(data stored in SCRATCH3701 zone)

EMBL: CP001829

ID   CP001829; SV 2; circular; genomic DNA; STD; PRO; 2337250 BP.
XX
AC   CP001829;
XX
PR   Project:PRJNA40875;
XX
DT   06-AUG-2010 (Rel. 105, Created)
DT   20-JAN-2020 (Rel. 143, Last updated, Version 8)
XX
DE   Corynebacterium pseudotuberculosis C231 chromosome, complete genome.
XX
KW   .
XX
OS   Corynebacterium pseudotuberculosis C231
OC   Bacteria; Actinobacteria; Corynebacteriales; Corynebacteriaceae;
OC   Corynebacterium.
XX
RN   [1]
RP   1-2337250
RX   DOI; .1128/JB.01211-10.
RX   PUBMED; 21037006.
RA   Silva A., Schneider M.P., Cerdeira L., Barbosa M.S., Ramos R.T.,
RA   Carneiro A.R., Santos R., Lima M., D'Afonseca V., Almeida S.S.,
RA   Santos A.R., Soares S.C., Pinto A.C., Ali A., Dorella F.A., Rocha F.,
RA   de Abreu V.A., Trost E., Tauch A., Shpigel N., Miyoshi A., Azevedo V.;
RT   "Complete genome sequence of Corynebacterium pseudotuberculosis I19, a
RT   strain isolated from a cow in Israel with bovine mastitis";
RL   J. Bacteriol. 193(1):323-324(2011).
XX
RN   [2]
RC   Publication Status: Online-Only
RP   1-2337250
RX   PUBMED; 21533164.
RA   Ruiz J.C., D'Afonseca V., Silva A., Ali A., Pinto A.C., Santos A.R.,
RA   Rocha A.A., Lopes D.O., Dorella F.A., Pacheco L.G., Costa M.P., Turk M.Z.,
RA   Seyffert N., Moraes P.M., Soares S.C., Almeida S.S., Castro T.L.,
RA   Abreu V.A., Trost E., Baumbach J., Tauch A., Schneider M.P., McCulloch J.,
RA   Cerdeira L.T., Ramos R.T., Zerlotini A., Dominitini A., Resende D.M.,
RA   Coser E.M., Oliveira L.M., Pedrosa A.L., Vieira C.U., Guimaraes C.T.,
RA   Bartholomeu D.C., Oliveira D.M., Santos F.R., Rabelo E.M., Lobo F.P.,
RA   Franco G.R., Costa A.F., Castro I.M., Dias S.R., Ferro J.A., Ortega J.M.,
RA   Paiva L.V., Goulart L.R., Almeida J.F., Ferro M.I., Carneiro N.P.,
RA   Falcao P.R., Grynberg P., Teixeira S.M., Brommonschenkel S., Oliveira S.C.,
RA   Meyer R., Moore R.J., Miyoshi A., Oliveira G.C., Azevedo V.;
RT   "Evidence for reductive genome evolution and lateral acquisition of
RT   virulence functions in two Corynebacterium pseudotuberculosis strains";
RL   PLoS One 6(4):0-e18551(2011).
XX
RN   [3]
RP   1-2337250
RA   Sousa T.J., Goncalves R., Gomide A., Seyffert N., Castro T., Soares S.,
RA   Brenig B., Azevedo V.;
RT   "New assembly genome of Corynebacterium pseudotuberculosis strain C231 by
RT   Illumina Hiseq and Optical mapping";
RL   Unpublished.
XX
RN   [4]
RP   1-2337250
RA   Ruiz J., Silva A., D'Afonseca V., Pinto A., Santos A., Soares S.,
RA   Almeida S., Resende D., Dorella F., Pacheco L., Moraes P., Seyffert N.,
RA   Castro T., Miyoshi A., Moore R., Azevedo V.;
RT   ;
RL   Submitted (26-OCT-2009) to the INSDC.
RL   General Biology, Federal University of Minas Gerais, Av. Antonio Carlos,
RL   6627 - Pampulha, Belo Horizonte, Minas Gerais 31270-901, Brazil
XX
RN   [5]
RC   Protein update by submitter
RP   1-2337250
RG   Redes Genomicas de Minas Gerais e do Para
RA   Ruiz J.C., D'Afonseca V., Silva A., Ali A., Pinto A.C., Santos A.R.,
RA   Rocha A.A., Lopes D.O., Dorella F.A., Pacheco L.G., Costa M.P., Turk M.Z.,
RA   Seyffert N., Moraes P.M., Soares S.C., Almeida S.S., Castro T.L.,
RA   Abreu V.A., Trost E., Baumbach J., Tauch A., Schneider M.P., McCulloch J.,
RA   Cerdeira L.T., Ramos R.T., Zerlotini A., Dominitini A., Resende D.M.,
RA   Coser E.M., Oliveira L.M., Pedrosa A.L., Vieira C.U., Guimaraes C.T.,
RA   Bartholomeu D.C., Oliveira D.M., Santos F.R., Rabelo E.M., Lobo F.P.,
RA   Franco G.R., Costa A.F., Castro I.M., Dias S.R., Ferro J.A., Ortega J.M.,
RA   Paiva L.V., Goulart L.R., Almeida J.F., Ferro M.I., Carneiro N.P.,
RA   Falcao P.R., Grynberg P., Teixeira S.M., Brommonschenkel S., Oliveira S.C.,
RA   Meyer R., Moore R.J., Miyoshi A., Oliveira G.C., Azevedo V.;
RT   ;
RL   Submitted (18-JUL-2011) to the INSDC.
RL   Department of General Biology, Federal University of Minas Gerais, Av.
RL   Antonio Carlos, 6627 - Pampulha, Belo Horizonte, Minas Gerais 31270-901,
RL   Brazil
XX
RN   [6]
RC   Nucleotide sequence updated by submitter
RP   1-2337250
RA   Sousa T.J., Goncalves R., Gomide A., Seyffert N., Castro T., Soares S.,
RA   Brenig B., Azevedo V.;
RT   ;
RL   Submitted (09-JAN-2020) to the INSDC.
RL   Department of Genetics, Ecology and Evolution, UFMG, Av Antonio Carlos
RL   6627, Pampulha, Belo Horizonte, Minhas Gerais 31270-901, Brazil
XX
DR   MD5; c5185c5f6ddfd349a84ed1983d53854f.
DR   BioSample; SAMN02604117.
DR   EnsemblGenomes-Gn; CpC231_r01.
DR   EnsemblGenomes-Gn; CpC231_r02.
DR   EnsemblGenomes-Gn; CpC231_r03.
DR   EnsemblGenomes-Gn; CpC231_r04.
DR   EnsemblGenomes-Gn; CpC231_r05.
DR   EnsemblGenomes-Gn; CpC231_r06.
DR   EnsemblGenomes-Gn; CpC231_r08.
DR   EnsemblGenomes-Gn; CpC231_r09.
DR   EnsemblGenomes-Gn; CpC231_r10.
DR   EnsemblGenomes-Gn; CpC231_r11.
DR   EnsemblGenomes-Gn; CpC231_r12.
DR   EnsemblGenomes-Gn; CpC231_t01.
DR   EnsemblGenomes-Gn; CpC231_t02.
DR   EnsemblGenomes-Gn; CpC231_t03.
DR   EnsemblGenomes-Gn; CpC231_t04.
DR   EnsemblGenomes-Gn; CpC231_t05.
DR   EnsemblGenomes-Gn; CpC231_t06.
DR   EnsemblGenomes-Gn; CpC231_t07.
DR   EnsemblGenomes-Gn; CpC231_t08.
DR   EnsemblGenomes-Gn; CpC231_t09.
DR   EnsemblGenomes-Gn; CpC231_t10.
DR   EnsemblGenomes-Gn; CpC231_t11.
DR   EnsemblGenomes-Gn; CpC231_t12.
DR   EnsemblGenomes-Gn; CpC231_t13.
DR   EnsemblGenomes-Gn; CpC231_t14.
DR   EnsemblGenomes-Gn; CpC231_t15.
DR   EnsemblGenomes-Gn; CpC231_t16.
DR   EnsemblGenomes-Gn; CpC231_t17.
DR   EnsemblGenomes-Gn; CpC231_t18.
DR   EnsemblGenomes-Gn; CpC231_t19.
DR   EnsemblGenomes-Gn; CpC231_t20.
DR   EnsemblGenomes-Gn; CpC231_t21.
DR   EnsemblGenomes-Gn; CpC231_t22.
DR   EnsemblGenomes-Gn; CpC231_t23.
DR   EnsemblGenomes-Gn; CpC231_t24.
DR   EnsemblGenomes-Gn; CpC231_t25.
DR   EnsemblGenomes-Gn; CpC231_t26.
DR   EnsemblGenomes-Gn; CpC231_t27.
DR   EnsemblGenomes-Gn; CpC231_t28.
DR   EnsemblGenomes-Gn; CpC231_t29.
DR   EnsemblGenomes-Gn; CpC231_t30.
DR   EnsemblGenomes-Gn; CpC231_t31.
DR   EnsemblGenomes-Gn; CpC231_t32.
DR   EnsemblGenomes-Gn; CpC231_t33.
DR   EnsemblGenomes-Gn; CpC231_t34.
DR   EnsemblGenomes-Gn; CpC231_t35.
DR   EnsemblGenomes-Gn; CpC231_t36.
DR   EnsemblGenomes-Gn; CpC231_t37.
DR   EnsemblGenomes-Gn; CpC231_t38.
DR   EnsemblGenomes-Gn; CpC231_t39.
DR   EnsemblGenomes-Gn; CpC231_t40.
DR   EnsemblGenomes-Gn; CpC231_t41.
DR   EnsemblGenomes-Gn; CpC231_t42.
DR   EnsemblGenomes-Gn; CpC231_t43.
DR   EnsemblGenomes-Gn; CpC231_t44.
DR   EnsemblGenomes-Gn; CpC231_t45.
DR   EnsemblGenomes-Gn; CpC231_t46.
DR   EnsemblGenomes-Gn; CpC231_t47.
DR   EnsemblGenomes-Gn; CpC231_t48.
DR   EnsemblGenomes-Gn; EBG00001211735.
DR   EnsemblGenomes-Gn; EBG00001211736.
DR   EnsemblGenomes-Gn; EBG00001211737.
DR   EnsemblGenomes-Gn; EBG00001211738.
DR   EnsemblGenomes-Gn; EBG00001211739.
DR   EnsemblGenomes-Gn; EBG00001211740.
DR   EnsemblGenomes-Gn; EBG00001211741.
DR   EnsemblGenomes-Gn; EBG00001211742.
DR   EnsemblGenomes-Gn; EBG00001211743.
DR   EnsemblGenomes-Gn; EBG00001211744.
DR   EnsemblGenomes-Gn; EBG00001211745.
DR   EnsemblGenomes-Gn; EBG00001211746.
DR   EnsemblGenomes-Gn; EBG00001211747.
DR   EnsemblGenomes-Gn; EBG00001211748.
DR   EnsemblGenomes-Gn; EBG00001211749.
DR   EnsemblGenomes-Gn; EBG00001211750.
DR   EnsemblGenomes-Gn; EBG00001211751.
DR   EnsemblGenomes-Gn; EBG00001211752.
DR   EnsemblGenomes-Gn; EBG00001211753.
DR   EnsemblGenomes-Gn; EBG00001211754.
DR   EnsemblGenomes-Gn; EBG00001211755.
DR   EnsemblGenomes-Gn; EBG00001211756.
DR   EnsemblGenomes-Gn; EBG00001211757.
DR   EnsemblGenomes-Gn; EBG00001211758.
DR   EnsemblGenomes-Gn; EBG00001211759.
DR   EnsemblGenomes-Gn; EBG00001211760.
DR   EnsemblGenomes-Gn; EBG00001211761.
DR   EnsemblGenomes-Gn; EBG00001211762.
DR   EnsemblGenomes-Gn; EBG00001211763.
DR   EnsemblGenomes-Gn; EBG00001211764.
DR   EnsemblGenomes-Gn; EBG00001211765.
DR   EnsemblGenomes-Gn; EBG00001211766.
DR   EnsemblGenomes-Gn; EBG00001211767.
DR   EnsemblGenomes-Gn; EBG00001211768.
DR   EnsemblGenomes-Gn; EBG00001211769.
DR   EnsemblGenomes-Gn; EBG00001211770.
DR   EnsemblGenomes-Gn; EBG00001211771.
DR   EnsemblGenomes-Gn; EBG00001211772.
DR   EnsemblGenomes-Gn; EBG00001211773.
DR   EnsemblGenomes-Gn; EBG00001211774.
DR   EnsemblGenomes-Gn; EBG00001211775.
DR   EnsemblGenomes-Gn; EBG00001211776.
DR   EnsemblGenomes-Gn; EBG00001211777.
DR   EnsemblGenomes-Gn; EBG00001211778.
DR   EnsemblGenomes-Gn; EBG00001211779.
DR   EnsemblGenomes-Gn; EBG00001211780.
DR   EnsemblGenomes-Gn; EBG00001211781.
DR   EnsemblGenomes-Gn; EBG00001211782.
DR   EnsemblGenomes-Gn; EBG00001211783.
DR   EnsemblGenomes-Gn; EBG00001211784.
DR   EnsemblGenomes-Gn; EBG00001211785.
DR   EnsemblGenomes-Gn; EBG00001211786.
DR   EnsemblGenomes-Gn; EBG00001211787.
DR   EnsemblGenomes-Gn; EBG00001211788.
DR   EnsemblGenomes-Gn; EBG00001211789.
DR   EnsemblGenomes-Gn; EBG00001211790.
DR   EnsemblGenomes-Gn; EBG00001211791.
DR   EnsemblGenomes-Gn; EBG00001211793.
DR   EnsemblGenomes-Gn; EBG00001211794.
DR   EnsemblGenomes-Gn; EBG00001211796.
DR   EnsemblGenomes-Gn; EBG00001211797.
DR   EnsemblGenomes-Gn; EBG00001211799.
DR   EnsemblGenomes-Gn; EBG00001211801.
DR   EnsemblGenomes-Gn; EBG00001211802.
DR   EnsemblGenomes-Gn; EBG00001211803.
DR   EnsemblGenomes-Gn; EBG00001211804.
DR   EnsemblGenomes-Gn; EBG00001211806.
DR   EnsemblGenomes-Gn; EBG00001211807.
DR   EnsemblGenomes-Tr; CpC231_r01-1.
DR   EnsemblGenomes-Tr; CpC231_r02-1.
DR   EnsemblGenomes-Tr; CpC231_r03-1.
DR   EnsemblGenomes-Tr; CpC231_r04-1.
DR   EnsemblGenomes-Tr; CpC231_r05-1.
DR   EnsemblGenomes-Tr; CpC231_r06-1.
DR   EnsemblGenomes-Tr; CpC231_r08-1.
DR   EnsemblGenomes-Tr; CpC231_r09-1.
DR   EnsemblGenomes-Tr; CpC231_r10-1.
DR   EnsemblGenomes-Tr; CpC231_r11-1.
DR   EnsemblGenomes-Tr; CpC231_r12-1.
DR   EnsemblGenomes-Tr; CpC231_t01-1.
DR   EnsemblGenomes-Tr; CpC231_t02-1.
DR   EnsemblGenomes-Tr; CpC231_t03-1.
DR   EnsemblGenomes-Tr; CpC231_t04-1.
DR   EnsemblGenomes-Tr; CpC231_t05-1.
DR   EnsemblGenomes-Tr; CpC231_t06-1.
DR   EnsemblGenomes-Tr; CpC231_t07-1.
DR   EnsemblGenomes-Tr; CpC231_t08-1.
DR   EnsemblGenomes-Tr; CpC231_t09-1.
DR   EnsemblGenomes-Tr; CpC231_t10-1.
DR   EnsemblGenomes-Tr; CpC231_t11-1.
DR   EnsemblGenomes-Tr; CpC231_t12-1.
DR   EnsemblGenomes-Tr; CpC231_t13-1.
DR   EnsemblGenomes-Tr; CpC231_t14-1.
DR   EnsemblGenomes-Tr; CpC231_t15-1.
DR   EnsemblGenomes-Tr; CpC231_t16-1.
DR   EnsemblGenomes-Tr; CpC231_t17-1.
DR   EnsemblGenomes-Tr; CpC231_t18-1.
DR   EnsemblGenomes-Tr; CpC231_t19-1.
DR   EnsemblGenomes-Tr; CpC231_t20-1.
DR   EnsemblGenomes-Tr; CpC231_t21-1.
DR   EnsemblGenomes-Tr; CpC231_t22-1.
DR   EnsemblGenomes-Tr; CpC231_t23-1.
DR   EnsemblGenomes-Tr; CpC231_t24-1.
DR   EnsemblGenomes-Tr; CpC231_t25-1.
DR   EnsemblGenomes-Tr; CpC231_t26-1.
DR   EnsemblGenomes-Tr; CpC231_t27-1.
DR   EnsemblGenomes-Tr; CpC231_t28-1.
DR   EnsemblGenomes-Tr; CpC231_t29-1.
DR   EnsemblGenomes-Tr; CpC231_t30-1.
DR   EnsemblGenomes-Tr; CpC231_t31-1.
DR   EnsemblGenomes-Tr; CpC231_t32-1.
DR   EnsemblGenomes-Tr; CpC231_t33-1.
DR   EnsemblGenomes-Tr; CpC231_t34-1.
DR   EnsemblGenomes-Tr; CpC231_t35-1.
DR   EnsemblGenomes-Tr; CpC231_t36-1.
DR   EnsemblGenomes-Tr; CpC231_t37-1.
DR   EnsemblGenomes-Tr; CpC231_t38-1.
DR   EnsemblGenomes-Tr; CpC231_t39-1.
DR   EnsemblGenomes-Tr; CpC231_t40-1.
DR   EnsemblGenomes-Tr; CpC231_t41-1.
DR   EnsemblGenomes-Tr; CpC231_t42-1.
DR   EnsemblGenomes-Tr; CpC231_t43-1.
DR   EnsemblGenomes-Tr; CpC231_t44-1.
DR   EnsemblGenomes-Tr; CpC231_t45-1.
DR   EnsemblGenomes-Tr; CpC231_t46-1.
DR   EnsemblGenomes-Tr; CpC231_t47-1.
DR   EnsemblGenomes-Tr; CpC231_t48-1.
DR   EnsemblGenomes-Tr; EBT00001780907.
DR   EnsemblGenomes-Tr; EBT00001780908.
DR   EnsemblGenomes-Tr; EBT00001780909.
DR   EnsemblGenomes-Tr; EBT00001780910.
DR   EnsemblGenomes-Tr; EBT00001780911.
DR   EnsemblGenomes-Tr; EBT00001780912.
DR   EnsemblGenomes-Tr; EBT00001780913.
DR   EnsemblGenomes-Tr; EBT00001780914.
DR   EnsemblGenomes-Tr; EBT00001780915.
DR   EnsemblGenomes-Tr; EBT00001780916.
DR   EnsemblGenomes-Tr; EBT00001780917.
DR   EnsemblGenomes-Tr; EBT00001780918.
DR   EnsemblGenomes-Tr; EBT00001780919.
DR   EnsemblGenomes-Tr; EBT00001780920.
DR   EnsemblGenomes-Tr; EBT00001780921.
DR   EnsemblGenomes-Tr; EBT00001780922.
DR   EnsemblGenomes-Tr; EBT00001780923.
DR   EnsemblGenomes-Tr; EBT00001780924.
DR   EnsemblGenomes-Tr; EBT00001780925.
DR   EnsemblGenomes-Tr; EBT00001780926.
DR   EnsemblGenomes-Tr; EBT00001780927.
DR   EnsemblGenomes-Tr; EBT00001780928.
DR   EnsemblGenomes-Tr; EBT00001780929.
DR   EnsemblGenomes-Tr; EBT00001780930.
DR   EnsemblGenomes-Tr; EBT00001780931.
DR   EnsemblGenomes-Tr; EBT00001780932.
DR   EnsemblGenomes-Tr; EBT00001780933.
DR   EnsemblGenomes-Tr; EBT00001780934.
DR   EnsemblGenomes-Tr; EBT00001780935.
DR   EnsemblGenomes-Tr; EBT00001780936.
DR   EnsemblGenomes-Tr; EBT00001780937.
DR   EnsemblGenomes-Tr; EBT00001780938.
DR   EnsemblGenomes-Tr; EBT00001780939.
DR   EnsemblGenomes-Tr; EBT00001780940.
DR   EnsemblGenomes-Tr; EBT00001780941.
DR   EnsemblGenomes-Tr; EBT00001780942.
DR   EnsemblGenomes-Tr; EBT00001780943.
DR   EnsemblGenomes-Tr; EBT00001780944.
DR   EnsemblGenomes-Tr; EBT00001780945.
DR   EnsemblGenomes-Tr; EBT00001780946.
DR   EnsemblGenomes-Tr; EBT00001780947.
DR   EnsemblGenomes-Tr; EBT00001780948.
DR   EnsemblGenomes-Tr; EBT00001780949.
DR   EnsemblGenomes-Tr; EBT00001780950.
DR   EnsemblGenomes-Tr; EBT00001780951.
DR   EnsemblGenomes-Tr; EBT00001780952.
DR   EnsemblGenomes-Tr; EBT00001780953.
DR   EnsemblGenomes-Tr; EBT00001780954.
DR   EnsemblGenomes-Tr; EBT00001780955.
DR   EnsemblGenomes-Tr; EBT00001780956.
DR   EnsemblGenomes-Tr; EBT00001780957.
DR   EnsemblGenomes-Tr; EBT00001780958.
DR   EnsemblGenomes-Tr; EBT00001780959.
DR   EnsemblGenomes-Tr; EBT00001780960.
DR   EnsemblGenomes-Tr; EBT00001780961.
DR   EnsemblGenomes-Tr; EBT00001780962.
DR   EnsemblGenomes-Tr; EBT00001780963.
DR   EnsemblGenomes-Tr; EBT00001780964.
DR   EnsemblGenomes-Tr; EBT00001780965.
DR   EnsemblGenomes-Tr; EBT00001780966.
DR   EnsemblGenomes-Tr; EBT00001780967.
DR   EnsemblGenomes-Tr; EBT00001780968.
DR   EnsemblGenomes-Tr; EBT00001780969.
DR   EnsemblGenomes-Tr; EBT00001780970.
DR   EnsemblGenomes-Tr; EBT00001780971.
DR   EnsemblGenomes-Tr; EBT00001780972.
DR   EnsemblGenomes-Tr; EBT00001780973.
DR   EnsemblGenomes-Tr; EBT00001780974.
DR   EuropePMC; PMC3019927; 21037006.
DR   EuropePMC; PMC3078919; 21533164.
DR   EuropePMC; PMC3280268; 22355329.
DR   EuropePMC; PMC3917457; 23199210.
DR   EuropePMC; PMC5282893; 28163825.
DR   EuropePMC; PMC5609009; 28934943.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001829.
DR   SILVA-SSU; CP001829.
XX
CC   On Jan 16, 2020 this sequence version replaced CP001829.1.
CC   Bacteria available from Dr. Vasco Azevedo (vasco@icb.ufmg.br).
CC   The annotation was added by the NCBI Prokaryotic Genome Annotation
CC   Pipeline (PGAP). Information about PGAP can be found here:
CC   https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
CC   ##Genome-Annotation-Data-START##
CC   Annotation Provider               :: NCBI
CC   Annotation Date                   :: 01/15/2020 16:57:34
CC   Annotation Pipeline               :: NCBI Prokaryotic Genome
CC                                        Annotation Pipeline (PGAP)
CC   Annotation Method                 :: Best-placed reference protein
CC                                        set; GeneMarkS-2+
CC   Annotation Software revision      :: 4.10
CC   Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
CC                                        repeat_region
CC   Genes (total)                     :: 2,128
CC   CDSs (total)                      :: 2,065
CC   Genes (coding)                    :: 2,004
CC   CDSs (with protein)               :: 2,004
CC   Genes (RNA)                       :: 63
CC   rRNAs                             :: 4, 4, 4 (5S, 16S, 23S)
CC   complete rRNAs                    :: 4, 4, 4 (5S, 16S, 23S)
CC   tRNAs                             :: 48
CC   ncRNAs                            :: 3
CC   Pseudo Genes (total)              :: 61
CC   CDSs (without protein)            :: 61
CC   Pseudo Genes (ambiguous residues) :: 0 of 61
CC   Pseudo Genes (frameshifted)       :: 54 of 61
CC   Pseudo Genes (incomplete)         :: 3 of 61
CC   Pseudo Genes (internal stop)      :: 6 of 61
CC   Pseudo Genes (multiple problems)  :: 2 of 61
CC   ##Genome-Annotation-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2337250
FT                   /organism="Corynebacterium pseudotuberculosis C231"
FT                   /host="sheep"
FT                   /strain="C231"
FT                   /mol_type="genomic DNA"
FT                   /country="Brazil"
FT                   /isolation_source="caseous lymphadenitis abscess"
FT                   /note="biovar: ovis"
FT                   /db_xref="taxon:681645"
FT   gene            join(2337250,1..1811)
FT                   /gene="dnaA"
FT                   /locus_tag="CPC231_00005"
FT                   /old_locus_tag="CpC231_0001"
FT   CDS_pept        join(2337250,1..1811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="CPC231_00005"
FT                   /old_locus_tag="CpC231_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09500"
FT                   /db_xref="GOA:D9QD56"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD56"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400874.1"
FT                   /protein_id="ADL09500.1"
FT                   /translation="MSEAPSTWNERWQEVTNELLSQSQDPESGISITRQQSAYLRLVKP
FT                   VAFVEGIAVLSVPHARAKKEIETTLGPVITEVLSRRLGRQYSLAVSVHAPEENPEVSSA
FT                   TPDAVSYYQEQSAVSGQYGATSANADFQNQQSTIYRKPQESQYPVTFGASSYGNEKYQE
FT                   NSQDQGISHHPYGFNEAQRIASSASHAVPQSGSELLHDPVHTRRTDAALDQNYPGNTGG
FT                   WRTEHIQEPMPTEQIPSGTPRTREQPSFNPDRALALNPHYTFDSYVVSDSNKLPCSAAI
FT                   AVAEKPARAYNPLFIWGDSGLGKTHLMHAVGNYAQYLNPRLRIKYVSSEEFTNEYINSV
FT                   RDDRQEAFKRKYRELDILMVDDIQFLQGKEGTQEEFFHTFNALYQANKQIVLSSDRPPK
FT                   QLTTLEDRLRTRFQAGLIADIYPPDLETRIAILMKKAASESIVADREAIELIASRFNTS
FT                   IRELEGAFIRVSAYASLMSPDKGKHRIDLRIAEKALEDMMPEQANEEITATTILAATAE
FT                   YFEMDVNALKGSGKTRAVAHARQLAMYLCRELTDLSLPKIGEQFGGKDHTTVMYADRKI
FT                   RKEITEKKETYDEIQLLTQQIKSSSRG"
FT   gene            2051..2230
FT                   /locus_tag="CPC231_00010"
FT   CDS_pept        2051..2230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00010"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366209.1"
FT                   /protein_id="QHI00959.1"
FT                   /translation="MWIISRGKKLSTGRTCYPPKFHSPLHNSKICNDRRISLSFHRVHR
FT                   TYCYYQRFTLKGTK"
FT   gene            2395..3582
FT                   /locus_tag="CPC231_00015"
FT                   /old_locus_tag="CpC231_0002"
FT   CDS_pept        2395..3582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00015"
FT                   /old_locus_tag="CpC231_0002"
FT                   /product="DNA polymerase III subunit beta"
FT                   /EC_number="2.7.7.7"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09501"
FT                   /db_xref="GOA:D9QD57"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD57"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240862.1"
FT                   /protein_id="ADL09501.1"
FT                   /translation="MDAQAVSFRVEKEDLSGAVSWVARNLPTKPTQPVLRAVVITADDE
FT                   GLEFAGFDYEISTKVRISADVSQPGRIAVAGKLLSDIIGTLPAKPVEIFVEGSQALVVC
FT                   GSSRFELPLIPLDEYPILPKLPAATGAIDPKLFADAVLQVAAAAGKDDTLPMLTGIHME
FT                   IDGEDVTLTATDRFRLALRRFQWTPAVPDAKADLLIPAKNLSDNARSLDQNSTDPVEIA
FT                   VGAGESIGSEGLFGIHIDSRQTTTRMLDADFPNVNPLLPKVHKSMASVEISALADAIRR
FT                   VALVAERNAQIRLQFSKNEVILSAGGSDAGHAEESVPCAYTGDEDFLIAFNSGYLRDGL
FT                   SVIKTNRVVFGFTEPSRPAIMIPEPEELPEADSDGTFPTPNTDFTYLLMPVRLPG"
FT   gene            3649..4863
FT                   /gene="recF"
FT                   /locus_tag="CPC231_00020"
FT                   /old_locus_tag="CpC231_0003"
FT   CDS_pept        3649..4863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="CPC231_00020"
FT                   /old_locus_tag="CpC231_0003"
FT                   /product="DNA replication/repair protein RecF"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09502"
FT                   /db_xref="GOA:D9QD58"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD58"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400877.1"
FT                   /protein_id="ADL09502.1"
FT                   /translation="MYIRELSLRDFRSWADCHVNLEPGVTVFVGRNGFGKTNIVEAIGY
FT                   IAHLGSHRVSQDSPLVHQGKDSARVSVTAVNQGRELTAHMLIKSKGTNQAQINRTRLKS
FT                   PRGLLGVVRTVLFSPEDLSLVRGEPGERRRYLDHIVATRKPRLAGVKADYDKVLKQRNS
FT                   LLKTASASLRRGYGADDGTLCTLDVWDAQLARLGSELIHARHSLVEELTPLVHSAYARI
FT                   APESRPARINYESTVPVPVAVTDAEEASSSIPDLDVLEASMLSQLGVQRKKEIDRGLTL
FT                   VGPHRDDLAVLLGDYPAKGYASHGETWSMALALRLAEFHLLSADGSEPILILDDVFAEL
FT                   DSKRRQKLVGIAMEAEQVLITAAVGDDLPDNLAESVVHRHTVTMTDTSEGRISELDKEG
FT                   TSDEQ"
FT   gene            4853..5425
FT                   /locus_tag="CPC231_00025"
FT                   /old_locus_tag="CpC231_0004"
FT   CDS_pept        4853..5425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00025"
FT                   /old_locus_tag="CpC231_0004"
FT                   /product="DUF721 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09503"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD59"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240864.1"
FT                   /protein_id="ADL09503.1"
FT                   /translation="MSNKPADAGSEDPVAEAFAAIRAEAQRRTGRIPDLSVQAPRSGLK
FT                   LNHAPAAPRKHQKTGKPTGLDGRRLRRSYDVEPVGSVLSKEIQRRGWKHGIAGGWVHSH
FT                   WDELVGEKIAAHTKVEMLKDKSLFISCNSTAWATNLRMMQRTILQAIAEKVGPDVVAEL
FT                   KIFGPKTPSWRHGPLHVKGRGPRDTYG"
FT   gene            5565..7610
FT                   /gene="gyrB"
FT                   /locus_tag="CPC231_00030"
FT                   /old_locus_tag="CpC231_0005"
FT   CDS_pept        5565..7610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="CPC231_00030"
FT                   /old_locus_tag="CpC231_0005"
FT                   /product="DNA topoisomerase (ATP-hydrolyzing) subunit B"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09504"
FT                   /db_xref="GOA:D9QD60"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD60"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599257.1"
FT                   /protein_id="ADL09504.1"
FT                   /translation="MATAEHEYGASSITILEGLEAVRKRPGMYIGSTGERGLHHLVWEV
FT                   VDNSVDEAMAGHATHVDVTLLEDGGVEVVDNGRGIPVDMHASGAPTVQVVMTQLHAGGK
FT                   FDSDSYAVSGGLHGVGISVVNALSTRVEADIKLHGKHWYQNFSNAVPDELVQGGNARGT
FT                   GTTIRFWPDAEIFETTTFKFDIIARRLQEMAFLNKGLTLSLTDKRVSDEELELEAIADE
FT                   GDTAENVSLEKIDSDADGNIEAPAAPKKREKKKVFYYPEGLKDYVAHLNKSKQVIHPTI
FT                   VAFEAKGDDHEVEVAMQWNNGYAQSVHTFANTINTIEGGTHEEGFRAALTTLMNRYARE
FT                   HRLLKEKESNLTGDDCREGLSAVISVRVGDPQFEGQTKTKLGNTEVKGFVQRMVNEHVA
FT                   DWLDANPAEAKTIINKAVSSAHARMAARKARDLVRRKSATDLGGLPGKLADCRSKDPVK
FT                   SELYVVEGDSAGGSAKAGRDSLYQAILPLRGKILNVEKARLDKVLKNAEVQAIITALGT
FT                   GIHDEFDINKLRYHKIVLMADADVDGSHIATLLLTLLFRFMPQLIEEGHVYLAQPPLYK
FT                   LKWGKGDPGFAYSDAERDSLLEEGLAQGRKINKDDGIQRYKGLGEMNASELWETTLDPE
FT                   FRVLRRVDINDAQRADEIFSILMGDDVAARRSFITRRAKDVRFLDI"
FT   gene            complement(7692..8126)
FT                   /locus_tag="CPC231_00035"
FT                   /old_locus_tag="CpC231_0006"
FT   CDS_pept        complement(7692..8126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00035"
FT                   /old_locus_tag="CpC231_0006"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09505"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD61"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400878.1"
FT                   /protein_id="ADL09505.1"
FT                   /translation="MSSLKSLLETKHATVGAELSAFIETTVAEQKGISGMAFKGAIGAA
FT                   KAVNSDIVTKAANRLLPDVIEVLDPYWTQFEESGATDFGVFLAERKTEVSSELLVMADR
FT                   NAEKIDVPALKKAYSSLRGKAAGFIEPNVEGLGRIMQNHM"
FT   gene            complement(8440..8703)
FT                   /locus_tag="CPC231_00040"
FT                   /old_locus_tag="CpC231_0007"
FT   CDS_pept        complement(8440..8703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00040"
FT                   /old_locus_tag="CpC231_0007"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09506"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD62"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799817.1"
FT                   /protein_id="ADL09506.2"
FT                   /translation="MRGLSPEQVLMLADDFCSTCNATINDFAAIAAIAAVTTASFEGSS
FT                   PFSSPAQQSEYLRSFVPQVSPLTRGNESFGIFLSRVLKDLNA"
FT   gene            complement(8700..8912)
FT                   /locus_tag="CPC231_00045"
FT                   /old_locus_tag="CpC231_0008"
FT   CDS_pept        complement(8700..8912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00045"
FT                   /old_locus_tag="CpC231_0008"
FT                   /product="CopG family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09507"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD63"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400879.1"
FT                   /protein_id="ADL09507.1"
FT                   /translation="MAMTLRLTPEQDRALTLLAEIQGSSKHEAAVRAIINTAVRALADS
FT                   EIRELARAHLPAFTATERRIRGNRP"
FT   gene            9080..11644
FT                   /gene="gyrA"
FT                   /locus_tag="CPC231_00050"
FT                   /old_locus_tag="CpC231_0009"
FT   CDS_pept        9080..11644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="CPC231_00050"
FT                   /old_locus_tag="CpC231_0009"
FT                   /product="DNA gyrase subunit A"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09508"
FT                   /db_xref="GOA:D9QD64"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD64"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799819.1"
FT                   /protein_id="ADL09508.1"
FT                   /translation="MSDDLLGGEGFDRIHPIDLNEEMETSYIDYAMSVIVGRALPEVRD
FT                   GLKPVHRRILYAMYDSGYRPERGYVKSARPVSDTMGQFHPHGDSAIYDTLVRLAQDWNM
FT                   RYPLVDGQGNFGSRGNDGPAAMRYTECRLTPLAMEMVRDIRENTVDFSPNYDGKTQEPD
FT                   VLPSRVPNLLMNGSNGIAVGMATNIPPHNLNELADAIFWLLENPDADEAAALEACMSYV
FT                   KGPDFPTSGQIVGSQGINDAYTTGRGSIRMRGVTSIEEEGSRQIIVITELPYQVNPDNM
FT                   ISNIAEQVRDGKLAGISKIEDESSDRVGMRIVVTLKRDAVPRVVLNNLYKHSQLQTNFG
FT                   ANMLSIVDGVPRTLRLDQMLRYYVTHQIEVIVRRTQHRLEEAEKRAHILRGLVKALDML
FT                   DEVIALIRRSATVDVARSGLIDLLTIDEIQADAILAMQLRRLAALERQKIIDELAEIEI
FT                   EIADYKDILAKPERQRAIVRDELKEIVTKYGDERRTQIIAATGDVTEEDLIARENVVVT
FT                   ITSTGYAKRTKVDAYKSQRRGGKGVRGAELKQDDVVRHFFVCSTHDWILFFTNFGRVYR
FT                   LKAYELPEASRTARGQHVANLLEFQPEERIAQVIQLQSYEDAPYLVLATAQGRVKKSRL
FT                   SDYESNRSGGLIAINLGEEDKLIGAALCSNDDELLLVSEEGQSIRFSADDDQLRPMGRA
FT                   TAGVKGMRFRGDDQLLAMTVVRSDAYLLVATSGGYGKRTSLEEYSQQGRGGLGVVTFKY
FT                   TPKRGKLIAAVVVDEDDQIFAITSAGGVIRTEVNQIRPSSRATMGVRLVNLEDGVELLA
FT                   IDRNVEGEGEETAEAVATGAIDGPADRGRQTEVNIEPEGADQ"
FT   gene            11644..11988
FT                   /locus_tag="CPC231_00055"
FT                   /old_locus_tag="CpC231_0010"
FT   CDS_pept        11644..11988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00055"
FT                   /old_locus_tag="CpC231_0010"
FT                   /product="DUF3566 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09509"
FT                   /db_xref="GOA:D9QD65"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD65"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525073.1"
FT                   /protein_id="ADL09509.1"
FT                   /translation="MATRHVVITRISPVSAFKTALSLSLIGLAAWVICVALLYLGMQAV
FT                   GVWDNVNEVIGGVGGSQIVTFGLVLSVAALMGAITSIIVTVLAPLGAIIYNAIVDLFGG
FT                   LAITYREEND"
FT   gene            12174..12250
FT                   /locus_tag="CPC231_00060"
FT                   /old_locus_tag="CpC231_t01"
FT   tRNA            12174..12250
FT                   /locus_tag="CPC231_00060"
FT                   /old_locus_tag="CpC231_t01"
FT                   /product="tRNA-Ile"
FT                   /anticodon="(pos:12208..12210,aa:Ile,seq:gat)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            12259..12331
FT                   /locus_tag="CPC231_00065"
FT                   /old_locus_tag="CpC231_t02"
FT   tRNA            12259..12331
FT                   /locus_tag="CPC231_00065"
FT                   /old_locus_tag="CpC231_t02"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:12292..12294,aa:Ala,seq:tgc)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            12431..13210
FT                   /locus_tag="CPC231_00070"
FT                   /old_locus_tag="CpC231_0011"
FT   CDS_pept        12431..13210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00070"
FT                   /old_locus_tag="CpC231_0011"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09510"
FT                   /db_xref="GOA:D9QD66"
FT                   /db_xref="InterPro:IPR025576"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD66"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400880.1"
FT                   /protein_id="ADL09510.1"
FT                   /translation="MTRVSTPRKSRRSPGWIPNQHGAWFMVTVPAIIGVALAPAWIDIP
FT                   LLLLWWCGYFAFFAASVWMRGRYRKHHLPPLVTYGVVTGISGLVVLLCQWQLVVWIPAF
FT                   LPLIGIAVYETWRRRPRSLLSGLATVCAACLILPVITWAGDGLTVRVWAICGVLLLYFA
FT                   GSIPYVKTLIRERGSRPWLIGSITFHIVFLIIACVAAAYQMVHVAVAVVAGILLLRAWL
FT                   MPVTGARRERLWTPRQVGLLDALLGVLVVLTAVLPPA"
FT   gene            13538..14053
FT                   /locus_tag="CPC231_00075"
FT                   /old_locus_tag="CpC231_0012"
FT   CDS_pept        13538..14053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00075"
FT                   /old_locus_tag="CpC231_0012"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09511"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD67"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799820.1"
FT                   /protein_id="ADL09511.2"
FT                   /translation="MSSNKNVALRNLAVAAGATALGLGAVFGTAGAAMAADEPATPPAV
FT                   NAEKPAPSIEQDTPVDVDKPETLDPDEKTPEIDDRDDVLKYEPTTVKAGHTAYAEIKGD
FT                   VDEDTIFGYSQSGIPEGWFVSVDEETGKVSVSASPDAKPGDTYTVKVKVVDLDGKVTWA
FT                   EAPFTVGE"
FT   gene            14286..14358
FT                   /locus_tag="CPC231_00080"
FT                   /old_locus_tag="CpC231_t03"
FT   tRNA            14286..14358
FT                   /locus_tag="CPC231_00080"
FT                   /old_locus_tag="CpC231_t03"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:14319..14321,aa:Ala,seq:tgc)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            14363..14611
FT                   /locus_tag="CPC231_00085"
FT                   /old_locus_tag="CpC231_0013"
FT   CDS_pept        14363..14611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00085"
FT                   /old_locus_tag="CpC231_0013"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: GeneMarkS-2+."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09512"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD68"
FT                   /inference="COORDINATES:ab initio prediction:GeneMarkS-2+"
FT                   /protein_id="ADL09512.2"
FT                   /translation="MKKTTSKFLEVVFLHEIGFEGMGGGVDTLKTITPNYQDAAAEVQQ
FT                   PSLEKETGLWADAAHPTGTGMRGCPRLRGEACAAQAL"
FT   gene            14684..15685
FT                   /locus_tag="CPC231_00090"
FT                   /old_locus_tag="CpC231_0014"
FT   CDS_pept        14684..15685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00090"
FT                   /old_locus_tag="CpC231_0014"
FT                   /product="substrate-binding domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09513"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD69"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558533.1"
FT                   /protein_id="ADL09513.1"
FT                   /translation="MKNLRFPLHAAVITLAASVVLSACSATGGAPRSSNITGGQSGGVD
FT                   TPRYVVAMVTHGAPGDTFWDLIRKGAEDAAKKSNIELRYASDPEAPNQSNLIQNAIDSK
FT                   VDGIAVTMPNAEAIGPTAKKAVAAKIPTVALNAGLDAYQKYDISAFFGQEEKVAGTLAG
FT                   KRLAQDGAKHALCVIHEQGNSSQEARCAGLKEGLADADVEILYVNGKDMTSVQSTVQAK
FT                   LAQDKSIDWVMGLVAPVALTSVDAVKNSGSSAKISTFDTNAQLVTAIKNGTVQWAVDQQ
FT                   PYLQGYLAIDALWLAQRNGSTVGGNRPVYTGPSFVDATNVDKIADSAKEGLR"
FT   gene            15682..16767
FT                   /locus_tag="CPC231_00095"
FT                   /old_locus_tag="CpC231_0015"
FT   CDS_pept        15682..16767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00095"
FT                   /old_locus_tag="CpC231_0015"
FT                   /product="ABC transporter permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09514"
FT                   /db_xref="GOA:D9QD70"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD70"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799822.1"
FT                   /protein_id="ADL09514.1"
FT                   /translation="MIIPRPTAQSAAASTADVGTATKSDDRLRRRTGFSALIRRPEFAS
FT                   LLGAVAIFVLFLSVAPSFRSIDALTTVLYASSTLGIVAVSVGLLMIGSEFDLSSGVAVT
FT                   TAALAATMLNYNLHLNSWVGALLSLFIALAIGALSGYLVTKTGIDSFLITLAAFLMLQG
FT                   LNLAITKLVTSQVATPSIADMEGFPSAQKVFAGTVHIGSVSVRATVFWWIFFVAASSWL
FT                   LFKTRFGNWIFAVGGDANAARASGVPVARVKIILFMFVGFAAWFVGMHNLFTFDSIQAG
FT                   QGVGNEFLYIIAAVIGGCAMTGGRGTIIGTAIGALIFGMTNQGIVYAGWNPDWFKFFLG
FT                   AMLLFAVLTNTSFATLTKGRK"
FT   gene            16769..17542
FT                   /locus_tag="CPC231_00100"
FT                   /old_locus_tag="CpC231_0016"
FT   CDS_pept        16769..17542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00100"
FT                   /old_locus_tag="CpC231_0016"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09515"
FT                   /db_xref="GOA:D9QD71"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD71"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910426.1"
FT                   /protein_id="ADL09515.1"
FT                   /translation="MDTSTTPIIELRDITKSYGAFDALRGVNLSVASGEVTCVLGDNGA
FT                   GKSTLIKILSGLHKQTSGELLIDGQPVTFSGPRAALDNGIATVHQNLAVVGQMSVWRNF
FT                   FLGQELTGFLGRLRESEMRSIAQEQLKTMGIDLPDIDVEVESLSGGQRQVVAIARAVYF
FT                   GARVIILDEPTAALGVKQSSMVLRFVAAARDKGLGVVLITHNPHHAYLVGDRFTILNLG
FT                   NQILNASRDQVTLEQLTQQMAGGGELEALSHELSR"
FT   gene            complement(17610..18281)
FT                   /locus_tag="CPC231_00105"
FT                   /old_locus_tag="CpC231_0017"
FT   CDS_pept        complement(17610..18281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00105"
FT                   /old_locus_tag="CpC231_0017"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09516"
FT                   /db_xref="GOA:D9QD72"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD72"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014654890.1"
FT                   /protein_id="ADL09516.1"
FT                   /translation="MNNSTIRGAILVTKAAYDKYANYRDRKTREAYDALLNAADSYDDI
FT                   HKDVKANVTEFYDQSQERVSSLTEQARKRLDSAIADAAAAKDNTVKTVNKKSKKAQKAA
FT                   RKAAKSAKKSAAPKKQPSFGKRLFNFSVFTTILATIGAVAYYFLSKRNVVSTEPPHVED
FT                   FGADSVNTEESRLVYSTQTPVDDEEEHVSSPEEGATERDEKLLGSLEDQLRQHTDSKDT
FT                   K"
FT   gene            18359..18895
FT                   /locus_tag="CPC231_00110"
FT                   /old_locus_tag="CpC231_0018"
FT   CDS_pept        18359..18895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00110"
FT                   /old_locus_tag="CpC231_0018"
FT                   /product="peptidylprolyl isomerase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09517"
FT                   /db_xref="GOA:D9QD73"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD73"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910428.1"
FT                   /protein_id="ADL09517.1"
FT                   /translation="MMVRMTLKTATAILHTNRGDVAIELFGNHAPKTVENFVTLSDGSA
FT                   DYKTENASGTTEGPFYDGAVFHRIIDGFMIQGGDPTGTGRGGPGYMFADEFHPELQFDR
FT                   PFLLAMANAGPGTNGSQFFITVVPTPHLNNHHTIFGEVTDPASQKVVMDIAQTATDRMD
FT                   RPVEPVVIESVEITE"
FT   gene            18957..19727
FT                   /locus_tag="CPC231_00115"
FT                   /old_locus_tag="CpC231_0019"
FT   CDS_pept        18957..19727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00115"
FT                   /old_locus_tag="CpC231_0019"
FT                   /product="rhomboid family intramembrane serine protease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09518"
FT                   /db_xref="GOA:D9QD74"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD74"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523731.1"
FT                   /protein_id="ADL09518.1"
FT                   /translation="MFHENGGMSDPRILHAAYKQAPVTVLLSLSTLIIFLITAFQSQSI
FT                   TDNLYDSWIGTHWILYTPEMHEPLGMLRAIGSMFLHIGPGHLAINIFLLFFLGREIEQC
FT                   IGSALFCAAYFISGLGASLMIMIMDPLSPTAGASGAIYGLMAIMVAIAVTRKTDIRAPL
FT                   ILVAVNVGYSLIADNVSLWGHIGGLVAGSVVALPLMAFHRKHVIAGGTGGFLVYGMPRN
FT                   HRAFTKDRLITWFVVAAIVVCEAIGIWIVGMKLL"
FT   gene            20670..21017
FT                   /locus_tag="CPC231_00120"
FT                   /old_locus_tag="CpC231_0021"
FT   CDS_pept        20670..21017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00120"
FT                   /old_locus_tag="CpC231_0021"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09520"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD76"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014654892.1"
FT                   /protein_id="ADL09520.1"
FT                   /translation="MAERSVVALRSLAPVARGRGSKGGFTIEKIVSGERTSKQFSFAWS
FT                   CTSQGKEMKNGTIKLTNGDVHHEKQLDKDASCVIKEEDADAASEKKHSLKWSVDSEEKR
FT                   RGVRNHIHQAA"
FT   gene            22235..22588
FT                   /locus_tag="CPC231_00125"
FT                   /old_locus_tag="CpC231_0023"
FT   CDS_pept        22235..22588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00125"
FT                   /old_locus_tag="CpC231_0023"
FT                   /product="CRISPR-associated protein Cas5"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09522"
FT                   /db_xref="GOA:D9QD78"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD78"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240887.1"
FT                   /protein_id="ADL09522.1"
FT                   /translation="MTSIIQRTYLAEAEFIVEVASDTHGELLRDALRAPKFSTYLGRKA
FT                   FAPAFPFFLGATADVDVLHRIPACDLSGTKRDTARVQIHHRSAGLQTSAEHINVPAVQE
FT                   RSDWLEKTKALFT"
FT   gene            complement(22663..23703)
FT                   /locus_tag="CPC231_00130"
FT                   /old_locus_tag="CpC231_0024"
FT   CDS_pept        complement(22663..23703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00130"
FT                   /old_locus_tag="CpC231_0024"
FT                   /product="transposase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09523"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD79"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799830.1"
FT                   /protein_id="ADL09523.1"
FT                   /translation="MIMASHPYRNHCNVCGNLLKKNGKTSTGKTRYRCKGCGASSTATR
FT                   SGTLHQRQMKDFITWLLGPTSRYNNDISRAQRRSMSWCWQVPVPQPEMLDNAYILVLDK
FT                   GASFRPEHLLVAYNSSHVLGWKWVDKDNKIACMQVHDHFPQPSAAVIDGSQSTAQTIQS
FT                   IWPGIPVRRCLSHIRKSVDQKTSQTPRTQPAIEIKELTDSLKNVYTSEQAKLWLARYAR
FT                   WEDRWKELLKHRTNVSKDNCSIDDYEWEWTHKELRTIRFMYRKLIKKEELFFPFSGSDI
FT                   VAHNVFLSRRDSQLGETISTDITNLFSAHRGINHDHGCRMVEWYLNSKTESPFIPERII
FT                   SHDHWR"
FT   gene            24111..25034
FT                   /locus_tag="CPC231_00135"
FT                   /old_locus_tag="CpC231_0025"
FT   CDS_pept        24111..25034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00135"
FT                   /old_locus_tag="CpC231_0025"
FT                   /product="phospholipase D"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09524"
FT                   /db_xref="GOA:D9QD80"
FT                   /db_xref="InterPro:IPR016674"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD80"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799831.1"
FT                   /protein_id="ADL09524.1"
FT                   /translation="MREKVVLFLSIIMAIMLPVGNAAAAPVVHNPASTANRPVYAIAHR
FT                   VLTTQGVDDAVAIGANALEIDFTAWGRGWWADHDGIPTSAGATAEEIFKHIADKRKQGA
FT                   NITFTWLDIKNPDYCRDARSVCSINALRDLARKYLEPAGVRVLYGFYKTVGGPAWKTIT
