunit"
FT                   /EC_number="1.6.99.3"
FT                   /note="COG1252, Ndh, NADH dehydrogenase, FAD-containing
FT                   subunit [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01051"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24007"
FT                   /protein_id="ADG24007.1"
FT                   /translation="MQQEDRAPITQKNRSFSRNTARCFDTFMDTVDFLGRIGWPVIDLA
FT                   FRIWIAQQLLVSAILLTNHWDTAVYLAKNEYPVPWLSPEWEALLGILAQFVGGISLLLG
FT                   LFTRCGAAVIIGFAVMTQVYYQPIDLNLLWIALMLGYVLRGPGPLSLDNLFEHGFSRSP
FT                   LPFAMLIVTFVDRTREFFSSLYLFSLRMWLMISLLLINQHIQLISSDALPLLMPWLPLN
FT                   SASIVFNNVSLFMAIFLGLGLATRVVAIFGLIVVLLSFTPGVTGFYLYWMVVMAILFIS
FT                   GPGILSLDHLIFHALKKHYPQLSGKPAFSLDGLPRVVIIGAGFGGIACAKALRHMPVKI
FT                   TLIDRHNYHLFQPFLYQIATGSLSPADIAISIRSIFLEQFNAEILLGNVTDINKEERLV
FT                   IADNFTIPYDYLVIATGATHSYFGKDSWAPYAPGLKTINDGTSVRSRIIKSFELAEIAE
FT                   SDEERKQFLNFVIVGAGPTGVELAGAIAELARFGIVKEFRHFDPASANIILVQAAPRIL
FT                   PTFSEQISQKAQRYLESMGVKVLVNSMVEQIDSDGVIINKERIYSKSVFWAAGVAASPA
FT                   SKWLQLEADPAGRVKVNDDLTVAGYSNIFAIGDTAASNAWNGKPVPGIAPAAKQGGAYV
FT                   AKVISKRIYNNNSRYKPFKYIHYGSLATVGRKAAVAEFDRFKISGELAWWFWGGVHVFF
FT                   LVGSRNRLSVILNWLWSYYTFRANNLLITDDSLNKKNKSGTSEV"
FT   gene            819117..819881
FT                   /gene="adc"
FT                   /locus_tag="lpa_01052"
FT   CDS_pept        819117..819881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adc"
FT                   /locus_tag="lpa_01052"
FT                   /product="acetoacetate decarboxylase"
FT                   /EC_number="4.1.1.4"
FT                   /note="COG4689, Adc, Acetoacetate decarboxylase [Secondary
FT                   metabolites biosynthesis, transport, and catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01052"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24008"
FT                   /protein_id="ADG24008.1"
FT                   /translation="MDKYLSANSLEGVIDNEFSMPAPRWLNTYPAGPYRFINREFFIIA
FT                   YETDPDLLQAILPPDMELLEPVVKFEFIRMPDSTGFGDYTESGQVVPVRYKGEEGGFTI
FT                   SMFLDCHAPIAGGREIWGFPKKLAKPKLFVEEDTLIGILKYGSIDIAIATMGYKHRPLD
FT                   TEKVLESVKKPVFLLKNIPNVDGTPLVNQLTKTYLTDITVKGAWTGPGSLELHPHALAP
FT                   ISNLYIKKIVSVSHFITDLTLPYGEVVADYLA"
FT   gene            819919..820191
FT                   /locus_tag="lpa_01053"
FT   CDS_pept        819919..820191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01053"
FT                   /product="signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01053"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24009"
FT                   /protein_id="ADG24009.1"
FT                   /translation="MNKRPIQNTAVIAAALGAALASIYTYTDWLSSDEITVKRERCYNV
FT                   ARAGKNDCATSQHSCAAQSTADRDPEAFIMLPKGLCERIVGGRSG"
FT   gene            820184..821497
FT                   /gene="cyaA"
FT                   /locus_tag="lpa_01054"
FT   CDS_pept        820184..821497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaA"
FT                   /locus_tag="lpa_01054"
FT                   /product="adenylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /note="COG2114, CyaA, Adenylate cyclase, family 3 (some
FT                   proteins contain HAMP domain) [Signal transduction
FT                   mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01054"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24010"
FT                   /protein_id="ADG24010.1"
FT                   /translation="MDSYSKLPLRIRKEIEAQQYTGELLVAGVQLGVIVLLSIINIFSS
FT                   AGYSPGAPVQSSSLGLWLFAILILLRLWFVYTNQLNPIFLGFFIVAEMALLLFIIWTYY
FT                   LQFETTPTINLKNPHINYVYVLIALRALRFEPLWVILSGLTAALGWGIIAWQTLSSSGM
FT                   NVITWDYVTFASTRSVYLGAVFDVILSVLLVTTIIALVLTRAKHTLFQAVEQTSAAKDL
FT                   SRFFDTSVVEKITTSEKSLQAGYGELRQAAIMFIDMRGFTKASVKLSPSELIGLLAEYQ
FT                   RLLVPIIQKNNGSIDKFMGDGILASFGAVTPSNTYAADALRTVDEIVASVDVWSENRRK
FT                   KEQIVVGVGIGLASGEVVVGVIGYENRLEYTVIGEAANLAAKLEKHNKEEKTQALTTRD
FT                   TFLEAVKQGYEDKITKKELNARNVGGVGEPLDLVVLAK"
FT   gene            complement(821517..822332)
FT                   /locus_tag="lpa_01055"
FT   CDS_pept        complement(821517..822332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01055"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24011"