FT                   ADLRDGEAVALSGPAQDVLNDFARSENKILTKQKIADYGYYNINQGFGNCYGTWNRTCD
FT                   QLRKSSEARDQGKLGKTFGWTIATGQDARVNDLLGKANVDGLIFGFKITHFYRHADTEN
FT                   SFKAIKRWVDKHSATHHLATVADNPW"
FT   gene            complement(25087..25953)
FT                   /locus_tag="CPC231_00140"
FT                   /old_locus_tag="CpC231_0026"
FT   CDS_pept        complement(25087..25953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00140"
FT                   /old_locus_tag="CpC231_0026"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09525"
FT                   /db_xref="GOA:D9QD81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD81"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366233.1"
FT                   /protein_id="ADL09525.1"
FT                   /translation="MHTPKTISTDLPTTAGISTDHTSALRTENVTLSWDKHVVSTDLSV
FT                   DIPTGKFTAIIGPNGCGKSTLLKSCARILAPDTGSIYLNQHNLTHLHTKEIAKQLALLP
FT                   QSTITPADITVEELVRRGRFPHHNWLHQWTAEDTRAVDAALNAASVKELTHKRVTDLSG
FT                   GQRQRVWLAMVLAQNTPTVLLDEPTTFLDIAHQYQLLELARSLTTQLNRTVVAVLHDLQ
FT                   QAVRYADHLIVMKNGSIVATGSPQEVISAELISEVFNITVRTMLIDDQLVVIPTELPVP
FT                   NVAMMQG"
FT   gene            complement(25962..26948)
FT                   /locus_tag="CPC231_00145"
FT                   /old_locus_tag="CpC231_0027"
FT   CDS_pept        complement(25962..26948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00145"
FT                   /old_locus_tag="CpC231_0027"
FT                   /product="iron chelate uptake ABC transporter family
FT                   permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09526"
FT                   /db_xref="GOA:D9QD82"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD82"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366234.1"
FT                   /protein_id="ADL09526.1"
FT                   /translation="MTHRRSLYTALILTLLLAISAAVAVSLPGAGITTAKVWSVFQGDD
FT                   SSLAHTIVFSWRAPRIVTALFVGAALGIAGSLFQALTRNPLGSPDIIGFNTGAYTGVLL
FT                   TMMAGMTSFASVAFGALAGGLATALAVMAFSVRVRIDGLRIILVGLGVSAMLSAFNRWL
FT                   ITRGDLNTALSAASWGAGTLNGIRWAAATPAVIALGIIVALALLLGSRIDILNLGDDTA
FT                   TALGLPVNPSKFVLLIVGVLLIATTTAIAGPISFIALASPHIAQRITASPRTPLLVSAL
FT                   TGATLLLVADIIAQRAFAPVQLPVGLVTVVIGGIYLLSLIASASRRA"
FT   gene            complement(26948..28015)
FT                   /locus_tag="CPC231_00150"
FT                   /old_locus_tag="CpC231_0028"
FT   CDS_pept        complement(26948..28015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00150"
FT                   /old_locus_tag="CpC231_0028"
FT                   /product="iron chelate uptake ABC transporter family
FT                   permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09527"
FT                   /db_xref="GOA:D9QD83"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD83"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523733.1"
FT                   /protein_id="ADL09527.1"
FT                   /translation="MVSTASSNPSPIRGFLRKSQPNVQRTRRSLLVVVLLLAVLLVVGS
FT                   IASVMIGARLIPLPEILNALFHPDPTNVSSTIVWDRRVPRTLLAIVAGMSLGLAGTLSQ
FT                   ALTRNPLADTGALGINSGAAFAIVVGIALFGASSPWAFLALALLGACGAAAVVYSVGTH
FT                   RSATADPVRLVLSGVALSAILSGIGEGLSLVNPQAFDRLKSWMVGSVDVGTLMPLGIAG
FT                   VGLAFGIVLTIACAHGLNALALGDAMATSIGASTARIRFISFIAVVILAASATAAAGVI
FT                   IFLGLMVPHVARWIVGPDLPRVLITSLLLGPLVLVVADIVGRLIVPGEFPAGVVVSFIG
FT                   APFLIAYAQSRKGDM"
FT   gene            28062..29114
FT                   /locus_tag="CPC231_00155"
FT                   /old_locus_tag="CpC231_0029"
FT   CDS_pept        28062..29114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00155"
FT                   /old_locus_tag="CpC231_0029"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09528"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD84"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910452.1"
FT                   /protein_id="ADL09528.1"
FT                   /translation="MKDTQSLNTWSHRIAVMLALFLSISLIFSLAACSSEEKQSKDAGQ
FT                   GNADVATGGAHFSTADAETAKLGSDAAPGEFPRTVKHALGETEIKEQPKRVVVLDTGEL
FT                   DSVLSLGITPVGMVTTKGANPVPSYLADKVKDVKSVGTINEINVEEIAALQPDLILGSK
FT                   LRADKIYAQLAEVAPTVFSIRPGFPWKENFLLIGDALGKEKEAEAKLNEYTEKVETIKA
FT                   SVPADTTVSLLRFMPKRIRLYGNKSLLGVILKDAGLARPENQNIDELATEISPETIDQA
FT                   EGSVIFYSSYGKPDATGQDAIVNGAAWKNLNAVKNGQAHEVNDDVWFLGLGPTGAMQIV
FT                   EELKELLPKK"
FT   gene            complement(29246..29515)
FT                   /gene="crgA"
FT                   /locus_tag="CPC231_00160"
FT                   /old_locus_tag="CpC231_0030"
FT   CDS_pept        complement(29246..29515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crgA"
FT                   /locus_tag="CPC231_00160"
FT                   /old_locus_tag="CpC231_0030"
FT                   /product="cell division protein CrgA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09529"
FT                   /db_xref="GOA:D9QD85"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD85"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910453.1"
FT                   /protein_id="ADL09529.1"
FT                   /translation="MPKSKITQSSAPFASSSTSNRTPVKINSTGTPVWYKTIMFGLILA
FT                   GLLWLIVNYLAGEDIAFMMSLGAWNYGIGFGLFIVGLLMTMGWR"
FT   gene            complement(29628..31622)
FT                   /gene="pknB"
FT                   /locus_tag="CPC231_00165"
FT                   /old_locus_tag="CpC231_0031"
FT   CDS_pept        complement(29628..31622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknB"
FT                   /locus_tag="CPC231_00165"
FT                   /old_locus_tag="CpC231_0031"
FT                   /product="Stk1 family PASTA domain-containing Ser/Thr
FT                   kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09530"
FT                   /db_xref="GOA:D9QD86"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD86"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240895.1"
FT                   /protein_id="ADL09530.1"
FT                   /translation="MNDVIAGRYELGEVIGTGGMSEVYSATDTLLGREVAIKMLRADLA
FT                   RDVNFRERFRREAQNSGKLNHPAIVAVYDTGETERAGISTPYIVMERVHGRTLRDIVRE
FT                   DGPLSPTEAAQTLLPVCQALQFSHDAGIIHRDIKPANVMITNTGAVKIMDFGIARALDD
FT                   ATSAMTQTSAVIGTAQYLSPEQARGKLADARSDVYALGCVLYETLTGRPPFEGETPFAV
FT                   AYQHVQEDPAKPSEFVSDLTPTAAVNVDAVVLTAMAKHPGDRYQTAMEMGADLERLARH
FT                   AVTEAARHYVSPASLISQEPNPTTIVPVTQLDQPEADPVTSRAERAGYERSAFAGPAHA
FT                   AEEDRSGMSKAMKAVLAVLAVLVLGVGGAFAYDYVSNSSKNRSLVNIPKLEKTSQQDAV
FT                   NQLEQLGLQVNVIEEANPEVPRGKVIRTNPTSGSSVQKNTTVTVIVSSGKEVTEVPDLA
FT                   RKNTADAAKILEEAGLQLDSTVREESSDSVPNGEIIEQTPSAGSQVSRGSKVVITVSTG
FT                   VQNVRVPVVTGMKWDQAEGNLTSLGFVPDVRTVDAPEPAGTVVAVSGEGTEVPKGSTIT
FT                   VKVSNGQMFNVPNITRLTVADAVRALNAAGWTGTASKLTQGERVPTVSLSDQNLIASQV
FT                   PAAGTPLRKDSPIEIHLYEFSLSALTGTR"
FT   gene            complement(31619..33139)
FT                   /locus_tag="CPC231_00170"
FT                   /old_locus_tag="CpC231_0032"
FT   CDS_pept        complement(31619..33139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00170"
FT                   /old_locus_tag="CpC231_0032"
FT                   /product="protein kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09531"
FT                   /db_xref="GOA:D9QD87"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD87"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799836.1"
FT                   /protein_id="ADL09531.1"
FT                   /translation="MSIDYASPDPALQALIGDDYRLQWVVGTGGMSTVWLADDTRNQRE
FT                   VAVKVLRPEFSDNNEFLSRFRNEALASENIISENVVQTFDYRELTDPSGRTLCFIVMEY
FT                   VRGESLADMLARKGTLDEDLALDVLEQAAHGLSIIHRMGMVHRDIKPGNLLITQNGKVK
FT                   ITDFGIAKAAAAVPLTRTGMVVGTAQYVSPEQAQGKDVTEASDVYSLGVVGYEMLAGRR
FT                   PFTGDSSVSVAIAHINQAPPALPTTVSAPARELIGIALRKDPAHRYADGNELALAVSTT
FT                   RMGQRPPQPQSAQLQQIAPEPTPTASTHALGQTAQPTTVIPATGEVPQTVSVGQMTGTH
FT                   TGYSAAPATIPPEEKKKSSGGVGTGLAVGVLLAALFGAGVWAASQGIFGDLLGGSDQPS
FT                   SSVNPETITATVTETPTIREEPRPIQRPQVTPTISSEPSEFPDASESVVPLPPTDNPRT
FT                   APTVDLNERSQVPSTHQNTSPTPTRGNGSDPIADLLNTLNTPEQGGAP"
FT   gene            complement(33147..34607)
FT                   /locus_tag="CPC231_00175"
FT                   /old_locus_tag="CpC231_0033"
FT   CDS_pept        complement(33147..34607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00175"
FT                   /old_locus_tag="CpC231_0033"
FT                   /product="penicillin-binding protein 2"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09532"
FT                   /db_xref="GOA:D9QD88"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD88"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240897.1"
FT                   /protein_id="ADL09532.1"
FT                   /translation="MNRSIRFTSVFALLLILVLLVNLTRIQGFSQEKYAQSPYNRRAFI
FT                   EAKSQARGQISAGGQVLAESYKDENGYYQRRYVTNPIAYGPVQGYLSDIYGTAGLESSY
FT                   NGILNGTDDSLGFSRWWDDLLGNEHKGANVELTLVPSVQEVAYNQLANAGYEGAVVALR
FT                   PSTGEVLAMASTPSFDPAAIVDPTTAESTWAALNSNPGNPLLNHATQEILPPGSTFKVI
FT                   TTAAGLNAGYGPDSKLTGQSQITLPGTTATLENYAGQTCAGAKEVTLATAFQFSCNTAF
FT                   VQMGIDTGAEKLQEAANAFGVGDSYDLGIGMARGTIGDISSAAARGQSAIGQKDVAMSV
FT                   LQNAVIAATVANGGKRMEPYLVSKIVGQDLKTISETKPRELNQAISPQVSTTLTQLMRL
FT                   SERHTAGYTGADIASKTGTAEHGEDSRNSNPHAWYIAFGPSVNADVAVAVVVKNGGSAG
FT                   QAATGGSVAAPIGRAVIAAAQAARGAQR"
FT   gene            complement(34604..35977)
FT                   /locus_tag="CPC231_00180"
FT                   /old_locus_tag="CpC231_0034"
FT   CDS_pept        complement(34604..35977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00180"
FT                   /old_locus_tag="CpC231_0034"
FT                   /product="FtsW/RodA/SpoVE family cell cycle protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09533"
FT                   /db_xref="GOA:D9QD89"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD89"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400888.1"
FT                   /protein_id="ADL09533.1"
FT                   /translation="MSFAQRLASRRIEFGLLVLATVLIGVTLINLNMAQGLKVTTETLW
FT                   VIGGFIGVFTIAHLAICFTAPNADQLMLPVASVLNGLGLVTVYRLDLATGKSLAGRQVI
FT                   WTLVAIILMIVVLTVIRNHRILSRYSYILGLLGLVLLALPLVWPTKMNADANIWISIGP
FT                   FSVQPGEFSKILLLLFFAQLLVNKRALFNVAGYRLLGLEFPRLRDLGPILAVWFFAILV
FT                   MAGENDFGPALLLFSTVLGMLYLATNRVSWLLIGAMLVVIGGTTLYQISSKIQSRVNNF
FT                   MDPLANFNGTGYQLSQSLFGLSSGGVAGSGLGQGHPELIPVAESDFILAVLGEEIGLVG
FT                   LAAILVLFAIFVTRGFRTALRARDSYGKLVASGLSLTIAIQVFVVTAGITALMPMTGLT
FT                   TPFMSQGGSSLMANYILLGLILRISHSAHSGQSDVAGATAQGGSSVGHRPVVSKEAQR"
FT   gene            complement(35978..37489)
FT                   /locus_tag="CPC231_00185"
FT                   /old_locus_tag="CpC231_0035"
FT   CDS_pept        complement(35978..37489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00185"
FT                   /old_locus_tag="CpC231_0035"
FT                   /product="protein phosphatase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09534"
FT                   /db_xref="GOA:D9QD90"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD90"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240899.1"
FT                   /protein_id="ADL09534.1"
FT                   /translation="MLRLNYAVASDRGLVRGNNEDSAYAGPHLIALADGMGGHAAGEVA
FT                   SQLMIKHLMPLDASPDDNDMLALLASGADDANRAIAQGVRDEPATNGMGTTLTAIMFNG
FT                   TDLAMCHVGDSRGYRYRDGELEQITVDDTYVQSLVDKGELSPEDVSTHPQRSMILKAYT
FT                   GRPVEPTLTMLEARAGDRLLLCSDGLSDPVTHSTIETAIAQGTPAEVARKLVDLALRSG
FT                   GPDNVTVVVADIVEGPSDDQELPVVPVTAGALNGEQPEDPRPDTSAGRAAIVMAARQPQ
FT                   TIPARDAHTVTADQANAVNTNEPPTDGEKKSGRGKFWAGIITLLVIAAAIAGGWWAKTM
FT                   VDNNYYVTTANEEGLENAIVIERGVDLEFFGKPLHSTYQYACLNSSGDLSLIPENSHDT
FT                   CHRFRLKDLTESARSSVASLPEGNYNDVQQQVQQLANQLLPVCVTREAVTKPDEKKPED
FT                   QAPNGAPPQAEANPAAPQEQEGASPSKKPEPGDLSTPGVTCREVK"
FT   gene            complement(37489..37968)
FT                   /locus_tag="CPC231_00190"
FT                   /old_locus_tag="CpC231_0036"
FT   CDS_pept        complement(37489..37968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00190"
FT                   /old_locus_tag="CpC231_0036"
FT                   /product="FHA domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09535"
FT                   /db_xref="GOA:D9QD91"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD91"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240900.1"
FT                   /protein_id="ADL09535.1"
FT                   /translation="MESVIVFSLRIALLVLLWLLILLALWIQRKDAKTASQSSGAPVAA
FT                   PAIPGAMNVSKPAKRGGTPRQIVIVEGPLMGSRLDLGSLDEITLGRAKECTFVVGDDYA
FT                   SARHARLIKRGNEWFVEDLDSRNGTFVGGYRIDQPEKISTGSDIKIGRTTVRLAA"
FT   gene            complement(38045..38998)
FT                   /locus_tag="CPC231_00195"
FT                   /old_locus_tag="CpC231_0037"
FT   CDS_pept        complement(38045..38998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00195"
FT                   /old_locus_tag="CpC231_0037"
FT                   /product="DUF3662 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09536"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD92"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240901.1"
FT                   /protein_id="ADL09536.1"
FT                   /translation="MSLMDKMARLDSAMQRGLDNGFAFVFGGKVVPAEIEELLKQEAQD
FT                   NLVRTYEGDVEAPNVFHIGVSPKDLANLSQRYPSLADDFADQMSRYNRNQGWTCVGPVV
FT                   VTIAIESGLRTGQLRAFSSVDPTPTGYSGFQGIDYAAPDSVDADDIEDIEDADNTDPKG
FT                   SQWDSDSFQDDESEDVVQHYQSPQFPQEPRTEYLTAQAPEAIHTEVPVPPAAPTTPTVS
FT                   LLLQDGSSRTYLVHEGSNIIGRSNDADFRLPDTGVSRQHAEITWNGHDAILTDLKSTNG
FT                   TTVNDTPIDNWLLEDGDVITVGHSHIEVRIVHPTYY"
FT   gene            39348..39431
FT                   /locus_tag="CPC231_00200"
FT                   /old_locus_tag="CpC231_t04"
FT   tRNA            39348..39431
FT                   /locus_tag="CPC231_00200"
FT                   /old_locus_tag="CpC231_t04"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:39382..39384,aa:Leu,seq:cag)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            complement(39654..40367)
FT                   /locus_tag="CPC231_00205"
FT                   /old_locus_tag="CpC231_0038"
FT   CDS_pept        complement(39654..40367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00205"
FT                   /old_locus_tag="CpC231_0038"
FT                   /product="CPBP family intramembrane metalloprotease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09537"
FT                   /db_xref="GOA:D9QD93"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD93"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522938.1"
FT                   /protein_id="ADL09537.1"
FT                   /translation="MSQTQNRYAGISPPPRITHLLWATVLLISMVIGAVSGGFAAGFLA
FT                   KKIQAPVTDFIVVGGMLGASLLGIALFYLGFIQRCHWGRRELGFISSSRSLWHLMWWFP
FT                   LTVTIGSIGAMIVGTSMGLSSKEADNAAAGFHLGPIASIALLAGTILIVPFFEEVIFRR
FT                   VLLDWLATKMPIQFASFLVILAFTLAHVSPAIMAYVFFLGISLGLARLWFSTMWAPLIV
FT                   HAANNALVTIIALSA"
FT   gene            complement(40506..41036)
FT                   /locus_tag="CPC231_00210"
FT                   /old_locus_tag="CpC231_0039"
FT   CDS_pept        complement(40506..41036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00210"
FT                   /old_locus_tag="CpC231_0039"
FT                   /product="DUF2812 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09538"
FT                   /db_xref="GOA:D9QD94"
FT                   /db_xref="InterPro:IPR021359"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD94"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799839.1"
FT                   /protein_id="ADL09538.1"
FT                   /translation="MNTIRIGSGLAFSPNKDLELFSRMAAKGKHLSGVGLAGHGWTFKD
FT                   GEPEHAIFDLVYEHNPHQDFYDIFAAAGWTHVLSASNIHVFKAPPGTTPAHTSIESKRE
FT                   EFTRQIKIFSRYSATALAVFIAAVFIITYVQLPSWVAPLVLVITLAPVVYTVMPLLGYC
FT                   WHRFRLPAPQSLA"
FT   gene            complement(41033..41356)
FT                   /locus_tag="CPC231_00215"
FT                   /old_locus_tag="CpC231_0040"
FT   CDS_pept        complement(41033..41356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00215"
FT                   /old_locus_tag="CpC231_0040"
FT                   /product="PadR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09539"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD95"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910473.1"
FT                   /protein_id="ADL09539.1"
FT                   /translation="MARSSGFDNGNLSDAAVHILLALIEPRHGYAVMQFLHDASHGHID
FT                   IGPASLYTTLKKLTAANLITEVDTDENRRIYHITPHGHEVLTDNLERRRQLITMVDSIL
FT                   ETS"
FT   gene            complement(41531..42529)
FT                   /locus_tag="CPC231_00220"
FT                   /old_locus_tag="CpC231_0041"
FT   CDS_pept        complement(41531..42529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00220"
FT                   /old_locus_tag="CpC231_0041"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09540"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D9QD96"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240905.1"
FT                   /protein_id="ADL09540.1"
FT                   /translation="MRISQSLTVITSTALLLTACGSSVTAPETSTSSTAKAVTISNCGR
FT                   ELSFDKAPEALVGMHPAQTELLIRLGLKDKIVGQAQAKAQALPDDVVDKAKNIPTIGGV
FT                   MPPSREELLAVKPDFVYSPTTYEFSAKQGFASIEQLKEAGAAAYVATGGCEDRRMTGEV
FT                   SDLFTDLANLGTIFGVQEEAQKMIDKDKAELEGVENALKDQKKLRVAQIYREGDTLQAI
FT                   GAGIEYDILKRAGADNVFTPDQKNFSEFFASTLTPEALAAENPEAIVFAAYDADHEQST
FT                   RDYLTKTFPDMPAVRENRIISVSTSDMFPGTQGNIKAVKHIASQLYPGAVK"
FT   gene            complement(42539..43309)
FT                   /locus_tag="CPC231_00225"
FT                   /old_locus_tag="CpC231_0042"
FT   CDS_pept        complement(42539..43309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00225"
FT                   /old_locus_tag="CpC231_0042"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09541"
FT                   /db_xref="GOA:D9QDG8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDG8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910474.1"
FT                   /protein_id="ADL09541.1"
FT                   /translation="MNIEFDCVSVELSGRTVVDRVSASVESGQILGLVGPNGSGKSTLL
FT                   RTVYRGLNPASGTVRLGGEDVRALSHREVARRVAVMLQDSPTDFDLTVEETVMLGRAPH
FT                   HSILGRDTDKDVRIVEEAMHATDVVELADRMVFTLSGGQRQRVLLARALAQRTPALLLD
FT                   EPSNHLDISHQHELMSTVAYHGGTVIAALHDLNLAMHYCDRVLLLKQGSVVAMGTPSQV
FT                   LTPELIRETFAINAHLLPGPVDPVLAFTPLSSSL"
FT   gene            complement(43306..44430)
FT                   /locus_tag="CPC231_00230"
FT                   /old_locus_tag="CpC231_0043"
FT   CDS_pept        complement(43306..44430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00230"
FT                   /old_locus_tag="CpC231_0043"
FT                   /product="iron chelate uptake ABC transporter family
FT                   permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09542"
FT                   /db_xref="GOA:D9QDG9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDG9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522074.1"
FT                   /protein_id="ADL09542.1"
FT                   /translation="MPHHNAIKQLSGKTAGASKQLTTRRRQTAKTRLICAVLTVAILIL
FT                   LIVSGATGTVDVSLLEAAQIVTGHLIPNMPWMSDGSLSTLQDQAVWQFRLPRTLLAGVA
FT                   GAGLALAGALMQVTVRNPLAEPYILGVSSGASVGAVLVIVLGSAALGGLPLNIAAFLGA
FT                   LCACIAVSLLARKDGTLSPTRMILAGVALGTLLSAITSYLTISTSAQNVVSVMFFLLGS
FT                   VSAASLSSVVAPLVALLVSLVVTYMLARHLNVLMTGDESAMSLGVNATKLRALLLVIAS
FT                   VLTGTVVAVAGGIGFVGLVVPHIARIAVGADHRRMIPVTVLGGMAFLMAADLLARTIAH
FT                   PTEIPLGILTAFVGAPFFLWLMRQGGAEKAGYGR"
FT   gene            complement(44501..45883)
FT                   /locus_tag="CPC231_00235"
FT                   /old_locus_tag="CpC231_0044"
FT   CDS_pept        complement(44501..45883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00235"
FT                   /old_locus_tag="CpC231_0044"
FT                   /product="magnesium transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09543"
FT                   /db_xref="GOA:D9QDH0"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDH0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240908.1"
FT                   /protein_id="ADL09543.1"
FT                   /translation="MHQANLSPTTPSADATMVEVLRSHTPEAAAQWFAAMPHSTVTTLI
FT                   TDLSTDDLYTLATTLTPENARTLLTVFGPEATARVLHALSPRECAELVVTLDTDVAAQT
FT                   LRRLAMDSEEFVDDLLSALPVATSAVLSRVLSWPAECAGAWMRPEAIKIPVHSSVGTAA
FT                   EACRQAPSTFNEGIFIVDSDMHLVGWLAPATLITSPDRTPVEDVMVDAATVRTWSTKPL
FT                   SDQEQATELAHRSPTGTVPVLDADHVLGVITRNSITRIHESELREDNALQGGASPLEVS
FT                   YRQASIKQLWRVRIVWLALLFLAEMYTGTVLRHFQDELEAVVALAFFIPLLIGTGGNIG
FT                   TQITTTLIRAMSTESLRLHDMGRVLPKELGAGLLLGLAMGLLGAIRAWSLGVVQPVILT
FT                   VAIALVCICLWSSLIASFLPLLLKRFGADPAVVSGPMISTIVDGTGLVIYFTVARLIIL
FT                   GN"
FT   gene            complement(46161..47759)
FT                   /locus_tag="CPC231_00240"
FT                   /old_locus_tag="CpC231_0045"
FT   CDS_pept        complement(46161..47759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00240"
FT                   /old_locus_tag="CpC231_0045"
FT                   /product="DUF3459 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09544"
FT                   /db_xref="GOA:D9QDH1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDH1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525116.1"
FT                   /protein_id="ADL09544.1"
FT                   /translation="MFNPRNGLPVPPAWLETAIFYEIYPQSFYDSNGDGIGDIQGIVDK
FT                   LDYIADLGANALWINPCFDSPFKDAGYDVRDYYTVAPRYGTNADLEKLFTEAHNRGIKV
FT                   LLDLVPGHTSEQNDWFQYSCKAEPNQYSDRYIWTSHAFDNGDGLPFIGGEAPRNGTYIL
FT                   NFFKSQPALNYGFNKKTRPWQQSVDAPGPVANQEEMANIMRYWLDKGADGFRVDMADSL
FT                   VKFDGEDKQETIKVWQKIFARFRNDYPEAAFVSEWGKPIQALKAGFDMDFYLDWRNNGY
FT                   NILARNTDDPLGRSEDLSFFKQVSGTSPQEFIDQYWPQYEQIRDLGYFSLISCNHDTPR
FT                   LAPRLNDAERRLFFMFLLTMPGVPFIYYGDEIGMRYLDIPTKEGGYQRTGTRTPMQWDA
FT                   AKKNYGFSSAQTEELYLPQDTAADAPDAASQMLDPAALRPFIQKLIGLRSQHPELHADS
FT                   DFSFLWAHDNSRILAYRRESSDGKRCAVALNAGDTADSITLESPATIIVSSGDARVEDN
FT                   TVHLGPSSGVVVELA"
FT   gene            48050..48340
FT                   /locus_tag="CPC231_00245"
FT                   /old_locus_tag="CpC231_0046"
FT   CDS_pept        48050..48340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00245"
FT                   /old_locus_tag="CpC231_0046"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09545"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDH2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240910.1"
FT                   /protein_id="ADL09545.1"
FT                   /translation="MSCTTHAEHTHTHGPECGHVAVPHGDHVDYVHDGHLHREHEGHWD
FT                   ECETTEHHVHENHDHQHGPECGHVAVPHGDHVDYIHDGHRHAFHEGHWDDH"
FT   gene            complement(48497..49771)
FT                   /locus_tag="CPC231_00250"
FT                   /old_locus_tag="CpC231_0047"
FT   CDS_pept        complement(48497..49771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00250"
FT                   /old_locus_tag="CpC231_0047"
FT                   /product="MFS transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09546"
FT                   /db_xref="GOA:D9QDH3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDH3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523734.1"
FT                   /protein_id="ADL09546.1"
FT                   /translation="MGEEIITCPRFFPGDGKKLGSIYALAVTYFFVATCGAMTSLAISL
FT                   HFASRESGEALVSAVLISGACAQVFLSPLLTPFFDRFRPLTVAQTAAFIECVALVLLCF
FT                   FPEPAFLIAGNVVVATLSGLSIPAYFVIAEECAPSHNQAHVFSLLDTARLSGSFAGPAL
FT                   GGLLLDFGTLSTALAYEAAAVAGSFLVLCILGFRLRKNFAQINSTNTGRKPLKIFRSIL
FT                   EAPALLLTQPHTRQALTSIWAAIIFTSIYNVALVFYATETLQASGLIYAIVAQGFIAGR
FT                   IFGARISARLTETNALPTLVKAGAAMGLCIAIPGFVPSLLVCIPFFALAGVCNALQVAA
FT                   LRIVIVGSVRPAIKSKALSTMGTVNNSAMLVGYIVGAPVITSIGPSLALVVAGLGTMLF
FT                   TVLPPTWRALRIATRGKTVTSSPSC"
FT   gene            complement(50406..50615)
FT                   /locus_tag="CPC231_00255"
FT                   /old_locus_tag="CpC231_0048"
FT   CDS_pept        complement(50406..50615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00255"
FT                   /old_locus_tag="CpC231_0048"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09547"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDH4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300367.1"
FT                   /protein_id="ADL09547.1"
FT                   /translation="MLATNVTTQQHANIKAEPHAHTLDRSDTKFFDKLPPQLETELAGV
FT                   SPPGAATRRNPREDAPVGTHKIRR"
FT   gene            complement(50994..51638)
FT                   /locus_tag="CPC231_00260"
FT                   /old_locus_tag="CpC231_0049"
FT   CDS_pept        complement(50994..51638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00260"
FT                   /old_locus_tag="CpC231_0049"
FT                   /product="anti-sigma factor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09548"
FT                   /db_xref="GOA:D9QDH5"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDH5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014654914.1"
FT                   /protein_id="ADL09548.1"
FT                   /translation="MTPTGHSEPFDDFPHDVEALLAQAPAPIIPSAQLRDNILDAIADI
FT                   PQEEPEATHAPPIDVPAEPIADVIPLSGRRKFTRGFLAVAASVAIIAGGFAFWPQADPH
FT                   AEMHSILAASDVRQANTHAMGASLDIVVSSSMNEGGALVDGAPKLSEGMGAQVWAVMAD
FT                   GSTKSAGVIGPEDHDGVWMPLPGETSKVMITEEPLKGSSQPQGTVLAVVDV"
FT   gene            complement(51635..52222)
FT                   /locus_tag="CPC231_00265"
FT                   /old_locus_tag="CpC231_0050"
FT   CDS_pept        complement(51635..52222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00265"
FT                   /old_locus_tag="CpC231_0050"
FT                   /product="sigma-70 family RNA polymerase sigma factor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09549"
FT                   /db_xref="GOA:D9QDH6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDH6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240913.1"
FT                   /protein_id="ADL09549.2"
FT                   /translation="MISTLSVVELPVMDPDNLLVASAHGDQRAFAALYDLLAPQMLGLA
FT                   AQIIHDRAQAEEVIQEVFIELWRSAKSYDPAKGGARSWALRLTRLRAIDRLRSDVATKQ
FT                   RDNKDFLEQTTTWHAAEEEAVESLESQRVRKLVDAIGEPHRTAIMLAYFSGLTHPEIAQ
FT                   ATGVPLGTAKTRVRDGLKKLRSAMSLMQGGAQ"
FT   gene            complement(52282..52575)
FT                   /locus_tag="CPC231_00270"
FT                   /old_locus_tag="CpC231_0051"
FT   CDS_pept        complement(52282..52575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00270"
FT                   /old_locus_tag="CpC231_0051"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09550"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDH7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240914.1"
FT                   /protein_id="ADL09550.1"
FT                   /translation="MKNTTIRKALIIGAFSAAALGLTACGDDPAPASQTSTSESSQPSD
FT                   AMSKDAMTKEDAMTKDAMPKDAMDRMEHREGMDGKDHMDRMEHTEPSDAMKH"
FT   gene            52933..54570
FT                   /locus_tag="CPC231_00275"
FT                   /old_locus_tag="CpC231_0052"
FT   CDS_pept        52933..54570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00275"
FT                   /old_locus_tag="CpC231_0052"
FT                   /product="redoxin domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09551"
FT                   /db_xref="GOA:D9QDH8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041017"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDH8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240915.1"
FT                   /protein_id="ADL09551.1"
FT                   /translation="MLELILIGLIGGIVTGISPCILPVLPVVLAVSVDRKPTHVISGLA
FT                   LSFATITLVGTLILGALGLPKDVLRWGGIILLVLVGVGMIVPKLGEWIEAPFNRIPRPT
FT                   SLQLKARNKGGFAIGLALGAVYVPCAGPILAAITVAGATGDIGLSTVILTVAFAIGASL
FT                   PLLIFALAGNKMGERIDAVRKHRGIVGAIILALALALALNVPEKLQRSLPDWTAGVQER
FT                   LSDNEAVQNALSNGNGNLDSCRRADKGSLQDCGSAPEFEGLTGWFNTDKPVGTHDGKVT
FT                   LVDFWAYACINCQRAGEHITKLYDTYKDAGLEVVGVHAPEYGFEHEAANVRAAAKREGI
FT                   NYPVAQDNDFATWKKFNNRYWPARYLIDTKGNVRHIHEGEGAYAETEQLVRQLLKQANP
FT                   DVQLPDPIETGGGTDSKLTEQRNPETYLGAERARFFNNNNYGLGERDFTYKEPRKGQYS
FT                   LSGKWDVKNDHIVPVKDAKLSINVHAAKVQLVVSGQGKVKATFPDGSDKTFDVSDGTID
FT                   VYDADKPLDGIISLEIEPSVTAYSLTFG"
FT   gene            54776..55402
FT                   /locus_tag="CPC231_00280"
FT                   /old_locus_tag="CpC231_0053"
FT   CDS_pept        54776..55402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00280"
FT                   /old_locus_tag="CpC231_0053"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09552"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDH9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240916.1"
FT                   /protein_id="ADL09552.2"
FT                   /translation="MGFLPYEAFEGEVAPVASASDAEIIAGVKAIVKAEGPVLGSRLFV
FT                   AYCRASNQKLGRRIRERLMFALEQALNSGDIVADIPFTRSNAEAMVLRPRSRPAVVVRS
FT                   LGPRSLEQVPLAELQTVMCGIEAENPKIGKGDLYKQTLIFYDRWGKLSNKVRLILDPAY
FT                   DAGGLGGEGSRPAISRPYASGRTPGYPGQRRGRYRTTVRKAMRDW"
FT   gene            complement(55404..56066)
FT                   /locus_tag="CPC231_00285"
FT                   /old_locus_tag="CpC231_0054"
FT   CDS_pept        complement(55404..56066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00285"
FT                   /old_locus_tag="CpC231_0054"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09553"
FT                   /db_xref="GOA:D9QDI0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDI0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366260.1"
FT                   /protein_id="ADL09553.1"
FT                   /translation="MSWFSDLFALLTTASQWWGPTGYLARIGEHIGISLAAVAIAAAFA
FT                   IPVGVAIGHTGRGSAIVGAISGAARALPTLGLLTIFGLALGIGLEAPLIALVILAIPSL
FT                   LAGAYAGVASTDHDTVDAARAMGYTEWQIIKNVELPLGAAVLVGGIRSATLQITATATL
FT                   AAYTSDVGLGRFIFHGLKARDYIEMLAGSVLVIVLALILDLVLSMFQRTTGAHSATA"
FT   gene            complement(56063..56701)
FT                   /locus_tag="CPC231_00290"
FT                   /old_locus_tag="CpC231_0055"
FT   CDS_pept        complement(56063..56701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00290"
FT                   /old_locus_tag="CpC231_0055"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09554"
FT                   /db_xref="GOA:D9QDI1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDI1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014654919.1"
FT                   /protein_id="ADL09554.1"
FT                   /translation="MRWLRHAWPYVLDMAAAHLFLSIPAILISIAVSIPIGMFAARNPR
FT                   VGNLVVSAASLAYTIPALPMLILVPFIVGVPLRSDTNVIIALCIYGVALLARTATDAFR
FT                   SIPEDVRMSASAQGMSAPQVALKVDLPLAIPVLISGIRVLGVSTIGLVTIGALIGVSSL
FT                   GTLFTDGFQRNITAEVLTGIGAVVILAVLFDVLCLILQRVLAPWSVIKK"
FT   gene            complement(56698..57585)
FT                   /locus_tag="CPC231_00295"
FT                   /old_locus_tag="CpC231_0056"
FT   CDS_pept        complement(56698..57585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00295"
FT                   /old_locus_tag="CpC231_0056"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09555"
FT                   /db_xref="GOA:D9QDI2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDI2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400895.1"
FT                   /protein_id="ADL09555.1"
FT                   /translation="MIEFIDVSKSYANPRKEKGDKKNKMPAGTASEKQTPTENAVNNFN
FT                   LVIPENQTTVFVGSSGCGKTTLLRMINRMVEPTSGEVHVRGRNVADVDPVELRRSIGYV
FT                   IQSGGLLPHRKVLDNVTTVPLLNREPKEEAIRRARLALETVELDPSFENRYPGELSGGQ
FT                   QQRVGVARALAADPDILLMDEPFGAVDPIVRRALQQQLIELQARLHKTVVVVTHDVDEA
FT                   FLLGDNIVVLEKGGKIAQVGTPTEIFAQPANDFVAQFMGTHRSDRDLHTTVIGGSRVVV
FT                   DKQGRPVGRLGADS"
FT   gene            complement(57942..58109)
FT                   /locus_tag="CPC231_00300"
FT                   /old_locus_tag="CpC231_0057"
FT   CDS_pept        complement(57942..58109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00300"
FT                   /old_locus_tag="CpC231_0057"
FT                   /product="antitoxin"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09556"
FT                   /db_xref="InterPro:IPR028037"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDI3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240920.1"
FT                   /protein_id="ADL09556.3"
FT                   /translation="MDILNKAKELLDQNADKVKDAVEKVGDLVDEKTDGKFADKVDQVQ
FT                   EAVKKKLDEK"
FT   gene            complement(58186..59523)
FT                   /locus_tag="CPC231_00305"
FT                   /old_locus_tag="CpC231_0058"
FT   CDS_pept        complement(58186..59523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00305"
FT                   /old_locus_tag="CpC231_0058"
FT                   /product="M20/M25/M40 family metallo-hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09557"
FT                   /db_xref="GOA:D9QDI4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDI4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366263.1"
FT                   /protein_id="ADL09557.1"
FT                   /translation="MLGHMTLYSDTLSLLTRMVQNACVNDLTPDSGQEVRNADTLEEFF
FT                   AGEAVTIDRYESHPGRVTIVVTVPGNDPTAEPLTLLGHTDVVPVDEKKWTKPPFEALIE
FT                   DGKMYGRGTVDMLFITATMAAVTREVARKKSNHGTLYFVGIADEEARGGLGAQWLREHH
FT                   PDAFSWKNCVSETGGSHLPGADGSDSVIVYIGEKGAAQRRLHVHGDAGHGSAPFQKDSA
FT                   IAKIGEVARRIASIQPSVRSDDTWHGFVRAFRFDPDTERKLLDGHPDSYKSLGELAAFG
FT                   HAISHLTIAQTVLRAGQAINVLPSHAWLEMDIRTLPGQSDEYVDQLLNQALADLAPEVT
FT                   IEHLISEEATISPTDSPLYNAMRDTLLEFFPESTVVPMIAPGGSDLRFARRAGGVGYGF
FT                   AVHAKQRTLGHAHAQLHSHDEFLYLEDLELTVAGYHRLVTRFLEHS"
FT   gene            59727..60722
FT                   /gene="bioB"
FT                   /locus_tag="CPC231_00310"
FT                   /old_locus_tag="CpC231_0059"
FT   CDS_pept        59727..60722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="CPC231_00310"
FT                   /old_locus_tag="CpC231_0059"
FT                   /product="biotin synthase BioB"
FT                   /EC_number="2.8.1.6"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09558"
FT                   /db_xref="GOA:D9QDI5"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDI5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240922.1"
FT                   /protein_id="ADL09558.1"
FT                   /translation="MTDILELARTKVLEEGNGLNKDEVLQVLTLEEDRIPELLALAHEV
FT                   RLKWCGEEVEVEGIISLKTGGCPEDCHFCSQSGLFESPVRSAWLDIAGLVEAAKQTQKS
FT                   GATEFCIVAAVKGPDERLMSQLEEAVAAIKSEVDIEVAASIGILTQEQVDRLKAAGVHR
FT                   YNHNLETARSYFPNVVTTHSWESRRETLRMIGEAGMEVCSGGIIGMGETLEQRAEFACD
FT                   LAELNPTEVPMNFLDPRPGTPFADLDVMETPDALRAIGAFRLALPKTILRFAGGRELTL
FT                   GDLGTEQGLLGGINAVIVGNYLTTLGRPMEDDLDMLGKLRLPIKALNASV"
FT   gene            60728..60982
FT                   /locus_tag="CPC231_00315"
FT                   /old_locus_tag="CpC231_0060"
FT   CDS_pept        60728..60982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00315"
FT                   /old_locus_tag="CpC231_0060"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09559"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDI6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910497.1"
FT                   /protein_id="ADL09559.1"
FT                   /translation="MKTTSTELIQVMLANEPPLFHPNTGQEIAAGETIRLSPSARAGLE
FT                   APRFCQICGRRMVVQVRPDGWEATCSRHGTVDSVYLGRR"
FT   gene            complement(61005..61436)
FT                   /locus_tag="CPC231_00320"
FT                   /old_locus_tag="CpC231_0061"
FT   CDS_pept        complement(61005..61436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00320"
FT                   /old_locus_tag="CpC231_0061"
FT                   /product="metallopeptidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09560"
FT                   /db_xref="InterPro:IPR011235"
FT                   /db_xref="InterPro:IPR038231"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDI7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014654922.1"
FT                   /protein_id="ADL09560.1"
FT                   /translation="MTFKSFEQYATAKGLNCRVTPEPQNSDYQSGITEIAGTTWHIRTA
FT                   RTTPTKKGAFVAFWTRDKAGKTTPFSTQNAQGGLLVFVEQGTHRGVFTFTAEHLERLGI
FT                   TAGCSAGKRGFRVYPSWCTDLNPQATAAQRAQAPAFSCY"
FT   gene            61537..62946
FT                   /gene="amn"
FT                   /locus_tag="CPC231_00325"
FT                   /old_locus_tag="CpC231_0062"
FT   CDS_pept        61537..62946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amn"
FT                   /locus_tag="CPC231_00325"
FT                   /old_locus_tag="CpC231_0062"
FT                   /product="AMP nucleosidase"
FT                   /EC_number="3.2.2.4"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09561"
FT                   /db_xref="GOA:D9QDI8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011271"
FT                   /db_xref="InterPro:IPR018953"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR037109"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDI8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240925.1"
FT                   /protein_id="ADL09561.2"
FT                   /translation="MKKGVGADVVQQLEEIYAASISLAKEILETGEYGRYCDVVYPKLI
FT                   VKILSWHPVDRTEPFGYVDAAGCYSAVLSKPELIHDYLCEQLERLCANYECVITVEPST
FT                   VRIPPEYIDGIEGVTEARRAGDVAAEIPRPTLDDVDDAIIDGEWDAFHGEEKPLFHFTP
FT                   QRFDIACARIQHYTGISPASVQKYILFTNYSMHAREFVNFGLCELSREGSRYSALVLPD
FT                   GHKITRDQAEHIDRESLSLESRFQMPRYDLVAEDGMGITMINIGVGPSNAKTITDCLAV
FT                   LRPEAWVMIGHCAGLDGRMRIGDLILGNAYQRDDHLLDDHIPLDLPIPAVPEVQRALEA
FT                   SVREVYGEDLSLMRTGTVLSTDDRNWEWHTPQKLWKLLRGSTAAACDMESATLAANGYR
FT                   YRIPYGTLLSVSDLPLHAVPKLPAAAQTFYANSKQAHVMCAVHAMELLALTPEKLRTRK
FT                   LRRTIGEVPFR"
FT   gene            63038..64447
FT                   /locus_tag="CPC231_00330"
FT                   /old_locus_tag="CpC231_0063"
FT   CDS_pept        63038..64447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00330"
FT                   /old_locus_tag="CpC231_0063"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09562"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDI9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799854.1"
FT                   /protein_id="ADL09562.2"
FT                   /translation="MAILCSTALALGACGSMGKAGGPSNALSIEQTTQIDSADGIDASK
FT                   LLFSSSQAVVIAGDSVGQKWEGAKAAVKRGAPLLVRTADNASAIDSEIKRLGAQDVIKI
FT                   DEPQAPDPEISEANIADKISQLTPESPLFNGGASILVSGHTTAADVATARASGANVEYL
FT                   SSGDARESSALSADPDAHVVALGPSFANKERFNRQVEMISHGEVPGGGHLIFPSHRVVA
FT                   LYGHPSGGALGVLGEQPAEEAVNRVNDLVGKYQAIAPEESMIPAFEIIATVASSSAGPD
FT                   GNYSNEGNVDELRPWVEAIGDAGGIAILDLQPGSASFLEQAQQFEELLKLPHVGLAIDP
FT                   EWRLKPGEKPMERVGSVGAGEVNQTAAWLRDLVKDNELPQKVFVVHQFQHQMVQNRETL
FT                   DTTAPELSWVLHADGHGTAGDKFATWDMVRKNLQPEFYLAWKNFIDEDQPMFTPEQTFK
FT                   IEPRPWFVSYQ"
FT   gene            64786..65922
FT                   /locus_tag="CPC231_00335"
FT                   /old_locus_tag="CpC231_0064"
FT   CDS_pept        64786..65922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00335"
FT                   /old_locus_tag="CpC231_0064"
FT                   /product="hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09563"
FT                   /db_xref="GOA:D9QDJ0"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDJ0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240927.1"
FT                   /protein_id="ADL09563.2"
FT                   /translation="MMKTRRLKTALCTVLASSTFAVASVQAIPLPFPLGASSGIDVSGH
FT                   QHPNSSSINWKDVKSHGQSFAFVKATEGLGWTNDFYASDITQAAAQGLKVGSYHYARPG
FT                   ADARQQARHYANVISHTPNHSLPPVLDLEVAEGKTPQELVNWTRDFVQELEKQTGRVPM
FT                   IYTYRYFWIEQMANTTEFSQYPLWLAAYQAQVPGTVGGWDQIDFWQRSSSGRINGIVGD
FT                   VDMNLFNGDDGELAAFAAGNLHAAGNKFASINLPELADLGKNAGGVVAVILALSAGAAA
FT                   APQLIQAAEAAGLSSEGAQDLTTVLQALAKAGKLPVDQLNKMASGNYTVGDLIILLDNA
FT                   AHIAGLDEGQSSKAAMRADELNIDANQVAQVLRSLAAR"
FT   gene            complement(65977..67062)
FT                   /locus_tag="CPC231_00340"
FT                   /old_locus_tag="CpC231_0065"
FT   CDS_pept        complement(65977..67062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00340"
FT                   /old_locus_tag="CpC231_0065"
FT                   /product="inositol-3-phosphate synthase"
FT                   /EC_number="5.5.1.4"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09564"
FT                   /db_xref="GOA:D9QDJ1"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR017815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDJ1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240928.1"
FT                   /protein_id="ADL09564.1"
FT                   /translation="MSNNRTIRVAIAGVGNCASSLIQGVEYYKDADPNTNVPGLMHVQF
FT                   GDYHVGDIEFVAAFDVDKEKVGLDLSHAINASENCTIKICDVPEQGVTIQRGPTLDGLG
FT                   KYYRQTITESDADPVDVTQTLKDVRADVLVSYLPVGSEEADKFYAQCAIDAKVAFVNAL
FT                   PVFIASDPEWAEKFEKAGVPIVGDDIKSQVGATITHRVLAKLFEDRGVHLDRTMQLNVG
FT                   GNMDFKNMLERERLESKKISKTQAVTSNLDQHIEAHDVHIGPSDYVGWLDDRKWAYVRL
FT                   EGTAFGDVPLNLEYNLEVWDSPNSAGIIIDAIRAAKIAQDRRLGGPVFAASSYLMKSPP
FT                   KQLRDEHARAELESFIAGDPS"
FT   gene            complement(67291..68028)
FT                   /locus_tag="CPC231_00345"
FT                   /old_locus_tag="CpC231_0066"
FT   CDS_pept        complement(67291..68028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00345"
FT                   /old_locus_tag="CpC231_0066"
FT                   /product="VIT family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09565"
FT                   /db_xref="GOA:D9QDJ2"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDJ2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240929.1"
FT                   /protein_id="ADL09565.1"
FT                   /translation="MTLPDHNTTQPAAQKEQSNRLNSRLNWLRAGVLGANDGIVSVSAL
FT                   ILGVIATDVSHGAILASGVAATIAGAISMALGEFVSVSAQRDSEHMVMERERLELLHTP
FT                   DEERQEIAKILSGYGMTEETALQAATEIGRNDPFPAHLRIEYGIDAQDLTSPWHAAFSS
FT                   AAAFTVGAILPLLMVVIAPQENSAIGIIAVSSITIIALAITGYLSAAIAGTSRMRSVLR
FT                   LVIGGTIGLVLTYGAGALFGGVL"
FT   gene            complement(68348..69154)
FT                   /locus_tag="CPC231_00350"
FT                   /old_locus_tag="CpC231_0067"
FT   CDS_pept        complement(68348..69154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00350"
FT                   /old_locus_tag="CpC231_0067"
FT                   /product="alpha/beta fold hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09566"
FT                   /db_xref="GOA:D9QDJ3"
FT                   /db_xref="InterPro:IPR002918"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDJ3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366272.1"
FT                   /protein_id="ADL09566.2"
FT                   /translation="MAVIDASLPLSARLPARGLFEDDWRARPTPHNPYPVILIHGTGVT
FT                   KGDWMELGTDLRKKGYAVFAPDFGMRSTAAVAESADQVGAYIHAVLKVTGAKQVILVGH
FT                   SQGGILARYWMHHLGGARYVSHLICLAVPNHGTSHGGVISPLTRTARGTVVVDSIITNF
FT                   FGASGFEMLAESDLIQELNANGDTLPGIYYSCITTKSDTIIQPAESCFLAGPLVRNIYV
FT                   QAVSKRAIVLHEDVPHDRRVRRIVLSELERVERLTTKKHVRTEHNA"
FT   gene            69247..69834
FT                   /pseudo
FT                   /locus_tag="CPC231_00355"
FT                   /old_locus_tag="CpC231_0068"
FT   CDS_pept        69247..69834
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00355"
FT                   /old_locus_tag="CpC231_0068"
FT                   /product="dehydrogenase"
FT                   /note="internal stop; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240931.1"
FT   gene            69872..70429
FT                   /locus_tag="CPC231_00360"
FT                   /old_locus_tag="CpC231_0069"
FT   CDS_pept        69872..70429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00360"
FT                   /old_locus_tag="CpC231_0069"
FT                   /product="gamma carbonic anhydrase family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09567"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDJ4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240932.1"
FT                   /protein_id="ADL09567.1"
FT                   /translation="MNPGPIILPFNGKTPRVHETAFIAPNATLIGDVEIAAHASVFYGC
FT                   VLRADINMIRVGARTNIQDNSVLHVDGDAPCILGEDVTVGHMALVHGSTVGSGALVGMH
FT                   SALLSHSVVGQGSLIAAGAVVLEGQEIPAGVLAAGVPAKVRRELSSEQSAGFISHAGRY
FT                   VHTASMHRELGAGLSLDQVRFS"
FT   gene            complement(70422..71441)
FT                   /locus_tag="CPC231_00365"
FT                   /old_locus_tag="CpC231_0070"
FT   CDS_pept        complement(70422..71441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00365"
FT                   /old_locus_tag="CpC231_0070"
FT                   /product="ROK family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09568"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDJ5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523741.1"
FT                   /protein_id="ADL09568.1"
FT                   /translation="MHTRSHLRNIPSFTQPSAPAASCLHLIRHFQPVTRSKLVHGSGKS
FT                   QPTVTRAVAALMEVKLVRERPDLSIPNGPGRPTIPIELSASPWVQIGLAVGTKTTYVGA
FT                   CSTRGAVIQEKILDITPSQMSADQYAETLSTTIREIAELSELPLANVGIATSGYVNDLG
FT                   LVTAKNLGWEGVDLAGRIYNRISVPVAITSAITAIAGAEQQAQNPDVPANSLIFYADDS
FT                   IGAALQNPQEVMVLPLDENIHGASSLGAAAVALVEQARPKVLVLAGSAFENSEDALAVG
FT                   QALRKSPHGTKDKLEIRVIPTHLDNARAAARAIAMDRLIEDPLGLAKRLITKRRRAAS"
FT   gene            72084..73562
FT                   /locus_tag="CPC231_00370"
FT                   /old_locus_tag="CpC231_0072"
FT   CDS_pept        72084..73562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00370"
FT                   /old_locus_tag="CpC231_0072"
FT                   /product="PepSY domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09570"
FT                   /db_xref="GOA:D9QDJ7"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDJ7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400900.1"
FT                   /protein_id="ADL09570.1"
FT                   /translation="MVTTDQALSAGSAAAKVAESGTGRSGEKSGKSRHLPRHLRRLHFF
FT                   AGIVCAPLIFIASLTGLAYAFAPTLENAVYSSNTTVEVPADAKQLPMEKIVDIATQRHP
FT                   DQPISGIRVGEKDQAVRVLFKHPTKSASFSDAVFVNPYNGEITGDMVQYGNAGALPLRD
FT                   WLSHGHRDLWLGDIGRFYSEFAASWLGVLAVSGVYLWWKRQRSGTGRIAAMLKVSGRGR
FT                   TRNLRWHGALGTALALGMIFFTFTGLTWSSVAGTNIGKVRTELNWTTPKVTTSLDGSAA
FT                   PAVKDPHAGHDHAGHDHGSHSATSPSAKLSLAEQATHVAATAAAELRSGVTLRPPSEAG
FT                   QAWSVMENRQAYRKDNNSIAVNGDTGEVTARLAFVDWPFAAQATAWMIQLHMGTMLGLP
FT                   NQIVLGLLAVGIIILVVRGYMLWFQRRPQGQLVADAPTRARGAERRFGLAGILAVVGMI
FT                   AYGFFAPVFGVTCLAFVVLSVLWDAVRSRRRKAS"
FT   gene            73633..74703
FT                   /locus_tag="CPC231_00375"
FT                   /old_locus_tag="CpC231_0073"
FT   CDS_pept        73633..74703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00375"
FT                   /old_locus_tag="CpC231_0073"
FT                   /product="TIGR00730 family Rossman fold protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09571"
FT                   /db_xref="GOA:D9QDJ8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDJ8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522956.1"
FT                   /protein_id="ADL09571.1"
FT                   /translation="MSFSPQEPLISGLTVRAMTSDDKDIRATALLKNLNRFEQRFDVQD
FT                   FASEPLRNYLDFDPTRGDIGLLLADDAGETVGVMWAAFIRGFGFINARVPELTLYLAEE
FT                   WHGKGVGQWMLDQAEEYGRVHGWPGVAVNVEKESPARRLYARCDYVTQDGGSAAGSVML
FT                   KTLSPKIRSVAVYCGSAHGARPDYTAAARALGTALAERGITMVYAGGKLGLMGETADAA
FT                   IAAGGEVHGVMPQNLVDLEQAHPRLTRLDITESIAERKTRMEDLADAFVVLPGGMGTME
FT                   EMFEVLVRQQLGPYCGPVALFNVEEYWEPLVNAFQAMSEEGFIAQRYIEALVIAGNTDE
FT                   LFEGFSNWVNPGLKWN"
FT   gene            74818..76488
FT                   /locus_tag="CPC231_00380"
FT                   /old_locus_tag="CpC231_0074"
FT   CDS_pept        74818..76488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00380"
FT                   /old_locus_tag="CpC231_0074"
FT                   /product="DUF885 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09572"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDJ9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240936.1"
FT                   /protein_id="ADL09572.1"
FT                   /translation="MTHGNADVRPPSLLDASCEAFVHDLAALSPTEATAWGIEGHAGEL
FT                   QDFSPAYWEAVADRNREMLADVDALDDGTDDCDDEDDFDEVDIVTAAVLRDRVCLDLSL
FT                   HHNDEFLGQLNNIASPIQTIRDTFLLMPQDTEEQREAIASRLSQVGKALAGYRESLTLA
FT                   ASHGKVSAIRQIEAAIGQCRELTQPGSMLDKLGVDPHSDAVVSAKKSFGSMAEWLGDQL
FT                   APHAPHHDAVGRERYERFSHLFVGDVVDLDDAYEWGLDRLQEIVAEQQNIAEKLYGSGT
FT                   SVAAAMKKLDTESRYTITGTDALREWMQEQADKTIADLNGVHFDIPQPVQSLEACIDPA
FT                   GTGGIFYTPPSDDFSRPGRMWWSVPAGQNTFHTWQELTTVFHESVPGHHLQCGQAVCER
FT                   ENLNLWRRIACWNSGHGEGWALYAEQLMADLGYHDDLGTRMGMLDAQRLRAARVVLDIG
FT                   VHLGKRTPEGSSVWDASYAKFFLRENSAMDERNLAFELDRYLGWPGQAPSYALGQRLWQ
FT                   QLRDRALDQGQTLKQFHTRALSYGSIPMSILGTQVLKAS"
FT   gene            76540..76956
FT                   /locus_tag="CPC231_00385"
FT                   /old_locus_tag="CpC231_0075"
FT   CDS_pept        76540..76956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00385"
FT                   /old_locus_tag="CpC231_0075"
FT                   /product="MarR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09573"
FT                   /db_xref="GOA:D9QDK0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDK0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558543.1"
FT                   /protein_id="ADL09573.1"
FT                   /translation="MAKDHALDELICFQLYTASRLMQRIYRPYFDDWGITYPQYLVLVC
FT                   LWERDGRSIGQLADPLNLDSGTLSPLLQRMEDNGFVRRKHVTDDFRRLRIFLTAKGKRL
FT                   KPLADKMQEELVETLRLDYQDLAAVHDLVNKISP"
FT   gene            76965..77321
FT                   /locus_tag="CPC231_00390"
FT                   /old_locus_tag="CpC231_0076"
FT   CDS_pept        76965..77321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00390"
FT                   /old_locus_tag="CpC231_0076"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09574"
FT                   /db_xref="GOA:D9QDK1"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDK1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014654931.1"
FT                   /protein_id="ADL09574.1"
FT                   /translation="MEKDGSKKSSRKSWSYVMIMIFLLMIILVPPLLHLFTSGGIILTA
FT                   LLLLALTFGFIDARTFRFTASFPLLIGAAYFIAMQMYFNAGTWIYLPIMVVLAFIGGAF
FT                   GDPRGMRSFGEDEG"
FT   gene            77321..78157
FT                   /locus_tag="CPC231_00395"
FT                   /old_locus_tag="CpC231_0077"
FT   CDS_pept        77321..78157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00395"
FT                   /old_locus_tag="CpC231_0077"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09575"
FT                   /db_xref="GOA:D9QDK2"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDK2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799861.1"
FT                   /protein_id="ADL09575.1"
FT                   /translation="MEIWSFEHPDLGVISVERGYDAEFREINPDWPEEPSEKEIRHVDS
FT                   NAGFKERIEALVHNPAVRLQIKVNGEIRRQLTDVPSGRIALSKSIGDSLTTSVMAKVNR
FT                   KKPHLYVHSNMFNEILSIEYREGNQVVEFTPPAGTRGHKRQQAMQESSIKRLLFPMMAG
FT                   LGKSGWAIGVIILGPIVSRVVKKLLELLPEWDFIDLPELPSINLPVPRFPHITLPVVQF
FT                   PDWELPHFELPWWVMFLLEYKKVWVPLMIAIFVGIVAVRNHKKSEEQKQQWESDQT"
FT   gene            complement(78163..79245)
FT                   /locus_tag="CPC231_00400"
FT                   /old_locus_tag="CpC231_0078"
FT   CDS_pept        complement(78163..79245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00400"
FT                   /old_locus_tag="CpC231_0078"
FT                   /product="AbrB family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09576"
FT                   /db_xref="GOA:D9QDK3"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDK3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014654933.1"
FT                   /protein_id="ADL09576.1"
FT                   /translation="MRRFITDRDLALRWSVVAPISLALGFLFAFLHVPAAWILAAIATS
FT                   GASALITGKELPMNRQLFNFARGFIGILAALPLLSTELFQLGRFVLPGIAVTIVTLMIG
FT                   VSGGLLLTHKEPEISQETGVLSMLAGGASIMPLLAKDLGADYRYVALSQYLRLLTVSVS
FT                   LPLITHLFPHSSTSTALPAAAQSQPWWALTIVIVIALVGHRVGKLLRLPAASILGPMVL
FT                   LVVTGFFIPHEVSLAPPEPVRYFAFLSIGWICGGSLSLGALKAFASQLPSTILFVVVLI
FT                   AGCALTAWPLMSVLHISYFEAYLATSPGALETVLALSSEGGAGSVVVATQVIRLISVIA
FT                   LAGWIPAFLQLLRRGKPKAS"
FT   gene            complement(79306..79902)
FT                   /locus_tag="CPC231_00405"
FT                   /old_locus_tag="CpC231_0079"
FT   CDS_pept        complement(79306..79902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00405"
FT                   /old_locus_tag="CpC231_0079"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09577"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDK4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522959.1"
FT                   /protein_id="ADL09577.1"
FT                   /translation="MKKLFTVALSAVVLFGVGSCANNKPPQPTATVADASSTSPTTQTT
FT                   QQPMPAPSSSSTPAIPQKDSTSAKTPPPAATPIPAGGYLLALDKEVTLACVIDYQSGVL
FT                   ADCSPTTHAITWKATSGNHPQANRLKAVFPPLKLSATGDGTAIDGSAFKRLDAGKKYSV
FT                   DAAIIDLTAPGSVTIREHQGPGVRITRDSFEKVSA"
FT   gene            79975..80787
FT                   /locus_tag="CPC231_00410"
FT                   /old_locus_tag="CpC231_0080"
FT   CDS_pept        79975..80787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00410"
FT                   /old_locus_tag="CpC231_0080"
FT                   /product="TSUP family transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09578"
FT                   /db_xref="GOA:D9QDK5"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDK5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240942.1"
FT                   /protein_id="ADL09578.1"
FT                   /translation="MELAAINTPEVAVDIGVGGWGILIAGAGIAGWIDAMIGGGGLVLI
FT                   PLIMAVAPGLAPVVAIATNKFVAVSGTASAAVTMTRKVGVDSSLVLRLVPIAALCSAGG
FT                   ALLAAWISKDVMRPVVIGLMLLAGIFVAFKPEFGQGGHAKSASARRRALAVLATGGIAL
FT                   YDGIFGPGTGMFLIMAFTALLSQDFLRSAALTKVVNTATNLGALVVFIAAGHVLWSLGI
FT                   VLAVANIAGAQLGAKTVLAGGTKILRLALLTLVIVMSIYLTAQQLYGA"
FT   gene            80918..81733
FT                   /locus_tag="CPC231_00415"
FT                   /old_locus_tag="CpC231_0081"
FT   CDS_pept        80918..81733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00415"
FT                   /old_locus_tag="CpC231_0081"
FT                   /product="PTS transporter subunit EIIA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09579"
FT                   /db_xref="GOA:D9QDK6"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDK6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366285.1"
FT                   /protein_id="ADL09579.1"
FT                   /translation="MPKLNELLADESIELHGKAETWSDAIAKSGALLEKTGAITDEYTR
FT                   AMIENVEANGPYIVVAPGFAFAHARPSSAVKKTAISWLHLDQPVSFGHSKNDPVHLVVA
FT                   LAAQGDTVHTAAMKDLAQLLGDKQRKNALDQVKTVEELRAVLEDDLTVNSAVKPAAAVA
FT                   STADYSAKTQATAPKGKILTVCGNGLGTSLFLKNTVEQVLDYWKWSPYFSVEATDTISA
FT                   KGRAHEADFILTSGEIAATLGDLGVPVYVIQNFTSPVEIDSALRQLFDV"
FT   gene            81745..83286
FT                   /locus_tag="CPC231_00420"
FT                   /old_locus_tag="CpC231_0082"
FT   CDS_pept        81745..83286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00420"
FT                   /old_locus_tag="CpC231_0082"
FT                   /product="PTS ascorbate transporter subunit IIC"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09580"
FT                   /db_xref="GOA:D9QDK7"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDK7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799864.1"
FT                   /protein_id="ADL09580.1"
FT                   /translation="MNVLLSIAEFLVNEILAVPAFLIGIITAVGLGAMGRGAGKVLGGA
FT                   LKATLGFLLIGAGAGLVSDSLAPLGVMIQGATGAHGVVPTNEAIVGIAQEHYGSQVAWL
FT                   MILGYAVSLVLARFTPLRYVFLTGHHVLFMATLLTIVMATAGFSSWVVITAGAILLGIL
FT                   MVSLPAIAHPWTRRITGDDSVAIGHFGTAGYVAAGAMGKLVGGKGKKISPSTEELKLPE
FT                   GLRFLRDSMVATALSMALMYVVLAVLFIFRAGKNEAFTAFTGGATGVGNYLMQSVTQGL
FT                   QFGVAVAVILFGVRTILGELVPAFQGIAEKVVPRAIPALDCPIVFPYAQNAVLIGFISS
FT                   FVGGLIGLAVLSAWLNPVFGVALILPGLVPHFFTGGAAGVYGNATGGRRGALCGAFVNG
FT                   LLITFLPAFLLGVLGSFGEANTTFGDADFGWFGILIGEAAHGGQTVGLILIVFIGIAIL
FT                   ALGLWSQKTLVQGNWDPAPLRSGGLASVDTECQNVAVYSRIAPPQGAPIPPPPLG"
FT   gene            complement(83302..85758)
FT                   /gene="hrpB"
FT                   /locus_tag="CPC231_00425"
FT                   /old_locus_tag="CpC231_0083"
FT   CDS_pept        complement(83302..85758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="CPC231_00425"
FT                   /old_locus_tag="CpC231_0083"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09581"
FT                   /db_xref="GOA:D9QDK8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDK8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400903.1"
FT                   /protein_id="ADL09581.1"
FT                   /translation="MTFFDLDSIGSGLPVMDSVPAIESALLAAGSVIVQAPPGTGKTTV
FT                   IPPLISNILNKNRSSQCNQGKVIVVVPRRVAVRAAAQRLIFLDGLHKNSGSVGFSMRGE
FT                   SRRGKLIEFVTPGVLLRRLLSDPELPGVSAVIVDEVHERQLDTDLVLGMLIELRELRPD
FT                   LFLAVMSATVDAHDFSRLVGAAPIVTVNAVTHPVNIDYRPAPGRSDFSQDYIHHLASVT
FT                   AHAVSQSEYSALVFVPGVREVSALCAALEATTHVKVLPLHGQLSSTEQEAALSPAEQRI
FT                   VVSTSIAESSLTVPGVRIVVDTGLSRIPKRDAGRGMSGLVTVSTSQSSADQRAGRAGRE
FT                   GPGHVLRCYSAQEFSRFSPHIPPEISSADLTQAALFLASWGAPRGEGFPLLTAPPAVAM
FT                   EQAVETLTRLGALDSSGYCTELGRTLATLPADPRLGKSLLECGTSAIPTVAALSTNIRG
FT                   DVSKEIQNLAGQRHYELEKTRLEKLISHRHGEPSSRNHSYQEKSLHSEPVSPGEAIGRA
FT                   FPENIARADGESYLLAKGTRAFLRNIPSLSGSPWLAISEVALSQGPHNHAVIHTAAAID
FT                   KATALEIIGVSEDTTATFAEGKLRGTRVTRAGAIVLSSTPCALEGDSARKALKEIIQSR
FT                   GLNLFNFSEKALTLKNRLRHLHNCYGDPWPNLDSVTVQEWLAPEIDYLLSGTPIAKVDM
FT                   YPALQRLLPWPEATHLEELAPSTLNVPSGRNASIDYSGERPKISIKLQECFGLQNSPII
FT                   CGQPLQFQLLSPAGRPLAVTDDLHSFWGGPYHHVRSEMRGRYPKHPWPEDPTTALATGK
FT                   TKKALS"
FT   gene            85928..86671
FT                   /locus_tag="CPC231_00430"
FT                   /old_locus_tag="CpC231_0084"
FT   CDS_pept        85928..86671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00430"
FT                   /old_locus_tag="CpC231_0084"
FT                   /product="alpha-ketoglutarate-dependent dioxygenase AlkB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09582"
FT                   /db_xref="GOA:D9QDK9"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDK9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522080.1"
FT                   /protein_id="ADL09582.1"
FT                   /translation="MFMRVILKTRFDIATTFGWVPTLFDSYPVPRSPQLIRPGIVHLPG
FT                   FLSFAEQRVMVEKARAVACRLAHTPLAMHQQQWKSGTMSAHLMSLGKHWEYSSHQYVSE
FT                   WQGQEVPDIPNNFLTQAYEAFEQAVCLDSDLAPWASDYRIDAALVNYYPPGSGMGMHQD
FT                   VFEESSAPVVSLSIGATAVFRAGNSENRNKPWQDVLLLSGDALVFGGPSRKIFHGIKRI
FT                   DDATVPDNCGLERGRINITFRQVEL"
FT   gene            86744..87406
FT                   /locus_tag="CPC231_00435"
FT                   /old_locus_tag="CpC231_0085"
FT   CDS_pept        86744..87406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00435"
FT                   /old_locus_tag="CpC231_0085"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09583"
FT                   /db_xref="GOA:D9QDL0"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDL0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522666.1"
FT                   /protein_id="ADL09583.1"
FT                   /translation="MDTSNVLKSTPLSTDLVLAEGLVVGEDGRVRPEWAAKDPLLRKYY
FT                   DYEWGRPVHTESGLLERLSLEAFQSGLSWATVLRKRDAFRAAFYDFDADTVARFGEEDI
FT                   VRLLGCSEIIRNRRKIEAVITNARATIALRASGGLDAFIWDFAPKEHQPPATLADTPTV
FT                   SNASKALAKALKKAGFTFIGPTTCYALSQAIGMIDDRPAGASKLLDDIADLNKGVMA"
FT   gene            87403..88104
FT                   /locus_tag="CPC231_00440"
FT                   /old_locus_tag="CpC231_0086"
FT   CDS_pept        87403..88104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00440"
FT                   /old_locus_tag="CpC231_0086"
FT                   /product="SDR family NAD(P)-dependent oxidoreductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09584"
FT                   /db_xref="GOA:D9QDL1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDL1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240948.1"
FT                   /protein_id="ADL09584.1"
FT                   /translation="MTKTAIVTGGSSGIGEATARALASDGWYVIVAARRMDRLRRIASE
FT                   IGGEAIQLDVTSDESVAHFASCIQQCHLLVNNAGGALGLDPIAEASIADWQWMYETNVL
FT                   GTLRVTRSLLDVLHDGAQIINISSIAGIAPYAGGAGYNAAKFGVTAINKVMRIEFAQRN
FT                   LRVTEINPGRVKTDFSLIRFHGDQAKADAVYADKLNLTAKDIAESIRWVASVPEHMNID
FT                   RMVITPRDQIV"
FT   gene            88204..88524
FT                   /locus_tag="CPC231_00445"
FT                   /old_locus_tag="CpC231_0087"
FT   CDS_pept        88204..88524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00445"
FT                   /old_locus_tag="CpC231_0087"
FT                   /product="heavy metal-binding domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09585"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDL2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_009234437.1"
FT                   /protein_id="ADL09585.1"
FT                   /translation="MIVTTTSVVSGREISEYVRVVAGETIVGINVFKDITAGFRNLVGG
FT                   RSQAYEGEVKNAREQALAEMVQRAIELGAEGVVGVDIDYQTLGSDNGMMMVSATGTAVR
FT                   FA"
FT   gene            88563..88853
FT                   /locus_tag="CPC231_00450"
FT                   /old_locus_tag="CpC231_0088"
FT   CDS_pept        88563..88853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00450"
FT                   /old_locus_tag="CpC231_0088"
FT                   /product="RNA-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09586"
FT                   /db_xref="GOA:D9QDL3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDL3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910540.1"
FT                   /protein_id="ADL09586.1"
FT                   /translation="MQAQDVTIRDQEIKLGQFIKLASLVETGGIAKEVIANGEVTVNGA
FT                   VDTRRGKKLRDGDVVCVGTLCARVKTTAEEDDYFDEKTADDDFDPEVWRNI"
FT   gene            88853..89677
FT                   /locus_tag="CPC231_00455"
FT                   /old_locus_tag="CpC231_0089"
FT   CDS_pept        88853..89677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00455"
FT                   /old_locus_tag="CpC231_0089"
FT                   /product="VOC family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09587"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDL4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240951.1"
FT                   /protein_id="ADL09587.1"
FT                   /translation="MPAFQAASGMPYWIDLTSSDLRKSTYFYTQVLGWEIEEFGQDYYL
FT                   ARVQGLPVAGFIKRPEDQQQADTWVTYFLTDNIHADCEGVEKLGGRVLAAPMEVRLGLM
FT                   SIVVDNSGALFGLIQPAGEEAFIAAGEPGTPVWHELTCTTGYAKAVKFYPSLFNWTTAT
FT                   VDSDHNFEYTTAETDGGAFAGIFNAEGQFPPQVPSFWQTYLGVSNMDEAVRKTKEFGGE
FT                   VIREPFASEFGLMSIISDSTGATVTICEVEEAVEEGRESDPLEGIDLSQFGI"
FT   gene            89682..89972
FT                   /locus_tag="CPC231_00460"
FT                   /old_locus_tag="CpC231_0090"
FT   CDS_pept        89682..89972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00460"
FT                   /old_locus_tag="CpC231_0090"
FT                   /product="cysteine methyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09588"
FT                   /db_xref="GOA:D9QDL5"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDL5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522081.1"
FT                   /protein_id="ADL09588.1"
FT                   /translation="MYELDDLSSKVLDVVDGIPVGRVLSYGDIAEIVGIGPRQVGKIMA
FT                   TVGHLTAWWRVVRSDGSSHLVDRAVHYWDLENIAHNGKRVFMKESRWGCDL"
FT   gene            89978..90262
FT                   /locus_tag="CPC231_00465"
FT                   /old_locus_tag="CpC231_0091"
FT   CDS_pept        89978..90262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00465"
FT                   /old_locus_tag="CpC231_0091"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09589"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDL6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400905.1"
FT                   /protein_id="ADL09589.2"
FT                   /translation="MFYNGGDYIRGEVVFAQDISKAIDRIADDIDSLRKLLTSPEEINF
FT                   SEMADSFVKLEQAFSFKAYSDAFVAYCAHINNAGTLVGSKNPSIFLLMV"
FT   gene            90325..91320
FT                   /locus_tag="CPC231_00470"
FT                   /old_locus_tag="CpC231_0092"
FT   CDS_pept        90325..91320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00470"
FT                   /old_locus_tag="CpC231_0092"
FT                   /product="DUF222 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09590"
FT                   /db_xref="GOA:D9QDL7"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDL7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400906.1"
FT                   /protein_id="ADL09590.1"
FT                   /translation="MGEDIRENAARTKIEKIKIIDRELRSLKKNTELETYQLRAEFIAK
FT                   AQGMGAEALGQYTRNRVKELNRKADPDPYAALKRRKITISKPDKDGGVYVSGYLPPATG
FT                   VLLKSLLSPARRKGVASSVAPEEDKRTWAQRRVDVFHQCLAQSSSLIAKQNGGVGTVIV
FT                   STTIEELEKADCSTRFYTNTDIELSPLDLLMLGLREDLFACLMDKQGIPLQLGRSKRTA
FT                   SIYQRLALVAREAVCSHPNCEQPASNCDVHHLIAWFDGGRTDLENLTLLCRHHHTSNND
FT                   RRDFRFGVGHYQRDAGVVKFYRPGVPPEENQAPARRKSAGYRIRMAEKSA"
FT   gene            complement(91317..92846)
FT                   /gene="glpK"
FT                   /locus_tag="CPC231_00475"
FT                   /old_locus_tag="CpC231_0093"
FT   CDS_pept        complement(91317..92846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="CPC231_00475"
FT                   /old_locus_tag="CpC231_0093"
FT                   /product="glycerol kinase GlpK"
FT                   /EC_number="2.7.1.30"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09591"
FT                   /db_xref="GOA:D9QDL8"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDL8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799871.1"
FT                   /protein_id="ADL09591.1"
FT                   /translation="MQYVAAIDQGTTSTRCIIFDHDGNQVSVGQYEHEQIFPQKGWVEH
FT                   DAIEIWDNTRRAVGTALADSDLSAKDIAALGITNQRETTVVWDKNTGEPVYNAIVWQDT
FT                   RTTSICKELAGDEGADRWYRKTGLLINSYPAGPKIKWILDNVDGARERAEAGELLFGTI
FT                   DTWLLWNLTGGADGDDGAPALHATDVTNASRTLLMDIEKLEWDKELCKAMDIPMEMLPE
FT                   IRPSVGDFHQVRERGSLSGVPIRSMLGDQQAAMFGQGCFRPGEAKNTYGTGLFLLLNTG
FT                   TTPKWSENGLLTTVCFQIEGQKPVYALEGSVAAGGSLVQWLRDNLMLVPNAPMIENMAR
FT                   SVEDNGGVYIVPAFSGLFAPYWRQDARGVIVGLTRFVNRNHLARAVLEATAYQTRDVAD
FT                   AMVADSDVKLTELRVDGGMTYNELLMQFQADILGVPVTRPKNVETTATGAAFAAGYSVG
FT                   YWENLDFLTQQKGDLHVWKPTMDQEKVDELYHDWKRAVKRSLNWEENVDEF"
FT   gene            complement(92856..93581)
FT                   /locus_tag="CPC231_00480"
FT                   /old_locus_tag="CpC231_0094"
FT   CDS_pept        complement(92856..93581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00480"
FT                   /old_locus_tag="CpC231_0094"
FT                   /product="aquaporin family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09592"
FT                   /db_xref="GOA:D9QDL9"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDL9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240955.1"
FT                   /protein_id="ADL09592.2"
FT                   /translation="MTGVEYLYWEFLGTTILLLMGNGVCALVTLRTSAGRNAGWLTIAF
FT                   GWGLAVFAGASIANPSGGHLNPAVTLMLAVKGSVAWNLVPWYFAGQMLGGIFGAFLCWA
FT                   AFKQLFDANNYDEAGNPGGNKNTGGIFFTNPAHPNNFWNAVTEFIATFVLLAFIALGPS
FT                   GDVGPLKYFAVAFIVVSIGLSLGSPTAYAINPARDLGPRIAYAFILPIKDKGSANWSYA
FT                   WVPIVAPMLAAVATGLLAL"
FT   gene            complement(93638..94498)
FT                   /locus_tag="CPC231_00485"
FT                   /old_locus_tag="CpC231_0095"
FT   CDS_pept        complement(93638..94498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00485"
FT                   /old_locus_tag="CpC231_0095"
FT                   /product="alpha/beta hydrolase fold domain-containing
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09593"
FT                   /db_xref="GOA:D9QDM0"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDM0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240956.1"
FT                   /protein_id="ADL09593.1"
FT                   /translation="MGRMDERKEFEVGGKDRKLSPEEQLEQLSTYIAAHYERPAMNPPW
FT                   SDSPTDPLVLDTYDARLADRITHASMLMLGSALDHTTPGVAFSDGVTTEDVPNGQIIRP
FT                   AHPTGVWGISLHPGGWWKGSGTALENAWRPEVAAVANLSGITFLDLDYPLLPDHTVSDA
FT                   IASVRRAAQWVRSMNPPRLVAWGYSSGAALAALTSDLWDAQALTFPHLTLDYLPTHLCD
FT                   AEFPQVFPPTFLQVATQDSVADRYPWAEAQSQVKEYVSEHRVATPEVMRERVKDVADFL
FT                   VISNT"
FT   gene            complement(94511..96382)
FT                   /locus_tag="CPC231_00490"
FT                   /old_locus_tag="CpC231_0096"
FT   CDS_pept        complement(94511..96382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00490"
FT                   /old_locus_tag="CpC231_0096"
FT                   /product="peptidase M13"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09594"
FT                   /db_xref="GOA:D9QDM1"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDM1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240957.1"
FT                   /protein_id="ADL09594.1"
FT                   /translation="MTSQQPLMKDLYRFVNGEWLDTHVIPEDRGVDGTFHSLRDQAEVD
FT                   VHELVKSSSSRAGKLYASFMDVPGIEAAGVAAIDEDLDRLKVETTNELATALGELDRLG
FT                   VGGPVSFWVAKDSDGSDSVAYIVQSGLGLPDEAYYREHPDMLESYKAHVTTMLGFLDPQ
FT                   RLGGLPAEEASERIVALETDIARGHWDVVSTRDALKTFNPTEFSELPENVATLLRAARL
FT                   PESRVIVMMPSYLDHINTLLSERIDDWKLLTTWHILHARAGVLTPEISRADFAFFGTTL
FT                   SGATQQRDRWKRAVGLAESFVGEEIGEVFVKEHFPASSKKDMATLVDYLIAAYRERIEH
FT                   LQWMTPVTRKRALEKLDKFNAKIGYPDTWRDYGDLEFSDAGQDLLRNVRTGSAYAHDYE
FT                   LSKLGKPADRSEWVTTPQTVNAFYNPVVNDITFPAAILRAPFYSPTADAAENFGAIGAV
FT                   IGHEIGHGFDDQGSQYDGDGNLHSWWTEEDREAFTQLTSKLVEQFDGLVPSVLKESTGV
FT                   NGKFTLGENIGDLGGLGIAVVAYQRYLADHGEDTTGLQRLFLSWARIWRTAIRPELAEQ
FT                   YLAIDPHSPAEFRCNVIAGNIAEFYQTFNVPEDSPMWIAPEKRVTIW"
FT   gene            96431..96973
FT                   /locus_tag="CPC231_00495"
FT                   /old_locus_tag="CpC231_0097"
FT   CDS_pept        96431..96973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00495"
FT                   /old_locus_tag="CpC231_0097"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09595"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDM2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400909.1"
FT                   /protein_id="ADL09595.2"
FT                   /translation="MSYFQFRPAMSAKSWWLVAVVVTLLLVLPAALNAVVPSIDFKLKN
FT                   VILGKKDSFELPVVLDDGAHLQCKEEMSDLFQPQWDCEGTRINSMVVDGSTDQDHTLRR
FT                   MMRLNAKVPLPKDAKIFREGNIRIIEGASQVGLSLAVQGEDEQKTLFVLVTGPDTDNAV
FT                   QLIAKNFQNYAVKGATA"
FT   gene            96970..97872
FT                   /locus_tag="CPC231_00500"
FT                   /old_locus_tag="CpC231_0098"
FT   CDS_pept        96970..97872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00500"
FT                   /old_locus_tag="CpC231_0098"
FT                   /product="PrsW family intramembrane metalloprotease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09596"
FT                   /db_xref="GOA:D9QDM3"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDM3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240959.1"
FT                   /protein_id="ADL09596.1"
FT                   /translation="MNTSLVGPIKSATHPASISWVMWAIIGISAPVSLFYLGAYVLLSP
FT                   SGSAVGLLCGVAYLIVGTLIFRVSPMWPKAGWKWYVTSLCWGACSSFALVMASSQPIID
FT                   LTEKLGWKMVSASFGGAYPEEISKALGVLLILFTFSKISRPWHGFVTGGMVGLGFEIFE
FT                   NLMYGVIEGMSDANSDVPGALSSWGLRTLAGPGLHVFFTAIAGYGIGLAVFTYGWDRFR
FT                   RLQVAGAALLVAFTFHFCWNLTWEGDLGTIINVIVVSLCLYPLVIYLWIRCHRDATADF
FT                   GMIRMNSPLTLVSQVRNDE"
FT   gene            97865..98740
FT                   /locus_tag="CPC231_00505"
FT                   /old_locus_tag="CpC231_0099"
FT   CDS_pept        97865..98740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00505"
FT                   /old_locus_tag="CpC231_0099"
FT                   /product="glycine/betaine ABC transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09597"
FT                   /db_xref="GOA:D9QDM4"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDM4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522084.1"
FT                   /protein_id="ADL09597.1"
FT                   /translation="MNKRIAVLGVAMCLTACGSIESVDGGRTDSDAIVIGSQTYYSNEV
FT                   IAEIYAQALEKAGHKVDRQFQIGQREVYMSEVENGSIDVFPEYSGPLLQYWKPDTTARL
FT                   PEAVYAELQSALPSSLQVLNQAEASDQDSYVVTKQYSEEHGIKSIQDLAKVKNITLGAN
FT                   SEAEDRPNGPKGLKSVYGVDAAFTPIEDSGGPLTVKALKDGDIQLAIIYSADPSIAANN
FT                   LVSLEDPKGQFLASRVVPLANKKLDADAAAVLNKVNAQLTTQDLIQLNTRSVTEQLPSA
FT                   LIAKEWLKAH"
FT   gene            complement(98748..102032)
FT                   /locus_tag="CPC231_00510"
FT                   /old_locus_tag="CpC231_0100"
FT   CDS_pept        complement(98748..102032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00510"
FT                   /old_locus_tag="CpC231_0100"
FT                   /product="arabinosyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09598"
FT                   /db_xref="GOA:D9QDM5"
FT                   /db_xref="InterPro:IPR007680"
FT                   /db_xref="InterPro:IPR027451"
FT                   /db_xref="InterPro:IPR032731"
FT                   /db_xref="InterPro:IPR040920"
FT                   /db_xref="InterPro:IPR042486"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDM5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558547.1"
FT                   /protein_id="ADL09598.2"
FT                   /translation="MDKHDVDSDFVSSSVSQKVKTLKLLAVLSGVLGFILFLLTPFMPV
FT                   NQVQSSLSWPQNGNLNSVNAPLMSYSPQELNAVIPISASEKLRPGQSLIVGTLPEDSED
FT                   AAARGLFVRSSDGGIQITSRGELVFELTADELKKLPADAKVSVSSTKDATTASVGEYSG
FT                   SIDEDKRPQITGLYSELDSQAADSLSSALKVDVEINSRFTTSPTAAKYTTMWLGGAMTV
FT                   IALVCLGLLDLQDNKKVRFLQHGAWRPRGLDAIVVAILGFWYFIGANTSDDGFILTMGR
FT                   IAAHADYMANYYRWFGVPESPFGAPYYDLLGLMSHVSTSSIWMRLPSLIAALIVWFALS
FT                   REVLPRLGEKIAGRRVSQWTMAFVFLAFWLAYNNGLRPEPIIAAGTLLTWLSFEVAIKT
FT                   ERLLPAAVGTLLAAFTLACGPTGLMAVACLLAGLSYLIRIIYRRIPLLGGKPAFNIAAM
FT                   VAPFAAAGTAVLVAVFGDQTLMNVFESIHVRSETGPSLSWYNEFARYQVLMQQTVDGSF
FT                   ARRIGVFFTFISIALVLTSILRNGKVPGSNKGPVFRLLLAMVGTLFFMMFTPTKWTHHF
FT                   GVWAGIAAALAGVGAVALSHMALRAPRSRTLLTGGILFVFAFALSGTNGWWYTSSYSVP
FT                   WWDKTIQIHEIEASTVMLVISLVVLGIGVLQSFKKDVAEERGEAPVDFRKQRFEGLAAA
FT                   PIAILSILAVAFSMASLGKGFLSQYPAYSVGLGNLRAAAGNTCNLANDVLVEANTNESF
FT                   LQPLHSSLGESLTFGKNRAFDPNHISSEAYTEENKSSSSTAGTANSTDTTETTTEGKEH
FT                   RAAVGVNGSTAQLPFNLDYTRVPVLGSWTSGEQHYAEAISDWYKLPERSESAPVIAVSA
FT                   AGSIEHLDLDGIKKEGQKLIIEYGTASNGKVDMLGEKQMLDIGPDLKWRNLRLPLSELP
FT                   EEANVIRIHATDGNLSPDEWLAFTPPRVPTLETLNDVYTSETPGLLDWAVPLQFPCQRT
FT                   FNHYAGVAEIPKFRISADAEGRASGASFQDYFGGGVTGIAEAVNYSYQLPSYSKNDWQR
FT                   DWGSIEVYHPRPNSQGKEPDLAQITTETVTRSGLWYPGPMNINTDH"
FT   gene            complement(102025..104100)
FT                   /locus_tag="CPC231_00515"
FT                   /old_locus_tag="CpC231_0101"
FT   CDS_pept        complement(102025..104100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00515"
FT                   /old_locus_tag="CpC231_0101"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09599"
FT                   /db_xref="GOA:D9QDM6"
FT                   /db_xref="InterPro:IPR020959"
FT                   /db_xref="InterPro:IPR020963"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDM6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910552.1"
FT                   /protein_id="ADL09599.1"
FT                   /translation="MINRARNADSQPPKDDSEAPHASAAASDPFPVMLKHPDKDNLRDK
FT                   SYDFDYTPDIQDGPHTLFGIVAAILGGGLFTFISWYILKQVNLPAFGPSLVTRALATFC
FT                   TLLVVVAVTALMIWWVHYEKTNQERPRWFTWLTYALTYLSPAGLVVASLGIPLSPTKLY
FT                   LDGLTVDQVFRTQYMTRLTDSWQLTDMNYIDLPAYYPGAWFWFGGRLGALLGLPGWEVF
FT                   QPYSLISLSMAGCLLVPIWQRLVGSLPVATGIALVTTTIALVMCAEEPYACIIAMGIPA
FT                   AVIIGRRALSGRKSAMLAIIFYLGVSASMYTLYTAIIALSLIAITGVISALMLRSWKPI
FT                   GRIVTIGVSSMAIAAIAWGPYFVFILSGNHTSGATASHFLPVEGTEIPLPMFAASIVGI
FT                   LCMLGLIYLLARAADPDINSLGVAVVVAYIWVIASMAVTLTGSTLLGFRLDPVVTVLLA
FT                   TAGVLAIADFRLVGIHRLYPVQFSASTSRQITMVIAIVIALGGIKYAQDIPAKHSHSID
FT                   HAYSSTDGNGERADRYPADATQYYAEIDKILRGNGSLPRETVVLTDEMNFMAYYPYHGF
FT                   QAFTSHYANPLGEFNERNKTIEQWAMDSWQQLKDPKAFDRALHATPWRAPDAFVFRADS
FT                   TEESSSGWNFDLAEDIYPNNPNVRFRGVKINPEVFTGKDSPWKVDQVGPFVVVTRG"
FT   gene            complement(104248..105009)
FT                   /locus_tag="CPC231_00520"
FT                   /old_locus_tag="CpC231_0102"
FT   CDS_pept        complement(104248..105009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00520"
FT                   /old_locus_tag="CpC231_0102"
FT                   /product="decaprenylphospho-beta-D-erythro-pentofuranosid-2-ulose
FT                   2-reductase"
FT                   /EC_number="1.1.1.333"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09600"
FT                   /db_xref="GOA:D9QDM7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDM7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005323212.1"
FT                   /protein_id="ADL09600.1"
FT                   /translation="MLNAVGKAQNILLLGGTSEIGLAIVNEFLTHGPAHVTLAARKDSP
FT                   RIDAAVKDIESAGASAVEVIDFDATAFDTHADVIDQAFLLGDVDVAIVAFGTLGDQEEL
FT                   WQDQSKAVASAETNYTAPVSVGVLLAEKFKAQGHGTIVALSSVAGQRVRRSNFVYGASK
FT                   AGMDGFYVNLGEALRDYGVNVLVVRPGQVRTKMSADAGEAPLTVDREDVAKATVQAVLS
FT                   GKSSIFVHPLFEYVSLVFKFIPQAIFRKLPF"
FT   gene            complement(105025..106491)
FT                   /locus_tag="CPC231_00525"
FT                   /old_locus_tag="CpC231_0103"
FT   CDS_pept        complement(105025..106491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00525"
FT                   /old_locus_tag="CpC231_0103"
FT                   /product="FAD-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09601"
FT                   /db_xref="GOA:D9QDM8"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDM8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_006061521.1"
FT                   /protein_id="ADL09601.1"
FT                   /translation="MTSAKGTSSTAASSGVSGALHTEAMKLTGWGRTAPTTAEVLATPD
FT                   LETIVKAVRQVAEQNDSKPDYLRRGVIPRGMGRSYGDPAQNAGGLVIDMQPLNKIHSID
FT                   PETAIVDVDGGVTLDQLMKAALPYGLWVPVLPGTRQVTIGGAIGPDIHGKNHHSAGSFG
FT                   DHVTSMELLVADGRILHLEPEGSADDPDGSLFWATVGGMGLTGIIVRAKIRMTKTETAY
FT                   FIADGDLTANLDETVEFHSDGSESNFTYSSAWFDAISPEPKLGRAAISRGSLATLAQLE
FT                   ELSPKLAKDPLKFNAPQLVTVPDIFPSFTMNKLSMIAIGELWWLKSGTYRNKVQNLTQF