FT                   /protein_id="ADG24011.1"
FT                   /translation="MPTIKQMQEFFLNTVLNQQDIAIFEYFCPDEITNEFRFDIYRNTI
FT                   FQNLRHSLEMTFPAIWKLVGKECADGLALHFIQDKNNLPTTHCLDDWGEKFPLFLKNNP
FT                   TVSHLLYLKDIAEIEWLKHLSYCSRDCLVFDPQKLQKHLNDRVEKLILLFNPSVFLYSS
FT                   SYYLKNIFDLIENPTETGSIDFQQIPSYAVISRQKNQTVIHWITHDLFHFLCHIKAGAS
FT                   LGFAYENTLENNPDFDLLTALQFLLRNELLEDSFIHSNYHLTHANNCPE"
FT   gene            complement(822319..823152)
FT                   /locus_tag="lpa_01056"
FT   CDS_pept        complement(822319..823152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01056"
FT                   /product="putative protein conserved in bacteria"
FT                   /note="COG3220, Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01056"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24012"
FT                   /protein_id="ADG24012.1"
FT                   /translation="MHKTINGAMTGIGLRAPHYAQILEKKPDIDWLEVHTENFLVEGGP
FT                   LLELLDSISQHYPLSFHGVGLSLGSAEGVCIAHLNRIKTLIDHFQPALISDHLSWSTIG
FT                   NTYLPDLLPIPYNEESLTIISNNIDRVQNYLKRTLLIENPSSYLEYQTSSYSEPDFLAE
FT                   IIKRTEARLLLDINNIYVSCSNNKRDPYQYIQRIPHEAVQEIHLAGHSIAYQDNTNFLL
FT                   IDTHNNYVCPEVWDLYRYAIHYTGLVPTLLEWDTEIPSLDTLLNEARKSACYAYN"
FT   gene            823450..823716
FT                   /locus_tag="lpa_01058"
FT   CDS_pept        823450..823716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01058"
FT                   /product="putative conserved protein"
FT                   /note="COG5397, Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01058"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24013"
FT                   /protein_id="ADG24013.1"
FT                   /translation="MSQNWPTRDKDLQTARVIMEEYANERDSDSLGLFEIVVDQNEKRM
FT                   NFRLSGWVVILAKHFTSLYGVSQGDYVTRQVISRCITQGQTLH"
FT   gene            complement(823960..824712)
FT                   /locus_tag="lpa_01060"
FT   CDS_pept        complement(823960..824712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01060"
FT                   /product="polar amino acid transport system
FT                   substrate-binding protein"
FT                   /note="COG0834, HisJ, ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain [Amino
FT                   acid transport and metabolism / Signal transduction
FT                   mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01060"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24014"
FT                   /protein_id="ADG24014.1"
FT                   /translation="MKFIQGLLLSFFFLVSPLHAQNEPIPLIVGVGGFYPPFIMQGTNN
FT                   ELFGYDIATMTELCKIMKRQCNFRVMRFRQLIPALINKQIDAAISAMSITSERSNLVNF
FT                   SMPYLLSYSRFLTNEVHNTHQPFNLMLLKGKRIGVEQNTVFSQEIRRMGIIDPVIVEFD
FT                   RTEEMLEALSANKIDFVLMDNPAALYWSANSSGRLLLIGSPMLIGYGLGIAVNRENSVL
FT                   LKSLNDALVEYQRSDKYKENYNKYMMNF"
FT   gene            824850..827591
FT                   /gene="glnE"
FT                   /locus_tag="lpa_01062"
FT   CDS_pept        824850..827591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="lpa_01062"
FT                   /product="glutamate-ammonia-ligase adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="COG1391, GlnE, Glutamine synthetase
FT                   adenylyltransferase [Posttranslational modification,
FT                   protein turnover, chaperones / Signal transduction
FT                   mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01062"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24015"
FT                   /protein_id="ADG24015.1"
FT                   /translation="MSPQSDIETLISTKSWLIEKYVAPLHHPLRESAEKLILVSDYACR
FT                   QIRLLVSLLESDSCCSLWSRESYFYAIQQISLELSQAQYMQELRRFRHTHFLRLLLLEI
FT                   ADLASTQEVMQSWSDLADSIILHTLKYIGFTLLSRYGVPRNSEGKEIQLYALAMGKLGG
FT                   RELNYSSDIDLIFAFNEVGSTDGEEQITNQHYFSKMVQTFVHLLQSVTPDGFVFRVDLR
FT                   LRPNGDSGPLVSSFAAMETYYQEQGRDWERYAMVKARVIAESLDEPFPWFERLIIPFVY
FT                   RRYVDFGVIESLRGMKAMIEREVQLNPLLNDIKRGRGGIREIEFIIQNIQLIRGGRLPQ
FT                   LQVQNAMLALAVIKKEKLLPRCDALKQAYLFLRKLENILQSLNDQQTHSLPEDQLKKVQ
FT                   IVYAMGFTDWEQFFNKLQQYQRIVSNFFHSILGKVDDYEDEKRLLNNQLFSLWQGHVES
FT                   NMAVNLLISLGYENAQHCYQMLHAFRHGPRCRRLSQGARIRLDRFMVLLLTELTYCPKT
FT                   DEVLLQVIHLLENIVGRSAYLALLTENPHALRELLFWFVNSPFISSLFVSQPFLLEILL
FT                   EQEKDWHPDSLSQMEQTIVEKLEHTNDVEVHEEILRQFKLTNWMVAARAELYGLCDAVR
FT                   IGKFLSDVAQVIVSQVLIIASKQLCGRHPEMAQIQSRFAIIAYGKLGSREMSYASDLDL
FT                   VFLHSAKPSEEALVTRLTQKILHMLTTRTQMGVLYHVDTRLRPSGAAGLLVSHVDAFVE
FT                   YQKSQAWTWEHQALLKARILSGNSKIKNQFSQLKKSVLLLERDSKLLQRDVLTMRSKID
FT                   QFQESDEVKLARGGLLDLEFLVQFLILNLRDPKFSSYTNTLSQLKHLFLSNVLTKSQFT
FT                   TLKKAYQYFHYLMHQKIVQPDVINDDEMQNAVSSVCKDLYRY"
FT   gene            827859..829070
FT                   /locus_tag="lpa_01063"
FT   CDS_pept        827859..829070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01063"
FT                   /product="dipeptidyl aminopeptidase/acylaminoacyl
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01063"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24016"
FT                   /protein_id="ADG24016.1"
FT                   /translation="MYANYYDMYQKTGIFSDEFFGQFLRTLGKCYVRCADVGECYATLS
FT                   KITDKDGESWYKAWYEMANTLKTKANISWEANHFITAAYAYLRAAEYYRASEFFLRANP
FT                   DDPRVIPCFDQLQFCFERAMHRLHPGSQKIWIPYDDQRLSGYLFFSDQSPKATLIVPGG
FT                   YDSTFEENYALVPAALLHGYHILIFDGPGQGHVLRRQKLYMRADFEHVVSQVVDWLDEQ
FT                   SELGTSSYVLIGRSFGGYLAPRAACSEKRLAALICDPGQMDIAGSLNKMLPPNLMMLLK
FT                   EGKADELNACFYQLFSENPMKEFYFKSRMYTHGLATPFDYLQALSAYTFVDRVQEITCP
FT                   TLVCDNPSDRISNRGNTLYEALRCEKTYVMFDAKLGAGMHCEADANGQFQQVIFDWLDE
FT                   RFTQ"
FT   gene            829138..829710
FT                   /locus_tag="lpa_01064"
FT   CDS_pept        829138..829710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01064"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01064"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24017"
FT                   /protein_id="ADG24017.1"
FT                   /translation="MRIGIAILVVLVCCTLQGCKKEKSPYQTTSYVESQLFIVSSPDGG
FT                   YIKEWYADEGQLLHKEDKIVTLDGVNSIKAPADSVMTERYYLKDEYVPPNFPIASLSLP
FT                   SQMKILFYVPESHLEKIKLGKKIRILLNEKKYSGKISFISNQAEYTPDAIFSEKNRYKL
FT                   VYKVKADLSQGLRDLLKIGQPVDVNYE"
FT   gene            829703..830629
FT                   /gene="ccmA"
FT                   /locus_tag="lpa_01065"
FT   CDS_pept        829703..830629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /locus_tag="lpa_01065"
FT                   /product="ABC-2 type transport system ATP-binding protein"
FT                   /note="COG1131, CcmA, ABC-type multidrug transport system,
FT                   ATPase component [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01065"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24018"
FT                   /protein_id="ADG24018.1"
FT                   /translation="MSKWSSKQIIIDVSGLAKSFNGINAVVNLNLQIEEGTIFGFLGPN
FT                   GSGKTTSLRLLSGLIIPDKGQGRCLNLDLMTQTKLIQAQIGYMPQNFCLYQNLTVYENL
FT                   DFIARIYQLKNRKERLKEIIELLALSDNQKRITATLSGGWKQRVALAAALLHKPRILLL
FT                   DEPTSGIDPQSRLLIWAHIQSIVSKGVTVLLSTQHMDEAERCHQLVYMSAGEIIARGSV
FT                   IEIIQSTGLHSWVVKGESFSRLKDILVNNPAIQMIEKGNEMRISSIVDDIHQVLDPFVL
FT                   NNYEIKKTDTTLEDAFIYKIMKEGNPK"
FT   gene            830644..831762
FT                   /locus_tag="lpa_01066"
FT   CDS_pept        830644..831762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01066"
FT                   /product="ABC-2 type transport system permease protein"
FT                   /note="COG0842, ABC-type multidrug transport system,
FT                   permease component [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01066"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24019"
FT                   /protein_id="ADG24019.1"
FT                   /translation="MQRLWAIIRKEFLLMKRDPATIVIMAILPLILVCIAGYAINTYPQ
FT                   KVPTVLINLDNTDVTRELVREIQNTGYFSFVASTNDSESAHHLLKTGKAILVLTIPVNF
FT                   TKAIRRNQNPALLLEDGSIDAIASGRAIIALAGLKSSFIEKMGQKGINIPLQRPDFQII
FT                   NHRLYDPDRVTQFYVVPGMIGLVLMLTMLLITVVVAFRDVQGGTIEYLLASPTRPSEVL
FT                   LGEIFSYILIGYLQLSLGLILSYYLFHVPFIGAPLLLYLCTLPYIVAELSLGLTIATFC
FT                   TSQFEAVQVINVFIAFSILLTGFTFPIFGMPEWAQYLGLFLPLTHFFKIMFGIMLKGNN
FT                   FGEIWANLWPLLAYCLTMISLATWRFKRHFVR"
FT   gene            complement(831832..833151)
FT                   /locus_tag="lpa_01067"
FT   CDS_pept        complement(831832..833151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01067"