FT                   YQPLDLIGEWNRGYGSKGFLQYQFVVPREAVEPFKDIVRDIQRSGHYSALNVFKLFGEG
FT                   NRAPLSYPMPGWNVCVDFPIKPGLGKFLDELDRRVMEFGGRLYLAKESRTSAENFHSMY
FT                   PEMEGWLKTRNAIDPTGVFASDMSRRLELH"
FT   gene            complement(106575..106799)
FT                   /locus_tag="CPC231_00530"
FT                   /old_locus_tag="CpC231_0104"
FT   CDS_pept        complement(106575..106799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00530"
FT                   /old_locus_tag="CpC231_0104"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09602"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDM9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240965.1"
FT                   /protein_id="ADL09602.1"
FT                   /translation="MFGFLKKKTVETHIAAERTNTPMDSRMTLLMAEEIPMLDSASRVR
FT                   IYQILEEYDGPQITSQEELPQEIRDMMDL"
FT   gene            106844..107305
FT                   /locus_tag="CPC231_00535"
FT                   /old_locus_tag="CpC231_0105"
FT   CDS_pept        106844..107305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00535"
FT                   /old_locus_tag="CpC231_0105"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09603"
FT                   /db_xref="GOA:D9QDN0"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDN0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366302.1"
FT                   /protein_id="ADL09603.1"
FT                   /translation="MKDTTVERNLNPLDDTMTGRISQAAAIGLITALPDYVHTKALRWV
FT                   INTVILGSLLGVALYANTHDDDPDNDPDVIAARVREQLESSDAKEFGPLVTWGAFAVLL
FT                   LIFLGINKLDRTISKKVVEFLRRRGVSKPHTLLGVVGAALVFVSSGDQR"
FT   gene            107302..107832
FT                   /locus_tag="CPC231_00540"
FT                   /old_locus_tag="CpC231_0106"
FT   CDS_pept        107302..107832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00540"
FT                   /old_locus_tag="CpC231_0106"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09604"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDN1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522969.1"
FT                   /protein_id="ADL09604.1"
FT                   /translation="MISIIDVRGAAPDHTVVLWHVHTDPSYPTGLMSGAWVLGPGEATP
FT                   VDKLPSLLTGTTALPLNAEARELVPGDITCVSLRDVADAVRTGLDEIKKEAARAKSENE
FT                   KLVAPRFEALTDISPEDFLDAYRGEPQARDAWMMASAVAGWMQQWLDIESVRRSRAYLK
FT                   EAFGSEPRPLPIG"
FT   gene            107853..108740
FT                   /locus_tag="CPC231_00545"
FT                   /old_locus_tag="CpC231_0107"
FT   CDS_pept        107853..108740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00545"
FT                   /old_locus_tag="CpC231_0107"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09605"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDN2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366304.1"
FT                   /protein_id="ADL09605.1"
FT                   /translation="MIQRSGVIWISEARLRRGKAVARRRRIRAGKIIVLQLKVIDAAGI
FT                   LHRVLGVRDTLKLAGVAEIIKTCFGFDAASPQSFYRCGEQVSMNDCLHAHTAAIRAGQL
FT                   EYNWGLWRVSLSILDTYSREASAPEALCLGGSGDLYEPDAPVDTARINMAISGGKRAQE
FT                   TLAHVHEEVVSIIQRTQETGLIPLLQALGLGEEPNYAASGLQALPVEQSRQAREAWWSF
FT                   VIGMACMGGKDLRSRVAGRLMRKLGWQEDLTDERIRELCGASISKLEELGGCGAHALSA
FT                   VERIDIYRELLRKR"
FT   gene            108752..109210
FT                   /locus_tag="CPC231_00550"
FT                   /old_locus_tag="CpC231_0108"
FT   CDS_pept        108752..109210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00550"
FT                   /old_locus_tag="CpC231_0108"
FT                   /product="GtrA family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09606"
FT                   /db_xref="GOA:D9QDN3"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDN3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240969.1"
FT                   /protein_id="ADL09606.1"
FT                   /translation="MANSNTGAHDQAAPNVTVTTSSASVASQGIKFIISGGISAVVDLG
FT                   LTYLCQIVFGFSAAGGRTIGFIFGTITAYLINRRWTFQAEASTKRFLQVAVLYTITYFV
FT                   NVGGHSLLFSLLTHYGVSEQIALVIAFVISQGTATVINFFVQRIFIFK"
FT   gene            complement(109214..110116)
FT                   /locus_tag="CPC231_00555"
FT                   /old_locus_tag="CpC231_0109"
FT   CDS_pept        complement(109214..110116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00555"
FT                   /old_locus_tag="CpC231_0109"
FT                   /product="glycosyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09607"
FT                   /db_xref="GOA:D9QDN4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDN4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525187.1"
FT                   /protein_id="ADL09607.1"
FT                   /translation="MPIASTGRIAAVIVTHNRVELLQNSLKIVAQQTHPVDHIIVVDNG
FT                   DDPAVESLVTAIAGERAVYLGSKHNLGGAGGFALGFLTALRLGADAVWCADDDGRPEDE
FT                   NVLATLLHVAKKHHLDEVSPVVCNAEEPDQLAFPLRRGTTWRRFRSELGNEDFLAGIAS
FT                   LFNGALISADAMQRIGVPDLRLFIRGDEVEYHRRLVRSGLKFGTCLTAAYLHPDGSDEF
FT                   KPILGGRMHTQYPDNEGKRFFTYRNRGYLMNQPGMRRLLPQEYARFGWFFLIQRKDPKG
FT                   FLQWLKLHHMGRSERFERP"
FT   gene            110370..111340
FT                   /pseudo
FT                   /locus_tag="CPC231_00560"
FT                   /old_locus_tag="CpC231_0110"
FT   CDS_pept        110370..111340
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00560"
FT                   /old_locus_tag="CpC231_0110"
FT                   /product="zinc ABC transporter solute-binding protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366307.1"
FT   gene            111419..112144
FT                   /locus_tag="CPC231_00565"
FT                   /old_locus_tag="CpC231_0112"
FT   CDS_pept        111419..112144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00565"
FT                   /old_locus_tag="CpC231_0112"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09610"
FT                   /db_xref="GOA:D9QDN7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDN7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014654957.1"
FT                   /protein_id="ADL09610.1"
FT                   /translation="MANLVGSALTMTGISVSYGPTVALENASIEVPVGSVMGFIGPNGA
FT                   GKSTLIKSAIDLVDHDGEVAFFGKPLAQVRDRVAYMPQSAAVDWDYPITVEQVVGMGLY
FT                   PRLGWFKRFTGKHREEVRHALERVGIADLAKRHISELSGGQRRRVFVARILVQNPDIFL
FT                   LDEPFAGVDAASERVIRDVLHGLCEDGKSVVIVHHDLSTVTELCDHVTVINRQIVATGT
FT                   VEEAFTRETVNAAFGLGLL"
FT   gene            112141..112785
FT                   /locus_tag="CPC231_00570"
FT                   /old_locus_tag="CpC231_0113"
FT   CDS_pept        112141..112785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00570"
FT                   /old_locus_tag="CpC231_0113"
FT                   /product="iron ABC transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09611"
FT                   /db_xref="GOA:D9QDN8"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDN8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240974.1"
FT                   /protein_id="ADL09611.2"
FT                   /translation="MSIIDFLAEFSYRRVVWGTLLIGLCSGAMGTFLYLRRQSMMSDVI
FT                   GHSATPGVMGAFLFFATTPWLSESQLLADWGIDARSMPVITIGAMVTGLASAIVANAVA
FT                   DSTRIGIDSTMAVMLSLLVVVAIVIGVKAVGLILMIAFAVFPPAAARQWTRTVAQMVVV
FT                   SGLIGAIAAIVGSYISISAGKVPTGPVIVLVLAAFVIVALVASPRRAAVIR"
FT   gene            112782..113657
FT                   /locus_tag="CPC231_00575"
FT                   /old_locus_tag="CpC231_0114"
FT   CDS_pept        112782..113657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00575"
FT                   /old_locus_tag="CpC231_0114"
FT                   /product="metal ABC transporter permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09612"
FT                   /db_xref="GOA:D9QDN9"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDN9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799883.1"
FT                   /protein_id="ADL09612.1"
FT                   /translation="MSFAVSVSVLALVVSLTAAIPGIVLVLRRQAMLSDALSHAVLPGI
FT                   AVAALWTASPDDPLLLVGATLSGVAVIALTEWIRDRKKVTEDSATGLVFPAFFAIGVII
FT                   ISMRFNNSTISEHTVLVGDLNIAALNHWVAWGIDFGPKSAWTIGVVGLVALGVVILARR
FT                   PLMISTFDPTFAAAVGIRTRLLNYLVMVLVSLTIVVVFDAAGAVLAVALMIVPAAAALM
FT                   VTRSETAMVVVTLIIAAASSQVGFWVAYRIDAATSPTMAFVDGLICLALWIGVRVLRKR
FT                   KEVHVRADVV"
FT   gene            113777..114769
FT                   /locus_tag="CPC231_00580"
FT                   /old_locus_tag="CpC231_0116"
FT   CDS_pept        113777..114769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00580"
FT                   /old_locus_tag="CpC231_0116"
FT                   /product="zinc ABC transporter solute-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09614"
FT                   /db_xref="GOA:D9QDP1"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDP1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240976.1"
FT                   /protein_id="ADL09614.2"
FT                   /translation="MNRSFFRNTCAAIAVVGLLSASACAADNKETAPVKNSSSPKIFAT
FT                   TGYIGDAVKNVAPDADLTVMVGPGGDPHTYQPSTSDVKAMQEADVVFWSGLGMEANMID
FT                   QLKGLGDKQIALAEQIPENMLLPWEEDGDHESHSHEGHEHEGHSHGAWDPHVWNSTDNW
FT                   KLVVDQIVKKMSAADPDKADTYKTNGAEYNKKIDETKAYVQERINTIPADQRTLVSGHD
FT                   AFRYFGKQFGLEIKATDFVTSDAQRSASELNELAEFIVEHKVPVIFQDASANPQAVKSL
FT                   EENVAAKGGKVTVSSAELYSDSLGATAPADTYTGALRYNADTIAAAYKG"
FT   gene            114816..115550
FT                   /locus_tag="CPC231_00585"
FT                   /old_locus_tag="CpC231_0117"
FT   CDS_pept        114816..115550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00585"
FT                   /old_locus_tag="CpC231_0117"
FT                   /product="phosphatase PAP2 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09615"
FT                   /db_xref="GOA:D9QDP2"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDP2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799885.1"
FT                   /protein_id="ADL09615.2"
FT                   /translation="MYPPFSQAGSTSLEVEKTMEVPSSHAKVSAQRWWTAIIGVLAVAI
FT                   IGLGVRSLTSDLFITQAMNNQRKGAIESLVDAVYYGLEPAYSLVLTLVISALVGIACKQ
FT                   VRIGLQCAVAIAITWVPVVFVKMLIERPRPSSDLLAHPIPVTPGDWSFPSGHTTYVTAL
FT                   AMMLMLTVGARLPLILRALLVLCAVLVIAGVVLTMGVHYLTDVVAAVIWSTTMAPLVWN
FT                   LVDNAGRRLWFSRFENAGRPSV"
FT   gene            complement(115597..116391)
FT                   /locus_tag="CPC231_00590"
FT                   /old_locus_tag="CpC231_0118"
FT   CDS_pept        complement(115597..116391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00590"
FT                   /old_locus_tag="CpC231_0118"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09616"
FT                   /db_xref="GOA:D9QDP3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDP3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558549.1"
FT                   /protein_id="ADL09616.1"
FT                   /translation="MVSIDTYNACVDFPIFDAKSRSMKKAFLGAAGGAIGRNKDNTVVV
FT                   EALRDVNLHLKEGDRIGLVGHNGAGKSTLLRLLSGIYEPTRGSAHVRGRVAPVFDLGVG
FT                   MDPEISGFENIVIRGLFLGQTRKQMKQKMDEIAEFTELGDYLAMPLRTYSTGMRIRLAL
FT                   GVVTSIEPEILLLDEGIGAVDAAFMAKARERLSDLVQRSGILVFASHSNDFLVQLCDSA
FT                   LWIDHGTVRQAGAVDDIVEAYEGKGAADHVRRLQKRIREESK"
FT   gene            complement(116407..117312)
FT                   /locus_tag="CPC231_00595"
FT                   /old_locus_tag="CpC231_0119"
FT   CDS_pept        complement(116407..117312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00595"
FT                   /old_locus_tag="CpC231_0119"
FT                   /product="ABC transporter permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09617"
FT                   /db_xref="GOA:D9QDP4"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDP4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366314.1"
FT                   /protein_id="ADL09617.1"
FT                   /translation="MQEQTKVNNPESLESMIARITHADHVDPKPSRSKTLAAAWSDLVR
FT                   GFKQHELWLQLGWQDIKQRYRRSVLGPLWITIATGVMALALGLLYSVLFKIPVAEFLPH
FT                   VTVGLIMWNFISGCIKEGAEVFITNEGLIKQLPSALSVHVYRLVWKQTLFLFHNMVIWF
FT                   ILMLVFPRPLGWDILLGIPAIALLVVNGVWVSMFFGIIATRYRDFSPLLEALTQLLFYV
FT                   TPIVWTTQTLYAQGGAVSERAKLAMLNPLYHYMEVVRAPLIGAPINPLNWYVVIGCTVV
FT                   GTFLAMLAMKQWRFRVSYWV"
FT   gene            117454..118647
FT                   /locus_tag="CPC231_00600"
FT                   /old_locus_tag="CpC231_0120"
FT   CDS_pept        117454..118647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00600"
FT                   /old_locus_tag="CpC231_0120"
FT                   /product="aminotransferase class V-fold PLP-dependent
FT                   enzyme"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09618"
FT                   /db_xref="GOA:D9QDP5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDP5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240980.1"
FT                   /protein_id="ADL09618.1"
FT                   /translation="MVFDVARVRGAYTSVSGTWTYLNAQEQPQIPERVSSAVSRGFRSA
FT                   PLAAEIERGAGSHALLQRAGRFIADDHFYSARMAIADMTGTSADAVLLGPSRDVLFARL
FT                   SRALRPLLRRGSSAVFSRTDSCGLDLDAEIRWAEPDLGTGEVPAWQFSKLVDGSTRVVA
FT                   LSAASRQVGTINPILEIAEYVHDSSRAWVLVDATPLAGHRPITREALGADIISVDCEAF
FT                   GGPQVAALAFRDTTMFPRIDMEVFDTPVAAGLAAGVSAAVDHLADLDEDARGTRRYRLA
FT                   QGVESAANYLGWLGTYLVDSIESLPNTHVFGVTGEAAAGSDVDRIPHATFCINGVPADM
FT                   IQQRLINNGLVATVAEADPLLTAMGVGDTKGAISVGLGPYNTVADVDQLIRVVASLA"
FT   gene            complement(118644..119603)
FT                   /locus_tag="CPC231_00605"
FT                   /old_locus_tag="CpC231_0121"
FT   CDS_pept        complement(118644..119603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00605"
FT                   /old_locus_tag="CpC231_0121"
FT                   /product="zinc-binding dehydrogenase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09619"
FT                   /db_xref="GOA:D9QDP6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDP6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366316.1"
FT                   /protein_id="ADL09619.1"
FT                   /translation="MKAIIIDENKQLSYQDVADPQLESGCALIRVKASGVNRADLLQAA
FT                   GHYPPPPGESKILGLECAGVVEDPGDTSWKKGDKVACLLAGGGYAELAVVPEGQLMPIP
FT                   AGYSFAQAAAIVEVACTVWSNIGMLTGLKPEHTILIHGGAGGIGTFAIQMAKHIGATVA
FT                   VTAGSTEKLEVCRELGADILINYREQDFAEILKNKCDRILDIMGAKYLDQNVRALAMDG
FT                   HQVTIGMQGGVKGELNIGRLLSKRGTISATALRARDRADKARIVADTVKNIWPLLESGR
FT                   ISHRIHATLPLSQAQKAHELLDSGEVSGTLVLLADAPS"
FT   gene            119684..119771
FT                   /locus_tag="CPC231_00610"
FT                   /old_locus_tag="CpC231_t05"
FT   tRNA            119684..119771
FT                   /locus_tag="CPC231_00610"
FT                   /old_locus_tag="CpC231_t05"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:119718..119720,aa:Ser,seq:tga)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            complement(119817..120848)
FT                   /gene="hisC"
FT                   /locus_tag="CPC231_00615"
FT                   /old_locus_tag="CpC231_0122"
FT   CDS_pept        complement(119817..120848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="CPC231_00615"
FT                   /old_locus_tag="CpC231_0122"
FT                   /product="histidinol-phosphate transaminase"
FT                   /EC_number="2.6.1.9"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09620"
FT                   /db_xref="GOA:D9QDP7"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDP7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240982.1"
FT                   /protein_id="ADL09620.1"
FT                   /translation="MIREDLAQIPTYVPGHHADHTLKLSSNEVAFGPLPGAAEAMAKAI
FT                   TTVNRYPDMGAEEIRERLAEHLGLDAQQVAVGCGSSALCQQLVQISAGPGDEVIFPWRS
FT                   FEAYPIFVHVTGATPVAVPLKEGFNDLDAMAAAITENTRLIFVCNPNNPTGTLISQDAF
FT                   LAFMNKVPSNVLVALDEAYIEYVRAEDTPLATEFIHAYPNLIGLRTFSKAFGLAGIRIG
FT                   YAFGSPSLIEALNKVALPFGVNTVAQAGAIASLENLDELMERTEEVVLNRDRVAEHVGA
FT                   GHSQTNFVWIPADSRPESPTDIAEQLHNHDVIVRAFPEGVRITVTNSEETDRLLAAWDA
FT                   SFS"
FT   gene            120955..121043
FT                   /locus_tag="CPC231_00620"
FT                   /old_locus_tag="CpC231_t06"
FT   tRNA            120955..121043
FT                   /locus_tag="CPC231_00620"
FT                   /old_locus_tag="CpC231_t06"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:120989..120991,aa:Ser,seq:gct)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            121091..121163
FT                   /locus_tag="CPC231_00625"
FT                   /old_locus_tag="CpC231_t07"
FT   tRNA            121091..121163
FT                   /locus_tag="CPC231_00625"
FT                   /old_locus_tag="CpC231_t07"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:121124..121126,aa:Arg,seq:acg)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            121603..123177
FT                   /locus_tag="CPC231_00630"
FT                   /old_locus_tag="CpC231_0123"
FT   CDS_pept        121603..123177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00630"
FT                   /old_locus_tag="CpC231_0123"
FT                   /product="DASS family sodium-coupled anion symporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09621"
FT                   /db_xref="GOA:D9QDP8"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDP8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525196.1"
FT                   /protein_id="ADL09621.1"
FT                   /translation="MSTPITHESSEHALAEDAEVRDQSERRRQIIGLFVGLVLAALVYL
FT                   IFPESSVDVVSSADSKGSYTHGALRITAAVAVLMGAWWMTEAIPLAATALVPLVAFPLL
FT                   QVIEFSKISAPYASPTIFLFMGGFILALGMQRWNLHRRLALSVVLLVGTKPKQLVAGFM
FT                   LATGFLSMWVSNTATAVVMLPIGVSVLQLTAESVGGMRAQKKFATSLMLAIAYSASIGS
FT                   LGTIIGTPPNALLVAYMAESHDIHIGFGTWMLVGVPLALVYMVIAWFILVTVFKPEVDT
FT                   IPGGRALIKEELHKMGAMKFGEAATAVIFASAALAWVFVPLVIKWMGWKVSIADAVIGL
FT                   VASMLLFLIPADRKTGTRLMDWKTANELPWDVLLLFGGGLALSKMFSESGLSLWIGETA
FT                   KGLGVLPLILLIGAIAALVLILTEFTSNTATAATFLPIMAGVAVGIGLNANGDQNILLL
FT                   TIPVALSATCAFMLPVATPPNAIAYSSGFVKIGDMVKGGVWLNLIGIILVTLVTYFLAI
FT                   PVFDIVL"
FT   gene            123428..124276
FT                   /locus_tag="CPC231_00635"
FT                   /old_locus_tag="CpC231_0124"
FT   CDS_pept        123428..124276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00635"
FT                   /old_locus_tag="CpC231_0124"
FT                   /product="PRD domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09622"
FT                   /db_xref="GOA:D9QDP9"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036650"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDP9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799889.1"
FT                   /protein_id="ADL09622.1"
FT                   /translation="MPELIIRRVLSNNAVLAAENCSEAGERILVGKGIGFSKKPGDYVE
FT                   HGGGSREYVELSEQHRALLEGLSSIDGATFHVISASIDVASDVLGKLHPSVYLILAEHL
FT                   SFAVQRVGRGETIRNSLVVEIKAVVPEEFSAAELVVNYLNTHLDSIVLPIDEAAFIALH
FT                   LHAARTGGTVKQPLAVANAIGQVTAKAHRLLRTPAEAGNDALSMELALAYQRLQRKQLR
FT                   HNVLLASVEKLLPHEYAVAAELLTDLSGEPQLPLSARGEAAFLAVFLHGWTQENVNKEK
FT                   G"
FT   gene            124280..125860
FT                   /locus_tag="CPC231_00640"
FT                   /old_locus_tag="CpC231_0125"
FT   CDS_pept        124280..125860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00640"
FT                   /old_locus_tag="CpC231_0125"
FT                   /product="PTS transporter subunit EIIC"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240985.1"
FT                   /protein_id="QHI00983.1"
FT                   /translation="MGSVMNALQRLGKALMGAVAVLPVAAILMGIGYWIDPVGWGADNT
FT                   VAAIFIQSGLAILDNLGWIFAIALAFGLAKDSNGAAALSGFVGFATITQLIGPKAVASY
FT                   KGIGDPTALEGDAALEWASQGWGAIGGKNVLFGILIGVLAAWVYNKFHATKLPDFLAFF
FT                   SGRRLVPILTSFFSIILSGIMYFVWPIIYSVLFNFGELIQGMGPAGAGIYGFINRLLIP
FT                   TGLHHAVNSIFWFDVIGINDIGKFLGGGKTIEAAQAATDAASCPGNWVDGSCQVVGIIG
FT                   QYQAGFFPVMMFGLPGAALAIYLRAESKRKKVVGSLMLAGALAAFFTGVTEPLEFSFMF
FT                   LAPVLYVVHALLTGLSLFIASVFHWTAGFGFSAGFIDMFLSAQNPLANQWWMLLVLGVI
FT                   YFALYFGIFYTLIGVLHLKTPGREEEDETEVESTADASTSDMAAQIIDGLGGPSNIDVV
FT                   DYCATRLRVTVQDSARVDEPAIKRAGVIGVMRPGAKNVQVVIGPQVQFVYDEVAAQLSG
FT                   KVSLKGEQG"
FT   gene            125863..126318
FT                   /locus_tag="CPC231_00645"
FT   CDS_pept        125863..126318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00645"
FT                   /product="PTS glucose transporter subunit IIA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240986.1"
FT                   /protein_id="QHI00960.1"
FT                   /translation="MFGFAKKKVVVIPPIHGPLLPLSSVNDAVFSSGMMGEGFAVEPDG
FT                   FGEVVAPVSGKLVTVFKTGHAFAIKTPEGLEVLVHIGLDTVEMGGRGFAAHKASGENVV
FT                   QGEKLITVDFDAVRAAGYDPVTLVVFTNKKCVDHVELNAGKATVFLN"
FT   gene            126478..127281
FT                   /locus_tag="CPC231_00650"
FT                   /old_locus_tag="CpC231_0126"
FT   CDS_pept        126478..127281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00650"
FT                   /old_locus_tag="CpC231_0126"
FT                   /product="VOC family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09623"
FT                   /db_xref="GOA:D9QDQ0"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDQ0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240987.1"
FT                   /protein_id="ADL09623.1"
FT                   /translation="MSLILHGDPTWIDLSTHDLEGSQAFYKELFGWEFNSQGEECGGYN
FT                   IILSEGQPVGGAMDSHMGPEGPSETPMAPTAWTIYLKVDDINAALAAAQETGGQVLLPS
FT                   MQVGTLGFMAIVSDPAGGVVGLWQALDFPGITREPVKGQPAWFEVMSKDFDAAAPFYQK
FT                   VAGWKLSYIGEDGQPADSAQDGIRYAANAPGEAATAGICEAKDFLPEEVPSHWRVYFSV
FT                   ADVDATVSKLQELGGQLIDGPVDTPFGRIATVADPQGASFQLSSR"
FT   gene            127508..129826
FT                   /locus_tag="CPC231_00655"
FT                   /old_locus_tag="CpC231_0127"
FT   CDS_pept        127508..129826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00655"
FT                   /old_locus_tag="CpC231_0127"
FT                   /product="nitric-oxide reductase large subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09624"
FT                   /db_xref="GOA:D9QDQ1"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDQ1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799890.1"
FT                   /protein_id="ADL09624.2"
FT                   /translation="MIGGSRVALLEAPQRMSSRDKRWWSALAAVIIASFVVLLWMGQQI
FT                   NVHKPPIPERVETAQGKVLVTKDQIINGQQVWQSIGGQQIGSVWGHGAYVAPDWTADWL
FT                   HREATQILDKWAQKEGASDYAALGVEKQAALKARLKSELRTNGYQDGRIVLSDDRVAAF
FT                   EANKKYYAELFANGHENYAIPKDSIKDEAAAQDMAAFFWWTSWAASTNSPGSEETYTQN
FT                   WPHEQLIDNVPPTSNILWSIISFILLLAGIGGLVWYQGWKGEENETPDVTPEKDPLLGF
FT                   KPTPSQRATLKYFFIVGLLFVLQIACGIIAAHYGVEGGALFGIPIDKILPYAVVRTWHT
FT                   QLGIFWIATAWFATGLYVGPAVGGKEPKFQRLGVNILFGALLVVVLGSMAGEWASIMGK
FT                   LGYGNPINFWLGTQGYEYVDLGRVFQIGLFIGLALWFILMWRALAPAVRKAKTVPGKIM
FT                   PTPEAPLAAGTQRSLTAMLLMSCLAIAGFYGAAFGVNHETHLSIAEYWRWWVVHLWVEG
FT                   FFEVFATTVIAFLFARIGLVRPAAATTSVIVSTTIFLAGGIIGTAHHLYFSGAPAHVMA
FT                   LGAVFSALEVVPLALIGVEAFRNLNLLKLQPWVAGYKWAIYFFVSVSFWNMLGAGVFGF
FT                   LINPPISLFYVQGLNLTPLHGHTALFGVYGMLGIGLMLFCVRSLMPNANWDDRWLKWGF
FT                   WGMNGGLLAMSLLSLLPLGLAQAWASMDVGLWYARSDSFLYTPVLTFIRWLRVPGDIIF
FT                   AVGALAIGVFMVRLVARKK"
FT   gene            129906..129978
FT                   /locus_tag="CPC231_00660"
FT                   /old_locus_tag="CpC231_t08"
FT   tRNA            129906..129978
FT                   /locus_tag="CPC231_00660"
FT                   /old_locus_tag="CpC231_t08"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:129939..129941,aa:Arg,seq:acg)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            complement(130144..130830)
FT                   /locus_tag="CPC231_00665"
FT                   /old_locus_tag="CpC231_0129"
FT   CDS_pept        complement(130144..130830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00665"
FT                   /old_locus_tag="CpC231_0129"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09626"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDQ3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366323.1"
FT                   /protein_id="ADL09626.1"
FT                   /translation="MHFKTRMSLFCTATTAATSLAVASLQPAAAVEQPSNTIVSTIMLP
FT                   TKATVTKTFTVSSTKGTARADYSSNSITVQPGDTISVKIHSQGGYTEFSELTEFVPSVG
FT                   RLHTESITFKEGDSGPHPLKVAGWNATSQADRVTFRTNDGKPKAITLDTTLEYTYTVGV
FT                   RATGDPSTRFQLSSSDSNTVFTSASGPKIHVKKTLPSWLSGAFPGAIFDSLTNLLSPIL
FT                   RALNIL"
FT   gene            complement(131036..132430)
FT                   /locus_tag="CPC231_00670"
FT                   /old_locus_tag="CpC231_0130"
FT   CDS_pept        complement(131036..132430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00670"
FT                   /old_locus_tag="CpC231_0130"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09627"
FT                   /db_xref="GOA:D9QDQ4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDQ4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522086.1"
FT                   /protein_id="ADL09627.1"
FT                   /translation="MRSELVTHLPIAVDSSSSQPLPVQITSHIRSLVSQKIIAPGDHIP
FT                   SSRSLAAQLGVSRGTVLAAYEQLSAEGYLLAAHGSGTMINPHLAAPQPPPPPIGHTLRP
FT                   PSPPPLLNLEPGIPDTATLADSSWRASWRAACSTPPATSDPLGLPRLRAEISEHLRRMR
FT                   GLIADPEHIVVTAGAREGLSLLLTASQRRLTIGVESPGYPSLRRIPHALGHRTSNVTTD
FT                   KQGLNPDSLHKGLDAVLVTPSHQYPHGGSLSATRRTALSAWASDTDSLIIEDDFDSELR
FT                   YVGMPLPALTAINPEHAVLLGTFSSVIAPQVATGYIVAPPHMISVLRNLRTALGQPVSM
FT                   ITQDAIARYLATGALRRRTQRLRRIYRRRREMVSTQLGHLSSSELHPIDGGLHAVLSCQ
FT                   RPEAEIITDCANRGIHVVGLSNYWGGTDGNITPGANHDNGIVFGFGCHDDNTLREALDI
FT                   LAEIVQ"
FT   gene            132520..133416
FT                   /gene="pdxS"
FT                   /locus_tag="CPC231_00675"
FT                   /old_locus_tag="CpC231_0131"
FT   CDS_pept        132520..133416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxS"
FT                   /locus_tag="CPC231_00675"
FT                   /old_locus_tag="CpC231_0131"
FT                   /product="pyridoxal 5'-phosphate synthase lyase subunit
FT                   PdxS"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09628"
FT                   /db_xref="GOA:D9QDQ5"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDQ5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_003850286.1"
FT                   /protein_id="ADL09628.3"
FT                   /translation="MTETQTSTATHRVKRGLADMLKGGVIMDVVTPEQARIAEDAGASA
FT                   VMALERVPADIRSQGGVARMSDPDLIEGIVNAVSIPVMAKARIGHFVEAQILESLGVDF
FT                   IDESEVLSPADYTNHIDKWNFKVPFVCGATNLGEALRRVTEGAAMIRSKGEAGTGDVSE
FT                   AVKHLRTIRGDINRLRSMDADELYVAAKELQAPYELVKEVAETGKLPVVMFVAGGVATP
FT                   ADAALVMQMGAEGVFVGSGIFKSGNPAARAAAIVKATTLYDDPAALAEVSRGLGEAMVG
FT                   INVADVPAPHRLAERGW"
FT   gene            133410..133976
FT                   /gene="pdxT"
FT                   /locus_tag="CPC231_00680"
FT                   /old_locus_tag="CpC231_0132"
FT   CDS_pept        133410..133976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="CPC231_00680"
FT                   /old_locus_tag="CpC231_0132"
FT                   /product="pyridoxal 5'-phosphate synthase glutaminase
FT                   subunit PdxT"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09629"
FT                   /db_xref="GOA:D9QDQ6"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDQ6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366326.1"
FT                   /protein_id="ADL09629.1"
FT                   /translation="MVIGVLALQGGFAEHIAVLSRCGAKTRRVRVAQDLEGLKGLVIPG
FT                   GESSVIDKLARALGLAEPLAQSIGAGLPVFATCAGLIYLGQVENPAPGQRSLGCLDAVV
FT                   RRNAFGRQTDSFDTRIRVFDRIEADVSFIRAPEIISWGSDVEVTARVGGRVVGVKQGLI
FT                   HAYAFHPESAGETRLHEEWLREIGR"
FT   gene            complement(134003..135016)
FT                   /locus_tag="CPC231_00685"
FT                   /old_locus_tag="CpC231_0133"
FT   CDS_pept        complement(134003..135016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00685"
FT                   /old_locus_tag="CpC231_0133"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09630"
FT                   /db_xref="GOA:D9QDQ7"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDQ7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835781.1"
FT                   /protein_id="ADL09630.1"
FT                   /translation="MTINEVSRPVCILGLGLIGGSLLRALKETGLPAFGFNRSPSAARA
FT                   AEKEGYDVHSDLIETLQRAELENALIVLATPMPAIDSLLEAIQKHAPSCGFTDVVSVKG
FT                   EVYELVCARGLTHKYVGGHPMAGTANSGWEASYPELFRRAPWVVTFDHACDGAGPEWIQ
FT                   LWTDVVNMASSVGAEVIPSRVSSHDAAVARISHLPHVFAETLAIVGDNGGALALSLAAG
FT                   SFRDSTRVAGSAPSLVRAMCETNAEALLTALDEALVLLNDARAHLAEKRPSIEELVDVG
FT                   YRSRIRFEARSGANAPEHVGPISISHRPVFRLQPGVRDWVSQLIQAEGLGARIEVF"
FT   gene            135054..135506
FT                   /locus_tag="CPC231_00690"
FT                   /old_locus_tag="CpC231_0134"
FT   CDS_pept        135054..135506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00690"
FT                   /old_locus_tag="CpC231_0134"
FT                   /product="tRNA adenosine deaminase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09631"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDQ8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300394.1"
FT                   /protein_id="ADL09631.3"
FT                   /translation="MKSDFAVTVARVDAAWQVRVFKDDFSSLQTSINAVRSLRAEGAAF
FT                   AMLSVDDDYFVLVRPTPQSVRLLISDATAAVEDDFASEILDELDADLPDADDAPYAEGD
FT                   FDILADLGVGEQIMSVITDETDWWASEQLQRIAEELGCDEELDDAL"
FT   gene            135524..135979
FT                   /locus_tag="CPC231_00695"
FT                   /old_locus_tag="CpC231_0135"
FT   CDS_pept        135524..135979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00695"
FT                   /old_locus_tag="CpC231_0135"
FT                   /product="nucleoside deaminase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09632"
FT                   /db_xref="GOA:D9QDQ9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDQ9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525211.1"
FT                   /protein_id="ADL09632.3"
FT                   /translation="MLIDAQSLMRQAIIQAQATPPGDIPVGAVIFGPDGEVLGRGVNRR
FT                   EADRDPLGHAEIMAIREAVANHDDGWRLTDCTLAVTLEPCTMCAGALVGARIGRIFFGA
FT                   YEPKTGACGSAFDVVRDPAVLHVPEVRGGILQDECAALVTHFFEGLR"
FT   gene            136008..136098
FT                   /locus_tag="CPC231_00700"
FT                   /old_locus_tag="CpC231_t09"
FT   tRNA            136008..136098
FT                   /locus_tag="CPC231_00700"
FT                   /old_locus_tag="CpC231_t09"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:136042..136044,aa:Ser,seq:cga)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            136451..138838
FT                   /locus_tag="CPC231_00705"
FT                   /old_locus_tag="CpC231_0137"
FT   CDS_pept        136451..138838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00705"
FT                   /old_locus_tag="CpC231_0137"
FT                   /product="MMPL family transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09634"
FT                   /db_xref="GOA:D9QDR1"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDR1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366330.1"
FT                   /protein_id="ADL09634.1"
FT                   /translation="MAKLLYRIGKWSFRAKWLVISIWLVVLAAVGGSAVAFQAGFNDLF
FT                   TINNTPAKKATELYLKNFPELKNPLQGTGVNIVFKAPDGERLEEPQNKKAVDDVLAYLN
FT                   EHLQGIVDTQRYGNPVTLNPLLQQGVIDQMVANGVPEETARKDADNLSLISADGAVGYT
FT                   TFSLDVPLPANVTKEQRAAINAALDVGRSEGLTVEAGGAGFGDPIVITSTSEVIGVAVA
FT                   AIILMVTFGALVAAGLPLLTAIIGVGIGSLSIMLATAWVSLNNVTPVLAVMIGLAVGID
FT                   YSLFIIFRYRHELLTRTREEAAGMAVGTAGSAVVFAGLTVIIALVALAVANIPFLAYMG
FT                   FAAAFTVFISVLIALTLVPALLGLLGDKVFKGKIRWRKKTRVAPKRTMGRRWAEFVHKV
FT                   PGVVIAVTVIGLGALTLPALQLHLSLPSDTQSELDTTQRKQADIMAEAFGPGINSPFLV
FT                   VVDAHHANPESVALDPLIRAQNPTDEESRGKAAANASYQYIVQKYSVNANVKHVQIVGL
FT                   SQDGLAAQLLLTPKTSPEDDATKELINSLLTQQREVESATGVESGITGLVPVQQDVTNR
FT                   LSGVMPLYLAIVVGLAIILLMVIFRSFWVPIVAGLGFLLSVGAAFGVTVLFWQQGLWGF
FT                   VSTPGPIIAFMPIFLIGVCFGLAMDYQVFLVSAMREHYTHSGGTASPGSRYNAMEESVV
FT                   EGFASSARVVTAAALIMIAVFVAFIGQPLPFIKIFGFALGAGVLFDAFLIRMAFVPAAM
FT                   FLMGRSTWHIPRWLDKVLPHLDVEGAALEREHSVQQGTRKDA"
FT   gene            138887..140128
FT                   /gene="tgt"
FT                   /locus_tag="CPC231_00710"
FT                   /old_locus_tag="CpC231_0138"
FT   CDS_pept        138887..140128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="CPC231_00710"
FT                   /old_locus_tag="CpC231_0138"
FT                   /product="tRNA guanosine(34) transglycosylase Tgt"
FT                   /EC_number="2.4.2.29"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09635"
FT                   /db_xref="GOA:D9QDR2"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDR2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240997.1"
FT                   /protein_id="ADL09635.1"
FT                   /translation="MDTTFELKTELYDEPGRHGRTGVIHTPHGDIATPAFIPVATKATV
FT                   KTLTPPQIRSTGAQAILSNAYHLYLQPGHDVVDEAGGVAAFENWNGPTYTDSGGFQVMS
FT                   LGVGFKKVLAMDVKGYEEADIRAKKRERMAKVDEDGVDFRSVLNGSRHRFTPEVSMQIQ
FT                   HGLGADIMFAFDELTTLIDTRDYQVNSVARTHRWAERCLIEHDRLTNERVGKPLQSLWG
FT                   VVQGAQYEDLRRKAIRGLLELNDQAEAAGRRGFGGFGIGGALEKENLGTIVGWVCDEIP
FT                   KEKPRHLLGISEPDDLFTAIEAGADTFDCVAPTRLGRRGGVYTLDGRMNLTNAKFKRDF
FT                   TPIDAEFGGPTVEYTRAYINHLLKAKEFLAGTLCTMHNVAFMVQLVDNIRASIDNGTYE
FT                   EYKAEFMGRYYARR"
FT   gene            140115..140981
FT                   /locus_tag="CPC231_00715"
FT                   /old_locus_tag="CpC231_0139"
FT   CDS_pept        140115..140981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00715"
FT                   /old_locus_tag="CpC231_0139"
FT                   /product="tRNA glutamyl-Q(34) synthetase GluQRS"
FT                   /EC_number="6.1.1.-"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09636"
FT                   /db_xref="GOA:D9QDR3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDR3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835785.1"
FT                   /protein_id="ADL09636.3"
FT                   /translation="MPAGRYAPSPSGDLHFGNLRTAVLAWLFARSSGRRFLIRIEDVDT
FT                   QRSSLASAQRQLEDLASLGLDWDEEPTYQHDHYDRYLAALGCLPHYECYCSRKDIQEAS
FT                   RAPHSIPGQYPGTCRNLSPEVREERRQELAAQGRVPALRLRANAASWRIHDYYGGNIVG
FT                   DVDDMILRRGGQQPDWAYNLAVVVDDAAQGVDQVVRGDDLLSSAPRQAYLAHLLGHSSP
FT                   QYIHVPLVLNAQGKRLAKRDGAVTFREMTDILPHVADSLGLKGQTLPELLEQFDPDALP
FT                   REPYVFR"
FT   gene            141213..142601
FT                   /locus_tag="CPC231_00720"
FT                   /old_locus_tag="CpC231_0140"
FT   CDS_pept        141213..142601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00720"
FT                   /old_locus_tag="CpC231_0140"
FT                   /product="GntP family permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09637"
FT                   /db_xref="GOA:D9QDR4"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDR4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523756.1"
FT                   /protein_id="ADL09637.1"
FT                   /translation="MENWVPTLSAGPLLGIAAAAIALILILVIVFRLHAFLTLIVVSAL
FT                   TALASGIPLDGIVSTMTKGFGSTLASVALLVGLGAMLGRLVETSGGAKSLAEALVARCG
FT                   ERRAPFALGVASLVMGFPIFFDAGLIVMLPVIFAVARRLKGPVLAYGIPAAGAFSVMHI
FT                   YLPPHPGPISAAEFYSADIGLVMLLGLLIAIPTWLVSGLWWGKKMGAKYPLPVPDILAG
FT                   GPQAADPKNPASPKLVVALLLLPMLLIFGNTGMSMAVAAGWVEKTSVAVRVLQFLGNTP
FT                   IALLISTLIALYFLGLRRGEPKEQLEKLLDGALGPICSVVLITGAGGMFGGVLRTSGIG
FT                   SALADSMSDLGLPVIVGCWLVAAILRLAQGSATVALTTAAALMAPAVAAGGFNEFQIAL
FT                   MVLASAAGSVFAGHVNDSGFWLVGRLMGMDVSTTLRTWTMNQALVGAVGFVIVLGFYGV
FT                   SLAF"
FT   gene            complement(142585..143076)
FT                   /locus_tag="CPC231_00725"
FT                   /old_locus_tag="CpC231_0141"
FT   CDS_pept        complement(142585..143076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00725"
FT                   /old_locus_tag="CpC231_0141"
FT                   /product="gluconate kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09638"
FT                   /db_xref="GOA:D9QDR5"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDR5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525215.1"
FT                   /protein_id="ADL09638.1"
FT                   /translation="MRIIVMGVSGSGKTTVGTMLAYKLEIPYFDGDDLHPQENINKMAQ
FT                   GCPLNDADRWPWLARVGEWLAHQPEGGVIGCSALKRSYRDLLRAHCPDAVFVHVHGSRE
FT                   VLLARMNRRKGHFMPSSLLDSQFATLEPLENDEVGRVFDVTDSPNQIAASASEWIKTRG
FT                   "
FT   gene            complement(143073..144062)
FT                   /locus_tag="CPC231_00730"
FT                   /old_locus_tag="CpC231_0142"
FT   CDS_pept        complement(143073..144062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00730"
FT                   /old_locus_tag="CpC231_0142"
FT                   /product="alcohol dehydrogenase catalytic domain-containing
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09639"
FT                   /db_xref="GOA:D9QDR6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDR6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241001.1"
FT                   /protein_id="ADL09639.1"
FT                   /translation="MAKEHMHAALISGAKQLEVTTLPCPTPSPGEVLVTVSYVGICGSD
FT                   LHYYQDGAVGAFEVRQPLVPGHEMSGTLSDGTPVTIHPATFGTCMEGIEDHPHLWPHGA
FT                   YLGSASTWPHTQGAMQEQLLVREDQIRRLPEGVPLRRASLAEPLSVGLHAITVAGSVEG
FT                   KHVLVSGAGPIGQLAALAAVNKGAATVTISDVVDGPLERAHESLTCVNTTRTQLHDESF
FT                   DVVLECAGVPAATTDALRVVRRRGTVVQVGMLPNQPVGINMAPLVSKEVLLRGTFRFLD
FT                   EVNQAIEMLKDPMFDSVITHEFPLSDVVTAFNIAADSQVSGKVVVKIP"
FT   gene            complement(144065..144814)
FT                   /locus_tag="CPC231_00735"
FT                   /old_locus_tag="CpC231_0143"
FT   CDS_pept        complement(144065..144814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00735"
FT                   /old_locus_tag="CpC231_0143"
FT                   /product="SDR family oxidoreductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09640"
FT                   /db_xref="GOA:D9QDR7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDR7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799899.1"
FT                   /protein_id="ADL09640.1"
FT                   /translation="MTTFDVTGKLALVTGSTRGLGRTLAAGLISAGAHVIVHGSDKQRA
FT                   ATVAEELGAYGAIGCPLTDSQATNVAISEMLQEYGTPDILVNNAGIQRRNPIEQFEDSD
FT                   WDDIIGVNLSGVFHVTKPIAAAMKSAGRGKIIMIGSVQSRLGRATIAPYCATKGGVAMF
FT                   AQGLAAELSPHNIQVNTLSPGYFDTDMNAALVADPEFTDWVSKRTPAGRWGDPQELVGP
FT                   LLFLASNASSFVTGQNLAVDGGMTAVV"
FT   gene            complement(144917..145005)
FT                   /locus_tag="CPC231_00740"
FT                   /old_locus_tag="CpC231_t10"
FT   tRNA            complement(144917..145005)
FT                   /locus_tag="CPC231_00740"
FT                   /old_locus_tag="CpC231_t10"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:144969..144971,aa:Ser,seq:gga)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            145158..145254
FT                   /gene="ffs"
FT                   /locus_tag="CPC231_00745"
FT   ncRNA           145158..145254
FT                   /gene="ffs"
FT                   /locus_tag="CPC231_00745"
FT                   /product="signal recognition particle sRNA small type"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: cmsearch."
FT                   /inference="COORDINATES:nucleotide motif:Rfam:12.0:RF00169"
FT                   /inference="COORDINATES:profile:INFERNAL:1.1.1"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            145508..146785
FT                   /locus_tag="CPC231_00750"
FT                   /old_locus_tag="CpC231_0145"
FT   CDS_pept        145508..146785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00750"
FT                   /old_locus_tag="CpC231_0145"
FT                   /product="aminotransferase class I/II-fold pyridoxal
FT                   phosphate-dependent enzyme"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09642"
FT                   /db_xref="GOA:D9QDR9"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024551"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDR9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366336.1"
FT                   /protein_id="ADL09642.2"
FT                   /translation="MSLLDFDAERLAQFHEDISAKYEALKAENLKLDLTRGKPSSEQLD
FT                   FSNALLSLPGENFRAKDGTDCRNYGGATGIADIRELWAEVLGLPAENLVAGDGSSLNIM
FT                   FDLISYAYAFGTNDSERPWKDEETVKWLCPVPGYDRHFTITEHFGFEMISVPMTDQGPD
FT                   LDVVRELVQDPQVKGMWTVPVFANPTGITFSEETCRALAELATAAPDFRIIWDNAYAVH
FT                   TLTDEFPVVHNVLDFAERAGKPNRFWFMSSTSKITHAGSGVSFLASSKENLDWYGAHAD
FT                   VRGIGPNKINQLAHAQFFGNAEGVRAHMRKHAGSLAPKFKRVLEILDSRLSEYQVAEWS
FT                   KPVGGYFISVDVVDGTASRVVDLAKQAGIALTGAGSSFPLHQDPRNRNIRLAPSLPPVA
FT                   ELEIAMDGFATCVLLAAVEKVLAERV"
FT   gene            146867..147436
FT                   /locus_tag="CPC231_00755"
FT                   /old_locus_tag="CpC231_0146"
FT   CDS_pept        146867..147436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00755"
FT                   /old_locus_tag="CpC231_0146"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09643"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDS0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366337.1"
FT                   /protein_id="ADL09643.1"
FT                   /translation="MILEETAVWIDGIIPGDMTIHLPETSYGEAFHIGTVEVGNQQVLA
FT                   TTLDFNGVDTGLTLGDGSGQVDVRSEIFTVGQFQTEVGVQVLRRLAIFLDNVGGSIPAQ
FT                   PGQLLPALGSMTDALDRCTVKHGLFVAPYMWGGQVPQYSEPSQLTALLQLIMLTQHEFD
FT                   YATTYGIPELQRALGNEGVDLTDWTR"
FT   gene            147450..149999
FT                   /locus_tag="CPC231_00760"
FT                   /old_locus_tag="CpC231_0147"
FT   CDS_pept        147450..149999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00760"
FT                   /old_locus_tag="CpC231_0147"
FT                   /product="DNA polymerase III subunit gamma and tau"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09644"
FT                   /db_xref="GOA:D9QDS1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDS1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522986.1"
FT                   /protein_id="ADL09644.1"
FT                   /translation="MALYRKYRPASFAEVVGQEQVTQPLSVALDSGRINHAYLFSGPRG
FT                   CGKTSSARIMARSLNCVEGPTSTPCGKCNSCISLAPNGPGNLDVTELDAASNNSVDDMR
FT                   ELRDRAMYAPAESRYRIFIIDEAHMVTTQGANALLKIVEEPPEHLIFIFATTEPEKVIG
FT                   TIRSRTHHYPFRLLTPQSMRGLLENTVASEGALVEDSVYPMVIRAGGGSPRDTLSVLDQ
FT                   LLAGTGPQGLNYETARLLLGATDDALIDAAVTALSSHDKAALFTTIDAAVEAGLDPRRF
FT                   ATDLLDRLRDLMVLQSVPDAFELGLVDAPTDRAEVLRAQAADFNQGEVAQLAALVNDGL
FT                   RSLKGATSPRLLLEILCAKMLLPSAPTGVALTPPPGNAQPSGLPTGGQAAGPAAIPAKY
FT                   ERKSIRMAREAAQRKAAQEEAAQREALQHEAPQAKAEPAAPSDKQASLKKQEVPKEQVA
FT                   EKPLPAPEPSGSTTPPSDEAERVAEGASISNDDAFAADVRARWEALRKMVHKKSAVAGI
FT                   LLAESRVLGMREGALILGHNTGPLAQRLNDAKNNDIIVEVIRAELGREVAVNCVVGTDP
FT                   AAAGFSEPKPEKAWNPEPAVSEPVTPESSVDDQEKQPNIVQPDPQPPAVEQPSEPVHDA
FT                   PSGAASTWGDPAPLGGETRRAPRTEPPTQGTKADGWGTPAPLGGQAEAENDAPKKPEQS
FT                   APVQPASVQRAPQRPVPKSVSEAPSTQKPKSRWQEAVARNAQATEERAKRPEFSDGVPL
FT                   PPEPDDFGAPDPAEWSPPEEPYGYAADEGFPEPAKHTPPPSPTEPTTTVETSNVSDQDE
FT                   EEEMVREAASGSVTRDHRDALTVAMDLLAEQLGARQL"
FT   gene            150103..150423
FT                   /locus_tag="CPC231_00765"
FT                   /old_locus_tag="CpC231_0148"
FT   CDS_pept        150103..150423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00765"
FT                   /old_locus_tag="CpC231_0148"
FT                   /product="YbaB/EbfC family nucleoid-associated protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09645"
FT                   /db_xref="GOA:D9QDS2"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDS2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_003850338.1"
FT                   /protein_id="ADL09645.1"
FT                   /translation="MTQPDMSQLLAQAQQMQAQLQEAQREILASTVTGTAGNGLVSIDI
FT                   QGNGMVSSVTIDPKVVDPEDVETLQDLIVGAFAEAHQKLSELADQKMGPLSQGFDGLGG
FT                   MF"
FT   gene            150535..151191
FT                   /gene="recR"
FT                   /locus_tag="CPC231_00770"
FT                   /old_locus_tag="CpC231_0149"
FT   CDS_pept        150535..151191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="CPC231_00770"
FT                   /old_locus_tag="CpC231_0149"
FT                   /product="recombination protein RecR"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09646"
FT                   /db_xref="GOA:D9QDS3"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDS3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599497.1"
FT                   /protein_id="ADL09646.1"
FT                   /translation="MFEGPLQDLIDELSRLPGVGPKSAQRIAFHLLHVEPADIARLQDA
FT                   LGAVRDGVTFCRICCNISRESVCRICADSGRDRGTICVVEEPKDIQVIERTGEYNGRYH
FT                   VLGGALDPLANIGPRELNISTLLQRIGGVLPDRELADSTPDAPLYDSSPTVTEVILATD
FT                   PNTEGEATASYLARLLRDFPDLVVSRLASGMPLGGDLEFVDELTLSRALSGRLTI"
FT   gene            complement(151207..152544)
FT                   /locus_tag="CPC231_00775"
FT                   /old_locus_tag="CpC231_0150"
FT   CDS_pept        complement(151207..152544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00775"
FT                   /old_locus_tag="CpC231_0150"
FT                   /product="GntP family transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09647"
FT                   /db_xref="GOA:D9QDS4"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDS4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366339.1"
FT                   /protein_id="ADL09647.1"
FT                   /translation="MTGVSLLLLGIAAVAVLLVLVIWAKVPAFVALIGVSIATAIASGI
FT                   PLADSVSTVTNGVGKTLGSVAVVVGLGAMLGRIIEVSGGAEAVARYFTDKLGRHRVTAA
FT                   VTIAAFILGIPVFFDVGFIILAPIVFGFAAVAKINPLKIGLPVAGAILTVHVTLPPHPG
FT                   PVAVAGIFSSDPGLMLTLGLPIAALTCVIGYYAAKVLKLDSIDRGPSPVELSDAAPNHQ
FT                   APSPFAVLGLILLPIVLIMVGATGAMYTEKGTVVHSLVSFIGSSPVALLVAVVVAWLSI
FT                   GKQQSWNREHSSGVLDSALPAVAIIIFVTGAGGGFANVLVESGIGKVLSDMLVAAHMPL
FT                   ILMAFLLSLALRASQGSVTVAMLTTAGLLTQPIAEAGLSSVRTTLVMIAIGFGAMCLSH
FT                   INDSGFWIVTKYLGLSVKQGLRTWTLLSTAFGVAGFALTSLVYAVV"
FT   gene            complement(152544..153452)
FT                   /locus_tag="CPC231_00780"
FT                   /old_locus_tag="CpC231_0151"
FT   CDS_pept        complement(152544..153452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00780"
FT                   /old_locus_tag="CpC231_0151"
FT                   /product="NAD-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09648"
FT                   /db_xref="GOA:D9QDS5"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDS5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910601.1"
FT                   /protein_id="ADL09648.1"
FT                   /translation="MSLIVTVVGLGAMGLPMATNLVQNFTVRGVDIAQSRLELGKAAGL
FT                   ETFHSAHQAATGADVVLLAVRNEEQLIQALFGQGNIAAALKPGAVVLLTSTVGITAVEK
FT                   AAEQLDSLGIDVVDAPISGGPGRAGSGELLVTVGAKPEVVDRIRPVLEAMSSHLVIVGD
FT                   RPGKGQALKTVNQLLCGVHIAAAGEALALADRLGLDPKAALDALMGGAAASFMLGDRGP
FT                   RMLEAYSEEGPEVRSRLDIFVKDMGIVTDAAKSAGIGVPLAAAAEQQYLAGLARGKGAQ
FT                   DDSTIIQVVAPTQVNKTRSKQ"
FT   gene            complement(153463..154904)
FT                   /pseudo
FT                   /locus_tag="CPC231_00785"
FT                   /old_locus_tag="CpC231_0152"
FT   CDS_pept        complement(153463..154904)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00785"
FT                   /old_locus_tag="CpC231_0152"
FT                   /product="hypothetical protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522987.1"
FT   gene            complement(155047..155751)
FT                   /locus_tag="CPC231_00790"
FT                   /old_locus_tag="CpC231_0153"
FT   CDS_pept        complement(155047..155751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00790"
FT                   /old_locus_tag="CpC231_0153"
FT                   /product="FCD domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09649"
FT                   /db_xref="GOA:D9QDS6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDS6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366342.1"
FT                   /protein_id="ADL09649.1"
FT                   /translation="MRTDLVTQGIEKIMDAIAEGVFRPGDALPPETNLAAYLEVSRPTM
FT                   REVVRTLADRGVVEVVHGRGTFVTPINQWNYVRSRMDVISRSLDPKTIGIYLTEVRRMI
FT                   EVGSSGLAAARATQEDIEKMTQALAAYDEATERGDVTATTDADVAFHTALLEATGNPFV
FT                   SALMIPLAGALAESRQKTNAVDEVRKRASKHHHAILDAIKARDEQAAKDAMRAHMTQTF
FT                   DDISTFLPGSMH"
FT   gene            155863..156711
FT                   /locus_tag="CPC231_00795"
FT                   /old_locus_tag="CpC231_0154"
FT   CDS_pept        155863..156711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00795"
FT                   /old_locus_tag="CpC231_0154"
FT                   /product="2-hydroxyhepta-2,4-diene-1,7-dioate isomerase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09650"
FT                   /db_xref="GOA:D9QDS7"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDS7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400921.1"
FT                   /protein_id="ADL09650.1"
FT                   /translation="MRLATIRTQGTTTAARIEGTDLAVAIPGFYDVGELLQKSDWQELA
FT                   RSASGTPVRFSQQDLHAVIPSPKKIICVGLNYSNHIKEMGRTLPEVPTLFVKFSDALTG
FT                   PFDDIPIPPWANSALDWEGELAVVISRHARRVKASEAEEYIAGYAVMNDYSARDYQYAT
FT                   LQWHQGKSLEKTAGFGPWLTTRDSFDLSGELKTYLNEEKVQSAAISDLVFKPADLIQYI
FT                   THLYPLDPGDVIVTGTPGGVGHARDPRRYIGDGDVVTVEIKGLGRIANKTIFEKWKEPN
FT                   N"
FT   gene            156833..157069
FT                   /locus_tag="CPC231_00800"
FT                   /old_locus_tag="CpC231_0155"
FT   CDS_pept        156833..157069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00800"
FT                   /old_locus_tag="CpC231_0155"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09651"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDS8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366344.1"
FT                   /protein_id="ADL09651.1"
FT                   /translation="MYFEAACFAFQQRGFHILVHACIFIHIIGVTHKREILLIGLDTYE
FT                   LGMSGRQCNYVMPPITGSLVGRVSAIKTVMLAS"
FT   gene            complement(157296..158048)
FT                   /locus_tag="CPC231_00805"
FT                   /old_locus_tag="CpC231_0157"
FT   CDS_pept        complement(157296..158048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00805"
FT                   /old_locus_tag="CpC231_0157"
FT                   /product="glutamine amidotransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09653"
FT                   /db_xref="GOA:D9QDT0"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDT0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241015.1"
FT                   /protein_id="ADL09653.1"
FT                   /translation="MTDLSIGLILPDVLSTYGDDGNALVLRQRARMRGFTAEIHTVKLG
FT                   QPVPESLDVYCIGGGEDTAQILAAEHLIADGGLTRAANAGRPILGICAGLQVLGSSFRA
FT                   SGKMVDGVGLVDATTASLAKRTIGELQTEPTRKGITAELTEPLTGFENHMGATILGADA
FT                   QPLGKVTRGVGNTDEHGISQASATSEQLIAEGAVQGNVICTYMHGPVLARNSQLADLLL
FT                   ARAMGIALDELAPLELPIVNQLRKERLA"
FT   gene            complement(158048..159343)
FT                   /locus_tag="CPC231_00810"
FT                   /old_locus_tag="CpC231_0158"
FT   CDS_pept        complement(158048..159343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00810"
FT                   /old_locus_tag="CpC231_0158"
FT                   /product="DUF1727 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09654"
FT                   /db_xref="GOA:D9QDT1"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDT1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558553.1"
FT                   /protein_id="ADL09654.1"
FT                   /translation="MSLNLRTRLAIGTAHLATTASRVTGRGSGGMIGGLIAEKIDPNIM
FT                   ASLGDDRPVALVTGTNGKSTTTRMLASAIRAQHTVATNEGGDNMDAGIISALMAGQKAS
FT                   HVILEVDELHVPAVADRLKPSCLILLNLTRDQLDRVGEINKIERALRDCVTKHPEMTVI
FT                   ANCDDVLVTSIAYDAKNVVWVSAGAGWQGDSVSCPRTGGHVVHDGADWYAVKPLPNGEQ
FT                   FRRPTPHWSITAEGIVSPADIGSSTGSDAPMTQEVSPLNLALPGNANRGNATQAVAAAV
FT                   ECFQVPLNQAVRSVESVDDVAGRYSTITLGQHQIHLLLAKNPAGWQEALSMVDRTAEGL
FT                   VIAVNGQVADGEDLSWLWDVKFEELDKLSVKASGERGTDLSVRLTYASVEHELIKNPLQ
FT                   AIKACPAGRVEVLANYTAFRDLKKAIAAVKES"
FT   gene            complement(159355..160401)
FT                   /locus_tag="CPC231_00815"
FT                   /old_locus_tag="CpC231_0159"
FT   CDS_pept        complement(159355..160401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00815"
FT                   /old_locus_tag="CpC231_0159"
FT                   /product="DNA polymerase III subunit epsilon"
FT                   /note="3'-5' exonuclease of DNA polymerase III; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09655"
FT                   /db_xref="GOA:D9QDT2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDT2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241017.1"
FT                   /protein_id="ADL09655.1"
FT                   /translation="MTNKQVDGTNADRAAEIERAPYVALSIQTSGIHPSTSRLITVDAV
FT                   TFTEDGEETDHFHAVINPGDNPGPFHLHGLSREEIAQGKKFSHILKPLGKLIDGRTLIL
FT                   HNTPYTWGFLVSESRRAISAAARANRNRYRHRNRRRQRVGHIPRPRMIVDTLATARRQG
FT                   VVFEDIRIRAVAHSLGLDSPSPVASLERAERPEQHVSREETLLIARMYFVEKACGVISS
FT                   YTPEQLRSDKFGLQRSDIRVDAMEVPRQYENPGVYSPEGGFVQGMEVVIAPEITMDPDV
FT                   IIEAILRSGLAYNEKLTRKSSVVVCNKQEDLVGKAMHGQRKGIPLITDEEFLRVVVDVK
FT                   PGKASEDD"
FT   gene            complement(160430..161198)
FT                   /pseudo
FT                   /locus_tag="CPC231_00820"
FT                   /old_locus_tag="CpC231_0160"
FT   CDS_pept        complement(160430..161198)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00820"
FT                   /old_locus_tag="CpC231_0160"
FT                   /product="NADPH-dependent oxidoreductase"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558554.1"
FT   gene            complement(161238..163055)
FT                   /gene="leuA"
FT                   /locus_tag="CPC231_00825"
FT                   /old_locus_tag="CpC231_0161"
FT   CDS_pept        complement(161238..163055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="CPC231_00825"
FT                   /old_locus_tag="CpC231_0161"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09656"
FT                   /db_xref="GOA:D9QDT3"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDT3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014309886.1"
FT                   /protein_id="ADL09656.1"
FT                   /translation="MGPTDAFISAPADIHTPSGSFAAGQATWNKQRSSDLPVHRYLPFA
FT                   AKVEKIDLPDRTWPSATIDTAPQWCAVDLRDGNQALIDPMSPERKRRMFNLLVAMGYKE
FT                   IEVGFPSASQTDFDFVREIIEKNMVPEDVTIQVLVQAREHLIRRTFEACEGAKNVIVHF
FT                   YNSTSILQRDVVFRKDKKAIKKLATDAAELIKSIAAEYPNTNWRWEYSPESFTGTELAY
FT                   TKEVIDAVVEVMDPTPMRPIIINLPSTVEMTTPNTYADSIEWMHRHLRRRDSIILSLHP
FT                   HNDRGTGVAAAELGYLAGADRIEGCLFGNGERTGNVCLVTLGLNMLTQGVDPQIDFSDI
FT                   EQIRRTVEYCNQLRVPERHPYGGDLVFTAFSGSHQDAVNKGLDAMASRVRPGATHVDVS
FT                   WEDLRAETWDVPYLPIDPKDVGRNYEAVIRVNSQSGKGGVAYIMKTDHGIALPRPMQIE
FT                   FSSVVQRVTDARGGEVDSQHMWDIFTHEYLNRTAPIQQISMRVDAAQNETDSVHIAATL
FT                   KFQGKETIVEGRGNGPIAAYANALESLGIDVEVQEYEQHARTAGDDAESAAYILAEVNG
FT                   QRYWGVGIAGSITYASLKAITSAVNRALS"
FT   gene            163282..164220
FT                   /locus_tag="CPC231_00830"
FT                   /old_locus_tag="CpC231_0162"
FT   CDS_pept        163282..164220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00830"
FT                   /old_locus_tag="CpC231_0162"
FT                   /product="RNA polymerase subunit sigma-70"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09657"
FT                   /db_xref="GOA:D9QDT4"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDT4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241021.1"
FT                   /protein_id="ADL09657.1"
FT                   /translation="MIDARDAQAIDAAKLYYASGLGQAEVAQRLGISRPTVSKLLSYAR
FT                   EKGFVTITLNDPREQGDEIAQRLKERFSLEHVRVVRPVSPDKEELLRELGNAGASLLED
FT                   LVCDGMSVGISWGNTLNNVSEHLRSLPRHDVSVVQLKGGHSLSERSTNDLSTLTRFARA
FT                   FNAEMNLLPLPVILDSREAKDLVVRDRHISCMLSAGANADVVVFTVGSVQRESLLLNLG
FT                   YLSEEEINRLLTHAVGDICSRFYTETGEIADPAIDARTVGISIKDLSSRPTRVLVAGGV
FT                   DKAKAIRVALEMGTTTHLVTDFGAAQAVLGE"
FT   gene            164514..165230
FT                   /gene="deoD"
FT                   /locus_tag="CPC231_00835"
FT                   /old_locus_tag="CpC231_0163"
FT   CDS_pept        164514..165230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /locus_tag="CPC231_00835"
FT                   /old_locus_tag="CpC231_0163"
FT                   /product="purine-nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09658"
FT                   /db_xref="GOA:D9QDT5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDT5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241022.1"
FT                   /protein_id="ADL09658.1"
FT                   /translation="MAEKSTPHINPRGVDIADTVLLPGDPRRAKFIAETYLDDVVQFNE
FT                   VRNMLGYTGTYKGTPVSVMGSGMGMPSIGIYSWELINIFGARNVIRVGSIGSLQEDINL
FT                   YDIIVASSASTDSNFLEQYNLPGTYAPTASWKLLKAIVDEADKAGQKVHVGNILSSDIF
FT                   YNADETASARWARMGVMGVEMESAALYSIAAYAGAHALGLFTVSDNIPKGESTTSEERE
FT                   KAFTSMMEIALPLAGI"
FT   gene            165243..166622
FT                   /locus_tag="CPC231_00840"
FT                   /old_locus_tag="CpC231_0164"
FT   CDS_pept        165243..166622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00840"
FT                   /old_locus_tag="CpC231_0164"
FT                   /product="MFS transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09659"
FT                   /db_xref="GOA:D9QDT6"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDT6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241023.1"
FT                   /protein_id="ADL09659.1"
FT                   /translation="MPHIKKVDSRNDTQHTGIVNPKAAVPVLLFSFVFCLIVDNGFKTM
FT                   TGPMAAGLGIDPNTASLQASLAGVIIGIGAVVYAALADTISIRKLMLVGIALIAVGSLI
FT                   GFVFSGSWPMVLCGRIIQTAGLAAAETLYVIYVTKHLSEGDQKTYLGFSTAAFQGGLLI
FT                   GALTSGFISTYVSWTAMFLVPLILILAVPFIQKMVPEDETVEGTFDALGLFLVSVFAAS
FT                   LTMYMQKFNPFWLIPTVAGIAGFVAHVKKNKRALVSPEFFSNGRYVWAIVLVFVIYSTQ
FT                   LGFIFLLPFAASDVHGLSQDKAALLMVPGYVCAILVGVFSGAIGKVLSSRQTIYAALTM
FT                   IFLSLVIAALGLRLHIAVLICAIILFASGFALMYAPLVNTALINITAAKSGIAIGFYNL
FT                   TINITIPLGIAYTAKLMDLRFGYSTILWVLAVIALLGAAIYVLADRRMSGAERARGVYV
FT                   A"
FT   gene            166682..167347
FT                   /locus_tag="CPC231_00845"
FT                   /old_locus_tag="CpC231_0165"
FT   CDS_pept        166682..167347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00845"
FT                   /old_locus_tag="CpC231_0165"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09660"
FT                   /db_xref="GOA:D9QDT7"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDT7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525229.1"
FT                   /protein_id="ADL09660.1"
FT                   /translation="MSSQLTRSQVAAMIDHTLLNPEAIEADVKELVKEAAKLGTYSICI
FT                   SPSLLPVEVPENVHVATVVGFPSGAVKPEVKANEASRAVHDGAEEIDMVINLALAKEGR
FT                   FEDLQAEIAAVRAAVPAPNVLKVILETAALDDAQIVRACEASEKAGADFVKTSTGFHPA
FT                   GGASVHAVEIMNRTVGGRLGIKASGGIRDAETAKAMIAAGATRLGLSASAAVLDGFDE"
FT   gene            167370..169034
FT                   /locus_tag="CPC231_00850"
FT                   /old_locus_tag="CpC231_0166"
FT   CDS_pept        167370..169034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00850"
FT                   /old_locus_tag="CpC231_0166"
FT                   /product="phospho-sugar mutase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09661"
FT                   /db_xref="GOA:D9QDT8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDT8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014654987.1"
FT                   /protein_id="ADL09661.1"
FT                   /translation="MTNTVIDRARVWAEHDPNQESREQIEAWIASYDESSLARAFAGPL
FT                   HFGTAGLRAQVGPGESQLNEATILRTTAGLMAWLLEKLGQESVPRVVIGCDARHGSSEF
FT                   YDVAAEVVSAAGGEALVLPKQNPTPLTAYTVKALGADAGIMITASHNPPADNGYKVYLG
FT                   GRIATGDAEGVQLIAPADAEIAEAIASAPFADQIARNRDNIREIDTRERYIERAVGLAG
FT                   AEISAETRGNVRIALTAMHGVGAALGKEILEKAGFEVSLVPEQAEPDADFPTVSFPNPE
FT                   EKGALDLAKAHANAIEADVIIAYDPDADRCAVATKDDNAEGGWRQLSGDETGALLGEYL
FT                   GATATGSYANSVVSGRLLAQVAKAHGLKHAQTLTGFKWIARTPNLAFGYEEAIGYCCDP
FT                   EAVADKDGISASVVVASLVAKLKSEGRTLDCALDDLAKTHGLYMTAPLTFRVEDLSIIA
FT                   EGMKALRTTPPTELAGSKVIEVVDLAEGTLGFGPTDGMMFLTEDDDRVICRPSGTEPKL
FT                   KCYLEVVRPVGEAGVDRQGARDRLAMIAEDVRKVLNM"
FT   gene            169615..171171
FT                   /locus_tag="CPC231_00855"
FT                   /old_locus_tag="CpC231_0167"
FT   CDS_pept        169615..171171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00855"
FT                   /old_locus_tag="CpC231_0167"
FT                   /product="VaFE repeat-containing surface-anchored protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09662"
FT                   /db_xref="GOA:D9QDT9"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="InterPro:IPR041100"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDT9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241026.1"
FT                   /protein_id="ADL09662.1"
FT                   /translation="MRSKPFKKVVALLTGIDIAFSANTSVQAEEVGPDYLGYLDEAAAV
FT                   KEPFGDGRYQNHSTVPPLVVKATDGGEEELAYCFNITKPYPVFKDSFPSDTSDVFNRGI
FT                   GLRYKGNYGVSLQSFASRWRGEGADAGVLKAVYNGHSHNAAGLKESLGLTEEEFRYATQ
FT                   LAVWYWTDSDSGSKYLIGAGPNSNKIGQAVKILTGQDKSSVQLKEVDPNLVTLVIYKPY
FT                   SLEGEFASYQNLLSVKFVSPKTGDSVNPEDPTKPEPKEPEKPKEPEAPQKEIEPKTPEE
FT                   PTLKTSATDQSDNDKLISATGGKVVDKVTYTGLKEGEKYLVEGELMDKETSESTGIKAE
FT                   ATFTASGANGTVDVIFDIDAAQSGKTLVAFEKLYKAEDKGTVVASHEDINDKAQTVVVE
FT                   KDVPVENEDLFTPEVPDDSSFNWKYLIPFAFIPVVGALIWGSSQGSSSAAAQTNPAYAA
FT                   PVAPAPATVTTTPAPKPAPAAATPVKKQLAATGANVLWTLLVALVLVAAGVFLVRMRRN
FT                   N"
FT   gene            171781..173952
FT                   /locus_tag="CPC231_00860"
FT                   /old_locus_tag="CpC231_0168"
FT   CDS_pept        171781..173952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00860"
FT                   /old_locus_tag="CpC231_0168"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09663"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDU0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241027.1"
FT                   /protein_id="ADL09663.1"
FT                   /translation="MNEVSPFNQPATKRLGRIVSAVVTATSVTFSGFLVPTASAEAASA
FT                   YSDNIGRNEIGPEPLEKLKPEIVGGEQSVSVGDSVTYKYTVKTGFPQDPNNVTAQRWVR
FT                   LVITQDPKVPFTEEPAAGKFGIPAGAVVTKTGVNEWTVVLGAEYEAWQHDATQAAESHN
FT                   NGLFKVNNNMHALWNADAALRASAWNPPAELTIAIPAKVNNADTAPSTGSLTVTSGRLA
FT                   DVALKDDLATATFVSNDGQGSCTWDSVYETKLLKEDIGYWVENVVISSNPESVNDYRLL
FT                   PMAYQDMGRYRPTLTSGKVFVGDKLIGEVKPVTTGDRNASGYPIGELVITENVPPFTSK
FT                   EWLNPKETVRVNYRFTNPCGSKVTAESVKNPSGLVPATDPSATGPGLRLEPDYTYVQAS
FT                   GVYVGLIRPPEDASATAQFVFNQDVVSLGDYVWFDRNADGKQGDATTEPGVAGVQVSLL
FT                   DENGKAFNKPGTSEPYTVITDESGKYLFEKLPKGKYKVQFDASKVPADKLPAGVPSFSD
FT                   FTTKNADNGQNNGTDSDVTPGSLISTTDVVDLQQDRTDIDAGLIAKTRFSVSKVLDGTD
FT                   AGNHIGTTARELQDGKLIVDHKITVKNETPGMPGKAPQVLDQPLSVPGFEVESLTVDGK
FT                   PAQKEEKGYLVSAEKDFTADQERQEYSVKVTYRRTADNAATGALTKAEAEAIGECSDQS
FT                   DTTKGIVNKVYLGNENNEADTDAEKEKNN"
FT   gene            174013..175116
FT                   /locus_tag="CPC231_00865"
FT                   /old_locus_tag="CpC231_0169"
FT   CDS_pept        174013..175116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00865"
FT                   /old_locus_tag="CpC231_0169"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09664"
FT                   /db_xref="GOA:D9QDU1"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDU1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241028.1"
FT                   /protein_id="ADL09664.1"
FT                   /translation="MWVDSNNDGIQDADEKGLAGVELQIVDSEGKPVKDINGEEVKNVT
FT                   TAADGKYSFDNLPTLEKGKHYTVKVVAVPTGYEPTKTGQGTEDNDSSKDSAETYKDLSE
FT                   NGAKDDSLDFGFVETKPEAPGSVSVGDFVWVDANENGIQDEDEEGLDGVTLKIVGPDGA
FT                   PVTDVNGNPVKDVTTRADGKYTFSDLPVLEDGQKYTVKLVEVPEGYEPTKTGQGTTETD
FT                   SSTDQAETVLDLTKPGAEDNSLDFGFIKIQELEIPDPFNEEDSSFNWKYLIPLALIPVI
FT                   GALAWGSSQGSSSPSAPAAPAPGAPKESGSATSPATAAPQSPATTAPKAPMKKQLAATG
FT                   ASVLYTLLIALLLVVAGVFLVRLRRRD"
FT   gene            175373..176464
FT                   /locus_tag="CPC231_00870"
FT                   /old_locus_tag="CpC231_0170"
FT   CDS_pept        175373..176464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00870"
FT                   /old_locus_tag="CpC231_0170"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09665"
FT                   /db_xref="GOA:D9QDU2"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDU2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522991.1"
FT                   /protein_id="ADL09665.2"
FT                   /translation="MVIWQDWVAAAVLFIVSALVRLTFLLWMRGDASLESLISKWDGRI
FT                   YLAIAKYGYFSDVGGAPDPEVYQTRLAFFPGYPGLIAAVHSVTRLNYVTSALVISYAAG
FT                   IVMTAGVMAMAARMGANRRLRLCAAMLVLGAPMSTTFTMVYTESVFLACAVWALVAMTD
FT                   KRWLLAGAFTFCAGFFRLTAVDLVAAFAVVVAVYAARNWRAWAAVAVSMLPLVSYLFYA
FT                   SSYTRDIGGYFGLQTKGWHSTFDFGRATVIWVSTQLREGNNVGYLLSIASIVGAMGAVI
FT                   VSFRRLPLSYWLFGAAVTANVVLSDGIMHSRPRLLLPAVVLLIPVIFQFSQRRYALPAV
FT                   ATCWLLFGAWFSAYMIAVFEWAI"
FT   gene            complement(176465..177310)
FT                   /locus_tag="CPC231_00875"
FT                   /old_locus_tag="CpC231_0171"
FT   CDS_pept        complement(176465..177310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00875"
FT                   /old_locus_tag="CpC231_0171"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09666"
FT                   /db_xref="GOA:D9QDU3"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDU3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014654989.1"
FT                   /protein_id="ADL09666.1"
FT                   /translation="MYSTLLAMGFALASALTIAWGTVVRHRIAEEAPAEGSPFLQAIRR
FT                   PAWWLGIFTALSGYGLQIAALGFGTLLVVQPILVLSLMFTLPLSAHYDGRRMAFDEITW
FT                   AGLLTVSVAVLVLLGNPSAGDPQPPLGHWLPALGIGFLVLFALERYAQKQIRNEKALLL
FT                   GIVTGGIYGYVAVLSKATVDVLTHGGFFALATTWQGYSLAAGAILGTVVQQYAFNAGAL
FT                   KNSLPAMTVTEPIVAFALGYAVLGEQFQVAGSNWLWMALALVAMILSTFALSRRGVGSA
FT                   "
FT   gene            177615..178880
FT                   /locus_tag="CPC231_00880"
FT                   /old_locus_tag="CpC231_0172"
FT   CDS_pept        177615..178880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00880"
FT                   /old_locus_tag="CpC231_0172"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09667"
FT                   /db_xref="GOA:D9QDU4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDU4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835808.1"
FT                   /protein_id="ADL09667.2"
FT                   /translation="MALVVQKYGGSSLESAERIRRVAERIVATKKQGNDVVVVCSAMGD
FT                   TTDELLDLAAQVNPVPPAREMDMLLTAGERISNALVAMAIESFGAKAQSFTGSQAGVIT
FT                   TERHGNARIVDVTPGRVREALNEGKICLVAGFQGVNRESKDVTTLGRGGSDTTAVALAA
FT                   ALNADVCEIYSDVDGVYTADPRIVSNACKLDQLCFEEMLELAANGSKILVLRSVEYARA
FT                   FGVPLRVRSSYSNDPGTLVAGSMEDIPVEEAVLSGVATDNSEAKITVLGIPDSPGAASV
FT                   VFRALADAEINIDTVLQNISSLEDNRTDITFTCPRADGPHAMELLHNLQSKNDWQNVLY
FT                   DDQIGKVSLVGAGMKSHPGVTAEFCEALRDQGINIELITTSEIRISVLIRETDLPAAAR
FT                   ALHEKFELGGDEEARVYAGTGR"
FT   gene            179164..182466
FT                   /locus_tag="CPC231_00885"
FT                   /old_locus_tag="CpC231_0173"
FT   CDS_pept        179164..182466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00885"
FT                   /old_locus_tag="CpC231_0173"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09668"
FT                   /db_xref="GOA:D9QDU5"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDU5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400926.1"
FT                   /protein_id="ADL09668.2"
FT                   /translation="MLITCLNRMNPSIRKVFRCLVKNKVESKNVQLALRERSLIRILIA
FT                   LVMVGVVCAGLMVSPSVPSADAAECKGEISNIQWKDTTHIKDGVFVGSYGDGADIQFDW
FT                   KVDPGAKSGDQFTLKLPNELMRLGIKDLTLTAPTGEEVAKGTWDATTKTWTFTLTDYAN
FT                   THGDISGTAFFTVQWDRRHTTANTTYPLNISGCRGNGILNGKTPEEGIGGVGQVSGKVG
FT                   GYDSRTDTVRWNIYVGTATDSDVYSPVVIKDIGNPQLLVRCSDVKVKDRTPFPHTAIRD
FT                   TPLDSSKWTCEESNGGVIVRLVPDQHGRYLMRGQSLLIELETAITDDTSRIITNKATIE
FT                   NAPDGTKEVVAEVDRGDAGGVGQGFQGNVKIEKEAVGDTAPDKSHKFEFDYTCGNTKQP
FT                   ISVASGETSNTFTQKSSSTCTITEKNVPEGVKVKFEVIDEGTGKPAYTVPTNNGITVKF
FT                   NRNSSTTLKIKATNTYPDKPKVKNGKFVIKKTTNGLDAGEKDKVFKFNYTCKAPGADAV
FT                   SEKKIADVTVGQTWESGEYPEGTTCAIEEDLESAKVSDYTLTSEQPKGNVTIKADGGEG
FT                   SPVEFAATNSYSKDLGGFSIQKKIEADPEALPLLKDQEFGFKYTCGADSGEFKLKNGES
FT                   KKVEGIAVGTKCTVEESDAKVPNGFTWSGKIEGTNLDPNDFTIEKDKSLTFTAVNTYQQ
FT                   KQGGFTLSKNVTGDATNLEELQAKTYTFNYTCTAPTGVVFTDKVEVTEGTPKSINNIPA
FT                   GSTCKVTEVAAPAKDTEWTVELSVNEKAVAGDTAEFVVPAEDEPSVSILAKNNYRQHKG
FT                   TFTIEKIVKASEGIVTPNEFVFKWQCGDAEGSETVQVANGKGKVKIDRGFPVGTSCSVE
FT                   ELDANVKGATLATEWKNQKFTITQDNQDVMVSAENIYAHADSKVKIVKKLDGPAKDKAK
FT                   DKTFTFDYSCVLNNETIKGTVNITGEGEAEIPESFPAGTKCTITEKDAHIRGTSWTHRI
FT                   ADDGQITIKNPSNVYEVTAVNAYSKPDFPWFIPLVPIVIIPIIPIFPHPTPAPQPPQKP
FT                   SDQQPAPKTPEEKPQKEKKVLARTGANVWMFIVIAALLVLLGVFLRRRGNKQ"
FT   gene            182721..183752
FT                   /locus_tag="CPC231_00890"
FT                   /old_locus_tag="CpC231_0174"
FT   CDS_pept        182721..183752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00890"
FT                   /old_locus_tag="CpC231_0174"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09669"
FT                   /db_xref="GOA:D9QDU6"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDU6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910626.1"
FT                   /protein_id="ADL09669.1"
FT                   /translation="MTTVAVVGATGQVGRVMRSILEERKFPADKVRFFASARSAGTTLQ
FT                   FNGEDIEVEDLAAQTEDSLKGIDVALFSAGGSTSKQYAPLFAAAGATVVDNSSAWRKDP
FT                   DVPLIVSEVNPEDKNNLVKGIIANPNCTTMAIMPVLKALHDVASVTKMHVASYQAVSGS
FT                   GLAGVETLAKQTAEIGDRCVELVHDGSVEAPEELGPYVAPIAYNALPFAGNLVEDGLNE
FT                   TDEEQKLRNESRKILGLPELKVAGTCVRIPVFTGHTMVVHAEFEKAITPDQARAVLADA
FT                   PGVEVVDVPTPLAAAGRDDSLVGRIRQDQTVDNNKGLVFVVSGDNLRKGAALNAIQIAE
FT                   LLV"
FT   gene            complement(183821..184384)
FT                   /locus_tag="CPC231_00895"
FT                   /old_locus_tag="CpC231_0175"
FT   CDS_pept        complement(183821..184384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00895"
FT                   /old_locus_tag="CpC231_0175"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09670"
FT                   /db_xref="GOA:D9QDU7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDU7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910627.1"
FT                   /protein_id="ADL09670.1"
FT                   /translation="MKNSERDDRVTQLALAAGRGDKTALTEFIRETQNDVWRLLAHLGG
FT                   SEIADDLTQETYLRVMGALPRFAARSSARTWLLSLARRVWVDNIRHDMARPRKSSAEVE
FT                   DLDPAVLSTNGETTWSDWIDVRLLIDALPTERREALILTQVLGYSYEEAAKIANVRIGT
FT                   IRSRVARARADVIAAAGRPNAASA"
FT   gene            184527..186065
FT                   /locus_tag="CPC231_00900"
FT                   /old_locus_tag="CpC231_0176"
FT   CDS_pept        184527..186065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00900"
FT                   /old_locus_tag="CpC231_0176"
FT                   /product="catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09671"
FT                   /db_xref="GOA:D9QDU8"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDU8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522995.1"
FT                   /protein_id="ADL09671.1"
FT                   /translation="MNSPVDPILGAGERTEPVAYTTREGGQPVPSENISITAGPQGANV
FT                   LNDLHLIEKLAHFNRERVPERNPHAKGHGAFGELHITEDVSAYTKAKLFQKGTVTPMAI
FT                   RFSTVAGEQGSPDTWRDVHGFALRFWTQDGNYDIVGNNTPTFFLRDAIKFPDFIHSQKR
FT                   LGRNGLRDADMQWDFWTRTPESAHQVTYLMGDRGTPKTSRHQDGFGSHTFQWINEEGKP
FT                   VWVKYHFKSRQGWDTFTDAEAQEMAGKNADHHREDLYNAIAHGDFPIWDVKVQIMPFED
FT                   AENYRWNPFDLTKTWSQKDYPLVDVGYFVLNRNPKNFFTQIEQLALDPSNLVPGVGLSP
FT                   DRMLMARAFAYADAQRTRIGANYRQLPINQPVVPVNTYEHEGAMAYQFNPADAPVYSPN
FT                   RYSKGAGYLDDGETSSSGITYGQASDLFVNPDPHGTDLTRAAYVKHAEDDDFIQAGILY
FT                   REVFDDGEKERFVDNVTNAMAGISPEVEERVYWYWTQVDANLGAEIKRVFATKK"
FT   gene            186673..187434
FT                   /locus_tag="CPC231_00905"
FT                   /old_locus_tag="CpC231_0178"
FT   CDS_pept        186673..187434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00905"
FT                   /old_locus_tag="CpC231_0178"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09673"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDV0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300409.1"
FT                   /protein_id="ADL09673.2"
FT                   /translation="MLSLHCSVQNSEFIKWELVILEFKEDIFPEHKDKIGGLVQFVNLP
FT                   YESAVEYAWDQLNVNQGTTRKFPSRYDLTVKSGDFVNAIPQGGRVFITVETENPRWIAV
FT                   MGVNELADSAIAFLPRNRAFGGLIFPIVKNSEVVSVSQASDYNSCSFDYSKLDYPWGGY
FT                   FGEGDFYINPARLSIFCENVEGWHFERSSNDERGENDVIFDFEEPEFYSCRLKKERFNP
FT                   DMMLRYLDRLDIRLRDLNFYSGRMTILQRAD"
FT   gene            187437..187643
FT                   /locus_tag="CPC231_00910"
FT                   /old_locus_tag="CpC231_0179"
FT   CDS_pept        187437..187643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00910"
FT                   /old_locus_tag="CpC231_0179"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09674"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDV1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400929.1"
FT                   /protein_id="ADL09674.1"
FT                   /translation="MSIVDMRKTQPLDSQIYYINMSFDQLMGYVREYIDGLDDQFPATL
FT                   FEVGRGDVRNGYIYSAAGNTGMS"
FT   gene            187652..188386
FT                   /locus_tag="CPC231_00915"
FT                   /old_locus_tag="CpC231_0180"
FT   CDS_pept        187652..188386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00915"
FT                   /old_locus_tag="CpC231_0180"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09675"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDV2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522324.1"
FT                   /protein_id="ADL09675.1"
FT                   /translation="MANPDWVAIIDPYIDHTMSYFSEVNRPNYVLLGAGSTMYSSIEKI
FT                   SDADGFGMPQTFSVIACAIFLKDPFFPAHGRLRPTFLSCSWGPHVEAGWLSVEQSRFYD
FT                   DVRRSLWASNELGTQGLTKFAVNLWPEKEKTFGRKTYNHLDLDWNGWGPDPTFRPDPQR
FT                   PVYEWFNHRVVDGWGKNLGLEVFDTKFHVGRQAIFKKMQRKDNPYINAPLLYEDFRPFE
FT                   ERQKMMGFSPDHMQWLVEQGLY"
FT   gene            188401..189024
FT                   /locus_tag="CPC231_00920"
FT                   /old_locus_tag="CpC231_0181"
FT   CDS_pept        188401..189024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00920"
FT                   /old_locus_tag="CpC231_0181"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09676"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDV3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525242.1"
FT                   /protein_id="ADL09676.1"
FT                   /translation="MAKWNNGSIGIDVCADQELFVPTAASLSSAPGHVTISDSAAESLE
FT                   DQIVEGDMAEIVEVIDSFAACSVAEAAQSFGLPESGYFEAVRPGSHARYPAAEETDSEL
FT                   ADLAGISVEIGGFSWSAVLFTRWEGCVNVALPWELARMLYFWNKRWGMELVALSEDTEA
FT                   TMLVHVSEPGKNREEIVATLAAAGDELVVIPGSHGSLILKVWWD"
FT   gene            189024..189968
FT                   /locus_tag="CPC231_00925"
FT                   /old_locus_tag="CpC231_0182"
FT   CDS_pept        189024..189968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00925"
FT                   /old_locus_tag="CpC231_0182"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09677"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDV4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799920.1"
FT                   /protein_id="ADL09677.3"
FT                   /translation="MGFFGFGKKKQQQPQTPVIRMALMALGYSTDIAPDGNGGEVNVVT
FT                   LGDLTVYFWNDPSLYHAQIEWPLTFGQEDTMHAVVGAHMLNVNSSTGVFRVDTSKGHTA
FT                   VVCRTWLRAEDGATFDQYLRFVQAALQDVLPEASALYDDMFGTNFEVPEPPEQHPLFAE
FT                   IPAHLDTPKFETPEVTADRIAALYSGTVSENTAHMTVKGREFVAEVHTAETPTGSARVL
FT                   EISSFKDLPASGPNDIAALINATAQFNDSMDLICAVLDEEGQKVASENLGQPAARMVIR
FT                   ARCDATVGLSDSQLKGYVDEAMHTIAGLLKAIN"
FT   gene            complement(190022..191074)
FT                   /locus_tag="CPC231_00930"
FT                   /old_locus_tag="CpC231_0183"
FT   CDS_pept        complement(190022..191074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00930"
FT                   /old_locus_tag="CpC231_0183"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09678"
FT                   /db_xref="GOA:D9QDV5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDV5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522998.1"
FT                   /protein_id="ADL09678.1"
FT                   /translation="MALVHIQNLSVTSRGTQLLNNVSLDADPGELIVILGRSGAGKSTL
FT                   LRALAGLIPATGVVEVDGESLSGLPPHQRPIAMMMDQPSLFPHMTVEDNIRFAGDSGTH
FT                   VAMLSLGIDHLALRYPHQLSTGQQQKVALARALIKQPTLMSFDEPLAHVDTYSSEQLKS
FT                   QILRTHRRLGCTTFYVTHDINEAFSIADRIIFLSRGEIIQDASPQDMREQPACLDIARH
FT                   LGASIFVPTTGAVTYSPFGTATAAVTALGANLMIDAHPDLHSDDAMVVVGYPTSATATP
FT                   TGHQARHLMGATGQVIRNIYMGDHHEVAIETSQGRIVLHCSPDNELAFAAIGDEVLIHC
FT                   DLEKMWVLPA"
FT   gene            complement(191065..192465)
FT                   /locus_tag="CPC231_00935"
FT                   /old_locus_tag="CpC231_0184"
FT   CDS_pept        complement(191065..192465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00935"
FT                   /old_locus_tag="CpC231_0184"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09679"
FT                   /db_xref="GOA:D9QDV6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDV6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400931.1"
FT                   /protein_id="ADL09679.1"
FT                   /translation="MALCIGTLGALAAAQFSRASVVLLDVILLFQLTIPHFVIGADWKT
FT                   IVGRTGIQLCSQCNFSGLMPLLFTFTMAFTPLVYFGQRTALRSVSPREVDAARVAGLHG
FT                   WALFRTVYQPRLVLFAPALGAFIFSAALSDPVTPNVMAPRASLAATRVWFQSDQAWTAL
FT                   ALTLPVALAVVVAGLTYMRLLRGNPALVELLHRTIDTPGQPHHAVGAQVRAPQMVLRLL
FT                   GAVAGLFVVVAAYRGFVHGSETPMGNAVVNTVGLAFLVLLCSLLLSAVALGARRSCGLR
FT                   WGRLGHRSIDAVFALLALLPGAAIGCGLRITAHHPGVHGPWASLSLVLLACLPTSLAMT
FT                   YFLMVYIGPLMSRSEYMVSLLQGVSPLRAVASIVLPRSTNVVILGFLMVFSNASVLAMP
FT                   LLWVGSPDTPLLMLRLFTLLDAANYPAALYISMTVSLFIVSLAGAIVVSINGVGLGAFA
FT                   RKQVTPWR"
FT   gene            complement(192616..193617)
FT                   /locus_tag="CPC231_00940"
FT                   /old_locus_tag="CpC231_0185"
FT   CDS_pept        complement(192616..193617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00940"
FT                   /old_locus_tag="CpC231_0185"
FT                   /product="extracellular solute-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09680"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDV7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523769.1"
FT                   /protein_id="ADL09680.1"
FT                   /translation="MLSRWLRLLAVCVVAIVSAVTVYRTLFPTKTAVTIMCSNDVTVCE
FT                   QWKHDIAHELGLKVRYVSLPTQEALKRLQTGSHEFDVWVGGPSENYRLAARLGLLQAAD
FT                   LPAADAIPAQFKDPQNRWFGVYASVLSVCSDRDALDRLGVPVPRSWADVMRPELRGWVS
FT                   APSPVSSGTGYAMLLSMQAAGLSQEQIARIVDNVDRFTRSGNAPSDVVAHGEAAVAISY
FT                   EPYCQNKTTRLGRDMEISYPAEGTSFEIASGGVVVQRHTKSAAYEVMNWLLSPSGQTSA
FT                   LRAGLPQIPTNNLVADNISTRLKDSHGIVAVDPTVADSEREQWMSWFSERRI"
FT   gene            complement(193697..195067)
FT                   /locus_tag="CPC231_00945"
FT                   /old_locus_tag="CpC231_0186"
FT   CDS_pept        complement(193697..195067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00945"
FT                   /old_locus_tag="CpC231_0186"
FT                   /product="MFS transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09681"
FT                   /db_xref="GOA:D9QDV8"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDV8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_003850393.1"
FT                   /protein_id="ADL09681.2"
FT                   /translation="MFAWLQAPGPAAPLPAEQADRIYPRMRLQVFMGIFLGYAGFYLIR
FT                   NNISAIAPLLIDESGAIDKPAIGIIGNAVLVSYGLSKFFSAMVSDRSNARYFLPLGLAL
FT                   SALMNLIVAFAPWVSASVGLFATVMFLNGWFQGMGYPPCGRIVVQWFSTSERGWKGSLW
FT                   NTSHNLGAFGLPILVGIGLSITGQNWRAAYWLPALVALLVAVVAFFLIRDNPQSVGLPP
FT                   IDDYRNDPAKVAEDTGEKISTKDLVFKHILHNRIIMLLAIANVFVYALRYGVLHWITTY
FT                   LSEQHHMSIGSGLIGFAAFELAGFIGTVLCGWLSDNMFKGNRSAAISLFTLGAGLSIAA
FT                   YWLAPVGTPFWLMVIFVALIGGFIYGPVGLIGLQALDLSPRNVAGTAAGFTGLFGYLLG
FT                   ATLASTGVGFLVKFAGWNVTFIVFLVFTVLILVIFQVIWREEKKLVHDRALQLEQGV"
FT   gene            complement(195196..195897)
FT                   /locus_tag="CPC231_00950"
FT                   /old_locus_tag="CpC231_0187"
FT   CDS_pept        complement(195196..195897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00950"
FT                   /old_locus_tag="CpC231_0187"
FT                   /product="response regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09682"
FT                   /db_xref="GOA:D9QDV9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDV9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_003850395.1"
FT                   /protein_id="ADL09682.1"
FT                   /translation="MHRRRVLVVDDEPQMVQIISYALELEGWEVLSAASAQKGWQLLGE
FT                   YRCDLVILDVMLPDASGYALCERIRASGDVAATPVIMLTALGDTDNRVEGLEAGADDYV
FT                   AKPFSPKELVLRAQAVVRRSGGIVQQESQEIVVGKVSVNPITHAVAIDGRKVDTTATEG
FT                   KLLQALVSHPNEVVSVKRLLNQVWDTTATQGGRNMVKSTTYRLRKKLENAGLPADSILS
FT                   VRGQGYIFHHK"
FT   gene            complement(195890..196675)
FT                   /locus_tag="CPC231_00955"
FT                   /old_locus_tag="CpC231_0188"
FT   CDS_pept        complement(195890..196675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00955"
FT                   /old_locus_tag="CpC231_0188"
FT                   /product="sensor histidine kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09683"
FT                   /db_xref="GOA:D9QDW0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDW0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241044.1"
FT                   /protein_id="ADL09683.1"
FT                   /translation="MFAALVLTACASACVASLVTAVVIRRRARGHTAAITDEQILAHEI
FT                   RTPLSLIKGAAELLGQETDPRKCERLAATIGANSTRAIEVAESFLLQTKLNSGSLTLQV
FT                   SQCDVRGLVRSTAQELRAMSEVPIVVDDPGDPLMIDGDPQLLRHALWNVLNNAARYAGS
FT                   DSDIVVGVEESSTGVIVTVADYGPGMTARQRQNMFVPFAQFGQEQSQGQGPVGVPSGAG
FT                   LGMAITQKIVQLHRGSVLVDSIADHGTSVLITLPKNYHA"
FT   gene            complement(196797..197105)
FT                   /locus_tag="CPC231_00960"
FT                   /old_locus_tag="CpC231_0189"
FT   CDS_pept        complement(196797..197105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00960"
FT                   /old_locus_tag="CpC231_0189"
FT                   /product="Na+/H+ antiporter subunit G"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09684"
FT                   /db_xref="GOA:D9QDW1"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDW1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241045.1"
FT                   /protein_id="ADL09684.1"
FT                   /translation="MFYDLTASALILIASFLIITTLIALLRAPDALTRANLMGTATSIA
FT                   LPLILIASLINDIGNGTFWWGNLIRVIITIAGLLIVLAIGSFLMGRALYGVAKEQQD"
FT   gene            complement(197105..197371)
FT                   /locus_tag="CPC231_00965"
FT                   /old_locus_tag="CpC231_0190"
FT   CDS_pept        complement(197105..197371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00965"
FT                   /old_locus_tag="CpC231_0190"
FT                   /product="cation:proton antiporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09685"
FT                   /db_xref="GOA:D9QDW2"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDW2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241046.1"
FT                   /protein_id="ADL09685.1"
FT                   /translation="MFLIASSIGMAATTIGIIATIILMIRTKDQLTRAVISDMVFYSMI
FT                   GFYIIWCMANHTQINYEIALLAALVGGILPTMSVARIISKGRR"
FT   gene            complement(197371..197790)
FT                   /locus_tag="CPC231_00970"
FT                   /old_locus_tag="CpC231_0191"
FT   CDS_pept        complement(197371..197790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00970"
FT                   /old_locus_tag="CpC231_0191"
FT                   /product="monovalent cation/H+ antiporter subunit E"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09686"
FT                   /db_xref="GOA:D9QDW3"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDW3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525246.1"
FT                   /protein_id="ADL09686.1"
FT                   /translation="MLHAIKYAFWLVGQVLIAGWVLTKDTLTGSKNLDPCVVRYPLRVT
FT                   KDWQITVFAASITATPGTMSITLEEDDSAESSDQRYLLVHAVAGADPRSVLADLAHMEE
FT                   TLAPHVKDLHPDFSAVLDRATWEYPSPKPVFKEDN"
FT   gene            complement(197790..199328)
FT                   /locus_tag="CPC231_00975"
FT                   /old_locus_tag="CpC231_0192"
FT   CDS_pept        complement(197790..199328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00975"