FT                   /product="Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01067"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24020"
FT                   /protein_id="ADG24020.1"
FT                   /translation="MNHKVGFVSLGCPKALVDSERIITQLKAQGYELVPTYEDAGVVVI
FT                   NTCGFIDSAVQESLDTIKEAMAENGRVIVTGCLGAKADVIKNACPDVLHISGAHAYEEV
FT                   VNAVHQHLPPPADPFTQLIPPQGIKLTPRHYAYLKISEGCNQKCTFCIIPTMRGKLQSY
FT                   PMAQILTEAKKLKQAGVKELLVISQDTSAYGVDTRYQQVEWQGKTVNTRFYDLCEQLGE
FT                   LGIWVRLHYVYPYPHVDDIVPLMRDGLILPYLDIPLQHANSRILKAMKRPASSENTLLR
FT                   IASWREICPDITLRSTFIVGFPGETEEEFSELLAFLKEAQLDRVGCFKYSPVEGAKAND
FT                   LDNPVSEDIKEERYHRFMQVQAEISRNKLKNKIGSTQTVLIDEITEDQIIARSKSDAPE
FT                   IDGLVYLPKISGITVGSFAEAMITDSDDYDLYGDLEYSLA"
FT   gene            complement(833241..835001)
FT                   /locus_tag="lpa_01069"
FT   CDS_pept        complement(833241..835001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01069"
FT                   /product="thiol-disulfide interchange protein DsbD"
FT                   /EC_number="1.8.1.8"
FT                   /note="COG4232, Thiol-disulfide interchange protein
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones / Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01069"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24021"
FT                   /protein_id="ADG24021.1"
FT                   /translation="MKKWLLFSLLFLTSLCVHAEPLPASEVFKVSVKKIDPNTFAIQWN
FT                   ILPKYFLYSDRIQLNSDNDDIAQLGTLRFPTPLTKTDKQGRTFKVYRNQLTLPVGVLGI
FT                   TPGETIVNLRFQGCADDGFCYPPEVKQIKLAIDYKLALSQVDLETFHAPEAKPLEKPEQ
FT                   DIADIFANHNWIMILLIFYGFGLLLSFTPCILPMVPVLSGIIVGHGRTATTKKAFFLSL
FT                   SYVLSMSVTYAIVGAVVALLGANLQISMQSPWAISLFSLIFVLLALSMFGFYEFKLPDA
FT                   WQSKIVGSSREQRGGHYLGAAIMGCLSTLILSPCVTAPLIGVLTYIAQTGNVLLGSVTL
FT                   FTLSLGMGTPLLLIGTSAGKWLPETGSWMNAVKAFFGILLLAVAIYLMARILPAGLVMG
FT                   LWACLLIFSGIYSGALTKSNTNQEKLCQGIGIILLTYGLLILIGASMGSSNPLQPLANL
FT                   QAAPTVSNAFESAKAQSVKSVELAIKQAFGKPVMLDFYADWCASCKVMENTTFKDPRVQ
FT                   KALSHFIVIKVDVTANNKNDRALMQHFRVVAPPTFIFFNADGVQLNNLKRVGELNADEF
FT                   MQTIKSIDEN"
FT   gene            835187..835477
FT                   /gene="groS"
FT                   /locus_tag="lpa_01070"
FT   CDS_pept        835187..835477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groS"
FT                   /locus_tag="lpa_01070"
FT                   /product="Co-chaperonin GroES (HSP10)"
FT                   /note="COG0234, GroS, Co-chaperonin GroES (HSP10)
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01070"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24022"
FT                   /protein_id="ADG24022.1"
FT                   /translation="MKIRPLHDRVVVRRMEEERTTAGGIVIPDSATEKPMRGEIIAVGA
FT                   GKVLENGDVRALAVKVGDVVLFGKYSGTEVKVDGKELVVMREDDIMGVIEK"
FT   gene            835505..837151
FT                   /locus_tag="lpa_01071"
FT   CDS_pept        835505..837151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01071"
FT                   /product="chaperonin GroEL"
FT                   /note="COG0459, GroL, Chaperonin GroEL (HSP60 family)
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01071"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24023"
FT                   /protein_id="ADG24023.1"
FT                   /translation="MAKELRFGDDARLQMLAGVNALADAVQVTMGPRGRNVVLEKSYGA
FT                   PTVTKDGVSVAKEIEFEHRFMNMGAQMVKEVASKTSDTAGDGTTTATVLARSILVEGHK
FT                   AVAAGMNPMDLKRGIDKAVLAVTKKLQAMSKPCKDSKAIAQVGTISANSDEAIGAIIAE
FT                   AMEKVGKEGVITVEDGNGLENELSVVEGMQFDRGYISPYFINNQQNMSCELEHPFILLV
FT                   DKKVSSIREMLSVLEGVAKSGRPLLIIAEDVEGEALATLVVNNMRGIVKVCAVKAPGFG
FT                   DRRKAMLQDIAILTKGQVISEEIGKSLEGATLEDLGSAKRIVVTKENTTIIDGEGKATE
FT                   INARIAQIRAQMEETTSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDAL
FT                   HATRAAVEEGIVAGGGVALIRAQKALDSLKGDNDDQNMGINILRRAIESPMRQIVTNAG
FT                   YEASVVVNKVAEHKDNYGFNAATGEYGDMVEMGILDPTKVTRMALQNAASVASLMLTTE
FT                   CMVADLPKKEEGVGAGDMGGMGGMGGMGGMM"
FT   gene            837274..837714
FT                   /gene="dps"
FT                   /locus_tag="lpa_01072"
FT   CDS_pept        837274..837714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dps"