FT                   /old_locus_tag="CpC231_0192"
FT                   /product="monovalent cation/H+ antiporter subunit D family
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09687"
FT                   /db_xref="GOA:D9QDW4"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDW4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835829.1"
FT                   /protein_id="ADL09687.1"
FT                   /translation="MDYVLPLFVGIPLALVAVSAIAPWRVLRDILALITPIGTGAAGVW
FT                   LFAYVSEHGTIAHSVGKYVGGVAIPFVGDHFSAIMIITCSVVAFASNWFAIVVGETRSR
FT                   FYSSLSLMLLTGVMGALLTADLFNFFVFIEVMLLPSYGLMAMTGTWARLSAGRTFVLVN
FT                   LATSTLLLIGVAIVYGVVGAVNIAALAGAAAGNGPVTVAMGIVVVAMVIKAGIFPVHTW
FT                   LPRSYPATSSSVMGLFSSMHTKVAVYMLMRIYVVIFDLDTRWVWLIITICILSMIVGAF
FT                   SGLGEGAMRRVLAYQMVNGMPMILVVLAFASHNAKTVIAAGILYALHHMITVGSLILTS
FT                   GSVEETYGTDKMSKLSGIAHRDPWVAAVFAAGAFSVVGFPPFSGLWGKVFLILGIADSA
FT                   SWQAWLVIAIIILASFGAFLSMLRLWREVYWGAPMNPQRIPESLRVPWLRLAPGAFLIV
FT                   ISFGMFLFAGPLVTATNDASESLLDVHSYSTAVLHQGEDAPVGVATNNTLQGGR"
FT   gene            complement(199328..199783)
FT                   /locus_tag="CPC231_00980"
FT                   /old_locus_tag="CpC231_0193"
FT   CDS_pept        complement(199328..199783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00980"
FT                   /old_locus_tag="CpC231_0193"
FT                   /product="cation:proton antiporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09688"
FT                   /db_xref="GOA:D9QDW5"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDW5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241049.1"
FT                   /protein_id="ADL09688.1"
FT                   /translation="MILALTIAILAAGGVYLVLQRGMLRIVIGMTLISHAANLLIVAIG
FT                   IPAWRGEPFPSITDLSVAADPVPQAFVLTAIVIAMATTTYMLTLSGLGRSDDTEPEEVA
FT                   DEDSPLQTLGRSTTNAELAEDEAHLVRERARRAHQHHADNDINKEAH"
FT   gene            complement(199784..202774)
FT                   /locus_tag="CPC231_00985"
FT                   /old_locus_tag="CpC231_0194"
FT   CDS_pept        complement(199784..202774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00985"
FT                   /old_locus_tag="CpC231_0194"
FT                   /product="DUF4040 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09689"
FT                   /db_xref="GOA:D9QDW6"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDW6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241050.1"
FT                   /protein_id="ADL09689.2"
FT                   /translation="MTLLLVLVLAAFTVSCAPVAVRVCERKAGWPLAALLLIAAGLLCK
FT                   ELPAVLDETPIVWTYTWIPDALGHGIDIQLALRADALSVFFALLALVIGSIVFIYSASY
FT                   LPKKTGNTSFYTLMTAFMAAILMLVLADDVFTLFIAWELVSLASFMLIARSGGSGGELG
FT                   SQRTLILTFIGGLTLLVSMAIAATQAGTTNIHEILVSDFWAEKPALTTVLGVLVAVSAF
FT                   TKSAQFPFHFWLPEAMAAATPVSAFLHAAAVVKAGIYVLMRFSAVFHNNQTWNLLLITV
FT                   GMLTAVMAAFFAIQKTDLKKLTAYSTVSHLGWIVATIGVGTPFALAAALVHTLAHALFK
FT                   SSLFMLIGVIDHQTGTRDASRLGSSWRQLPFTFGSVILAASSMAAVPPMLGFVSKEGLL
FT                   AALAEAPLGKAGIVVLLLTAGIGALFTFTYSVRIVADGFIDGDRDMSHVKEAPVSLWLP
FT                   AALPGALSLPLAFALGYLNLPISEAVDVVAEDPHTHLALWHGLSLVFIISLVVFVLGIV
FT                   GVVFRKQIWMALGSRPLFPTSGNDVLRLMHQGSSSLGRAMGAMADSIAPTRHLAYMFLT
FT                   IIIFGAFYVLPGLVGGGVDGIPAPARISTDRWYDAIPLAIVLLGVIALVRTKKRLSGVV
FT                   LIGVVGAGVTLQVFMLGAPDVAMTQFMVEALTVVIMMMVVRQQPSHFHKPRKSQKALGI
FT                   AMATGVGLFAFLSVWVLLSRHERSELALWYLNEAPKISGGDNVVNTILVEFRGFDTLGE
FT                   LSVLGMAAIVIAAVITSMPRYPFAKGTHPAPFSGSDLNSIPLRILLKVLVPVLIVLSVM
FT                   IFWRGHNAPGGGFIAALVASTAMMLSYLSFPRDKHIFPVRTPIYLTGIGILTAIFAGFL
FT                   GLSHGSFLYAIHGHWAGQHWTTSMIFDVGVYLAVLGMVSMAINALGGYLRPGLDYENLN
FT                   YNREDSPLTPLPKVGHLDDFGGEPHLPPSEPERVRLAKQAERASKALREDNDRHLNAAS
FT                   STAEEEK"
FT   gene            202959..204392
FT                   /locus_tag="CPC231_00990"
FT                   /old_locus_tag="CpC231_0195"
FT   CDS_pept        202959..204392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00990"
FT                   /old_locus_tag="CpC231_0195"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09690"
FT                   /db_xref="GOA:D9QDW7"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDW7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558559.1"
FT                   /protein_id="ADL09690.1"
FT                   /translation="MSRFAVRHLSAAILLAAPLIAGTVYAVSTDYDLASSWSTGEESAG
FT                   APAVHDDAALVDARRAAGEAGAQAGLLKGGTKQLADGTHKLAEGSKQLGAGTTSARDGA
FT                   AKLADGMNQLQAATGQLGNGATEIANGVDHAVGQLFALEAVRGQILGAIDRTIGDIAKS
FT                   KDPKAAEFKPELEEFRNQVDTFQVDKSITDQLTKLRDGSRELANQLHVPGYGFHDGIYS
FT                   ATKGSKELSAGLNELAAGVDEALKGVEQLDQGAQKVDGMAKTNQDRVGAVSRALPVIQA
FT                   GTPEAKEAGITKTLAPMYAFLVAAGVMLAAGTYGRGRAWVVSLVGGIALAALGGSLVAI
FT                   LGSELGAAEAAAAAGICALLVLASGLGTAVLIRAFGATWGYLAALVGIIAQVGVVGWVW
FT                   NSAATAQIGTTAQALVNLMPLNYPTLALSSLGNGTHSPALWVAIVVTAGLAAVGAAALK
FT                   LLGKREPSGAHATPEDIIR"
FT   gene            complement(204389..205795)
FT                   /locus_tag="CPC231_00995"
FT                   /old_locus_tag="CpC231_0196"
FT   CDS_pept        complement(204389..205795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_00995"
FT                   /old_locus_tag="CpC231_0196"
FT                   /product="DUF4185 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09691"
FT                   /db_xref="InterPro:IPR025442"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDW8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799932.1"
FT                   /protein_id="ADL09691.1"
FT                   /translation="MRMTRRKALTVATLVTLSSFTSVSTGHAIDFGNIMRLPSALSSAL
FT                   SSGSSGSSAPDAKPAPQRPNRISEGLTVTMLDDLFGRGKSDKVGILSGDLGEMVRLAKD
FT                   GKEFAIIFGDSFTGEGLQGEWKSPIGLVAKLGEDGKIQIVRPLNEGEKAEQLIKYEHKD
FT                   RLTLLPSDVINIDGTIYMQAMWHQGLGNVIKTQIWKSTDQGKTWSSVNEIPASYMNEFG
FT                   SLLSWENGDDGYVYMVSSKFGRAHSVYLTRFRPEQIGDEQQWEHYNPTANTWSKHVDGA
FT                   HLTPILSNSVKAGEMSLRRIEGHWVLSMFNEETWAIEVRISEKLDQSWDKIKPANVVVA
FT                   GTGGWGAKQNENNFTQLYGGYITPFSTLADMNIVVSQWNTSNNSRYNSTQFNVKGLDKF
FT                   FNITPKPADAQPTPRAVTADQTADQSVIEVSEVAPADSDKAATPEQEIIESVAPVEVLP
FT                   LTGALDSQKN"
FT   gene            complement(206190..207017)
FT                   /locus_tag="CPC231_01000"
FT                   /old_locus_tag="CpC231_0197"
FT   CDS_pept        complement(206190..207017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01000"
FT                   /old_locus_tag="CpC231_0197"
FT                   /product="ABC transporter permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09692"
FT                   /db_xref="GOA:D9QDW9"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDW9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525252.1"
FT                   /protein_id="ADL09692.1"
FT                   /translation="MIIANDSFRYSLVFLVAQREALLSVRSKSVSIVFAVVALGAIALV
FT                   GFSSKQVVNSGKDFNPHDVSVVVGLFMLVALSMSIMMSSPLLGASMVDEKDNKVVEILL
FT                   SSIRADELYLGKVFGHVIIGLFQLTALWGITAVSSILFGLSDFASFPWSRTFIVLLFMF
FT                   PGYLVFTALFGMAGALVSRNEDYLAAQLPILILFFVTLFVPFLPLIKIGSFESGWLPAV
FT                   SWIPPLSMVATPVREIYIGEPNWVVVISWILLLVLSAFLFFLGALTFKKNILK"
FT   gene            complement(207021..207935)
FT                   /pseudo
FT                   /locus_tag="CPC231_01005"
FT                   /old_locus_tag="CpC231_0198"
FT   CDS_pept        complement(207021..207935)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01005"
FT                   /old_locus_tag="CpC231_0198"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835835.1"
FT   gene            complement(208669..209148)
FT                   /locus_tag="CPC231_01010"
FT                   /old_locus_tag="CpC231_0199"
FT   CDS_pept        complement(208669..209148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01010"
FT                   /old_locus_tag="CpC231_0199"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09694"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDX1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522095.1"
FT                   /protein_id="ADL09694.1"
FT                   /translation="MGSRLSISFPWYTPAGSLYTCKSAPVRKRTDTLNRCEITPKGLFH
FT                   ADLCALTSSNHQKQTHFCCLTRNIATQSLLETKAKASGLRLTGALHIRPKYPPVSTIQD
FT                   DGKASQKHRNTPANTSHDIPYSNTIVLCMDLPISLHCAAASTKLGAPWSSRNHAG"
FT   gene            complement(209057..210312)
FT                   /pseudo
FT                   /locus_tag="CPC231_01015"
FT                   /old_locus_tag="CpC231_0200"
FT   CDS_pept        complement(209057..210312)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01015"
FT                   /old_locus_tag="CpC231_0200"
FT                   /product="IS256 family transposase"
FT                   /note="frameshifted; internal stop; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_006680457.1"
FT   gene            complement(210529..210605)
FT                   /locus_tag="CPC231_01020"
FT                   /old_locus_tag="CpC231_t11"
FT   tRNA            complement(210529..210605)
FT                   /locus_tag="CPC231_01020"
FT                   /old_locus_tag="CpC231_t11"
FT                   /product="tRNA-Pro"
FT                   /anticodon="(pos:210569..210571,aa:Pro,seq:cgg)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            complement(210662..211600)
FT                   /locus_tag="CPC231_01025"
FT                   /old_locus_tag="CpC231_0201"
FT   CDS_pept        complement(210662..211600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01025"
FT                   /old_locus_tag="CpC231_0201"
FT                   /product="metallophosphoesterase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09695"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDX2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799933.1"
FT                   /protein_id="ADL09695.1"
FT                   /translation="MVVKPTRRYAIRVASLTKTLLTATGVLGLTGFSALAWAYRECSNF
FT                   ELKIVELPILEPGVLRNADEFRILHLSDLHMTPNQVKKQEWVAQLDRLSPDLVINTGDN
FT                   LSDPKGVPGVLRALGPLLRRPGLFVFGTNDYFAPSMVNPFLYLFGKKRKPSEVPLPWKG
FT                   MRAAFIEHGWRDANQARHEFQINHVRIAVGGVDDPHHDLDDYEEIAGPPNPDADLSIAL
FT                   LHAPEPRVLERFERDGYMLSLSGHTHGGQVCLPGSRALVTNCGIDTRRVQGLHTFGKMW
FT                   MHVSNGLGTSKFAPIRLFCRPSATLIRVTER"
FT   gene            211599..212060
FT                   /locus_tag="CPC231_01030"
FT                   /old_locus_tag="CpC231_0202"
FT   CDS_pept        211599..212060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01030"
FT                   /old_locus_tag="CpC231_0202"
FT                   /product="GatB/YqeY domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09696"
FT                   /db_xref="GOA:D9QDX3"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDX3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241059.1"
FT                   /protein_id="ADL09696.1"
FT                   /translation="MSELKKKIRADLTTAMKAREKERTGTLRMLLAAIQTEETSGTKHE
FT                   LTDGDVLKVIAREIKKRRESAEVYAGAGRQELADAETQEADILAEYQPAQLDDAQLAAL
FT                   VAQAVEEVAAEHGEATMKQMGQVMKIATAKAAGQADGKRLSTAVRAALA"
FT   gene            complement(212086..214458)
FT                   /locus_tag="CPC231_01035"
FT                   /old_locus_tag="CpC231_0203"
FT   CDS_pept        complement(212086..214458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01035"
FT                   /old_locus_tag="CpC231_0203"
FT                   /product="penicillin-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09697"
FT                   /db_xref="GOA:D9QDX4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDX4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655001.1"
FT                   /protein_id="ADL09697.1"
FT                   /translation="MSKWNSLNRIVAAAVAAGAASALALSPIAAITGVAAARTSATMQS
FT                   NLQDLTDGSAPGVSTILDNQGSPIAWLYSQRRYSVPSEAIPQTVKDAVVSIEDRRFYEH
FT                   KGVDLQGNLRAIAANLFAGGVAQGASTLDQQYVKNYLLLVTSNNADEQAAATETSIPRK
FT                   LREMRMASTIDKMLSKDEILTRYLNLVPFGNNSFGIEAAARTYFGISASELSLAQSAMF
FT                   AGMVQSSSYLNPFTNAPAVIERRNTVLDSMVMNGYINQEEADLAKAEPLGVLDAPQGLA
FT                   NGCIAAGDSGFFCDHVLSYLNKKGLSTEQITKGAYTIKTTLDPQTQLAAHNAVTSQVNS
FT                   QSPGVADVMNIIEPGTNSRKILAMTSSRDYGLDLNAGQTVLPQTSSLVGAGAGSIFKIF
FT                   TAAAALKQGYGLDTVLQVPRRYEAKGLGDGGAAGCAPGTYCVENSGSYAPQMSLRDALA
FT                   YSPNTPFVKLIESVGVRDVVDISVALGLRSYSEKGSFDQDNSIADYFKEHNLGSYTLGP
FT                   TAVNALELSNVAASLASDGMWCEPSPIESVTDHNGNEVYIERPACEQALSKEIANALSN
FT                   GLSQDIIKGTGSAAAKAAGFRAPTAAKTGTTESHQSAAFLGFNSNFASAAYIYNDGTTV
FT                   SPLCTSPVSQCGKGTLFGGDEPARTWFTAATATGRAATGALPAYNTKYNRGSSEDLGSS
FT                   YVGRNGDDVKRELSGKGYKVVTEYTAGNGLPKDHVVRTEVPVPLKSDSTIKLVLSDGTP
FT                   PRRTTSPLIPRDEGPSDNNRNPGGDDLANLLQQLLGR"
FT   gene            214651..214998
FT                   /locus_tag="CPC231_01040"
FT                   /old_locus_tag="CpC231_0204"
FT   CDS_pept        214651..214998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01040"
FT                   /old_locus_tag="CpC231_0204"
FT                   /product="WhiB family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09698"
FT                   /db_xref="GOA:D9QDX5"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDX5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300416.1"
FT                   /protein_id="ADL09698.1"
FT                   /translation="MTTSLMNVRKISPLEEDSLGSLQALDRGDWVMHAHCRHEDPDALF
FT                   VRGAAQRRAAAICSECPVMMRCRADALDNRVEFGVWGGLTERQRRSILRNNPDVKSWRD
FT                   FFARGGELSGV"
FT   gene            215100..215255
FT                   /locus_tag="CPC231_01045"
FT                   /old_locus_tag="CpC231_0205"
FT   CDS_pept        215100..215255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01045"
FT                   /old_locus_tag="CpC231_0205"
FT                   /product="DUF4177 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09699"
FT                   /db_xref="InterPro:IPR025234"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDX6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241062.1"
FT                   /protein_id="ADL09699.1"
FT                   /translation="MTKWEYATVPLLTHATKQILDTWGEDGWELVNVVPGPNPENVVAY
FT                   MKREVE"
FT   gene            215255..215713
FT                   /locus_tag="CPC231_01050"
FT                   /old_locus_tag="CpC231_0206"
FT   CDS_pept        215255..215713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01050"
FT                   /old_locus_tag="CpC231_0206"
FT                   /product="RidA family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09700"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDX7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366380.1"
FT                   /protein_id="ADL09700.1"
FT                   /translation="MTASENLKNLGIELPKVAAPVAVYIPATKVGNQVWTSGQLPFIDG
FT                   SLPAVGKVGAEVSAEQAESYARVAALNALAAIDALVGIDKVTRVLKVVGFVASAQDFGG
FT                   QPGVVNGASNLMGEVFGAAGEHVRSAVGVAELPLNSPVEIEVIVEVAE"
FT   gene            215795..216628
FT                   /locus_tag="CPC231_01055"
FT                   /old_locus_tag="CpC231_0207"
FT   CDS_pept        215795..216628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01055"
FT                   /old_locus_tag="CpC231_0207"
FT                   /product="MBL fold metallo-hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09701"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDX8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558562.1"
FT                   /protein_id="ADL09701.1"
FT                   /translation="MAKLMGMEHPAYSQLRPVSPSVSVVLCPNPGYAALEGTNSWVVRA
FT                   EGDARSIVIDPGPEDEGHLNVLNSKANEVGLILLTHRHHDHADGAPRFYQLTGGAPIRA
FT                   QDPAYCKGGAPLVDGEVITVDGVTPQVEVVFTPGHTADSVCFFVWSGEPHASELEGIIT
FT                   GDTIAGRHTTMISETDGDLGDYLSTLALLEDRGKDVRLMPGHGPDGDDVASFAHWYTQR
FT                   RRQRLDQIRAARAELGEDVPIKQLIDAVYDDVDPVLRGAAEQSTRVALRYLAEQE"
FT   gene            complement(216708..217391)
FT                   /locus_tag="CPC231_01060"
FT                   /old_locus_tag="CpC231_0208"
FT   CDS_pept        complement(216708..217391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01060"
FT                   /old_locus_tag="CpC231_0208"
FT                   /product="cyclic nucleotide-binding domain-containing
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09702"
FT                   /db_xref="GOA:D9QDX9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDX9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_006770229.1"
FT                   /protein_id="ADL09702.1"
FT                   /translation="MDGVQDILSRAGIFQGVDPVAVGNLIQELESVRFPRGATIFEEGE
FT                   PGDRLYIITSGKVKLARHSLDGRENLLTVMGPSDMFGELSIFDPGPRTSSAVCVTEVHA
FT                   ATMNSEMLRQWISDHPEISEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANR
FT                   FGTQEDGALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHL
FT                   AKRAR"
FT   gene            complement(217693..218001)
FT                   /locus_tag="CPC231_01065"
FT                   /old_locus_tag="CpC231_0209"
FT   CDS_pept        complement(217693..218001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01065"
FT                   /old_locus_tag="CpC231_0209"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09703"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDY0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241066.1"
FT                   /protein_id="ADL09703.2"
FT                   /translation="MAPTLFQAYDIAPTLAQNRTAYQRIRDYSDSMSFLLVFFVPLALA
FT                   LFLLWMDRLEIKVLHPHGIPEKNNAAADITDLPRTGTAEEGSDSTDNAKNFLSSEEK"
FT   gene            218000..218806
FT                   /gene="nth"
FT                   /locus_tag="CPC231_01070"
FT                   /old_locus_tag="CpC231_0210"
FT   CDS_pept        218000..218806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="CPC231_01070"
FT                   /old_locus_tag="CpC231_0210"
FT                   /product="endonuclease III"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09704"
FT                   /db_xref="GOA:D9QDY1"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDY1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241067.1"
FT                   /protein_id="ADL09704.1"
FT                   /translation="MSSQYLSELPTSPPAARIKVGRHRATRGQETPLGKKRRARRINRL
FT                   LSIGYPEAHCELDFKTPLELTVATVLSAQCTDVRVNQVTPRLFSRYPTAWDYANANELE
FT                   LQELIRPTGFYKAKAAHLIGLGQKLVTDFGGEIPQSIQDLVSLPGVGRKTANVVRGNAF
FT                   GIPGLTVDTHFGRLVRRMGLSSHTDPLKVEAELAELIEKKEWTMFSHRIIFHGRRVCHS
FT                   RKAACGACFLAAECPSFGLEGPIDPELASALVVGDNREALLELAGA"
FT   gene            218810..219415
FT                   /locus_tag="CPC231_01075"
FT                   /old_locus_tag="CpC231_0211"
FT   CDS_pept        218810..219415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01075"
FT                   /old_locus_tag="CpC231_0211"
FT                   /product="redoxin family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09705"
FT                   /db_xref="GOA:D9QDY2"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDY2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366384.1"
FT                   /protein_id="ADL09705.1"
FT                   /translation="MKKTIAASFGVFVVMLVFLLAVVPQLLRGDNSGNQNGSTGAEGTE
FT                   ATAQNVQNRPECPIADLGGVSLPCLGAQHRARPMPAVTVVSLWAWWCEPCRKELPLFDE
FT                   LAAKHPEFSVIGVHADPNAANGAALLNDLGIQMPSLQDNNNNFAASLGLPKVVPITLVF
FT                   DQNGKLISTIPKPFEHYGELESAVLGKLPATVTPTEAS"
FT   gene            219415..220194
FT                   /locus_tag="CPC231_01080"
FT                   /old_locus_tag="CpC231_0212"
FT   CDS_pept        219415..220194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01080"
FT                   /old_locus_tag="CpC231_0212"
FT                   /product="NUDIX domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09706"
FT                   /db_xref="GOA:D9QDY3"
FT                   /db_xref="InterPro:IPR000059"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDY3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523774.1"
FT                   /protein_id="ADL09706.1"
FT                   /translation="MDSNEKQGSDFPRPDMPGENITLRPERAPIWMRRLVGDVTGGVID
FT                   GRIRRALRPESSPDSTRRAAVLVLLAGAETSAEMPNDASVLLTHRSPRMRAHSGQIAFP
FT                   GGRLDKTDANAVDCALREAWEETGLDRRTVTPLAQLPEVHIRATGYPVLPVLAHWHSVS
FT                   PIGVVSPQEADSVANIPVLALTDPANRFVVQHQDWTGPAFRVNDYVIWGFTGGLLDALI
FT                   AHAGWEQPWDKTTRYDLHKTLSESRNNERLGQLYPRR"
FT   gene            220266..221465
FT                   /locus_tag="CPC231_01085"
FT                   /old_locus_tag="CpC231_0213"
FT   CDS_pept        220266..221465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01085"
FT                   /old_locus_tag="CpC231_0213"
FT                   /product="MarP family serine protease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09707"
FT                   /db_xref="GOA:D9QDY4"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDY4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241070.1"
FT                   /protein_id="ADL09707.1"
FT                   /translation="MTPGTVVDIIIGLALIFAIFSGWRQGAFASVLSTLGVIAGLICGA
FT                   ALAPVVMEQTESTALRFLLALGTVILLVGIGNLVGGLIGSSLRDRAQWRRTLAIDSMVG
FT                   ALFQAFATLIVAWLGAIPLATSLSGSVSQGIKNSTILGFVDRNIPAAFSTLPSRISAML
FT                   NESGLPPLISPFVEGSQSKNVEAPAIKVADTALVERLRPSVIHVLGESEECSRRLMGSG
FT                   FVIDESHVITNAHVVAGTNKVSLDTVEGVFPAEVVYYNAQLDIAVLKSDKISLPALSWA
FT                   QEPAESGEDAIVMGFPESGPFEAAPARVSDRIKISGADIYSNGRVEREAYTVRGSIRKG
FT                   NSGGPMVDTEGNVLGVVFGASVDSSDIGYVLTAQEVQNMVGDIAALETPVDTQKCVTAR
FT                   "
FT   gene            complement(221458..222375)
FT                   /locus_tag="CPC231_01090"
FT                   /old_locus_tag="CpC231_0214"
FT   CDS_pept        complement(221458..222375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01090"
FT                   /old_locus_tag="CpC231_0214"
FT                   /product="alpha/beta fold hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09708"
FT                   /db_xref="GOA:D9QDY5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDY5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799941.1"
FT                   /protein_id="ADL09708.1"
FT                   /translation="MKKHRQPLSPSVVALEGPFHHQMLHTRGLRLHAATAGDPQNPAIV
FT                   LLHDSFGGWFDFRHVIEPLAAAGFHVAALDMRGYGLSDKPPSGYEHRFVTGDIAGSIRT
FT                   LGHNSAHVIGAGSGASIAWLLAANYPDHVDSLLTMGALHPADMRRAIGLRPWLFSHILP
FT                   LTMMFRLPHFLRSWCWSRRDLLIERDLRLTTGLRFHVSERFSQELRLRRKAMSIDSTFL
FT                   PVTKTSRYSVNVPPSKWTLPKVQVPVHMLVDASATSAWLARRAHSRSAAGLSTSTVGGT
FT                   GQRPHLENPEGFVSEVLRFIRSTI"
FT   gene            complement(222465..222965)
FT                   /locus_tag="CPC231_01095"
FT                   /old_locus_tag="CpC231_0215"
FT   CDS_pept        complement(222465..222965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01095"
FT                   /old_locus_tag="CpC231_0215"
FT                   /product="phage holin family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09709"
FT                   /db_xref="GOA:D9QDY6"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDY6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655004.1"
FT                   /protein_id="ADL09709.1"
FT                   /translation="MSKDNGFFTDGADQFDAKVNGIPLTDVDATNKGSIGSLVSDATAQ
FT                   MSSLFRAEVELAKTELAAEAKKGVIGGGLFGVAGTIALYSSFFFFFFLAELLSVWLDRW
FT                   AAFLIVFLIMIVLAALLALVGFKKVKKIGKPKQTIQSVTELKNLVPGKAQANLEAKQHG
FT                   MYS"
FT   gene            223082..223747
FT                   /locus_tag="CPC231_01100"
FT                   /old_locus_tag="CpC231_0216"
FT   CDS_pept        223082..223747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01100"
FT                   /old_locus_tag="CpC231_0216"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09710"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDY7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835845.1"
FT                   /protein_id="ADL09710.1"
FT                   /translation="MATLDHLLASGEIKALSQRATDGIAAVHRRPVNLRKYDVTSSESI
FT                   LRGARTSAALDPKVGEKYHISGYSVLAPAVIEQTSRTFLRAPLQVLARIDALAGGPGRP
FT                   TSASMELEVLARVITSGPNPALLPAVVHGEIIGRAAFGPRSALVARVAARSAAVTFGLD
FT                   PRGLCVPETYLRRHRVEYQASAAHFTAGQEQAVKFIELYLKAMIAGAEEAESIAAAAR"
FT   gene            complement(223791..224663)
FT                   /locus_tag="CPC231_01105"
FT                   /old_locus_tag="CpC231_0217"
FT   CDS_pept        complement(223791..224663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01105"
FT                   /old_locus_tag="CpC231_0217"
FT                   /product="HAD-IB family hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09711"
FT                   /db_xref="GOA:D9QDY8"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDY8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910664.1"
FT                   /protein_id="ADL09711.1"
FT                   /translation="MAHSSEHPRPGASHDDSTPGSGMIFPADSSKVVAFFDLDKTIIAT
FT                   SSVYVYGREFLHSGLISPVTALQISIAKATYMIAGHSSEQMDTTRDQLAQMIVGWSEEQ
FT                   VKAIATETMHSLVTPTFYAEARELIRMHQEAGHDVVIISASARILVEPIAQELGVENVV
FT                   ATELVVEDGKFTGEMPFYCKGEMKAQAIAELTQQRGYDLDSSFAYSDSVTDLPMLEAVG
FT                   HPIVVNPDRALRRIATEKGWEIRTFKNPVPLFPKPTMREVQIGTGVAAGVAAMLGGVVW
FT                   WNKRTDKRT"
FT   gene            complement(224945..225160)
FT                   /locus_tag="CPC231_01110"
FT                   /old_locus_tag="CpC231_0218"
FT   CDS_pept        complement(224945..225160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01110"
FT                   /old_locus_tag="CpC231_0218"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09712"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDY9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523775.1"
FT                   /protein_id="ADL09712.1"
FT                   /translation="MLQVLAEASFNEKEILRWTEKGKKVNHEIWYEEIPLDKSSHSSSL
FT                   PGEIPVYFNGCSFNEGWDQDFHTTVA"
FT   gene            225492..226520
FT                   /locus_tag="CPC231_01115"
FT                   /old_locus_tag="CpC231_0219"
FT   CDS_pept        225492..226520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01115"
FT                   /old_locus_tag="CpC231_0219"
FT                   /product="pilus assembly protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09713"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDZ0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366388.1"
FT                   /protein_id="ADL09713.1"
FT                   /translation="MKPAPVLIAVTDPIVHPEAVHIVAATGRPMIDSTDPREITRHAHR
FT                   AAAVLVDATTAPHAATLPAGTRRFLLAAEPGPIDWQLAMACHAEAAYVVPAQAPELLKA
FT                   LGRDDDPPPAEGIVIAVMGAVGGSGTSTLASAIALNCENAVLIDADPSSGGVDLLLGIE
FT                   ESPGMRWNDLALRQGDVRSDDLIAAFPKTSQGLPVLTVARGNDAHTIDDATFNAVIRSL
FT                   HGHTSVVVDLLRETSIADSALDAADCVVLCIPAEIRAVAAERLVQQMRARNIKVVGVLR
FT                   HRLWSSVDASDVERAAHLDVVAEIGNLSRLTKTTEYTGLSSPLPRSLKAAATAVLEEAQ
FT                   AA"
FT   gene            226517..227641
FT                   /locus_tag="CPC231_01120"
FT                   /old_locus_tag="CpC231_0220"
FT   CDS_pept        226517..227641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01120"
FT                   /old_locus_tag="CpC231_0220"
FT                   /product="TadA family conjugal transfer-associated ATPase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09714"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDZ1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241077.1"
FT                   /protein_id="ADL09714.2"
FT                   /translation="MMNHQDVVARVQRRIAEDPGLADSASLASLVRQEAHGVISDVDMI
FT                   SLLRQLRYDSVGIGQLERLLVIPGVTDIVVNGTTGVWFDRGQGLERADVAFASDDEVRR
FT                   LATRFLVASGSRLDHSHCFGDGRITRDDATSIRVHAVLSPPSESGTCLSLRVLRQATTT
FT                   IKQLTATGTFSPEVAGGLQEMIALRKPFLVVGGTGSGKTTLLSALLAQVDPGERIVCIE
FT                   DTAELRPAHPHVVSLVSRAKNTEGSGEITMTTLLRQALRMRPDSIVLGEIRGPEVVDLL
FT                   AALNTGHEGCAGTLHANSLQEVPARIEALAALGGLDRQALHSQLAAASPVVLAMKRTRQ
FT                   GRRLQQIGVLRGYPLEVHLVWDDTMQGAPSWNLS"
FT   gene            227641..228396
FT                   /locus_tag="CPC231_01125"
FT                   /old_locus_tag="CpC231_0221"
FT   CDS_pept        227641..228396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01125"
FT                   /old_locus_tag="CpC231_0221"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09715"
FT                   /db_xref="GOA:D9QDZ2"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDZ2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366390.1"
FT                   /protein_id="ADL09715.1"
FT                   /translation="MLAAAAWVSASPSPKRRVVGKKATRQWQKKAISVILVVALIFPLR
FT                   HHIPLVVSGALIVATIVNSWNKRRLEASQRREQEEISTALGSLAGDLRAGVEASVALEN
FT                   VAQNLPESALKDTLMAASRSSRIGGSASAYWQQRALAIHGIEKITHAWRLSERYGIALA
FT                   PLLEKNRASLDEDLRHAERTQAALQGAKATAYILTALPFVGILLGRGMGVNALGFLFHT
FT                   RIGAVLLILGTLLVCVGNLWSQAIMEKAR"
FT   gene            228393..229016
FT                   /locus_tag="CPC231_01130"
FT                   /old_locus_tag="CpC231_0222"
FT   CDS_pept        228393..229016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01130"
FT                   /old_locus_tag="CpC231_0222"
FT                   /product="type II secretion system F family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09716"
FT                   /db_xref="GOA:D9QDZ3"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDZ3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523777.1"
FT                   /protein_id="ADL09716.2"
FT                   /translation="MITVIAMALIALAASIKRPDVVQRIYRARDGPQKIPCGVQRYWDA
FT                   LLHKLFADRLSSDFLRKSAYQLDLFAACVQSGLTPSQSAFAVAATEESSPRDARVRSGW
FT                   LEVAMMLEMGMPAERAWQSLAEHPALGDLVTVARASERSGATLAEACERLARQLRARAS
FT                   DLSLARAERAGVLIALPLTVCFLPAFFLLGLAPVVISLGIGIFS"
FT   gene            229081..229275
FT                   /locus_tag="CPC231_01135"
FT                   /old_locus_tag="CpC231_0223"
FT   CDS_pept        229081..229275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01135"
FT                   /old_locus_tag="CpC231_0223"
FT                   /product="DUF4244 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09717"
FT                   /db_xref="GOA:D9QDZ4"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDZ4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835851.1"
FT                   /protein_id="ADL09717.1"
FT                   /translation="MFTAFIHNCHKLVDNEDGMTTIEYAMGALAAAALAGALYLVATSG
FT                   SVSTALEGIITNALNKTPG"
FT   gene            229286..229558
FT                   /locus_tag="CPC231_01140"
FT                   /old_locus_tag="CpC231_0224"
FT   CDS_pept        229286..229558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01140"
FT                   /old_locus_tag="CpC231_0224"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09718"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDZ5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799949.1"
FT                   /protein_id="ADL09718.1"
FT                   /translation="MSTIETAIVSAALIILAAAMCSGIVSVAAQLTAIDNAGAAARARA
FT                   IGVEFTAPRGTIDFSESGGLITATARVPSPLGTRTATAIFPKEQP"
FT   gene            229555..229887
FT                   /locus_tag="CPC231_01145"
FT                   /old_locus_tag="CpC231_0225"
FT   CDS_pept        229555..229887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01145"
FT                   /old_locus_tag="CpC231_0225"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09719"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDZ6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241082.1"
FT                   /protein_id="ADL09719.2"
FT                   /translation="MKKLRLAISNQDGNATILGAGIMVAFSAVLLCFVIIANSVLDQHT
FT                   AQNTADLSAIAGATAATQGLVACEQTQRVAALNDAVLIDCIQIHNDVIVETKVGQQTAK
FT                   ARAGPL"
FT   gene            complement(229919..232276)
FT                   /locus_tag="CPC231_01150"
FT                   /old_locus_tag="CpC231_0226"
FT   CDS_pept        complement(229919..232276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01150"
FT                   /old_locus_tag="CpC231_0226"
FT                   /product="DUF1998 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09720"
FT                   /db_xref="GOA:D9QDZ7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDZ7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366394.1"
FT                   /protein_id="ADL09720.1"
FT                   /translation="MAEANPNMGYQLGQELASIVADRYPNSTCTHLETTPAKPARYADW
FT                   PEWVYPPVKEALISRGIQRLYAHQQEVAHNAWEKIDTVIATGTSSGKSLGYQLPILSCL
FT                   AYDSTACAIYLTPTKALGSDQLNAVTALLQEAQTLGGDALDSVHPAPYDGDTPSDARSG
FT                   IREQSRFIFTNPDMLHAGILPNHQRWARLFRHLRFIVIDECHSYRGVFGAGVSLVLRRL
FT                   LRIASRYGSTPTVILASATSNNPAEHAELLLGRPVCAVTTDSAPTGARTIMLWEPGFLD
FT                   GVEGEHGAPVRRAASSEAASIMATLIAEGARTLTFVRSRRQAELTALRCAEELSYHGRP
FT                   DLAPRISAYRAGYLAEDRRRIEEQLDNGQLLGVASTNALELGIDVGGLDAVVTAGFPGT
FT                   VASFWQQAGRAGRRGQGSLVTLVARDEPMDTYLVHHPEALLGRPIERTVFNPHNPHILA
FT                   GHLCCAALEAPLSDAEINSLGAQQVAERLEREGLLKHRRHGWFAVEKPGEPSAHELVSL
FT                   RGSGSAITIVDETDGRVLGTIEQTRAVSQVHPGAVYLHRGESFIISSLDLEQHLALAHP
FT                   DAPDHSTYARSTTDIRILGEVDKVANPAPGLWVSNLNVEVTDRVTGYVVKAPDGSVLDV
FT                   VSLQMPPQTLITRAVAYTIDPLILDQLGITDVPGALHAAEHAAIGILPLIATCDRWDIG
FT                   GVSTEMHPDTGLPTVFVYDGHPGGAGFTDCGYERFPEWIATTFDAIRSCSCESGCPSCV
FT                   QSPKCGNGNSPLDKGGAVALLGSICTMLGVTP"
FT   gene            232526..232729
FT                   /locus_tag="CPC231_01155"
FT                   /old_locus_tag="CpC231_0227"
FT   CDS_pept        232526..232729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01155"
FT                   /old_locus_tag="CpC231_0227"
FT                   /product="cold shock domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09721"
FT                   /db_xref="GOA:D9QDZ8"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="PDB:5O6F"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDZ8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_010266781.1"
FT                   /protein_id="ADL09721.1"
FT                   /translation="MAQGTVKWFNAEKGFGFIAPDDGSADVFVHYSEIQGNGFRTLEEN
FT                   QKVEFEIGEGAKGPQAQQVHAL"
FT   gene            232971..235907
FT                   /gene="topA"
FT                   /locus_tag="CPC231_01160"
FT                   /old_locus_tag="CpC231_0228"
FT   CDS_pept        232971..235907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="CPC231_01160"
FT                   /old_locus_tag="CpC231_0228"
FT                   /product="type I DNA topoisomerase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09722"
FT                   /db_xref="GOA:D9QDZ9"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:D9QDZ9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599561.1"
FT                   /protein_id="ADL09722.2"
FT                   /translation="MAEKSGPKRLVIVESATKAKKIAPYLGDDYIVEASVGHIRDLPRG
FT                   AADVPTKYKKEPWARLGVNTENGFAPLYVVSPDKKKKVADLKQKLKLVDELLLATDPDR
FT                   EGEAIAWHLLEVLKPKVPVKRMVFNEITKPAILAAAENTRELDANLVDAQETRRILDRL
FT                   YGYEVSPVLWKKVMPRLSAGRVQSVATRVIVERERERMAFVSAEYWDIEAEFDTGKPDT
FT                   DGNPHQFTGRLTSVDGKRVATGRDFNDRGELKGDAVVVNKQRAEALVAELTGAPMNVAK
FT                   VEEKPYTRRPYAPFMTSTLQQEAGRKLHFTSERTMRIAQRLYENGHITYMRTDSTTLSE
FT                   QGLKAAREQAISLYGNDYVAEGPRRYDRKVKNSQEAHEAIRPAGEHFATPGELHAQLDA
FT                   EEFKLYELIWQRTVASQMADAKGTSMKVTIAGKNAEFSATGRTITFPGFLRAYVEITKL
FT                   SDGRDLADNAERHLPRLAEGDALDVNKLEVDEHSTNPPARYTEASLVKKMEELGIGRPS
FT                   TYASIIKTIQDRGYVYSRGNALVPSWVAFAVVGLLEKSFSALVDYDFTSSMEDELDDIA
FT                   AGREDGTEWLTGFYFGDAAASDATAESIARHGGLKALVGDNLEHIDARLVNSLELFQDS
FT                   EGRAVNVRVGRYGPYIERQIGVSADGEAEYQRANLSDTTTPDELTLDVAEKLFATPQSG
FT                   RELGRNPKNDRMIVAKEGRFGPYVTELVNDDERAQVEAKAEEIVASERKAEDEQRAAEG
FT                   KRAKNWETKTAVKQKEKRIAEIVDETLKPGTASLFKDMEPATVTLEQALQLLSLPREVG
FT                   VDPSDNAPITAQNGRYGPYLKKGNDSRSLASEEQIFTITLDEARRIYAEPKRRGRGATS
FT                   QSVIKELGDNDVSGKPMSVRDGRFGPYVTDGTTNASLRRGDDPTELTDARANELLSERR
FT                   AKEAADGGAEKKATKKAAKKSTKKTTAKKAVKKPAKTTKRVVKAGRKK"
FT   gene            complement(236042..238015)
FT                   /locus_tag="CPC231_01165"
FT                   /old_locus_tag="CpC231_0229"
FT   CDS_pept        complement(236042..238015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01165"
FT                   /old_locus_tag="CpC231_0229"
FT                   /product="oligopeptide transporter, OPT family"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09723"
FT                   /db_xref="GOA:D9QE00"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE00"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655007.1"
FT                   /protein_id="ADL09723.1"
FT                   /translation="MSDTDIAKPSTGSSIRELTLRAVIIGGLITLVFTAANVYLGLKVG
FT                   ITFATSIPAAVISMAILRRFAGHTIQENNVVQTIASAAGTLSAIIFVLPGLIMVGWWSG
FT                   FPYWTTAFVCAIGGVLGVMYSIPLRRALVTGSDLPYPEGVAAAEVLKVGNDAGNAEEYE
FT                   GNKKGLAVIVWGGIASVGYSLLTAMKGVAGEVSTTFKVGAGGTMFGSSLSLALIGVGHL
FT                   VGPAVGISMIVGLLISYGVLFPYFSAAPLAEGGELASVVNSTFVGEVRFVGAGAMAVAA
FT                   VWTLIKIIGPIVKGIKESLASSRTRAAGGDVDLTERDIPFKLVVGTILASMLPVSALLY
FT                   LFIHASEIAHHTATLVIFSIVFVLLIGLIVASVCGYMAGLIGAPNSPISGVGIIVVLAS
FT                   ALLIKVVTGSESDTNAPALVAYTLFTSAVVFGIATISNDNLQDLKTGQLVNATPWKQQV
FT                   ALIIGVIFGSIIIPPVLQLMLDGFGFVGMEGAGDNALAAPQAALLSSVAEGIFGDSLNW
FT                   NRIGLGAIIGVIVIIIDELLKRTKGWSLPALSVGMGIYLPIALTAIIPVGAFIGYFYDK
FT                   WAKKQSNPEFSKRMGILLATGVIVGESLFSVLNAAMVGGTGMEAPLAIFGYGENVATGV
FT                   GIIVFVLLVVSLYRWVRSKASE"
FT   gene            complement(238223..239749)
FT                   /locus_tag="CPC231_01170"
FT                   /old_locus_tag="CpC231_0230"
FT   CDS_pept        complement(238223..239749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01170"
FT                   /old_locus_tag="CpC231_0230"
FT                   /product="HAMP domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09724"
FT                   /db_xref="GOA:D9QE01"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE01"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_010934219.1"
FT                   /protein_id="ADL09724.2"
FT                   /translation="MTRMWRAFKWLFGTSWPLYATTVLGSNVLGAVGVMLFLRYLVPLP
FT                   EFAAFTKGTSYLPTLGISYLVVAVAFGIVVTFRLFRPVLDWQRHPEIHDPNMVRNLVMR
FT                   IPFYQSTLCALVWLIGIVILAVASAQTSLRLSLAIIVATALSGSVVIVLTYLEAERLVR
FT                   PVAATALARRFEDSTLEPPIASRLRLTWLLTSAVPIVGVLLMIAGYYAGLFGNNIRDII
FT                   PAVLTLSLVALVTGFLGTTLSIMSVVDPILELQGAINRVRRGESDVQVDIYDGSELGVL
FT                   QAGFNEMMRGLNERQRVRDIFGRYVGTEVARRALEEKPQLGGEDREVAVIFVDVIGSTT
FT                   FAVNHDPEEVVAELNKFFEHVVGVVHRNKGSINKFQGDAALAVFGAPITLSDATGHALT
FT                   AARELRQELSGLRLEAGIGVASGHVVAGNIGGLDRFEYTVIGDAVNTAARLTEIAKNTP
FT                   GRVLTNAATLKKANEAEQARWTLMKSVELRGRSMMTQLARPIRPTLADRS"
FT   gene            239797..240999
FT                   /locus_tag="CPC231_01175"
FT                   /old_locus_tag="CpC231_0231"
FT   CDS_pept        239797..240999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01175"
FT                   /old_locus_tag="CpC231_0231"
FT                   /product="DNA polymerase III subunit delta'"
FT                   /EC_number="2.7.7.7"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09725"
FT                   /db_xref="GOA:D9QE02"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE02"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799954.1"
FT                   /protein_id="ADL09725.1"
FT                   /translation="MSTNDIFSHMGVSEHIAPALRTAAYAARAHEDGSAMTHAWLFTGA
FT                   PGSGRSVAAVAFAAALECEDPHVAGCGRCPQCRSVMANAHADVVHIVPRELSISVETMR
FT                   AEVVEPAAKRPTVGRWRVVILDNADRLTDGAANALLKTVEEPPAHTVIMLCAPSTDPTD
FT                   IIPTLLSRSRHVYVPQPTTEQVVAVLTRDGSITEEDARLAAASSGGHIGRARWLARDVE
FT                   AQRRRASILNMAELVFHGDQAFQAVTGIVKTVTKQVEEQLSQENDAELDKLRNSLGMGA
FT                   RGKGVHKALRGYEAFVRDLEEKQKKRRTRAIRDSLDLSLVDLAGLYRDAIMISSHADVP
FT                   RTHPDMVGLAEELAQRVSAEGLVACVDAINLCREHINHNVRPEVAFDAMIGRIRLACGA
FT                   H"
FT   gene            241103..241178
FT                   /locus_tag="CPC231_01180"
FT                   /old_locus_tag="CpC231_t12"
FT   tRNA            241103..241178
FT                   /locus_tag="CPC231_01180"
FT                   /old_locus_tag="CpC231_t12"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:241136..241138,aa:Thr,seq:cgt)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            complement(241319..241555)
FT                   /locus_tag="CPC231_01185"
FT                   /old_locus_tag="CpC231_0232"
FT   CDS_pept        complement(241319..241555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01185"
FT                   /old_locus_tag="CpC231_0232"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09726"
FT                   /db_xref="GOA:D9QE03"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE03"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400945.1"
FT                   /protein_id="ADL09726.1"
FT                   /translation="MASSRSQCSLPQNKKTHSTASIVAGALHALSWIALILVCFFAFKN
FT                   GHFSEQIIGLSFIAVAATGIWVAICGVNRRRNN"
FT   gene            complement(241689..243335)
FT                   /locus_tag="CPC231_01190"
FT                   /old_locus_tag="CpC231_0233"
FT   CDS_pept        complement(241689..243335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01190"
FT                   /old_locus_tag="CpC231_0233"
FT                   /product="AMP-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09727"
FT                   /db_xref="GOA:D9QE04"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE04"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525265.1"
FT                   /protein_id="ADL09727.1"
FT                   /translation="MKARRGVPSTLKAMVQLAPTLISSGILNVEGNSSAIFSIPQLLAR
FT                   YRFTTAREVEQAYRICPNRIALIDDDGTLTFSQLRNDSLTVARHFASLGINDLRIGVMA
FT                   RNGRASIYPLAAKGYVGASIYLLNIGSSPEQLVGCIKRDGINVLVIDEEFVDRLPTDLT
FT                   GLHVIVGHREKVSSQRTAELITLDDIVRKPWETADISLPTFPKHGSIVLMSSGTTGIPK
FT                   GVMRKELTAPTVLESVLTQVPWRANMTIQLTGSIFHTWGWACLNIAFGLRCTVITRRKF
FT                   DPQEALADVQKHKIDAMISSPIFLKQFFAVEGQENYDCSSLKFIFSSGHSLSPWLVDAV
FT                   HERFGKILCNLYGSTEISAAAIASMEEIAENPAVAGKICKGTQLVILDDNDNPVGPGVP
FT                   GRIFCHNNLSLTGYTDPNIPIPRVGDLVQIGDRGYIDENNYLFVLGRADDMIIVGGENV
FT                   YPRSVEEVLEPMAGIADLYASGVEDEDMFERIAVWVVRSDSPEGAALTEDSIRDWVKNN
FT                   LAEHSIPRDVHFVDSLPRNATGKVIPRMLKP"
FT   gene            243544..244353
FT                   /locus_tag="CPC231_01195"
FT                   /old_locus_tag="CpC231_0234"
FT   CDS_pept        243544..244353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01195"
FT                   /old_locus_tag="CpC231_0234"
FT                   /product="hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09728"
FT                   /db_xref="GOA:D9QE05"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE05"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241091.1"
FT                   /protein_id="ADL09728.1"
FT                   /translation="MLRKLVTALTSAAIVVSLTTAPQALAAERNMVVLGDSIIADSPAT
FT                   QLLADRFTSSRNCRRSPDSYAEQAGRRLGLPVRNFSCPGVQSISTGSFSGGPFNVEVDS
FT                   ALNSGALNTATARVVITHGFNDTYFNGGESEGATRARFVAAMRPQIDRIRAAAPHARIQ
FT                   IVGYPTIVTGSRICPLHIIPNITLPVPAGAMERWENLAQWMNVDLAHATGVEFLDLKPH
FT                   TRNNGMCAPDADRYFSGVIDFTAGRGNMPLHINARGHERIGEILANS"
FT   gene            complement(244458..245327)
FT                   /gene="rfbA"
FT                   /locus_tag="CPC231_01200"
FT                   /old_locus_tag="CpC231_0235"
FT   CDS_pept        complement(244458..245327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="CPC231_01200"
FT                   /old_locus_tag="CpC231_0235"
FT                   /product="glucose-1-phosphate thymidylyltransferase RfbA"
FT                   /EC_number="2.7.7.24"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09729"
FT                   /db_xref="GOA:D9QE06"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE06"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835861.1"
FT                   /protein_id="ADL09729.1"
FT                   /translation="MKGIILAGGSGTRLHPITFGISKQLMPIYDKPMIYYPLTTLIQAG
FT                   ISEILIITTPEDQQAFQRLLGTGEQWGISLSYAVQPSPDGLAQALVIGRDFIGNDDVAL
FT                   VLGDNIFDGNDLDASLQNCYTPGKATVFAYEVSDPQRYGVVNFDSHGMATAIEEKPTHP
FT                   TSNFAVVGLYFYPNDAATLAERLTPSERGELEITALNSAYLEQGRLRVHKLERGSVWLD
FT                   TGTIDSMSEASSYVEVLQKRTGSIIGSPEVAAWRAGFINDSQLRALGHAQLKSGYGKYL
FT                   LRALGEGW"
FT   gene            complement(245331..246713)
FT                   /gene="rfbD"
FT                   /locus_tag="CPC231_01205"
FT                   /old_locus_tag="CpC231_0236"
FT   CDS_pept        complement(245331..246713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /locus_tag="CPC231_01205"
FT                   /old_locus_tag="CpC231_0236"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09730"
FT                   /db_xref="GOA:D9QE07"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE07"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241093.1"
FT                   /protein_id="ADL09730.1"
FT                   /translation="MNIETCPIQGMMVIHLDLHEDSRGWFKENWQESKLVGLGFTGFRP
FT                   VQNNISFNAEAGVTRGLHAEPWDKYVSVATGSVFGAWCDLREGSATFGATFTITITPET
FT                   AVFVPRGVANGFQALEATAYTYLVNDHWAPDAHYSFVNLADPALNISWPIPLDQATLSK
FT                   KDTAHPPLASAVPVPPKKVLVTGANGQLGRTLKKVFPHAEFCSRTDLDITTDITEARRW
FT                   ADYSVIINAAAYTAVDAAETDSTAAWRTNAEAPARLAAIAARYGITLVHLSSDYVFDGE
FT                   LPVHSEQEPFSPLSVYGQSKAAGDTAVSVAPQHYVVRTSWVVGEGNNFVSTMLSLAARR
FT                   ISPQVVNDQLGRLTFTEDLAAGIRFLLDNHAPYGVYNLSNSGEIVSWAQLAQRVFTLAG
FT                   RSASDVQPVSTTEYFAGKAPAAPRPRHSALDLSKITGLGFTPRDWQDALASYCTTLDAK
FT                   EG"
FT   gene            complement(246713..247717)
FT                   /gene="rfbB"
FT                   /locus_tag="CPC231_01210"
FT                   /old_locus_tag="CpC231_0237"
FT   CDS_pept        complement(246713..247717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="CPC231_01210"
FT                   /old_locus_tag="CpC231_0237"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09731"
FT                   /db_xref="GOA:D9QE08"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE08"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910684.1"
FT                   /protein_id="ADL09731.1"
FT                   /translation="MRKNLLVTGGAGFIGSNFVRRTLETRSDYRVRVLDKLTYAGNSAN
FT                   LDGCDAELVEGDICDAALVDKLLSDADVIVHFAAESHNDNSLEDPSPFIHTNVVGTFTL
FT                   LEAARRHRVHLHHVSTDEVFGDLELEDPNRFTERTPYNPSSPYSASKAGSDHLVRAWVR
FT                   SFDVSATLSHCSNNYGPYQHIEKFIPRQITNILSGIPPKLYGTGEQVRDWIHVDDHNDA
FT                   IHAILDRGRIGESYIIGADNDHVNNKQVIELICHLMGADSYEHVADRPGHDMRYAMDST
FT                   KLRTELGWKPRFTDTATGMREGLSYTIQWYRDNEHWWRPLKDTVENNYAKRGQ"
FT   gene            complement(247741..249114)
FT                   /locus_tag="CPC231_01215"
FT                   /old_locus_tag="CpC231_0238"
FT   CDS_pept        complement(247741..249114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01215"
FT                   /old_locus_tag="CpC231_0238"
FT                   /product="M1 family peptidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09732"
FT                   /db_xref="GOA:D9QE09"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE09"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241095.1"
FT                   /protein_id="ADL09732.1"
FT                   /translation="MTRPRLRSTPVPGTRDSYTGVDFNLGFHVRCYELIMDYAVGPNRL
FT                   AAEATLYMDNYLPLSHLTLDFADNLRATSVDITTAGGVRTDVKRFRQSDNKLRISFTDP
FT                   IPADAEFALSISYAGNPHPIRTFWGLIGWEELTNGSLVASQPCGSRSWLPCDDTPDEKA
FT                   LFDITFTCDSDYSVIANGGLISKNTSGARTTWRYRSEHPLATYLSTIQVGQYQEESLNH
FT                   TPPITTVPIRGYVPPHMISGFRNDFAQQEEMLAIFSKLFGSYPFDSYSVVVTEDELEIP
FT                   LEAQGLSIFGANHARGHGQWERLIAHELSHQWFGNSLGLAQWNDIWLNEGFACYSEWLW
FT                   FEYSGRGPTAHESARFHYDQLAALPQDLLLADPGPKDMFDDRIYKRGALTVHALRCELG
FT                   DAPFFRAVQRYVAAGRHSVVEPHDLRREILKEASNPQRCEELWASWLYRTELPEFPNP"
FT   gene            complement(249107..251188)
FT                   /locus_tag="CPC231_01220"
FT                   /old_locus_tag="CpC231_0239"
FT   CDS_pept        complement(249107..251188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01220"
FT                   /old_locus_tag="CpC231_0239"
FT                   /product="prolyl oligopeptidase family serine peptidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09733"
FT                   /db_xref="GOA:D9QE10"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE10"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799960.1"
FT                   /protein_id="ADL09733.1"
FT                   /translation="MSTTPFLRSEHHSLADLPFNADVLETIDAPEALDWAKRWSHATES
FT                   ALDFSDLQQRMRSALNVDTKIPYVLRRGSYLYNFWQDADHPRGLWRRTTLDAFLSGTEE
FT                   WQTLIDVDKLAHEENESWVWKGAHVRPHHFDRALVQLSRGGADAVEIREFDLCANDFVT
FT                   ADPFHIPEAKTRVSWVDRDTLLIGTDLGPGTLTDSGYPARAYTWQRGTPLQSAKEFFAG
FT                   KTSDLAVSAWADSTPGFERKFIRRALDFYRSHTFIERDEALQIVEVPEDCELAFHRQWM
FT                   FVFPREDYAGVPAGGVGAIVFQRFLDGDRDFRRVFTPTPTTSIQDISFTKTRIILTVLD
FT                   NVSSRLEVLRLDSLEPEDATIQLPPLTTARVVATCDDSDEVWLGASSFTQPDTLFRVDV
FT                   NDSLIPVEVRHAPALFNAHGMETRQHWAISADGTKIPYFIVGDFSQGPRPTLVGGYGGF
FT                   EVSLVPGYSATRGLGWLEQGNFYVQPNLRGGGEFGPAWHESVIRMNRPLIYQDHQAVLK
FT                   DVLSRGYASSIFVRGGSNGGLLTSVALTSYPELIQGAVVQVPLTDMLRYHQWSAGSSWI
FT                   AEYGDPSDPQEREVLESYSPLHNIREHSEVSYPPALVTTSTRDDRVHPAHARLFAAALA
FT                   DCGQPVDYYENVEGGHAGAADNEQVAFMEALIFTWLQKHADQASPSRSIFTEEGSHHD"
FT   gene            complement(251273..252352)
FT                   /locus_tag="CPC231_01225"
FT                   /old_locus_tag="CpC231_0240"
FT   CDS_pept        complement(251273..252352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01225"
FT                   /old_locus_tag="CpC231_0240"
FT                   /product="esterase family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09734"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE11"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525271.1"
FT                   /protein_id="ADL09734.1"
FT                   /translation="MKFLRSIAAFSVATATTVSLLGAAVAPAAGAAEKTPAQISNGTAL
FT                   ADVHFGATPDISPVWREKLDNDRVVEAWAHSPSMNRNIPMVVLKASSPDRPTVYLLNGG
FT                   DGGEGRANWIMQTDAMDFYKGKDVNVVIPMAGKFSYYTDWVSDNAALGGKQKWETFLTK
FT                   ELPGPMESMLKANNKRAIIGMSMSATSSLLLAEHAKGFYDAVGSFSGCAATSNPMAYQF
FT                   LRLTLQRGHATPEQMWGPMGSDYNRYNDAVVMAEDLRGTEVYVSNASGVAGGHDILANP
FT                   RFAGLDPAIASAGLTAVVVEGGLIEAGTNMCTNDLKVRLQSLNIPADFNLRNTGTHSWS
FT                   YWQDDLRASWATLERAFNK"
FT   gene            complement(252866..253129)
FT                   /locus_tag="CPC231_01230"
FT                   /old_locus_tag="CpC231_0242"
FT   CDS_pept        complement(252866..253129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01230"
FT                   /old_locus_tag="CpC231_0242"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09736"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE13"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400950.1"
FT                   /protein_id="ADL09736.2"
FT                   /translation="MYLCPIRNPPTNKKPHLGGYNAPLSLPQNGALIFPFLRNLTHAIL
FT                   EKTLYEQAPEPALHTKITQALSSAMQRPACVITYEFLLKQPD"
FT   gene            253173..254582
FT                   /gene="lpdA"
FT                   /locus_tag="CPC231_01235"
FT                   /old_locus_tag="CpC231_0243"
FT   CDS_pept        253173..254582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="CPC231_01235"
FT                   /old_locus_tag="CpC231_0243"
FT                   /product="dihydrolipoyl dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09737"
FT                   /db_xref="GOA:D9QE14"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE14"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004566447.1"
FT                   /protein_id="ADL09737.1"
FT                   /translation="MTEHYDVVVLGAGPGGYVAAIRAAQLGKKVAVVEKQYWGGVCLNV
FT                   GCIPSKALLKNAEVAHIFNHEAKTFGISGDVSFDFGVAHKRSRKVSSGIVKGVHYLMKK
FT                   NKITEIDGLGSFKDAKTIEISEGKDAGKTVTFDDCIIATGSVVRSLPGVEIGGNIVSFE
FT                   EQILKEEAPKSMVIVGAGAIGMEFAYVLANYGVEITIVEFMDRVLPNEDADVSKEIAKQ
FT                   YKKLGVKLLTGHKTTAIRDNGQGVEVDVESKDGSKSETIKAERVMVSIGFAPRVEGYGL
FT                   ENTGVKLTDRGAIQIDDFMRTNVDHIYAIGDVTAKLQLAHVAEAQGVVAAETIAGAETQ
FT                   ELGDYMMMPRATFCNPQVASFGYTEEQAKEKFAGREIKSATFPFSANGKAQGLGESAGF
FT                   VKIVADAEFGELLGAHMVGANVSELLPELTLAQRFDLTAEEIGRNVHTHPTLSEAMKEA
FT                   AEGIMGHMINL"
FT   gene            complement(254651..256078)
FT                   /locus_tag="CPC231_01240"
FT                   /old_locus_tag="CpC231_0244"
FT   CDS_pept        complement(254651..256078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01240"
FT                   /old_locus_tag="CpC231_0244"
FT                   /product="DUF2083 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09738"
FT                   /db_xref="GOA:D9QE15"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE15"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241100.1"
FT                   /protein_id="ADL09738.1"
FT                   /translation="MSKTYVGSRLRQLRKERGLSQANLAGTLELSASYVNQIEHDVRPL
FT                   TLPVLHRITEVFGVDATFFSKDDASRLLAEVHDVMLDKELCPEDIDLQELSDLVDHHPD
FT                   IARAVVEMHRRYRNVRDKLSAATDARLVNSLDETRTISGALSMPHDEVRDFFYARQNYL
FT                   DDLDHTAEAISAELGITTFNIRANEAALIDRLESRHGVTIKAGRDIGSTLHHFDTQTRV
FT                   LTLSTRLITGQRAFRLATELAFLEANERIDAYLADAYFTSKEARTLARRGIASYFAAAV
FT                   MLPYRLFHAEAERSGYDIEYLCQMFGVGYETICHRLSTLQRPNLRGIPFTFVRVDRAGN
FT                   ISKRQSATGFHFTHAGGTCPLWNVYETFTSPGTIMRQLAQMPDGRNYLWVARTVRHHQG
FT                   RFGETGKMFSIGLGCEARHAARTVYAHGLDVKTFANAVPIGAGCRVCTREDCAQRAFPA
FT                   VNKLIAIDAHMSSVAPY"
FT   gene            256554..257312
FT                   /locus_tag="CPC231_01245"
FT                   /old_locus_tag="CpC231_0245"
FT   CDS_pept        256554..257312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01245"
FT                   /old_locus_tag="CpC231_0245"
FT                   /product="succinate dehydrogenase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09739"
FT                   /db_xref="GOA:D9QE16"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR011138"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE16"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558565.1"
FT                   /protein_id="ADL09739.1"
FT                   /translation="MTVNNIDRDAIAHGKITEKPLRERPKFPTWALKLTMAVTGLIFCF
FT                   FVVFHMVGNLKVFLPFYEDGTHPIDVYGEWLRNLLYPLFPHGAFLWLFRITLLLCIVLH
FT                   IYGAFALIGRSSRSRGKFRRTNLMGGMNSFTTRTMLVTGVILLAFIVFHILDLTVGATP
FT                   AASEVFEHGHIYANMVASFSRWPVTIFYIIAMVTLFMHLSHGIWLAASDLGITGKRWRA
FT                   IILFLAYLVPAIVMIGNIAIPLSIACGWIS"
FT   gene            257331..259346
FT                   /gene="sdhA"
FT                   /locus_tag="CPC231_01250"
FT                   /old_locus_tag="CpC231_0246"
FT   CDS_pept        257331..259346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="CPC231_01250"
FT                   /old_locus_tag="CpC231_0246"
FT                   /product="succinate dehydrogenase (quinone) flavoprotein
FT                   subunit"
FT                   /EC_number="1.3.5.1"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09740"
FT                   /db_xref="GOA:D9QE17"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011280"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE17"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599619.1"
FT                   /protein_id="ADL09740.1"
FT                   /translation="MSFNSETATRPEFTQPASIVDGVKLGSILESNEPKGVPTKDMWEY
FT                   QKDHMNLVSPLNRRKFTVLVVGTGLSGGGAAAALGELGYNVKVFTYHDAPRRAHSIAAQ
FT                   GGVNSARGKKVDNDGAYRHVKDTVKGGDYRCRESDCWRLAYESVRVIDHMNAIGAPFAR
FT                   EYGGTLATRSFGGVQVSRTYYTRGQTGQQLQLSGAAALQRQIGLGTVEIFTHADMHDLI
FT                   LTDENGKKACRGIVTRNLITGELTPHTGHAVILATGGYGNVYHMSTLAKNSNASAMMRA
FT                   YELGAYLASPSFIQFHPTGLPVNSEWQSKTILMSESLRNDGRIWSPLEPKDDRDPNTIP
FT                   EEERDYFLERRYPAFGNLVPRDVASRAISQQINKGLGVGPLHNSAYLDFRDSIERLGEN
FT                   TIRERYSNLFQMYEEAIGENPFKAPMRIAPTCHFTMGGLWTDFNEMTSIDGLFAAGECS
FT                   WTYHGANRLGANSLLSASVDGWFTLPFTIPNYLANHLGEAKLAEDAPEAVAAVARAQAR
FT                   IDKLMNIKGDDPHGPEHYHRQLGDILYFSCGVARNVEDLKTGIEKIRKLRKEFWSNLRI
FT                   TGEAEEMNQVLEYACRVADYIDLGELMCVDALDRDESCGAHFREDHLSSEGEAERDDEN
FT                   WCFVSAWEPGAQEHEFIRHAEPLTFESIPLMTRNYK"
FT   gene            259346..260095
FT                   /locus_tag="CPC231_01255"
FT                   /old_locus_tag="CpC231_0247"
FT   CDS_pept        259346..260095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01255"
FT                   /old_locus_tag="CpC231_0247"
FT                   /product="succinate dehydrogenase/fumarate reductase
FT                   iron-sulfur subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09741"
FT                   /db_xref="GOA:D9QE18"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE18"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_010267267.1"
FT                   /protein_id="ADL09741.1"
FT                   /translation="MKLHLEIWRQAGPHSEGHFESIDVEDAVAQMSILELLDHVNTGLV
FT                   EEGKEPFVFASDCREGICGTCGLLVNGRPHGLDKNKPSCQQRLDHVADGSTLKIEPFRS
FT                   AAYPVIKDLAVDRSALDRVMQKGGYVSINAGTAPDADTIYQNHEKAELALDHAACIGCG
FT                   ACVAACPNGAAHLFTGAKLVHLALMPLGREERGKRARNMIDELETNFGHCSLYGECADV
FT                   CPAGIPLSAVAAINKERARAFFRGKDD"
FT   gene            260157..260507
FT                   /locus_tag="CPC231_01260"
FT                   /old_locus_tag="CpC231_0248"
FT   CDS_pept        260157..260507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01260"
FT                   /old_locus_tag="CpC231_0248"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09742"
FT                   /db_xref="GOA:D9QE19"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE19"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910695.1"
FT                   /protein_id="ADL09742.1"
FT                   /translation="MSHSAPATQETAGYPVFEGRMHYIDGYDPASLWAPHSSLQRTSTW
FT                   VGMGAILVSLAGFGALIFGLGAASVGSQDAWATYVIIGAVLGFALLIGGFLLVHHGRRN
FT                   YRQYRAETGRMN"
FT   gene            260766..262073
FT                   /locus_tag="CPC231_01265"
FT                   /old_locus_tag="CpC231_0249"
FT   CDS_pept        260766..262073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01265"
FT                   /old_locus_tag="CpC231_0249"
FT                   /product="DUF445 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09743"
FT                   /db_xref="GOA:D9QE20"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE20"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300425.1"
FT                   /protein_id="ADL09743.1"
FT                   /translation="MAQHAAPRGLAVPGPPPEAEAEKRRALRKHKTIATGLLFVAAAIF
FT                   LSCQWYTSVTDPTPAWVGFVRAAAEAGMVGGLADWFAVTALFRYPLGIKIPHTAIVRRK
FT                   KDQVGVALSGFVSENFLNAEQITEKVSQAHVASRIGEWLSEPDNAETVSREVGAFTAKA
FT                   VRALDPQDAEAVIKKAIVEKLAEPEWGPPLGRLLQQLNQGGQTEPIVDQLVSWLHKKAL
FT                   TSESLILKILGERAPSWAPKFVNELVGERVYRELIQWTAAVKSDKNHEARQAIRRFLEK
FT                   FADDLQTDPVLIQKVEDVKHDVMGSAPVQDAASTIWAHVSKNVILAVEDADSLLRQKIK
FT                   EYALEWGNRIHSDDALRADLGARITKAAAFLADNYADQVTSIISETIERWDADEASDKI
FT                   ELMVGKDLQYIRLNGTVVGALAGLAIYTVSYSLFGV"
FT   gene            262135..262425
FT                   /locus_tag="CPC231_01270"
FT                   /old_locus_tag="CpC231_0250"
FT   CDS_pept        262135..262425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01270"
FT                   /old_locus_tag="CpC231_0250"
FT                   /product="DUF2516 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09744"
FT                   /db_xref="GOA:D9QE21"
FT                   /db_xref="InterPro:IPR019662"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE21"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241106.1"
FT                   /protein_id="ADL09744.1"
FT                   /translation="MTFVFLIFGYLLKAAVYLAVAAALIGAGLAAATRADAFEAGDRQN
FT                   KWIWVGLLLLAALMVYLKVQFLSWIGLVIIGLYWFDVRPQIKNILNGNYGW"
FT   gene            262433..263008
FT                   /locus_tag="CPC231_01275"
FT                   /old_locus_tag="CpC231_0251"
FT   CDS_pept        262433..263008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01275"
FT                   /old_locus_tag="CpC231_0251"
FT                   /product="aminotransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09745"
FT                   /db_xref="GOA:D9QE22"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE22"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241107.1"
FT                   /protein_id="ADL09745.2"
FT                   /translation="MASDKTVVVTLLDPLATADDVKQLAATARQQGMGICVEPSLLHAI
FT                   DAATKHAEQFPVVSWAGYPTGKHHVLIKASEARLAVQSGATMVIYVPDPASLIHTTGAA
FT                   FIGEIVAAREAVPHPAQLAVLVDDTLLGEELRARAHEWLAKVGVDAVVSYSVGDHEKSG
FT                   IPLYVLCDISEAPVHKAAGAHGVLVTGL"
FT   gene            complement(263005..263853)
FT                   /locus_tag="CPC231_01280"
FT                   /old_locus_tag="CpC231_0252"
FT   CDS_pept        complement(263005..263853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01280"
FT                   /old_locus_tag="CpC231_0252"
FT                   /product="LmeA family phospholipid-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09746"
FT                   /db_xref="GOA:D9QE23"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE23"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366415.1"
FT                   /protein_id="ADL09746.1"
FT                   /translation="MSKTIGSRISKLILTIIVVLMVLLLLAEFGVRWSISKQLKDAVGS
FT                   NSTGQEASISFGPTPLLFSAVTQNIPSVTIESPSTVNIKHPGGANAVPEVTGTPQAFIN
FT                   VDSLNISDPDNPVAASLSLRTTLADDYLLAVLQKSIAENQTHQPAPTEGKDNELGALAG
FT                   TFLQQLIQVTGITSNPADGTVKVDITGGAAKLTLKPEAVDGRLSFTATNASFLGVELPS
FT                   TVSDALTKGLRDQASTMAGNLKIKSVKVVEHGVTIEVDGENVNLNELGKEKDQQPVAPT
FT                   R"
FT   gene            complement(263945..264814)
FT                   /gene="pflA"
FT                   /locus_tag="CPC231_01285"
FT                   /old_locus_tag="CpC231_0253"
FT   CDS_pept        complement(263945..264814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflA"
FT                   /locus_tag="CPC231_01285"
FT                   /old_locus_tag="CpC231_0253"
FT                   /product="pyruvate formate lyase-activating protein"
FT                   /EC_number="1.97.1.4"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09747"
FT                   /db_xref="GOA:D9QE24"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE24"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799966.1"
FT                   /protein_id="ADL09747.1"
FT                   /translation="MADGINSTVTVERSDGPRLRGTAAGIGTDLELEDVSHKELIEARR
FT                   TGDIALVHSWELVTAVDGPGTRMTMFMAGCPLRCLYCHNPDTMQMKKGTLERVEDIIKK
FT                   IKRYRRVFKASGGGLTISGGEPLFQIAFTRRVLKEVHDAGIHTTIDTSGYLGARLSDED
FT                   LENIDLVLLDVKAGDEETYRRVTGRELQPTIDFGNRLHAVGKPVWIRFVLVPGLTDSPE
FT                   NINKVADIVEQWKDNVERVEVLPFHNMGADKWHELNLQYDLEDVKPPTEESVAFTKNVF
FT                   RSRGLLVP"
FT   gene            complement(264998..265249)
FT                   /gene="grcA"
FT                   /locus_tag="CPC231_01290"
FT                   /old_locus_tag="CpC231_0254"
FT   CDS_pept        complement(264998..265249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grcA"
FT                   /locus_tag="CPC231_01290"
FT                   /old_locus_tag="CpC231_0254"
FT                   /product="autonomous glycyl radical cofactor GrcA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09748"
FT                   /db_xref="GOA:D9QE25"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE25"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910701.1"
FT                   /protein_id="ADL09748.1"
FT                   /translation="MSSKTFEERLNDMKTQRNENNANAGLYHANINVLDQKTLEDAMEN
FT                   PDKYPNLTVRVSGYAVNFVKLTREQQLDVLSRTFHHSA"
FT   gene            complement(265301..267397)
FT                   /gene="pflB"
FT                   /locus_tag="CPC231_01295"
FT                   /old_locus_tag="CpC231_0255"
FT   CDS_pept        complement(265301..267397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflB"
FT                   /locus_tag="CPC231_01295"
FT                   /old_locus_tag="CpC231_0255"
FT                   /product="formate C-acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09749"
FT                   /db_xref="GOA:D9QE26"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE26"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004566466.1"
FT                   /protein_id="ADL09749.1"
FT                   /translation="MTTAQQETNVSAWEGFAAGPWQEDIDVRDFIQRNYTPYDDDASFL
FT                   AGPTEKTLRVWDTLEKNYLSVERKKRVFDVDTDTPADIDAFPAGYISEDDNVIVGLQTD
FT                   VPLKRAMMPFGGWRMVETAIKEAGKEANEDIKNIFTKYRKTHNEAVFDIYTPRIRAARS
FT                   SHIITGLPDAYGRGRIIGDYRRVALYGVDFLIEEKNRAKDAVATENFSEHWARYREEHS
FT                   EQIKALKKLKIMAAAYGFDISRPAKTAQEAVQWTYFAYLASVKSQDGAAMSIGRLSAFL
FT                   DIYFERDLASGLITEEDAQEMIDALVIKLRIVRFLRTIDYDQIFSGDPYWATWSDAGFA
FT                   EDGRSMVTKTSFRLLQTLRNLGPAPEPNITIFWDPELPEGYKDFCAAISIETSSIQYES
FT                   DKQIRDQWGDDAAIACCVSPMAIGKQMQFFGARVNSAKSLLYAMNGGRDEVSGKQITEP
FT                   GLFAPIQGDGPLDFDEVWEKYENMLDWVVGTYIEALNIIHFCHDRYAYESIEMALHDSN
FT                   IVRTMGCGIAGLAIVADSLSAIKYAKVTPVRDETGLIVDYITEGDFPRYGNDDDRVDDI
FT                   AATIVHTVMSKIKEIPLYRDAIPTQSVLTITSNVVYGKATGAFPSGHKAGTPFSPGANP
FT                   ENGADTHGMVASMLSVGKLDYQDALDGISLTNTITPSGLGRTADEQVKNLVGILDAGFI
FT                   MDEE"
FT   gene            complement(267945..268772)
FT                   /locus_tag="CPC231_01300"
FT                   /old_locus_tag="CpC231_0256"
FT   CDS_pept        complement(267945..268772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01300"
FT                   /old_locus_tag="CpC231_0256"
FT                   /product="class I SAM-dependent methyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09750"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE27"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400954.1"
FT                   /protein_id="ADL09750.1"
FT                   /translation="MADHAHNLRASFGQGRPSSRPVGVITRGTTGYNRLRRCDRWMAHH
FT                   PDIRTALRRAQNPLALDVGYGASFTTTVEWARWLRTIRLNTQVTGLEIDPERVLPPRDG
FT                   VTFELGGFELAGYRPTIVRAFNVLRQYDVDQVHAAWDMVTSRLQPGGFFIEGTCDELGR
FT                   RSTWVLLDSSGPLSLTLAWDPFDVERPSDIAERLPKALIHRNVPGEKIHQLLSLADAAW
FT                   NRSAPWASYGPRVRWRAARASLVEQGISLMPIRRPVRDNLITVPWSLVDPEKS"
FT   gene            complement(268795..269298)
FT                   /locus_tag="CPC231_01305"
FT                   /old_locus_tag="CpC231_0257"
FT   CDS_pept        complement(268795..269298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01305"
FT                   /old_locus_tag="CpC231_0257"
FT                   /product="DUF2505 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09751"
FT                   /db_xref="InterPro:IPR019639"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE28"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910704.1"
FT                   /protein_id="ADL09751.1"
FT                   /translation="MTTRSENTVTINQPAEKVHAALTNPDYWAFVVENLSPEPGQVHEF
FT                   ADANGGAVATLFEVLPLEILPEAVRAMISQALKVKRVVTVGGLNGDTAPISYTADVKGT
FT                   PVDFNGEISLTGAGQSTTLSYANEVTVNIPFMGAAIEPKIGEALGELFQNEGNLTAQWI
FT                   SENL"
FT   gene            269322..270461
FT                   /locus_tag="CPC231_01310"
FT                   /old_locus_tag="CpC231_0258"
FT   CDS_pept        269322..270461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01310"
FT                   /old_locus_tag="CpC231_0258"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.3.1.98"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09752"
FT                   /db_xref="GOA:D9QE29"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE29"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835870.1"
FT                   /protein_id="ADL09752.1"
FT                   /translation="MTDTSLAQTFAEIRPAIEQHADIRVDSLSFSELTTLHLGGTPIAA
FT                   VRCGSRASVVHAVKLLDAHRIPLLIVGGGSNLVIADGDIPVVAVIVECKEMSADMHTGK
FT                   LVADAGVVWDEVVAFAVEAGLGGIECLSGIPGSAGATPVQNVGAYGVEIADVLVSVELL
FT                   DRATGEVSEVPAAELDLAYRYSNLKFTGRGVVLGITLQLALDGLSAPLRFGELARLLGV
FT                   TATGGEQIRWNSREVREAVLQLRRGKGMVYDPDDHDTWSAGSFFTNPIISDALLASVRT
FT                   RVAELCTPEDAAAMPCYAAGSGAWKLSAAWLIDRAGYKKGYPEGAVARLSTKHTLALTN
FT                   RGNANTADLVALARDIRDGVQETFGVALEPEPVWIGVEF"
FT   gene            complement(270556..272262)
FT                   /locus_tag="CPC231_01315"
FT                   /old_locus_tag="CpC231_0259"
FT   CDS_pept        complement(270556..272262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01315"
FT                   /old_locus_tag="CpC231_0259"
FT                   /product="AMP-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09753"
FT                   /db_xref="GOA:D9QE30"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE30"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599647.1"
FT                   /protein_id="ADL09753.2"
FT                   /translation="MSAFETKAWLQYYPSWTPHSLDYGDTTLLDIYDNNLAINADKPAT
FT                   YFFGKRQSYAELDKQVRSAAAGLRALGVRAGDRVAICLPNCPQHVAAHYAVLKLGAIVV
FT                   EHNPLYTAHELEAPFTDHGARVAIVWDKAAPTLEKLRRTTPLETIVSVNMIDAMPPLQK
FT                   YALKLPIPTLMKKRDALTAPAPNTIPWQILTGSALGGQGEDIVSCPEVTKASVALILYT
FT                   SGTTGAPKGAQLTHGGLFANLLQGKAWIQGLGDQDERLLGAIPMFHAYGVTIVLNLAIY
FT                   IGGEMVLLPAPQIPLIMKTMKKEPVTWVPGVPTLYQKIAEAAEKSGISISSVRNSFSGA
FT                   SALPVDTVAYWEKLTSGLLVEGYGLTETSPVIVGNPMTSDRRPGYVGIPFPDTEVRIAN
FT                   PENLDETMPDGQEGEILVRGPQVFAGYLNQPEATANSFHNDWYRTGDVGIMEEDGFIRL
FT                   VARIKEVIITGGFNVYPAEVEDVLRQHPDVLDAAVVGLPRSDGSESVVAAITLNEGAAL
FT                   DPEGLKDYCRENLTRYKVPRTFYHFEELAKDQLGKIRRREVQAELIRKLKK"
FT   gene            272581..273852
FT                   /gene="mshA"
FT                   /locus_tag="CPC231_01320"
FT                   /old_locus_tag="CpC231_0260"
FT   CDS_pept        272581..273852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshA"
FT                   /locus_tag="CPC231_01320"
FT                   /old_locus_tag="CpC231_0260"
FT                   /product="D-inositol-3-phosphate glycosyltransferase"
FT                   /EC_number="2.4.1.250"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09754"
FT                   /db_xref="GOA:D9QE31"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR017814"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE31"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_016829999.1"
FT                   /protein_id="ADL09754.2"
FT                   /translation="MAYMRIAMISMHTSPLQQPGSGDAGGMNVYVLSMARELARRGLEV
FT                   DVFTRATRLSHGETVDVEPGLRVINIVAGPYEGLSKEELPTQLAAFAGGIVQFVKCNAL
FT                   AYDVVHSHYWLSGQVGWLLRDLWEIPLVHTSHTLAAVKNFHSSTSDMRESEARRICEQQ
FT                   LVDNADILVVNTPEETSDLVHHYDALPDKVAVIAPGTDISLFTPGTQRNTEVSRRCLGI
FT                   PLHIKVIAFVGRLQEFKGPQVLLAAVAELLRRDPDRELRVIFCGGPSGAAATVEHYIEL
FT                   SRRLGLGKQVRFLDPRPPEELVSIYQAADIVAVPSYNESFGLVAMEAQASGTPVVAARV
FT                   GGLSIAVSDGETGLLVDGHAPEAWADALAQLLDDDALRIQMGEDAVGHAANFTWAASAE
FT                   KLEEVYEAALDIDVDECKERHAEG"
FT   gene            273976..274722
FT                   /locus_tag="CPC231_01325"
FT                   /old_locus_tag="CpC231_0261"
FT   CDS_pept        273976..274722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01325"
FT                   /old_locus_tag="CpC231_0261"
FT                   /product="phosphoglyceromutase"
FT                   /EC_number="5.4.2.11"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09755"
FT                   /db_xref="GOA:D9QE32"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE32"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599649.1"
FT                   /protein_id="ADL09755.1"
FT                   /translation="MTIGKLILLRHGQSEWNASNQFTGWVDVNLTEQGEAEAKRGGEML
FT                   KQQDVLPTVVYTSLLRRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETK
FT                   DKYGADQFMEWRRSYGTPPPELEDSSEFSQANDPRYADLSQVPRTECLKDVVERFVPYF
FT                   EEEILPRAKKGETVLIAAHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDQEGKV
FT                   LNPGGTYLDPEAAAAGAAAVAAQGGK"
FT   gene            274743..275981
FT                   /locus_tag="CPC231_01330"
FT                   /old_locus_tag="CpC231_0262"
FT   CDS_pept        274743..275981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01330"
FT                   /old_locus_tag="CpC231_0262"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09756"
FT                   /db_xref="GOA:D9QE33"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE33"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366422.1"
FT                   /protein_id="ADL09756.1"
FT                   /translation="MNVLLAFVLGAALMGLALPAFKWVQGRSGRYRRALAGAHANQVTT
FT                   VGQMLHLAVQGSPTGVTVVDRTGSVLLSNARAHDMGIVHERTLNPDIWALSQEVFEDRE
FT                   THSLELAIADRRTRITSVRAMVKPLTLVDDRYVIVFSTDESENQRMEAARRDFVANVSH
FT                   ELKTPVGGMALLAEAITQGSDDQEQVEYFGKRLQKEAHRLADMINELISLSKLQGAEAL
FT                   PDLQPVAVDEIIDEALSRNYLAAENAGIELTRGKKCGVEVMGDRSLLVTAVSNLISNAI
FT                   NYSPNAMPVSVTTKVLFDELVLIRVIDSGIGISPENQGRVFERFFRVDKARSRSTGGTG
FT                   LGLAIVKHVAANHGGDVKLWSRPGTGSTFTIDLPIYHPEEPAPVDSVDTESDSDLLLYP
FT                   SASRGDSRRKDKA"
FT   gene            275982..276677
FT                   /locus_tag="CPC231_01335"
FT                   /old_locus_tag="CpC231_0263"
FT   CDS_pept        275982..276677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01335"
FT                   /old_locus_tag="CpC231_0263"
FT                   /product="response regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09757"
FT                   /db_xref="GOA:D9QE34"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE34"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910710.1"
FT                   /protein_id="ADL09757.1"
FT                   /translation="MITILLVEDEESLADPLAFLLRKEGFEVVVAGDGPTALVEFEKND
FT                   IDIVLLDLMLPGMSGTDVCKRLRKVSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYS
FT                   ARELIARIRAVLRRGGEPQVADYEEEGDDILGGGRVRMDVERHTVTVAGENISMPLKEF
FT                   DLLEYLMRNSGRVLTRGQLIDRIWGADYVGDTKTLDVHVKRLRSKIEEEPSSPKHLVTV
FT                   RGLGYKFED"
FT   gene            complement(276674..277606)
FT                   /locus_tag="CPC231_01340"
FT                   /old_locus_tag="CpC231_0264"
FT   CDS_pept        complement(276674..277606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01340"
FT                   /old_locus_tag="CpC231_0264"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09758"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE35"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241120.1"
FT                   /protein_id="ADL09758.2"
FT                   /translation="MNDPKTTPESAPVHLGFPEFSPAADSIRRGDELPPDFPRQWFEFT
FT                   NPEDPTHQFSIDLTWIESTYSCAFGTESCKGIDASLPSVGCCGHGAFLSDDEDREQLLH
FT                   AVTQMPARYWQLRPEETDAFLSADDPAELEPWLVWDELDDDNGEPEPALKTTVVDGACI
FT                   FANREGWATGTGCAIHQWALDAGQDLTVVKPEVCWQLPLRRLEAYEERADGVEILRTTI
FT                   TEYERRGWGNGGEDFDWYCTTAPGCHENADPLWVTHESELRALMGDSSYEFLAHICRTR
FT                   DNARSNGVPSSIFSPHPASVAAARPQTES"
FT   gene            277639..278595
FT                   /locus_tag="CPC231_01345"
FT                   /old_locus_tag="CpC231_0265"
FT   CDS_pept        277639..278595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01345"
FT                   /old_locus_tag="CpC231_0265"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09759"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE36"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910712.1"
FT                   /protein_id="ADL09759.2"
FT                   /translation="MRLGVLDVGSNTVHLVAVDAQQGGRPTPMSDWKTTLKLVGYLDKK
FT                   GAITAAGVDKLVDSVAEAAALAQQLGCEELMPFATSAVRSATNSDEVLAEVARHTGINL
FT                   EVLSGTDEAKLTFLAVRRWYGWSAGRIINLDIGGGSLEMSTGENENPDAAFSLDLGAAR
FT                   LTHDWFDTDSPERRKINLLRDFIDAELVESAKILRTYGEARLAVGTSKTFRTLGRLTGA
FT                   SPSPAGLFIKRELSAPGLRQLIAFISRMTAADRAELEGVSANRSQQIVAGALVAEAAMR
FT                   ALGIEHLEICPWALREGVILRRMEQGIVPKETPLGEK"
FT   gene            278601..279707
FT                   /locus_tag="CPC231_01350"
FT                   /old_locus_tag="CpC231_0266"
FT   CDS_pept        278601..279707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01350"
FT                   /old_locus_tag="CpC231_0266"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09760"
FT                   /db_xref="GOA:D9QE37"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE37"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241122.1"
FT                   /protein_id="ADL09760.1"
FT                   /translation="MSEKQLTVAELLARSGKNGGSSETSRRRRRNLEDGGISVAELTGS
FT                   IPKVNSKPTESKHSSQPIDVPAAAAASSNTRESDSAAQGPHSHPESFVDSASAAPFADA
FT                   FPTTSRTQALKRDAAFTAVKEQAEKTQERQAADKAEELLAADSAETSTTPENTAAAIPS
FT                   KEQTIVLSVVDEKDPVRLTTDFFPAVSQNSQREEVQVAADSLGMPAVASAEPTDAPSSE
FT                   TLNAAEETSTFAVVEDEEPYGREDDYEAYEDYAAYEEYEDYEGAEEFNDEYDDYDEYYE
FT                   EDEEERVSAMGVILMALAGIVLGVVIFLGFQQLWGALGKAIVAVLAVAVTGAIVGVVHA
FT                   LRTERDRESMILAGVAGLIMTFGPLLLS"
FT   gene            279805..280608
FT                   /gene="proC"
FT                   /locus_tag="CPC231_01355"
FT                   /old_locus_tag="CpC231_0267"
FT   CDS_pept        279805..280608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="CPC231_01355"
FT                   /old_locus_tag="CpC231_0267"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09761"
FT                   /db_xref="GOA:D9QE38"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE38"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241123.1"
FT                   /protein_id="ADL09761.1"
FT                   /translation="MTSIAVIGGGKIGEALISGLIAAGMNPKNINVTNRNAEHGQALKE
FT                   KYGVVSFTENIPAVDEVDVVFLCVKPKQIIKVVEEIADAVDNNSNTTVVSMAAGVNTAA
FT                   IEEILAAGSPVIRVMPNTPMLVGKGNSAVAPGRFADQSAVEQVRKLLETVGNVTLIEES
FT                   DLDAVVALSGSSPAYLFLFAEALIDAGVNLGLNREQSKELAVNAFYGAAAMLKETGEEP
FT                   AQLRANVCSPAGTTIAAIREMEESGLRGMVYRAAEAAAKRNGELG"
FT   gene            complement(280613..280810)
FT                   /locus_tag="CPC231_01360"
FT                   /old_locus_tag="CpC231_0268"
FT   CDS_pept        complement(280613..280810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01360"
FT                   /old_locus_tag="CpC231_0268"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09762"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE39"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366427.1"
FT                   /protein_id="ADL09762.2"
FT                   /translation="MKRVALATHLLIYFPTRNISHANTFAFSVETTGHRENTKVSTLKY
FT                   RFNKKGKAKGVEVFFYPFSF"
FT   gene            280895..281086
FT                   /locus_tag="CPC231_01365"
FT                   /old_locus_tag="CpC231_0269"
FT   CDS_pept        280895..281086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01365"
FT                   /old_locus_tag="CpC231_0269"
FT                   /product="excisionase family DNA-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09763"
FT                   /db_xref="GOA:D9QE40"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE40"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599659.1"
FT                   /protein_id="ADL09763.1"
FT                   /translation="MAREDNGTFLTVAEVAEIMRVSKMTVYRLVHSGELPAVRVGRSFR
FT                   VHEKAVNEYLDASYYDVG"
FT   gene            281398..281499
FT                   /locus_tag="CPC231_01370"
FT                   /old_locus_tag="CpC231_0271"
FT   CDS_pept        281398..281499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01370"
FT                   /old_locus_tag="CpC231_0271"
FT                   /product="AURKAIP1/COX24 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09765"
FT                   /db_xref="InterPro:IPR013177"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE42"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_003402602.1"
FT                   /protein_id="ADL09765.1"
FT                   /translation="MGSVIKKRRKRMSKKKHRKLLRRTRVQRRKLGK"
FT   gene            281582..282463
FT                   /locus_tag="CPC231_01375"
FT                   /old_locus_tag="CpC231_0272"
FT   CDS_pept        281582..282463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01375"
FT                   /old_locus_tag="CpC231_0272"
FT                   /product="thioredoxin domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09766"
FT                   /db_xref="GOA:D9QE43"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE43"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241125.1"
FT                   /protein_id="ADL09766.2"
FT                   /translation="MFSIKRPAVLALLIVILLIVGIGAYTLGRGSAAKDGDTSANSAGS
FT                   SQGAGPSLPPGFTGKTGSSRVSPGTKTDGPVALANGSYDAMIYGPGKELKSAEDILNVH
FT                   RRNTKDPFALGALDAPVVISEFSDFECPFCAKWSNETEPTIIKEYVEKGFVRIEWNDLP
FT                   INGPDAVSAAKAGRAAAAQGKFNEFRSALFQASKTIKGHPENKLTNFEEFAREAGVKDM
FT                   ARFSREASDATYDSVVDKAREYAGSLGINGTPGFVVGTQYVSGAQPTEVFIRAIEAELA
FT                   KVADGKVAVPSV"
FT   gene            282456..283280
FT                   /locus_tag="CPC231_01380"
FT                   /old_locus_tag="CpC231_0273"
FT   CDS_pept        282456..283280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01380"
FT                   /old_locus_tag="CpC231_0273"
FT                   /product="cytochrome c biogenesis protein CcdA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09767"
FT                   /db_xref="GOA:D9QE44"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE44"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366430.1"
FT                   /protein_id="ADL09767.2"
FT                   /translation="MSDIGLLGAFLGGILALLSPCSALLLPAFFAYAFQRSSQIMARTG
FT                   VFFLGLAAVLVPVGTAAGRLGGFLALHRETLIIGGGIVIVALGIFTFFGGGITLPGLSG
FT                   LAGRVRGRGWLSVFLLGAAYGFSGFCAGPLLGAVLTTAVVSASSAYGALVLGCYALGMV
FT                   VPLVVLALFWERIPHGALGGKVVHIGRLKLNTMSMISGVIFVIIGLVFIFTHATTGLPG
FT                   LLGIETQSKIQAWALDVAANVSNLTSVLIALGIIAVGLVIYILRTPEKGKRD"
FT   gene            complement(283277..284320)
FT                   /locus_tag="CPC231_01385"
FT                   /old_locus_tag="CpC231_0274"
FT   CDS_pept        complement(283277..284320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01385"
FT                   /old_locus_tag="CpC231_0274"
FT                   /product="HAD-IB family hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09768"
FT                   /db_xref="GOA:D9QE45"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE45"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014317526.1"
FT                   /protein_id="ADL09768.1"
FT                   /translation="MSISQPDPTWPQTPQEFLAGWSTSRGNLRRFFEEHALPPIDAQAQ
FT                   REAGEAAAALAAAEIYGIELDQYTSGLESVSGSFEAAGATHVTSPDPDIPQDLGAAAFF
FT                   DIDNTLIQGSSLVVFALGLAKKRYFKLSEILPVAWKQIKFRVTGAENAADVAEGRKQAL
FT                   EFIKGRRVDELVELCEEIVGNNMSEKLWPGTKSLADQHIAAGQQVWLVSATPVQLAQSL
FT                   AKRLGFTGALGTVAEVKDGVFTGRLVGDILHGPGKLHAVAALATIERLDLSRCTAYSDS
FT                   VNDVPMLSMVGTAVAINPDRPLAKVAKQHGWEMHDYRSLRKAMRTYGLPALITAAFSLG
FT                   GWKAWRR"
FT   gene            284414..284668
FT                   /locus_tag="CPC231_01390"
FT                   /old_locus_tag="CpC231_0275"
FT   CDS_pept        284414..284668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01390"
FT                   /old_locus_tag="CpC231_0275"
FT                   /product="glutaredoxin family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09769"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE46"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366432.1"
FT                   /protein_id="ADL09769.1"
FT                   /translation="MSGVASAREVELMTRKTCGSCQRVAEQIIPVVAAAGAKLSIVDVD
FT                   MDRLLAAEYGDRVPVVVIDGEEFACWEVDNEELAAELAS"
FT   gene            284831..286195
FT                   /locus_tag="CPC231_01395"
FT                   /old_locus_tag="CpC231_0276"
FT   CDS_pept        284831..286195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01395"
FT                   /old_locus_tag="CpC231_0276"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09770"
FT                   /db_xref="GOA:D9QE47"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE47"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525281.1"
FT                   /protein_id="ADL09770.2"
FT                   /translation="MSVLVVGMSHRSAPVTLLERLSMNDEVRSQTATDLIARPSLTEAM
FT                   IISTCNRLEVYAMTSSFHTGVNDVVEVLHAVSGVDMDTLRGYLYVRYADAAAEHMMVVA
FT                   SGMDSMVTGEQQIIGQVRTAYQQAIESGTVGPALHGLVQASLHTGKRVHTETDIDDAGA
FT                   SMVSFALDQAMSGAGLSDLRGKKALVLGAGAMASLAATHLGRLGIEGIIFSNRTRNRAE
FT                   RLAEHSREAGVPAEVVDFASRGNALSGVHIAISATGAHTYTISAQDVPEKHLGLIFVDL
FT                   SMPRDINDDVAEIAGVQLVNIEKLHEAKAEGKDADEAAHKIVAEELSAYTSAQRVRDVA
FT                   PAVSALRRHASGLITTELERLKTRTPSMGEEDFEEVQRTIRRVVDKLLHQPTVRVKELA
FT                   ASSGAVSYETALQDLFGLPVEAKSVKLGVRDLPDAEVVALGVSDANKIIRAIKED"
FT   gene            286198..287088
FT                   /gene="hemC"
FT                   /locus_tag="CPC231_01400"
FT                   /old_locus_tag="CpC231_0277"
FT   CDS_pept        286198..287088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="CPC231_01400"
FT                   /old_locus_tag="CpC231_0277"
FT                   /product="hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09771"
FT                   /db_xref="GOA:D9QE48"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE48"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241130.1"
FT                   /protein_id="ADL09771.1"
FT                   /translation="MTFTIGTRGSLLATTQSGHVRDALISQGYSAELSIVTTPGDVNMA
FT                   PVERIGVGVFTQALRDVLVKGGCDIAVHSFKDLPTQRDPRFHLIVPERADARDCLVARD
FT                   GLTLAELPQGARIGTGAPRRISQIKALRPDVECVPLRGNIDTRMGKVFSGELDAVVLAY
FT                   AGLSRVGRGDEATEVFNPERFLPAPAQGALAIECRVDDAAAVAAINAIRNAEDETCALA
FT                   ERVVLNRLEAGCTAPVAAHSVIIEQELQVTGAVISLDGSKVFRATMTGGLSEAVAIGEK
FT                   VAAKLIQDGAAELLS"
FT   gene            287342..289030
FT                   /locus_tag="CPC231_01405"
FT                   /old_locus_tag="CpC231_0278"
FT   CDS_pept        287342..289030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01405"
FT                   /old_locus_tag="CpC231_0278"
FT                   /product="bifunctional uroporphyrinogen-III
FT                   C-methyltransferase/uroporphyrinogen-III synthase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09772"
FT                   /db_xref="GOA:D9QE49"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE49"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241131.1"
FT                   /protein_id="ADL09772.1"
FT                   /translation="MSSTPQPTPVTPAPEGKVIFVGAGPGNPDLLTVRAREVLSHTAFA
FT                   VVDAEVLPGVRSVVARELDVPMDKVQAAEEEYERLCAEAKEAGARRKPQRPDAPTAAEI
FT                   TEVDDDVPVVEVVEKLKELLSSGEDVIRLVQGNPLSCDRTLEEISAVKQAGLEFHVVPG
FT                   MSLPATVPAFAGIALGSSYTETDVTGEDVDWEQLAAAPQPLVLQATKEDLPTIAAELKS
FT                   RGIEASTPVTVTARGTTRLQRSFDISLGALHKLDGDLAGTLVVTLGKAADERTKYSWWE
FT                   NRSLFGWRVLVPRAKEQAGSMSALLAAQGAIPQEVPTISVEPPRNPAQMEKAVKGIVEG
FT                   RYQWVIFTSVNAVKSVREKIGSFGLDARAFAGVRIGAVGTKTAKAIRELGITPELLPPR
FT                   NRQNAAGLVSVFPEYVEDLDPVGRVLLPRADIATDVLVEGLEGLGWEVDDVVAYRTVRA
FT                   APPSAEVRDMIKSGGFDAVCFTSASTVKNLVGIAGKPHQRTIIACIGPMAAAAAKELGL
FT                   RVDVIPEVADVPHLINGLATHVAQLRAAGQLPPPRKKRRARKNRE"
FT   gene            289077..290084
FT                   /gene="hemB"
FT                   /locus_tag="CPC231_01410"
FT                   /old_locus_tag="CpC231_0279"
FT   CDS_pept        289077..290084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="CPC231_01410"
FT                   /old_locus_tag="CpC231_0279"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09773"
FT                   /db_xref="GOA:D9QE50"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE50"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599678.1"
FT                   /protein_id="ADL09773.1"
FT                   /translation="MSNADLHLIRRPRRLRSTPVMRELVAETTLRPADLILPMFVADGI
FT                   AEPREISSMPGVYQHTIPSLIEAVREAISVGIKCIDLFGVPLDADKDAQGSQSWAPDGI
FT                   LNRGIRALRQEFGNDVIIMADTCLDEFTDHGHCGVLDTDRFGEAVVDNDATIPLYQKMA
FT                   VAQAEAGAHMVSPSGMMDGQILAIRDALDAHGFQDVAIMAYSAKYASAFYGPFRDAVGS
FT                   SLDGDRRTYQQDPANCRESLMEVDLDIEEGADFVMVKPAMPYLDVLAEVASTSSVPVAA
FT                   YQVSGEYAMLHAAARNNWLDLERVMMESLISIKRAGADQILTYFAVDAAKKLQH"
FT   gene            290092..290673
FT                   /locus_tag="CPC231_01415"
FT                   /old_locus_tag="CpC231_0280"
FT   CDS_pept        290092..290673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01415"
FT                   /old_locus_tag="CpC231_0280"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09774"
FT                   /db_xref="GOA:D9QE51"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE51"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799983.1"
FT                   /protein_id="ADL09774.2"
FT                   /translation="MTNHQQRLERSPSQQTTPNAKRERPDAIRWAVRAWIFAICVEVVH
FT                   QIINIIVGFANKPELISRLKDSMKDENLSPEIMNVAASLSIVLAGLFAFIMLGIIAWLA
FT                   ALLYKSNKSATLARRILTYFSIYFGVRLVTVFLLTPSSPSVPVAVYAVDGCIQIGMGVA
FT                   AIVALIFKMRPESLIWTGEWETSRGKNGRA"
FT   gene            290660..293296
FT                   /locus_tag="CPC231_01420"
FT                   /old_locus_tag="CpC231_0281"
FT   CDS_pept        290660..293296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01420"
FT                   /old_locus_tag="CpC231_0281"
FT                   /product="HAD family hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09775"
FT                   /db_xref="GOA:D9QE52"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE52"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300440.1"
FT                   /protein_id="ADL09775.3"
FT                   /translation="MGAPSGSRDSQEGGVPARPLGTQEGLADAIEKAKRAAAQAGINTG
FT                   AFHAIDPEEVAAAAIHAGKTSFAFELKGLTSASSVAEVEEALGELEGVEAKIVYPSSMA
FT                   WVSASRTIDPMMFVDVFQRFGISATLTDSSLRRRLAWSDVEEGRYKRSRRRDRRVSRFG
FT                   SRVDEEERRFELARRAGFLERREDVSRKEPSTAVLFTARSLMTKTRLFTSALFTIPVVA
FT                   ISYSRDLQFDGWQWVLAVLSIPVVFYGAWPFHRATLGGARRGMSALDSASSVAILLAWL
FT                   WSLSMVLFTAVGDPGYRARPKWVAIDPTIFESGALFFDVACGMTLILLAGKLAARRARS
FT                   SLQDDLLKYKPNPASTVTVVSKKRKSGAVGKEDKAIQKLNVGDDVIVPAGELVPVDGIV
FT                   VGGGGTLDGTALGIGSFDVKVNDRVYAGCINGSKNLKVRVLQTGHRTWLAAINRWVVDA
FT                   NVHQNRSDAIATKAASMLVPVSFVIAATDFALWALITNNLNQAFATGLAVLGCVAPAAL
FT                   ATSASLAMRQGIEGAARRGTLIKSGETLRNVDEVDTVIFNRVGAISRPEMSVETVTADR
FT                   GENPDLVLRVAGALAMESGHPVSRALVRAAREARDASTDDSIPGWIEVSHSEVDEEGSF
FT                   RGHVELPVVNSDGEEELRSVEAVLWRPRNLSDLHGRLAAAAVSGSSPLVVRWKNKDRGV
FT                   ITLYNGAKDDAVDAVDALEAMGLETMMLSRDTYPVARRYGDMVGVSHVLAGVQPGRKPQ
FT                   TVRSVRSHGANIAMVGDESVEECYRVANVGIMISAMSGPQGALALEHPAADVVMLKPDV
FT                   APIPRLFHFARRLNRRIRGNLIFAWTYNLLAIVAAVAGVLHPMIAPLLMLGSSVIIEVR
FT                   SHWLRSM"
FT   gene            293430..294476
FT                   /gene="hemE"
FT                   /locus_tag="CPC231_01425"
FT                   /old_locus_tag="CpC231_0282"
FT   CDS_pept        293430..294476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="CPC231_01425"
FT                   /old_locus_tag="CpC231_0282"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09776"
FT                   /db_xref="GOA:D9QE53"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE53"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523029.1"
FT                   /protein_id="ADL09776.2"
FT                   /translation="MSQPFNAPILDAIQGKTPTRRPVWFMRQAGRSLPEYRKVREGIGM
FT                   LDSCFMPELLAEITLQPVRRHDVDAAILFSDIVVPLKAAGVKVEIIPGRGPVMDRAIQS
FT                   RADVDALPILEEDVLQVARGIEIIRDELTEQQTLIGFAGAPFTLASYLVEGGPSKNHEK
FT                   TKSMMHGDPETWHALMQRLVPTIVRFLRTQIDAGVQAMQFFDSWAGFLTERDYRNHVLP
FT                   YSTQILEEVADVPRIHFGVSTGELLATMSEAGSEVMGVDWRVPLDAAAERIHARSGAKV
FT                   LQGNLDPALLFAGDDVLKAEIERICMEADRAIAAGHATGHIFNLGHGVLPHTDPEAITR
FT                   AVELIHRF"
FT   gene            294544..295929
FT                   /locus_tag="CPC231_01430"
FT                   /old_locus_tag="CpC231_0283"
FT   CDS_pept        294544..295929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01430"
FT                   /old_locus_tag="CpC231_0283"
FT                   /product="protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09777"
FT                   /db_xref="GOA:D9QE54"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR004572"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE54"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241136.1"
FT                   /protein_id="ADL09777.1"
FT                   /translation="MRIAIIGAGLAGLTAAYEIHKLAPHADVEVFEATDRIGGKLFTVP
FT                   FASGPTDMGAEAYLVFREDTTEFFKELGLEESLRSPSGLPSLLYQGGSLHSMPSNTIMG
FT                   IPGTSEDLGNLVSEETRKRIDSEINAESIEWPQEISLGALLRERLGDDVVDHVVSTLQG
FT                   GVYSSTSDDLSVRATVPQLARALDKLKEEGKPVTITGAVQRLLSEREERNKKRGYTPSV