FT                   /locus_tag="lpa_01072"
FT                   /product="starvation-inducible DNA-binding protein"
FT                   /note="COG0783, Dps, DNA-binding ferritin-like protein
FT                   (oxidative damage protectant) [Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01072"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24024"
FT                   /protein_id="ADG24024.1"
FT                   /translation="MSKVIKKLEVALADTYALYLKTQNYHWHVTGPQFKSLHELFEMQY
FT                   KELAEAVDQIAERIRIMGHKAPATFAEFNQLKTIKDGDSGLSANEMVSELAKDNMMIVK
FT                   DLNQAIKIAQENEDEGTVTILSDRVAAHEKAHWMLSASKEKK"
FT   gene            837971..840088
FT                   /locus_tag="lpa_01073"
FT   CDS_pept        837971..840088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01073"
FT                   /product="spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01073"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24025"
FT                   /protein_id="ADG24025.1"
FT                   /translation="MFRFLFPVSLFISSILLFSIQPMVAKAILPIYGGTPGVWTVCVLF
FT                   FQFILLIAYGYVWLLSQIKKPAVWRLIHMVLVVLSFTAFPLLFHPAARDGQPEWVILHN
FT                   LLIQLGLPLLVIGASAPLLQFAYSQTKSKGASDPYYLYISSNLGSLGALLIYPWVIERF
FT                   IGLTHQFYFWNFGFAIYSLLLVTVLFFTKYQPLMLTEKKEVDFLPWREIAYWIFLSFVP
FT                   CSLMLGVTLYITTDVAATPLFWVLPLALYLLSFVFTFTATPFISQKWISRNCLFFLVFT
FT                   ILGFIFGVSQIRVWQLVLFNLLSFFILALLCHGQLFARRPKPHKLTLFYFCLSIGGVLA
FT                   GIFNGVLAPNWFNYVYEYPLAILLSLFVLPLPKTNRGWWVPLVVLGLLSLHYFIPTVPW
FT                   FKSTTTFHILAILALGIIVIWHRNKINLVLSMLILFVFLYFPPLQDKQILLKERNFYGV
FT                   KQVFKKDDVHALISQSTLHGMQVMNGEKASYGRSSYYGAIAPIVDILKKEFHPLSATIM
FT                   GLGAGTLLCQFRATDSIKVIEIDQQVIDLAKNNKLFTYIRDCSPSAEIIKQDGRLALVN
FT                   MPDASQDLLILDAFNSDAIPVHLMTLEAFTLYKKKIVEDGVILVNLSNRHLQMLPVINA
FT                   IGRALNMITLFLAHKGDKKLGQFNSEWAMLTSNQSLAFQVMKGTNWKFVADDDQFLWTD
FT                   DYSNIIPLLKW"
FT   gene            complement(840344..842224)
FT                   /gene="parE"
FT                   /locus_tag="lpa_01075"
FT   CDS_pept        complement(840344..842224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="lpa_01075"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01075"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24026"
FT                   /protein_id="ADG24026.1"
FT                   /translation="MSENYTAEAIEVLSGLEPVQRRPGMYTDTTRPNHLAQEVIDNSVD
FT                   EVLAGFASRIIVTLHEDGSIEVEDDGRGMPVDLHPQLGLSGVEVIMTRLHAGGKFSDKN
FT                   YSFSGGLHGVGVSVVNALSERLDVTIKRNGIIYQMTFANGDKLCELNETGVTKKRETGT
FT                   VIRFWPNGKYFDTTKISVKHLTHVLRAKAVLCSGLSMTFINKITNEEMNWCYEQGLTDY
FT                   LQQTLPEDYLPEEPFAGAFKSDEATVDWALAWSDSANGNLNESYVNLIPTIQGGTHVNG
FT                   LRSGLFEAMSEFCELRNLLPRGVKLTADDLWESCQYVLSIKMKEPQFAGQTKERLSSRQ
FT                   TSGLVSNVIKDAFAIWLNQHRNQGEAIAALAIERAQKRLKQAKQVARKRVSQGPALPGK
FT                   LADCLQTDLSQAELFLVEGDSAGGSAKQARNKDYQAILPLRGKILNSWEVDSSQVLASQ
FT                   EIHDISVAIGVDPGSSDLEGLRYGKICILADADSDGAHIATLICALFLRHFKPLVKAGH
FT                   VFVAMPPLYRIDAGKLIHYALDDEEKNRIVQHLSQTTKSKVNVQRFKGLGEMNPIQLRE
FT                   TTMDPNTRRLVQLTLDDEEQTEAIMDMMLNKKRAADRKLWLETKGNLAEI"
FT   gene            842358..844169
FT                   /locus_tag="lpa_01077"
FT   CDS_pept        842358..844169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01077"
FT                   /product="ABC type dipeptide/oligopeptide/nickel transport,
FT                   ATPase component"
FT                   /note="COG1123, ATPase components of various ABC-type
FT                   transport systems, contain duplicated ATPase [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01077"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24027"
FT                   /protein_id="ADG24027.1"
FT                   /translation="MQNTAKINQLSVAFKSPDKTVLALDKLSFSLNPGETLVLLGESGC
FT                   GKSLTSLAMMRLLPRAGVYGIDSQINIHGEDILNLPEKMMRELRGRRLAMVFQEPMTAL
FT                   NPVLTIGEQIAEVLKRHRSLTKEQIKERVILLLNEVEMPQPQMRIYQYPHQLSGGQKQR
FT                   VVIAMALACEPDILIADEPTTALDVTIQAQILALLKKIQKKHQMSLLLITHDLGVAKTM
FT                   ADRICVMYAGQVVEQASVKDFFSKVSHPYVQQLLTSLPSFAKRNEKLSIIAGTVPSLES
FT                   MPSGCRFHTRCIYAFERCHHEEPQLQEVEQRILRCHLYPDIKELPLLDKNKISWVPSVE
FT                   KEEIVFTVDDLSVHFIHKKGFLSRKKTIFKAVDGLSFTLSRGKTLALVGESGCGKTTAS
FT                   RALLRLLPAAGGKIRYKDSDVLSMTGSALRRYRKKVQIIFQDPFSSMNPRMTVGEIIAE
FT                   GMHAQGMKPSYIRKQQKSLIEQVNLPITSLHRYPHQFSGGQRQRICIARALATEPDILI
FT                   CDEPTSALDVSVQAQILNLLKELQQQRGISYLFITHNMGVVSYIADDVLVMKDGLAVEY
FT                   GACEKVLRQPEHPYTRQLLNAVLDIES"
FT   gene            844275..845060
FT                   /locus_tag="lpa_01078"
FT   CDS_pept        844275..845060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01078"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24028"
FT                   /protein_id="ADG24028.1"
FT                   /translation="MNYRVICCTPLLLTAMNLYAGSMGPVVEQTGFGGFYAGLGTGFTT
FT                   IFSTDEYSIVRPGFGVIRTGIHKVTNSAVLFSGQAGYGVMLNQKTYLGGKGSIYYTPME
FT                   NNNQISFASSRGPNELASGHDNFVRSLKPIYNIDAVLGYEIFPNFLPFVEAGVSFANVK
FT                   HRFVLEGAITNLVTGTVSNYTGGATSDNYNTGYNIGIGANYQVHKNWIFSGELVYHDLG
FT                   TNNLTIPNFTPDRRSATHYREEKNQAVSILASVSYLIPS"
FT   gene            845419..849702
FT                   /locus_tag="lpa_01080"
FT   CDS_pept        845419..849702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01080"
FT                   /product="LigA, interaptin"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01080"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24029"
FT                   /protein_id="ADG24029.1"
FT                   /translation="MKITRNQLNFKGVKEFGGCLTRNDEQIEFINKEIKFLKELIEFNI
FT                   LKGIDENKSQSLFDAVIEAVEKAGLDVEHELLIQFIQSTSEIIDSKSTDLPELVSLLTV
FT                   LIKSSNKYDKSELTRYCRLIDKLEKKDEKSLEQWIKILTILGRNVESVNGDLLFNVQSR
FT                   LEIHSVLLKDISSLFDYPPYPTLDAFSEKLREYSRELKLYIDSFDRDPAGSRAPKVNQE
FT                   GILIKSREQILNEQFDTSQIQEVIAKIESLVDGSGLSCKGQYELAQQVVFINAIGRDFP
FT                   LKIANETYTDLTQLGRNKLQELSDFFIMEMRRLDISKEDKLRTQLKLLAVMREQYFRST
FT                   GIFFDTTQMISLLLSLHHQEQNVLMGVSRNENLSAPPAAILAAMQWVLADGGTVDLCFA
FT                   NHGLIAQDYLEKGDRDFFTCLGIPSSVVEANSESGTYQVGGINYSTLSDLTSYRSHAVI
FT                   EDEELSMDRCGYPVSSYLILNHIDFSNLDDRTFSHFSSLYDYYKGKGRVVRITEIEETV
FT                   GEVVGQISRFDMDVGYRVFPARKNLQEELNTQSLAERRREEAVKQYFIQSVSNIQQAVL
FT                   NQLEEWQAFLHLIYPKSEWRQLDNELFAQRNELIDSLKKQWTKCLEDSDPKKMYPNPYV
FT                   RRDVFQRLQTRELEKAIQAYEKSVSSIWNLNRDQLKAKTENRFSSDSVNALRCKYLEEV
FT                   DLSEQIKWSKLSARLKKKEATQEKRRSHRHLESAVEVTGAMLSYHDGDLEPYRLAFVHS
FT                   QLKLWARDISKEINNSSLPASVKQGLIERANNADNFLALELLLIDYESRWLDKEKLSEK
FT                   FRMQPIISDMLRVYKQAGFEEHKELKILKETYLDSTATQIIHHLDKTLAWAKPENRGPW
FT                   YWIERSAVKKAANEILVLANGVKQARDSLSKQIAIKKLYRDLCKHQAQLEDVWIFSFDH
FT                   KNTRDLINQTLNTMDSLTVLGRDEGGLDINFIQECKEEAQYYLLGEKFSSVLEDFEKNN
FT                   SQILTAHSEWQEVKRQLQQKQNESRKVYTLNEMYYVLCKKINELSISYSLLREPLVQLR
FT                   GMIRTLWNSFQEKHQDIIDESKYFDFKARKIKEELEGIEGYSVFNVKVKKGYTGFNEYV
FT                   ELIIEGEGTSALFEGFMQYKSRLTELKEAYRQLEFSLKQNRLELLNLNRIHAKHLPFLK
FT                   DRIKGNPEVELFPEQCRSKVKEILTLKEWINGQIPENLSQFPENMQNHFLDRNTLKSMD
FT                   RNTMTMEQIDKIKDEQLKAELTELYNKMHKVGEEQSTSWFSTVTRRIVGLIPGMFRQEE
FT                   TEDDWRYQFNELQGRSDSILQSLLTKKIMTKYDALVNEMVLIQSNLAQQMDSGNKKIQF
FT                   LSDKILEEERKTNVIIKRFDNLNDFYDFEAKLKRFKTAPPIVPVNEVQIESKNRILSCG
FT                   EGAFSNLEEEFQTDSVMQPPMVFNI"
FT   gene            complement(850060..851769)
FT                   /gene="proS"
FT                   /locus_tag="lpa_01081"
FT   CDS_pept        complement(850060..851769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="lpa_01081"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="COG0442, ProS, Prolyl-tRNA synthetase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01081"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24030"
FT                   /protein_id="ADG24030.1"
FT                   /translation="MRASQWFLVTQKETPNDAEIASHQLMLRSGMIRKLGSGLYTWMPL
FT                   GLRVLRKVENIVREEMNKTHAMELLMPSVQPAELWQETGRWETFGGQLLTMKDSNQREY
FT                   CFGPTHEEVITDIMRNELQSYKQLPVNFYQIQTKFRDEIRPRFGVMRAREFIMKDAYSF
FT                   HLSIESLQETYKDMYQAYCRIFDRMGLKYRAVEADTGAIGGSASHEFQVLAESGEDLIF
FT                   YSDASDYAANIEQATSLKPPKANQACNETITLVDTPNQKTIDEVASFLGIASNQTIKTL
FT                   IVKGKEHPMVALVLRGDDELNEVKATKHPLVHSPLSFIDEELILKTLKTPLGSIGPIQL
FT                   NIPVIVDHHALAMPSFVCGANQADKHFINAAWERDAKYDDAYDLRNVKEGDPSPDGRGM
FT                   LHCCRGIEVGHVFQLGDKYAKAMNASVINEQGQLQTMIMGCYGLGITRVVAAAIEQHHD
FT                   EHGIIWPQALAPFQVNIIPLNGARSQTVKEQAESLYQQLKSHGIDVLLDDRNERAGVLF
FT                   ADNDLIGIPHRLVVSERNLEQGCIEYKSRTSSETQLINLDKVVNFIIELINK"
FT   gene            851943..854780
FT                   /gene="arp"
FT                   /locus_tag="lpa_01082"
FT   CDS_pept        851943..854780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arp"
FT                   /locus_tag="lpa_01082"
FT                   /product="Ankyrin repeat protein"
FT                   /note="COG0666, Arp, FOG- Ankyrin repeat [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01082"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24031"
FT                   /protein_id="ADG24031.1"
FT                   /translation="MPNLPGLYFLQAYPREEIWRLFVDGRFWSKENGWRGYESREPGCL
FT                   NAALESLCSIALQVEKSGEEFELSVDLIKRIHKKCGKKVEELQEKNPGELRTDEPVSFG
FT                   IPAGRASIKGIEEFLSLVFLTEGEAEFGPGKAGPFGPRFDKNYFKNLNPEQIPDLAKQI
FT                   YFDMCKYGHSNTNHFYLAVMKNVDVYLEKITQSYNQEIKTAETLDEKLKIIVKHIRMYE
FT                   VLHPFRDANGRTFVNNLLNILLMQQGLPPATFYEPNVFDLYSAEELVVVVKEAIFNTVE
FT                   IIEQSKRKTPITLYGYHSSLEEQTKFRDMLDSPAYEKIKHMDFSDLNPEKLHRKTQKCL
FT                   SSLNEQYPLHRGAIYLSDPGEIKLLLSNRNESQINQQIEQGAPPIYVGKTPAHLAVISG
FT                   NMAMIDELIAKKADLSLQDYDGKTALHYAAECGNMQIMGKILKVVLSQEDAIKVLNIKD
FT                   NHGKTAFHYAAEFGTPELISALTTTEVIQINEPDNSGSSAITLAYKNHKLKIFDELLNS
FT                   GADISDELLDAIWARKDKETLGKIIAKNEKILLNKEAFRIAISLGSVSLVKKFLRAGVD
FT                   IDIPLTKDKATPLMLSINSGNPKLVSYLLKKGANTRLTDTSGNSVLHYVFYSKAENREA
FT                   LANIITEKDKKLINQPNTNGNPPLYNAVVVNDLKMATILLEMGARVDFEDRLGNNILHS
FT                   AMRRCDLPIILDIVKKDSTLLHNRNSERRNPFHQALHEMHTFPSSKETEEIHFMNLSDL
FT                   LLKEGVDLNKKDIKGKTILDIALSKQYFHLCVKLMKAGAHTNISSPSKFLKNSDANSIL
FT                   ERPFKFKNDLKKELDDNPLIAMAQINDLYVQIKNNRIRTPTGYAPKEGVSFFKGKSSDA
FT                   KAHDEVLSVLKELYDSKLTEMLGNLPGEGLEEIKRSQKFFDGELKLLIKNQDISRKVDK
FT                   KSIQEAVGTSLKLKW"
FT   gene            complement(854787..856445)
FT                   /locus_tag="lpa_01084"
FT   CDS_pept        complement(854787..856445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01084"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24032"
FT                   /protein_id="ADG24032.1"
FT                   /translation="MRDKIITGKKVIFSQSVAKDQKKNLSSFLSERFYSVNQSHNHSII
FT                   IGSSLSHQENDIEHDTILDTSGMLVTTDTNGLVNGARVAITDGLGGGNGDQEEDDEIYR
FT                   VSHSSCENFLNCNQNMDTTLSLITQPKASDKKQTAPKTLQHTEASMAAFIYQNHPGKGY
FT                   IGEFANIGDGLIIILDKRFKIKHMVSACHIYRGFGTWTPPSLQALATTANKDALLVRQT
FT                   LKLAEGDIIISMTDGVWGELKTSLIAQTNDRRDIGVDKEYFKTLFDELTDSPYPSSFDI
FT                   ARIITSSAMSRSLERRKTLIKLINEIEQQHFHEKSVKTINEVLEYFLKTGHVETAQTLK
FT                   AILFEDGLSDGITYFENIEIPLEMVMHDLKSRTVGDCSTINVTRIPYHLDELIRGFINY
FT                   PEKHQILAPLFKARVKSEADLEEAFHRLSLEMVQAEIECPISEAHFERAFKKETLDKTQ
FT                   AVLTHYFRISTGLDSKKNYQERLNDLSAYLSKESSLEKNDIKLLLSMLDSEIKPKTGVF
FT                   QTLFGENQNKLYKAFHKKIELQFLDGEIENKNELK"
FT   gene            complement(856586..858892)
FT                   /locus_tag="lpa_01085"
FT   CDS_pept        complement(856586..858892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01085"
FT                   /product="sulfate transporter"
FT                   /EC_number="4.2.1.1"
FT                   /note="COG0659, SUL1, Sulfate permease and related
FT                   transporters (MFS superfamily) [Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01085"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24033"
FT                   /protein_id="ADG24033.1"
FT                   /translation="MIDRNIVNLRLFRIYSKRYLKFDFVAAIVVFLVAIPLCLGIALAS
FT                   GAPLFSGILSGIIGGIVVGIFSGSQVSVSGPAAGMAAVVLAAISQLGDFNTFLLALTLA
FT                   GVLQLIIGALRAGFVADYVPSNVVQGLLCSIGILLIIKQLPLAFTLSSDFDELKTHLLE
FT                   TTEGFTVSPLLALSQHINEGALIITTLSLAILIYFDITKNKILKEIPAPILVVLAGILL
FT                   NELFIWANSSLAQNSPQLVNIPDTNGFFQFFSHLEYPDWSAWANPKVYLYALVICIVAS
FT                   LETLLNLKASERLDKKRRHSPTNQELVAQGLGNITSGLVGGIPVTSVIVRTSINIHAGS
FT                   KTKFSAVLHGFFILFAVMLIPGALNKIPLSSLAAILIYTGYKLNKPAIYINIFSQGSDR
FT                   FIPFIVTVISIIAFNLLAGILIGLAISLFYILKSNSQARIDIIKEIYPNGSTYRLMLPQ
FT                   QMTFLNKAALVAELDTLPRRSQLIIDARHSQYIDKEILDLFNELKEELAGSKQISLNFT
FT                   GFQEHYKIHNYIDFITVTTYDVQTNLTPAQVLNILLEGNQRFLSDNRIHRSNQIDIKYT
FT                   AKTQHPIAVVLACIDSRVPVETIFDMSFGDLFCVRIAGNVINDDILASIEYACNVVGAK
FT                   LIMVLGHTRCGAIQSACDGIEKGHITQLLSKIKPAVNAEKETTTERNGKNQIFVNHVTE
FT                   LNVANTLQNIYKKSDILRTMIDSNEIGMVGAIYDVSSGKVSCKTYTEELSTLDGDENKL
FT                   LAQKFETILLEAKAS"
FT   gene            complement(859083..859934)
FT                   /locus_tag="lpa_01086"
FT   CDS_pept        complement(859083..859934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01086"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24034"
FT                   /protein_id="ADG24034.1"
FT                   /translation="MSSNPSSVEKKLLHYTGKAIADFNMIRRGDRVMVCLSGGKDSFTL
FT                   LTILNQLRIKSGNKFEIFAFTLDQAQPGWNDACLRQWLAEKSIPHEILTRDTYSIVKEK
FT                   IPEGKTYCSLCSRLRRGIIYRYAEENGFNKIALGHHRDDLIRTLMMSILYNGDIRSMPP
FT                   KLLSDNKKHIVIRPLCYVQEKDIITFASEQAFPIIPCNLCGSQENLMRKKVASLIDQLA
FT                   IENPKVPSNMLHALQSLKPSQLMDQNFWNFKNLEDGLETAQSVQCEEVFNAQEFEFEDE
FT                   KI"
FT   gene            complement(859952..861319)
FT                   /locus_tag="lpa_01087"
FT   CDS_pept        complement(859952..861319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01087"
FT                   /product="outer membrane factor, OMF family"
FT                   /note="COG1538, TolC, Outer membrane protein [Cell envelope
FT                   biogenesis, outer membrane / Intracellular trafficking and
FT                   secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01087"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24035"
FT                   /protein_id="ADG24035.1"
FT                   /translation="MRKSLFCWILTLGVSTHAFATDLMDIYQQALENDTIFKEAYDTYM
FT                   SSTEAIPQARAALYPQVGLGSQAGRNYQDAVAGAFSANQYYGSYLWQVKASQALFNYQA
FT                   WAQVAQAKASVKAAQASFNDAAQNLILRTAKAYFDVLFAKDTLDFAEAKKRANKRQYDQ
FT                   ATQRFQVGLDAITSVYEAKAAYDQSIATVIAARNNQINQSENLRKLTNHVYETLAPLKD
FT                   SKIPLVKPEPNDVNQWIDTGLKQNYKLYAAKYNLEVAKENVKAISAGNWPVFSLQSNAS
FT                   QVHNNASGNNVFIPSKQTQANIAIAMNFPVFQGGLVQAQTRQAQYNFQSTSEKLEQTYR
FT                   DVIVNSRIAFNTITDGISKVKADRQTVISVQNSLQSTEAQFEVGTRTMVDVVNAQQRLF
FT                   EAQEQLARDQYDLINSILTLKYLAGTLNVNDLEQINSWLATTRVNGFSPVDNKTSK"
FT   gene            complement(861331..861957)
FT                   /gene="pcm"
FT                   /locus_tag="lpa_01088"
FT   CDS_pept        complement(861331..861957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcm"
FT                   /locus_tag="lpa_01088"
FT                   /product="protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="COG2518, Pcm, Protein-L-isoaspartate
FT                   carboxylmethyltransferase [Posttranslational modification,
FT                   protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01088"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24036"
FT                   /protein_id="ADG24036.1"
FT                   /translation="MIKQQLRTGDVLNESILDLYDEILRHEFVPEPFSHFAYSDMQIPL
FT                   AHGQRMLTPLEEGTILQSLDLKGHETVLEVGTGTGFMTALLSKLCKKVISIDYYSEFTT
FT                   NAKRKLEEHNCNNVELITGDACRGWLESAPYDVIVFTGAMEKLTDTHKLQILPGGKLFA
FT                   ILGKSPVMKAYLFQLDHNAIWTESMLFETDIPPLVDQLKPKEFVF"
FT   gene            862162..863346
FT                   /locus_tag="lpa_01089"
FT   CDS_pept        862162..863346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpa_01089"
FT                   /product="glycine C-acetyltransferase"
FT                   /EC_number="2.3.1.29"
FT                   /note="COG0156, BioF, 7-keto-8-aminopelargonate synthetase
FT                   and related enzymes [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:lpa_01089"
FT                   /db_xref="EnsemblGenomes-Tr:ADG24037"
FT                   /protein_id="ADG24037.1"
FT                   /translation="MLERFINYLQNELETLKADGLYKSERVISSQQQADVKVNEREVIN
FT                   LCANNYLGLANDPELIAEGQAALAKYGYGMASVRFICGTQTPHKQLEQKISHFLNKEDT
FT                   ILYSSCFDANTGLFETLLTEEDAIISDALNHASIIDGVRLCKAARYRYANNDMKALEEQ
FT                   LIAAKNARFRLIATDGVFSMDGILANLPAICELADKYDAMVMVDDSHAVGFMGKTGRGT
FT                   PEHFGVSDRIDIVTGTLGKALGGASGGYTASNQVVIDWLRQRSRPYLFSNTLAPVIAHT
FT                   SCVVLDKLSTNNSLAEKLKRNSHYFREGMTQLGFELIPGEHPIIPVMLGDASLAGRIAN
FT                   RLLELGVYVVGFSYPVVPKGLARIRT