FT                   FASFAGGYAEMYEALAERSEAKIHIDAFITAVDKKPEGFVLKGAEGVFDKVLLTVPAPT
FT                   AALLLKNLVPEAAQQLKTIKLASSAVVGMKFDNSAGLPDNSGILVATNAQDVRAKAFTF
FT                   SSKKWPHLGERGGALVRASFGRFGEDAIARADEDELVDAALDDLQTITGFDGRAAGLSE
FT                   IFVQRWFGGLPVYGPGHLDTVAAIKKALAQVEGIDATGAWADGVGVPAVIDAAKAAAKR
FT                   ALA"
FT   gene            complement(295936..296772)
FT                   /locus_tag="CPC231_01435"
FT                   /old_locus_tag="CpC231_0284"
FT   CDS_pept        complement(295936..296772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01435"
FT                   /old_locus_tag="CpC231_0284"
FT                   /product="NAD-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09778"
FT                   /db_xref="GOA:D9QE55"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE55"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241137.1"
FT                   /protein_id="ADL09778.1"
FT                   /translation="MTIAFLGTGRMGTELALHLLKEHELVVWNRTPSKAERLVAAGATL
FT                   ASSPEEAVAAADIVVTSLFGPDTVRDVVITPRLIPDGVLWIDTTTVSPEDCIEFAHAVP
FT                   SYVAAPVVGTLGPARAGSLGVYVGGTDEQYRNTAAALVAPWADPERLVLVDAAPKAAVG
FT                   KLLANLALAVSAQGLKEALLLGDSSGLSPEETLTMLRSTGLAFIAGMKHPFVVGERPTA
FT                   PGDFTADAIAKDARLMLNTADQPLPAVASALKSLEEQQQAGHGDEDFSVMLTRRDS"
FT   gene            296859..298184
FT                   /gene="hemL"
FT                   /locus_tag="CPC231_01440"
FT                   /old_locus_tag="CpC231_0285"
FT   CDS_pept        296859..298184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="CPC231_01440"
FT                   /old_locus_tag="CpC231_0285"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09779"
FT                   /db_xref="GOA:D9QE56"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE56"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366441.1"
FT                   /protein_id="ADL09779.1"
FT                   /translation="MVRMTVIPTSSNVQRSRELFDQACKVTPGGVNSPVRAFGSVGGQA
FT                   RFIASAQGSKLYDVDGNEYVDLVCSWGPMLLGHAHPEIVEAVQKAAEKGLSFGAPTEAE
FT                   VRIANMIVERTSVEEVRMVNSGTEATMSAVRLARGFTGRPKIIKFDGCYHGHVDALLAS
FT                   AGSGVATFALPDSPGVTGASAADTIVVPYNDIEAVAQAFAENDGQIACIIAEAAAGNMG
FT                   TVAPRNDFNAKLKELAHAHGALLILDEVMTGFRTSYNGWFGVDHVAGDLTTFGKVISGG
FT                   LPAAAFGGRADIMKYLAPEGPVYQAGTLSGNPVAVAAGMKSLELATPEVYDIVRANADR
FT                   LAELLSSALEREGVAHHIQRAATMLSIRFAEGEGHNFDQMKSAETFRFSPFFHALMDNG
FT                   IYAPASVFETWFVSAALSDEDFEKIENALRPAAQAAAAANKY"
FT   gene            298193..298801
FT                   /locus_tag="CPC231_01445"
FT                   /old_locus_tag="CpC231_0286"
FT   CDS_pept        298193..298801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01445"
FT                   /old_locus_tag="CpC231_0286"
FT                   /product="histidine phosphatase family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09780"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE57"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241139.1"
FT                   /protein_id="ADL09780.1"
FT                   /translation="MSTTIVHLIRHGEVFNPERILYGRIPDYHLSSRGHSMAARTASSF
FT                   AGHDVSVLMSSPLERAQETAAPFAEKLGLEVRLDDRLLESGNRFEGLRVKGLRSQLWNP
FT                   VRWPLMANPLLPSWGEHYVDQRDRMMAVVEDARRAAEGHEAILVSHQLPIVCVQRHVQG
FT                   KPLAHNPAARQCNLASVSSLVFEGDQLVDYIYTEPAQEI"
FT   gene            298804..299388
FT                   /locus_tag="CPC231_01450"
FT                   /old_locus_tag="CpC231_0287"
FT   CDS_pept        298804..299388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01450"
FT                   /old_locus_tag="CpC231_0287"
FT                   /product="redoxin domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09781"
FT                   /db_xref="GOA:D9QE58"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE58"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241140.1"
FT                   /protein_id="ADL09781.1"
FT                   /translation="MKRTLAATMISSLLVLSACSSEDTAGTDAVAIGGTFQFHSPGGQT
FT                   EIFYEEADRAPVKNISGESLSSDAKISLDDYKDQVVVLNAWGQWCAPCRSESDDLQTVQ
FT                   EYLEKEQRGTVLGINVRDYSKQIAQDFVKDNGLTYPSLYDPPFKSAAQLGGVPAAVVPT
FT                   TIILDKQHRPAAVFLREITAKDVIDVVERIV"
FT   gene            299385..300191
FT                   /locus_tag="CPC231_01455"
FT                   /old_locus_tag="CpC231_0288"
FT   CDS_pept        299385..300191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01455"
FT                   /old_locus_tag="CpC231_0288"
FT                   /product="cytochrome c biogenesis protein CcdA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09782"
FT                   /db_xref="GOA:D9QE59"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE59"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241141.1"
FT                   /protein_id="ADL09782.1"
FT                   /translation="MTDVLASGIGEQIADVAATGPLLLGLAAAALAGLASFASPCVIPL
FT                   VPGYMSYLAGVVGAEMELGEQGPQVAKKGRWRVTGAALLFVLGFTVIFTLATATVFGAI
FT                   SALTLNAETLMRIGGVVTLLMGVVFLGWVPFLQEDKRMAPKRWSTWLGAPLLGGVFALG
FT                   WTPCLGPTLAAIISISAGTEGTTAARGVALILAYCVGLGFPFVAVALGSARAMHGIGVL
FT                   RRHSRTIQIVGGVALIAVGTALVSGTWGIFINWVRQWTVEYGATFI"
FT   gene            300205..301812
FT                   /locus_tag="CPC231_01460"
FT                   /old_locus_tag="CpC231_0289"
FT   CDS_pept        300205..301812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01460"
FT                   /old_locus_tag="CpC231_0289"
FT                   /product="cytochrome C biogenesis protein ResB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09783"
FT                   /db_xref="GOA:D9QE60"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE60"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522675.1"
FT                   /protein_id="ADL09783.1"
FT                   /translation="MSKRTRKLLSYPLKAWHWLTSMRTALALLFLLALASIPGALLPQR
FT                   SLNQSKVTEYIANNGRTAEIYDKLQLFDVFSSTWFTAIFALLFLSLIGCIIPRSWDHYK
FT                   AMKTPPVRAPKNLSRLPLHGEGSVEKPLSQVEEDIRAQLKGWKLAEYTPEEDRAGMRSF
FT                   SAERGYLREFFNLTFHLGLVGMLVAIAMGKLFFYEGQVIIVASDDKTKSTEFCNTATAN
FT                   YDSFRAGSLFDGTGLNPFCFIAHNFSADYLPNGQAKMFSSLVSYAAGEKIFNDTETWQQ
FT                   YTLKVNHPLRIAGDRVYLQGHGYAPTFSVTWPNGEKRTQTVQWQPTDLMNFLSDGVVRF
FT                   DPPAGMYKDAFEKRQNQLAIQGLFAPTASWEGENKALLTSRYPAMTNPAVAIDIYRGDN
FT                   GLDSGRGQNLFSLDSALIHSGQLQKLERVNLSVGQSVTLDNGTVVSFDGAEQFANYQIS
FT                   HDPAQLWVLFFTVIALCSLAGSLLIRRRRIWVRVRPVSSTVTCVETAGLARTDRAGWGR
FT                   EYERIHRRILGLPDPDED"
FT   gene            complement(301816..302577)
FT                   /locus_tag="CPC231_01465"
FT                   /old_locus_tag="CpC231_0290"
FT   CDS_pept        complement(301816..302577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01465"
FT                   /old_locus_tag="CpC231_0290"
FT                   /product="methyltransferase domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09784"
FT                   /db_xref="GOA:D9QE61"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE61"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241143.1"
FT                   /protein_id="ADL09784.1"
FT                   /translation="MTPQELLMAWHEQQTAFIEHRALRTRTLIEVLKARYGDAPISVLD
FT                   LACGPGSLGTEILQELPNATVVGVDRDPVLLRLGAETNQFGERLRFVDANLTDSAWVEQ
FT                   LPATNFDAVISATALHWFAPDQLSQLYQDLTRVVKPGAIFMNADHLLYDAHHNPVLASL
FT                   SETIREDFRARTVSSGVFTWEAWWDAAFQMPGWEKEADLWHQRWANKSATVKVDSTYHL
FT                   AALRSAGCSETGHLYQWLDDYLIYGIWPTAS"
FT   gene            complement(302597..303367)
FT                   /locus_tag="CPC231_01470"
FT                   /old_locus_tag="CpC231_0291"
FT   CDS_pept        complement(302597..303367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01470"
FT                   /old_locus_tag="CpC231_0291"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09785"
FT                   /db_xref="GOA:D9QE62"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE62"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300444.1"
FT                   /protein_id="ADL09785.1"
FT                   /translation="MITATDLNITFQGTPILQGVNLSAQGGHTIGIVGPNGSGKTTLLR
FT                   ALYKSLSPQSGRIEIDTEDLSSLTPRRIAQKVAVVAQERDSSLPLRVSDCVGLGRLAQS
FT                   TLLSYSNAHNHMIVASALEQVGLSGFGSRLISELSGGERQRVLIARAIAQQADHVLLDE
FT                   PTNHLDLAHQFAIMELVTTLRSTSVVVLHDLNLAARFCTEVIVLNHGMVVAQGKPDHVF
FT                   NAEMFAEVFGLHAQILQHRGSPQFLFSPLSSRAS"
FT   gene            complement(303374..304360)
FT                   /locus_tag="CPC231_01475"
FT                   /old_locus_tag="CpC231_0292"
FT   CDS_pept        complement(303374..304360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01475"
FT                   /old_locus_tag="CpC231_0292"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09786"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE63"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523030.1"
FT                   /protein_id="ADL09786.1"
FT                   /translation="MKKTTAQYLALVSVAALALTACGESAADKQAAHDKTAASEAKIQV
FT                   ASCDETLSFNKAPEKVLVMSETDISILHDLDVIDKVVAKAGAKRVEGISPSLEKAIANI
FT                   PTIAAGELDTGGAKVSTEAILELKPDLVIGFDTGADRQALKDAGIPLYSPDAFCPNASA
FT                   KKADWGLVNNEIDKLATIFDVKGKGEELKKSVQDKLKQQGSTQGDTSAVMLYITPGSDE
FT                   FYAYGNTSMVQPILEANGLKNVYADNPERVFDSSMEEILAKNPDRIVLLSESSDSDAAM
FT                   KTFLNFPGAKDLKAVQNNHVAHMPFILTDPPTTLSVEGASYLHNLIK"
FT   gene            complement(304409..305461)
FT                   /locus_tag="CPC231_01480"
FT                   /old_locus_tag="CpC231_0293"
FT   CDS_pept        complement(304409..305461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01480"
FT                   /old_locus_tag="CpC231_0293"
FT                   /product="iron chelate uptake ABC transporter family
FT                   permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09787"
FT                   /db_xref="GOA:D9QE64"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE64"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400967.1"
FT                   /protein_id="ADL09787.1"
FT                   /translation="MFISQGHQLTVQYTGQRTTITTLVLSIMVLFIPALSVCIGAAGVA
FT                   PSHVFGVILSHIPHVPVDISWDRATDAIIWHNRFPRVLLGLAVGAILGVSGVVFQAVIR
FT                   NSLAEPYVLGVSSGASTGAAFSLIILGLSSAWAMGFFAFAGSVIATCAVLIIAGRSSSP
FT                   LKLILSGLAIGFGAQAFTNFIIFTNGSPETNQAVMFWMLGSLGRARWQAVVATIIVAIF
FT                   LTLLMAIIGPLLDALASGDETARAVGVPPEITRLLVLIVVSAAVAIAVSSSGGIGFVGL
FT                   IVPHIMRIVSGYSHRMLVINTALASALFLVLADALARVLISPQELPIGVLTGLIGAPVL
FT                   AILIRRTTNV"
FT   gene            305701..306702
FT                   /gene="ccsB"
FT                   /locus_tag="CPC231_01485"
FT                   /old_locus_tag="CpC231_0294"
FT   CDS_pept        305701..306702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccsB"
FT                   /locus_tag="CPC231_01485"
FT                   /old_locus_tag="CpC231_0294"
FT                   /product="c-type cytochrome biogenesis protein CcsB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09788"
FT                   /db_xref="GOA:D9QE65"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE65"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241147.1"
FT                   /protein_id="ADL09788.1"
FT                   /translation="MNVNPNLASLSDMAFASSFVIYFIALVLSIVFYMKTRTFIDLERE
FT                   RVNERALVTVGSESDSTEGMGTELDSADDQISKVGASAEKFAGMTQMIVWLGVVVHAAS
FT                   VILRGLSASRFPFGNLYEYVLVISCFAVAIAAFFLQRREMRVLWPWVLTPILALLFFGG
FT                   TKLYADSAPVVPALQSFWFPIHVSTVSIGASIGMISGVASVLYLLRLYQEQGKEKGVLG
FT                   ALAKPLPSAKLLDAIAYRTAIITVPVFGLGIILGAIWAESAWGRFWGWDPKETVAFATW
FT                   ILYAAYLHARATSGWRDSRAAWINIVALCTMVFNLFFINMVVSGLHSYAGLN"
FT   gene            complement(306832..307137)
FT                   /locus_tag="CPC231_01490"
FT                   /old_locus_tag="CpC231_0295"
FT   CDS_pept        complement(306832..307137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01490"
FT                   /old_locus_tag="CpC231_0295"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09789"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE66"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366451.1"
FT                   /protein_id="ADL09789.1"
FT                   /translation="MKGSSVGRLILLLLLIAAIVLVWKAFGPKTWQKSAIPEPPRIKGP
FT                   DDDEEFLWRLERDQFKKRRAAEEAKRKAAEQKKREATEDTSHGDREKSQDDGTPSA"
FT   gene            307206..307541
FT                   /locus_tag="CPC231_01495"
FT                   /old_locus_tag="CpC231_0296"
FT   CDS_pept        307206..307541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01495"
FT                   /old_locus_tag="CpC231_0296"
FT                   /product="DUF4229 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09790"
FT                   /db_xref="GOA:D9QE67"
FT                   /db_xref="InterPro:IPR025323"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE67"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522106.1"
FT                   /protein_id="ADL09790.1"
FT                   /translation="MLNVSETAMSENSRPIVDPQVRTAARKAVIVYGIARCALFIVLTA
FT                   IIQGIAVAIGAPVPILISATLALILAMPLSMFVFKGIRVQATQAVALWSAQRKAEKDWV
FT                   KSELSSR"
FT   gene            complement(307527..308402)
FT                   /locus_tag="CPC231_01500"
FT                   /old_locus_tag="CpC231_0297"
FT   CDS_pept        complement(307527..308402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01500"
FT                   /old_locus_tag="CpC231_0297"
FT                   /product="1,4-dihydroxy-2-naphthoate polyprenyltransferase"
FT                   /EC_number="2.5.1.74"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09791"
FT                   /db_xref="GOA:D9QE68"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE68"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522107.1"
FT                   /protein_id="ADL09791.1"
FT                   /translation="MSKATFADWKEGARPHTWANAFAPVIIGSGAAAQAHGFSWWRALL
FT                   ALVVAWALIVGVNYANDYSDGIRGTDDDRTGPLRLTGSGLAQPEDVKRAAFLAFGVAAI
FT                   AGIALCLASAWWLIAVGALCILGAWFYTGGKNPYGYRGLGEVSVFVFFGLVAVLGTQFT
FT                   QLGRVTWVGFGCAVAVGAMSAGVNLVNNLRDIPTDSAAGKTTLAVILGDTATRRLYCVL
FT                   VAIPFAVSLAFFAVSPWAGIGIIALPLVIKAAQPVVKGRHAQDLIPVLGATGKSMAVWA
FT                   VATAIALAAG"
FT   gene            complement(308416..309543)
FT                   /locus_tag="CPC231_01505"
FT                   /old_locus_tag="CpC231_0298"
FT   CDS_pept        complement(308416..309543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01505"
FT                   /old_locus_tag="CpC231_0298"
FT                   /product="o-succinylbenzoate--CoA ligase"
FT                   /EC_number="6.2.1.26"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09792"
FT                   /db_xref="GOA:D9QE69"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE69"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655037.1"
FT                   /protein_id="ADL09792.1"
FT                   /translation="MHVLEPLVVPTHNPASILDRLEQAIVGQRSFLPLPSDDKDRAELL
FT                   RRTQRVGHPIDPDIALVMSTSGSTGIPKGAMLTAGNLVSSADATHQFLGGEAQWLLAMP
FT                   AHHIAGMQILVRSIIAGYDPIVVDVSRGFNVAAFAAAAASVEGERVYTSLTPLQLLKAM
FT                   DTLVGIEALRVFTAILVGGAPLRADDRRAAKELGINVVTTYGASETSGGCVYNGRPVPG
FT                   ATIRVINERIHLGGPMIAQGYRNIPDHHAFSQPGWFITSDAGILNDGILEVVGRLDNVI
FT                   DSGGLKIHPEVLERKLCDVPGVTAACVVGLPDRRFGHIIVAAYEGNAHPTTIISALDDL
FT                   PRWQLPKDIRRVESLPLIGPGKIDRRGVTALFTQQ"
FT   gene            complement(309606..310574)
FT                   /locus_tag="CPC231_01510"
FT                   /old_locus_tag="CpC231_0299"
FT   CDS_pept        complement(309606..310574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01510"
FT                   /old_locus_tag="CpC231_0299"
FT                   /product="1,4-dihydroxy-2-naphthoyl-CoA synthase"
FT                   /EC_number="4.1.3.36"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09793"
FT                   /db_xref="GOA:D9QE70"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE70"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_010189742.1"
FT                   /protein_id="ADL09793.2"
FT                   /translation="MDEQKTYSTDNPFDASQWETVAGFQDLTDITYHRHVGEGRENGIV
FT                   RIAFDRPEVRNAFRPHTVDELYRALDHARRTPDVGTVLLTGNGPSEKDGGWAFCSGGDQ
FT                   RIRGRSGYRYATEHAHDDATADESTVDTAREKVEGGRLHILEVQRLIRTMPKVVIAVVN
FT                   GWAAGGGHSLHVVCDMTIASRQEARFKQTDADVGSFDAGYGSAYLAKMVGQKFAREIFF
FT                   LGRTYDAETMQRMGAVNIVADHKNLEDEAIQMAREINGKSPTAQRMLKFAFNLTDDGLM
FT                   GQQVFAGEATRLAYMTDEAVEGKEAFLQKRAPDWNDFPYYY"
FT   gene            complement(310706..312128)
FT                   /pseudo
FT                   /locus_tag="CPC231_01515"
FT                   /old_locus_tag="CpC231_0300"
FT   CDS_pept        complement(310706..312128)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01515"
FT                   /old_locus_tag="CpC231_0300"
FT                   /product="transporter"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366456.1"
FT   gene            312432..313469
FT                   /locus_tag="CPC231_01520"
FT                   /old_locus_tag="CpC231_0302"
FT   CDS_pept        312432..313469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01520"
FT                   /old_locus_tag="CpC231_0302"
FT                   /product="o-succinylbenzoate synthase"
FT                   /EC_number="4.2.1.113"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09796"
FT                   /db_xref="GOA:D9QE73"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="InterPro:IPR041338"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE73"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655039.1"
FT                   /protein_id="ADL09796.1"
FT                   /translation="MTQAKPLSAWGATIDEVLERAHVVALPMRVPFRGVTTREALLFRG
FT                   PVGWGEFAPFSDYSPEESAYWLSSGLEMAYQGPPKAMRDCVEVNGTIPAVIPEQVPEVM
FT                   AHFDGCRTFKVKVAEKGHSLSDDVARVNAVREAMPSAIIRVDANRGWSVEQAFCAAKQL
FT                   SPLDYMEQPCATVAELIELRQRLIRAGLFVRVAADEAIRRAEDPYEVARAQAADVAVVK
FT                   AAPLGGPRKLLQIAEFMRARGLDITVASALDTGVGMNAGLAAVAALPKHTDDEDFDVPP
FT                   AAAGLATQRLFVEDITAPRQIVDGQLAVEMLSPDPDRLSEFSVKDSRRDAWLQRLQEAW
FT                   EFLER"
FT   gene            313533..315146
FT                   /locus_tag="CPC231_01525"
FT                   /old_locus_tag="CpC231_0303"
FT   CDS_pept        313533..315146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01525"
FT                   /old_locus_tag="CpC231_0303"
FT                   /product="2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid
FT                   synthase"
FT                   /EC_number="2.2.1.9"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09797"
FT                   /db_xref="GOA:D9QE74"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE74"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799996.1"
FT                   /protein_id="ADL09797.1"
FT                   /translation="MISSPQLARAVAAKLAHYLTDVVICPGSRNSPLSLELLARDDIRV
FT                   HTRIDERSAAFLALGMGRASGRHVGVVTTSGTAVASCLPAMVEAYHSHAPLAMISADRP
FT                   AHLHGTGANQTINQTGIFGVVPTTSVAALADVELIDAAFKRGQVHINVELDTPLVEDCL
FT                   PAPTTKGAKKAPIKGDFTDHGEVEIDLSRPTLVITGDEAWDVPGLEDVPTIAEPSAPAP
FT                   YHPVHPLATSIFAHEQVSAEGYVVNTKPEQVIVVGHPTLHRSVFDLIADPAIEVTVLTR
FT                   TDTITDPTHSAQKVATRIKTTGRPSEQWLKICEAASELAAEAVRDVLAQDFRFSGLHVA
FT                   AAVADTLATGDTLVLGASNPVRDASFVGLPFSAVDTYTPRGTAGIDGTVSQAIGVALTV
FT                   QARNPEEIRAARTVALMGDVTFLHDVGGLFTGPDSPQPENLTIVVANDSGGGIFETLEV
FT                   GSPQLRGSFERAFGTPHEIDIESIAAAYGVEYQLATDMQGLIEKLIDATDTAGFTLIEA
FT                   RTTRADRRAMHEALVKKVNM"
FT   gene            315143..315598
FT                   /locus_tag="CPC231_01530"
FT                   /old_locus_tag="CpC231_0304"
FT   CDS_pept        315143..315598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01530"
FT                   /old_locus_tag="CpC231_0304"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09798"
FT                   /db_xref="GOA:D9QE75"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE75"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241156.1"
FT                   /protein_id="ADL09798.2"
FT                   /translation="MSRLPHYPPASIRRRLHQAILALFVAATVGCISMVIGPALNDREI
FT                   SKAPGRTLAKVIDVGTFRSTVEYQDEEGVYHSPRGGLLYPTGLGKGQRVWVTYAKSNPD
FT                   LVKVQGRGWTLALIPALSTWVVSFMITMTLWWVVTLWYRKHANSDNR"
FT   gene            315576..316700
FT                   /locus_tag="CPC231_01535"
FT                   /old_locus_tag="CpC231_0305"
FT   CDS_pept        315576..316700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01535"
FT                   /old_locus_tag="CpC231_0305"
FT                   /product="glycosyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09799"
FT                   /db_xref="GOA:D9QE76"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE76"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910750.1"
FT                   /protein_id="ADL09799.3"
FT                   /translation="MRIAIIAESFLPAVNGVTNSVLRVLEHTQRCGHEAMVIAPGARDG
FT                   EEEIRSYCGASIYRVPTVMVPLINSLPIGIPLGLRELLQAFRPDVVHLASPYALAARGA
FT                   FVARNLGLPCVAVFQTDIAGFSHRYHLRCLERTSWAWTRAFHNAATLTLTLAPSRSAAA
FT                   ALNVHGIERVKPWGRGVDLELFHPDRRDEKLARNWGADNRIVVGYVGRLAAEKGVHRLV
FT                   DLACDNNIQLVIVGDGPERKNLEKQLPCAIFTGGLTGLDLARAYASFDVFVHPGEFETF
FT                   CQTIQEAKASGIPVISVAEGGPRDLIDNRSGVLLPLIHDSLVGLSQSVYEVFENREDLS
FT                   KTARQSVEDKSWARVCDQLFRYYQEAMITLDNRG"
FT   gene            316693..317391
FT                   /locus_tag="CPC231_01540"
FT                   /old_locus_tag="CpC231_0306"
FT   CDS_pept        316693..317391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01540"
FT                   /old_locus_tag="CpC231_0306"
FT                   /product="demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.163"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09800"
FT                   /db_xref="GOA:D9QE77"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE77"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241158.1"
FT                   /protein_id="ADL09800.1"
FT                   /translation="MAKASLEKNPFDVAKMFDGVGKNYDITNTVLSFGQDRKWREKTRE
FT                   RLNLQPGERVLDLAAGTAVSTVELGKSGAWVVACDFSQGMLAAGKERDVPKVVGDGMQL
FT                   PFADNSFDAVTISYGLRNVHDFQAALREMARVTKPGGRLTIAEFSTPNVPGFKTIYKEY
FT                   LTRLLPLIAKAVGTNPEAYEYLAESIRAWPEREELARAINNNGWSDAGWQNLSLGIVAL
FT                   HSAVKPEHNG"
FT   gene            complement(317471..318433)
FT                   /locus_tag="CPC231_01545"
FT                   /old_locus_tag="CpC231_0307"
FT   CDS_pept        complement(317471..318433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01545"
FT                   /old_locus_tag="CpC231_0307"
FT                   /product="L-lactate dehydrogenase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09801"
FT                   /db_xref="GOA:D9QE78"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE78"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910752.1"
FT                   /protein_id="ADL09801.1"
FT                   /translation="MHTSKLVVVGVGHVGSYVLSYAMDSGLYSEIATIDIKPGVSKGEA
FT                   IDQAQSTGVPGTAYTYCHPGDYSDCADADVIIVAAGGSILPDPDDPERMPDRAELAEIS
FT                   GAVIRDVMGNIAAHTKNAVVIFITNPLDAMVHIASTEFDYPTEKIFGTGTMLDSARMRW
FT                   IIGTELGIDPKSVTGYMMGEHGSTSVPILSRVNVQGLSWDELSAWRGSPLPTAPEIQER
FT                   VIKAAYDVLLAKGWTNAGVARSANELAKCVLLNEHAVHPICTPLDGEYGLHDVSMSVPT
FT                   LIGNAGALRKMPPTLNDWELEQIHKSAEFIRETVSRASS"
FT   gene            complement(318531..319808)
FT                   /locus_tag="CPC231_01550"
FT                   /old_locus_tag="CpC231_0308"
FT   CDS_pept        complement(318531..319808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01550"
FT                   /old_locus_tag="CpC231_0308"
FT                   /product="geranylgeranyl reductase family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09802"
FT                   /db_xref="GOA:D9QE79"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE79"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800000.1"
FT                   /protein_id="ADL09802.1"
FT                   /translation="MRVNNSVFSVDVLVVGAGPAGSTAAINAAQRGSTVLLIDAATFPR
FT                   DKTCGDGLTPRAVHQLEKIGIDVTSRYASKGLKLHGFGGSVTAPWPQSPFGTISSAMPR
FT                   SEFDELLLNTAQQHSNVQVWQGVTAVSVEASPASSQPTSEFPKAGRIRTVTLDDGRVVA
FT                   PAFVIVADGVRSTFGKLLGRQWHRGEVYGIAARSYCETPRGDDPWMHSHLELRDDTGTA
FT                   QPGYGWIFPLGNGTANVGCGALSTDARPAKVNTKKLLQSYAQQQSDEWGFGVPQRVTSA
FT                   LLPMGGAVSNVAGPNWMLIGDAAACVNPLNGEGIDYGMETAALAVSLMGTDADLSHAWP
FT                   ELLRSTYGEAFLLARTAARLLTYPRLLPIAGPLALRKPLGTVIMPAAARLMGNLVSDSD
FT                   RDLVARLWRFAGTGVSRWRRDSPLWS"
FT   gene            319963..320982
FT                   /locus_tag="CPC231_01555"
FT                   /old_locus_tag="CpC231_0309"
FT   CDS_pept        319963..320982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01555"
FT                   /old_locus_tag="CpC231_0309"
FT                   /product="polyprenyl synthetase family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09803"
FT                   /db_xref="GOA:D9QE80"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE80"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523037.1"
FT                   /protein_id="ADL09803.1"
FT                   /translation="MSNGAEGLSTSTGTRVDLGNPALNEDISAGMTRVEELLQKELCVG
FT                   EDFIVEKVKHLANAGGKRFRPMFALLASQYGDHPVSEDVIKAAVVVEMTHLATLYHDDV
FT                   MDEAAKRRGVESANARWNNSVAILAGDILLAHVSRLMADLGTDTVRHFSETFGDLVTGQ
FT                   MRETIGVGEGDPIEHYMAVIREKTGVLIASAGYLGALHSGATADHIEALRAYGAAIGMV
FT                   FQIVDDIIDIFSDSEDSGKTPGTDLREGVFTLPVLYALREQTPIGEELRATLTGPVTDD
FT                   TTVARVLDLLTQSTGRDRALADVHHYLNEAEAQLELLPQNATTEALRNLARFTVQRVG"
FT   gene            321062..321146
FT                   /locus_tag="CPC231_01560"
FT                   /old_locus_tag="CpC231_t13"
FT   tRNA            321062..321146
FT                   /locus_tag="CPC231_01560"
FT                   /old_locus_tag="CpC231_t13"
FT                   /product="tRNA-Tyr"
FT                   /anticodon="(pos:321096..321098,aa:Tyr,seq:gta)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            321449..321521
FT                   /locus_tag="CPC231_01565"
FT                   /old_locus_tag="CpC231_t14"
FT   tRNA            321449..321521
FT                   /locus_tag="CPC231_01565"
FT                   /old_locus_tag="CpC231_t14"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:321482..321484,aa:Thr,seq:ggt)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            321560..321631
FT                   /locus_tag="CPC231_01570"
FT                   /old_locus_tag="CpC231_t15"
FT   tRNA            321560..321631
FT                   /locus_tag="CPC231_01570"
FT                   /old_locus_tag="CpC231_t15"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:321592..321594,aa:Met,seq:cat)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            321759..321831
FT                   /locus_tag="CPC231_01575"
FT                   /old_locus_tag="CpC231_t16"
FT   tRNA            321759..321831
FT                   /locus_tag="CPC231_01575"
FT                   /old_locus_tag="CpC231_t16"
FT                   /product="tRNA-Trp"
FT                   /anticodon="(pos:321792..321794,aa:Trp,seq:cca)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            322157..322483
FT                   /gene="secE"
FT                   /locus_tag="CPC231_01580"
FT                   /old_locus_tag="CpC231_0310"
FT   CDS_pept        322157..322483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="CPC231_01580"
FT                   /old_locus_tag="CpC231_0310"
FT                   /product="preprotein translocase subunit SecE"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09804"
FT                   /db_xref="GOA:D9QE81"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE81"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800001.1"
FT                   /protein_id="ADL09804.1"
FT                   /translation="MTEQQPEKVGAASRPTGKRQLAGVNTTSTSSYEAKKVAPAGDSEG
FT                   KKNNKVVAFVPEVASEMKKVIWPTAKQMINYTLIVFAFLILMTALVAGVDFVAGLGVEK
FT                   VLTR"
FT   gene            322602..323432
FT                   /gene="nusG"
FT                   /locus_tag="CPC231_01585"
FT                   /old_locus_tag="CpC231_0311"
FT   CDS_pept        322602..323432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="CPC231_01585"
FT                   /old_locus_tag="CpC231_0311"
FT                   /product="transcription termination/antitermination protein
FT                   NusG"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09805"
FT                   /db_xref="GOA:D9QE82"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE82"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525303.1"
FT                   /protein_id="ADL09805.1"
FT                   /translation="MSDENNSGSFAEAFDDAVEATIAAETEAAEAGVELDEAVEQPVQE
FT                   VDAEAALAGAVEDGDAEYKARLRKYTRELKKLPGSWYIIQCYSGYENKVKTNLDMRAQT
FT                   LEVEDSIFDVVVPIEQAVELRDGKRKLVKRKLLPGYVLVRMDINDRSWSVVRDTPGVTS
FT                   FVGNEGNATPVKHRDVAKFLMPQESVAGDGGESNAVNAEGEKVVAMPGASSKPKVEVDF
FT                   QVGEAVTILSGALASVSATISAIDTENNKLQALVSIFGRETPVELNFDQVEKVS"
FT   gene            323729..324160
FT                   /gene="rplK"
FT                   /locus_tag="CPC231_01590"
FT                   /old_locus_tag="CpC231_0312"
FT   CDS_pept        323729..324160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="CPC231_01590"
FT                   /old_locus_tag="CpC231_0312"
FT                   /product="50S ribosomal protein L11"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09806"
FT                   /db_xref="GOA:D9QE83"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE83"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366465.1"
FT                   /protein_id="ADL09806.1"
FT                   /translation="MAPKKKVTGLIKLQIQAGQANPAPPVGPALGAHGVNIMEFCKAYN
FT                   AATENQRGSVVPVEITVYEDRSFEFKLKTPPAAKLLLKAAGLQKGSGVPHTQKVGKVTM
FT                   EQVREIAQTKLEDLNANDIDNAARIIAGTARSMGIVVED"
FT   gene            324239..324949
FT                   /gene="rplA"
FT                   /locus_tag="CPC231_01595"
FT                   /old_locus_tag="CpC231_0313"
FT   CDS_pept        324239..324949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="CPC231_01595"
FT                   /old_locus_tag="CpC231_0313"
FT                   /product="50S ribosomal protein L1"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09807"
FT                   /db_xref="GOA:D9QE84"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE84"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241165.1"
FT                   /protein_id="ADL09807.1"
FT                   /translation="MGNKKSKAYRAAAEKIDKGRLYTPLKAAELVKETSSKNYDATIDV
FT                   AIRLGVDPRKADQLVRGTVSLPNGTGKTVRVAVFAEGEKATEAEAAGADIVGTTELIEQ
FT                   ITAGTINFDVAIATPDQMAKVGRVARVLGPRGLMPNPKTGTVTTDVAKAIADVKGGKIS
FT                   FRVDKAANLHAVIGKASFDAKALAENYGALLDEINRIKPSSSKGIYVKKVTLASTSGPG
FT                   VPVDTSIQKNYTAE"
FT   gene            325058..326394
FT                   /pseudo
FT                   /locus_tag="CPC231_01600"
FT                   /old_locus_tag="CpC231_0314"
FT   CDS_pept        325058..326394
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01600"
FT                   /old_locus_tag="CpC231_0314"
FT                   /product="biotin transporter BioY"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525304.1"
FT   gene            326434..327735
FT                   /locus_tag="CPC231_01605"
FT                   /old_locus_tag="CpC231_0315"
FT   CDS_pept        326434..327735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01605"
FT                   /old_locus_tag="CpC231_0315"
FT                   /product="aminopeptidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09808"
FT                   /db_xref="GOA:D9QE85"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE85"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523039.1"
FT                   /protein_id="ADL09808.1"
FT                   /translation="MTELTMNSVSAINTELLKDPTLRLARNAVAVSSATKVALNREAVR
FT                   SLDTSVSTKVDSWTVANQKKSGRCWIFAGLNSLRGAIMKETAIKDFELSQTYIHFWDKV
FT                   EKANYFLCAMDELRDRDLTDRTVEKLLHDPIDDGGQWNMFVALVQKYGVVPQYAMPETF
FT                   SSSNTYAMNRDLASVLRRGALRIRDGVPGAREEALESAFKVITTHLGVPPETFQWQYRT
FT                   KDDDFVREGTLTPLDFAQRYLPDDLGDYVCVVNDPRNAFGELYTVEYLGNVVGAPPVTY
FT                   VNAPIEVLRDAVRDSLIDATPVWFGCDTEVQAYSDAGLWDAHLFDYEGLYGVNFDMSKT
FT                   QRLLTGDSLMTHAMVFTGMDLAEDGTTVNRWRVENSWGTEKADKGFWTMSDSWFEEYVF
FT                   EVAVPASRLPEEYRQALTKTPHVLPAWDPMGALA"
FT   gene            327861..328934
FT                   /locus_tag="CPC231_01610"
FT                   /old_locus_tag="CpC231_0316"
FT   CDS_pept        327861..328934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01610"
FT                   /old_locus_tag="CpC231_0316"
FT                   /product="alkene reductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09809"
FT                   /db_xref="GOA:D9QE86"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE86"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241169.1"
FT                   /protein_id="ADL09809.1"
FT                   /translation="MTSLFTSAQAGALNLRNRITMAALTRLRAGEDGVPGALHAEYYAQ
FT                   RASAGLIVTEGTYPTLRGRGFSGQPGIANSAQQEGWRKVAEAVHTAGGSVVMQVMHAGR
FT                   MSHESMNGGVLPEAPSAVASGTQMRTPAGKIDLPVPHALEAEELERVKQEFVAASRRAV
FT                   DAGLDGVELHGANGYLLHEFLSPSSNVRTDEFGGTPENRARFVIQVVQAVAEEIGAHRV
FT                   GLRISPEHNIQGVLETDREETLAKYRVLLNEIRSLELAYLSILHADYRSDFVHQLAEAF
FT                   GGFVILNSGFSTYTEYAEAVGIVESGYADAVAVGRELIANPDLVRRWQEGIELNVPDPD
FT                   TFYVGGPKGYTDYSFAE"
FT   gene            329268..329783
FT                   /gene="rplJ"
FT                   /locus_tag="CPC231_01615"
FT                   /old_locus_tag="CpC231_0317"
FT   CDS_pept        329268..329783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="CPC231_01615"
FT                   /old_locus_tag="CpC231_0317"
FT                   /product="50S ribosomal protein L10"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09810"
FT                   /db_xref="GOA:D9QE87"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE87"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599730.1"
FT                   /protein_id="ADL09810.1"
FT                   /translation="MANPKNVSSLAELKERFADTDSIVITEYRGLTVAQITELRRSLGA
FT                   DVQYSVAKNTLLKLAAKEAGVEGLDDLLSGPTAIAFIKGEAVDAAKAMKKFASNNKAFV
FT                   VKGGYMDGDALNADQVNAIAELDNRETTLAKLAGAMKGNLAKAAGLFNAPASQVARLGA
FT                   ALQEKKEA"
FT   gene            329862..330245
FT                   /gene="rplL"
FT                   /locus_tag="CPC231_01620"
FT                   /old_locus_tag="CpC231_0318"
FT   CDS_pept        329862..330245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="CPC231_01620"
FT                   /old_locus_tag="CpC231_0318"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09811"
FT                   /db_xref="GOA:D9QE88"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE88"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_006770269.1"
FT                   /protein_id="ADL09811.1"
FT                   /translation="MAKLTKDELIEAFKEMTLIELSEFVKEFEEVFEVTAAAPVAVAAP
FT                   VAAGAEAAAEEKTEFDVVLEDAGAKKIGVIKAVREIVSGLGLKEAKELVESAPKAIIEA
FT                   ASKDDAEAAKAKLEEAGAKVTLK"
FT   gene            330580..331533
FT                   /locus_tag="CPC231_01625"
FT                   /old_locus_tag="CpC231_0319"
FT   CDS_pept        330580..331533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01625"
FT                   /old_locus_tag="CpC231_0319"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09812"
FT                   /db_xref="GOA:D9QE89"
FT                   /db_xref="InterPro:IPR022435"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE89"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835911.1"
FT                   /protein_id="ADL09812.1"
FT                   /translation="MFTRPLRSSRTSRIAAASAVVLVGLSASFVPTAWAEDLELDSGHI
FT                   DVFNVTADGGNLKLDLKEDVTGSHVLRDPDSVTLRVKEEAWTDKTAQVPEVGTSGYYLP
FT                   QTQDPNLIWPGWDTNGVRSGGFGEVDINFVKVSGPGQIYAFQTGSFGGNTPILANNGFE
FT                   VRSGEMITQQEPAHVHTNWVFTAPGTYTMCVQATADGASSNVARYVWSVGNGGPNTVAS
FT                   CDGEGEAVAVAARSGNDDRKNRSSSTSSSRSTSRATTSSKPTSSKPAPAAAPAKRNSLP
FT                   ETGPSYMTAAFLVLGVGLAVFGAGTVRLVKAITRNK"
FT   gene            331542..333167
FT                   /locus_tag="CPC231_01630"
FT                   /old_locus_tag="CpC231_0320"
FT   CDS_pept        331542..333167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01630"
FT                   /old_locus_tag="CpC231_0320"
FT                   /product="anchored repeat ABC transporter,
FT                   substrate-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09813"
FT                   /db_xref="GOA:D9QE90"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="InterPro:IPR022434"
FT                   /db_xref="InterPro:IPR022435"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE90"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241173.1"
FT                   /protein_id="ADL09813.1"
FT                   /translation="MYSKTILSAYQRSVGAGALVACAFLVAACGTDTRDLPSRVDGITD
FT                   VVASTQIVADIARNVAGDRARVTALMPRGADPHTYEPSLRDVRNVANADVIFTNGLLLE
FT                   QQSVLRAIDNAVVAPAKVVALGEQSTKHGAHLLQLVEDVTLDSVWLGMRVEGTGAQLGA
FT                   NSHSEINIHVTGVRGIDGSEAPGDAAAYLTTAFGKPEVYFNSRDGFHPERGYDGDTITL
FT                   PAAAHTHVSWAFSKPGVYVIDIEAELVTERGARPIPVGASSITMAVGVRGESALPGTSA
FT                   TVINQGHQDVSINLNSKKIEIQGDSANGKDIATVYDSASTVIEVPNNTLQKIPAGSQFR
FT                   FLGTPGDEVYVLPQAVLGKHVHGEVDPHLWHDVDNVIAFVKTIRDELISADPQGAREYT
FT                   TNADAYIDQLGKVHQEVRDAIAAIPEEHRHLVTTHDGYSYLAHAYGIDVAGFVTPNPGV
FT                   EPSARDLIALTNTLKNLHVPAVFLEPQLAVASTDLLETAKRLNIRVCPIRGDSFDEDVT
FT                   TYVDLMRANAASLQQCLGDRRDTS"
FT   gene            333259..334293
FT                   /locus_tag="CPC231_01635"
FT                   /old_locus_tag="CpC231_0321"
FT   CDS_pept        333259..334293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01635"
FT                   /old_locus_tag="CpC231_0321"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09814"
FT                   /db_xref="GOA:D9QE91"
FT                   /db_xref="InterPro:IPR022435"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE91"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523041.1"
FT                   /protein_id="ADL09814.1"
FT                   /translation="MSTNLKFRIPVACLSKARVGVLATSMVIASSIAVPAAHIAFPAAA
FT                   LAQTQDDPSLEQTVTDSEDVVPLGTQKVFDHGHADLGPVVDSDSGETRFLVRDDSEFPP
FT                   KWRHLSDTIFLVDDSAKQTLPEEAQSFDFTGAQPGSQVWVIPQSEVHGVPWLGWNTQNP
FT                   TLTKSADRGITLEFAGHEGDGQFSLFLQNGGFAEPQVLWTSAKKESQPMWVDLNTHTHA
FT                   NWVFTQPGVHKVAVRALIPLLDGTTKEFTEVLTFAVGKDALEEAKSAQWEGEYLPSSTK
FT                   GEEKGASASSTAKGAPASEKSSSVAVWIFVAMILIALGFVVAGLRMRASAKKRKETAAQ
FT                   NGQR"
FT   gene            334290..335090
FT                   /locus_tag="CPC231_01640"
FT                   /old_locus_tag="CpC231_0322"
FT   CDS_pept        334290..335090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01640"
FT                   /old_locus_tag="CpC231_0322"
FT                   /product="anchored repeat-type ABC transporter ATP-binding
FT                   subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09815"
FT                   /db_xref="GOA:D9QE92"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022508"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE92"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300454.1"
FT                   /protein_id="ADL09815.2"
FT                   /translation="MSKAASVIEVRGLGVSLGGRTVMKDINFDVRAGEFIGLIGPNGAG
FT                   KTTMMRAILGLIPTDSGRVTISGVQGRGVRNHAGYVPQRHEFAWDYPIDVHGLVMNGRT
FT                   GLIGWFKRAGQKDFDAVHRALDMVGMAHLSDRPIGELSGGQKQRVLIARALSIAPKVLF
FT                   LDEPFTGLDMPSAESLLELFHRLAQEGTAIVMSTHNLVEAISSCDRILLFNGQIVADAA
FT                   PEDLERPQPWIETFSVSEHSPLLVSVGALRREDARSAQKGMPAP"
FT   gene            335087..335968
FT                   /locus_tag="CPC231_01645"
FT                   /old_locus_tag="CpC231_0323"
FT   CDS_pept        335087..335968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01645"
FT                   /old_locus_tag="CpC231_0323"
FT                   /product="anchored repeat-type ABC transporter permease
FT                   subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09816"
FT                   /db_xref="GOA:D9QE93"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR022392"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE93"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800009.1"
FT                   /protein_id="ADL09816.1"
FT                   /translation="MISLVEFFSDLSNPALAFLPKALLISVISSIVCGVVGTHVVLRGM
FT                   AFVGDAVAHAVFPGIAIAFVLQGSVLLGGAVAGAVVALLIAMFSQRRRVKEDTVIGIFF
FT                   AAAFASGVVFISQVDGYTASLTSFLFGSITGVSTEDIILTAVVGLVVIVLLALLAPQFT
FT                   AVTLDRETARAMNLPTMLLDVLLYVAVTAAVVISVQTIGNILVLALLVTPAATARMLTD
FT                   KFSVMSAIAAGVGTCSSLVGVYLSWALDLPTGATIVLVATAFFLLSWCLSPRRGLFKRR
FT                   ISADNSQGAVFS"
FT   gene            335965..337926
FT                   /locus_tag="CPC231_01650"
FT                   /old_locus_tag="CpC231_0324"
FT   CDS_pept        335965..337926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01650"
FT                   /old_locus_tag="CpC231_0324"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09817"
FT                   /db_xref="GOA:D9QE94"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE94"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800010.1"
FT                   /protein_id="ADL09817.1"
FT                   /translation="MRKQRITTRIGRPLVGVGLAAALCGLQNPLGLAQEAADPEPTAAL
FT                   ESNSETDKNIAHDFESIRKKINSFTLPIGSVAPSDKEPTLKPSESTEDLPEEPETLEGG
FT                   SEEESELLPETLEKKLIKEGKKLEASDRDNSKLNDQEVRSLWEKLIQKTKAPQKVLRKG
FT                   DMSITIPGQKTGEKHDAQNVASLVVAKEEKDVLTTNTEVPQTYASGEALLAIGDAARVP
FT                   GALLGLKEKKDLAPVWYLPQEKDANPDAPSVGFNFEQVSATKKITVSLTDYHGPGRMVT
FT                   AEMGEEKAETAFDSQDLEQAWEYEGGASYRQAFAFTEPGAYTATFKFLVEDQESQGKTA
FT                   SQEYSFNTTFLVGSVKEEKVTPLKEIVEKSVNKKPLKEKTKETDATETERKTNKDNKKE
FT                   QSKAPGSQEPQTSVPKTPETDVPQKTPEKDPENVEPETKHPESKEPRAEEHAPSVPSPI
FT                   VPVDLKGLAKEIRELDRELNAMSRQTDSLFKAINANEPERKQEQRRPASNASGRTETGG
FT                   SEQGSGNQNAPAPVRSSSGGSSGRGSNAAKPNKPRNSAASGSSSAKSSDKNKESSKDKK
FT                   KSAKKSTEKKASAKSAKKTTEGKTDEAQGASNEKIAATGESMRKRGWWTGFLFGLGAMA
FT                   MLGGVVFFTQARNIAKRK"
FT   gene            338031..338972
FT                   /locus_tag="CPC231_01655"
FT                   /old_locus_tag="CpC231_0325"
FT   CDS_pept        338031..338972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01655"
FT                   /old_locus_tag="CpC231_0325"
FT                   /product="DUF3068 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09818"
FT                   /db_xref="GOA:D9QE95"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE95"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835917.1"
FT                   /protein_id="ADL09818.1"
FT                   /translation="MLPRSRILAVLGLGLGLAFIMWGVLAPRFLISDARLPLNLSHTTL
FT                   TLRDEKATTRVVGKDLVVQAPVTRQFHMEILPPSDNVNATVRIGVTDMRESLQKDLDRL
FT                   INATIWSYSIDRLSGAATSQATVADQLASPTRSVDIDGQWLKFPTNAEKTTYEVFDVTL
FT                   RKTLPAVFAEEATKEGRTLYRYRQEIQPTNVAQLYQSVFNTTTLGNGEDAAPGYLFHSG
FT                   TRDWWVDQKTGLIVDVEEKIDDYFGDAEGAKHEDVLTFNGKISEEQVSELLHQASSVSD
FT                   GKIVRVINYVVLAVGVILTIVGAVGAFGPRKR"
FT   gene            339217..342699
FT                   /locus_tag="CPC231_01660"
FT                   /old_locus_tag="CpC231_0326"
FT   CDS_pept        339217..342699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01660"
FT                   /old_locus_tag="CpC231_0326"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09819"
FT                   /db_xref="GOA:D9QE96"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE96"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599733.1"
FT                   /protein_id="ADL09819.2"
FT                   /translation="MAVSRQTKSVADIPGAPERFSFAKITEPIEVPGLLDIQLDSFAWL
FT                   IGTPEWRARQQEELGESVRITSGLEEILEELSPIQDYSGNMSLSLSEPRFEDMKNTIDE
FT                   CKDKDINYSAPLYVTAEFINNETQEIKSQTVFIGDFPMMTDKGTFIVNGTERVVVSQLV
FT                   RSPGVYFDQTIDKSTERPLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLK
FT                   ALGWTTEQITERFGFSEIMMSTLESDGVANTDEALLEIYRKQRPGEQPTRDLAQSLLDN
FT                   AFFRAKRYDLAKVGRYKVNRKLGLGGDNEGLMTLTEQDIATTLEYLVRLHAGESTMVAP
FT                   NGDVIPVDTDDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDAESITPTSL
FT                   INVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVH
FT                   ASHYGRMCPIETPEGPNIGLIGSLASYARVNSFGFIETPYRKVENGVLTDQIDYLTADE
FT                   EDRFVVGQAHVEVDAQGKITADSVTVRVKNGDIQVVAPESVDYLDVSPRQMVSVATAMI
FT                   PFLEHDDANRALMGANMQRQAVPLVRSEAPFVGTGMERRAAYDAGDLIINKKAGAVENV
FT                   SADFITVMADDGTRETYMLRKFERTNQGTCYNQIPLVNLGDRVEAGQVLADGPGTHNGE
FT                   MSLGRNLLVAFMPWEGHNYEDAIILNQRVVEEDILTSIHIEEHEIDARDTKLGAEEITR
FT                   EIPNVSEDVLKDLDERGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAR
FT                   EVRDTSMKVPHGETGKVIGVRRFSREDDDDLAPGVNEMIRVYVAQKRKIQDGDKLAGRH
FT                   GNKGVVGKILPQEDMPFMPDGTPVDIILNTHGVPRRMNIGQVLEVHLGWLAAAGWKIDP
FT                   EDPANAELLKTLPEDLYDVPAGSLTATPVFDGATNEEVAGLLTNSRPNRDGDVMVDANG
FT                   KAQLFDGRSGEPFPYPVSVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGG
FT                   QRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVL
FT                   LKELQSLCLNVEVLSADGTPMELSGSDDDEFDQAGASLGINLSRDERSDADIA"
FT   gene            342805..346815
FT                   /locus_tag="CPC231_01665"
FT                   /old_locus_tag="CpC231_0327"
FT   CDS_pept        342805..346815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01665"
FT                   /old_locus_tag="CpC231_0327"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09820"
FT                   /db_xref="GOA:D9QE97"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE97"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558579.1"
FT                   /protein_id="ADL09820.2"
FT                   /translation="MIDVNFFDELRIGLATADDIRRWSKGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPTRDWECACGKYKRVRYKGIICERCGVEVTKSKVRRERMGHIELAAPVTHI
FT                   WYFKGVPSRLGYLLDLAPKDLERIIYFAANIITGVDEEARHSDQTTLEAEMLLEKKDVE
FT                   ADAESEIAERAQKLEEDLAELEAAGAKADARNKVQKAADKEMQHIRERAEREIDRLEEI
FT                   WQTFIKLAPKQMIIDETIYEELVDRYEDYFTGGMGAEAIQTLIRNFDLDAEAEELREII
FT                   NNGKGQKKMRALKRLKVVAAFQRSGNDPAGMVLDCIPVIPPELRPMVQLDGGRFATSDL
FT                   NDLYRRVINRNNRLKRMIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPL
FT                   KSLSDLLKGKQGRFRQNLLGKRVDYSGRSVIIVGPQLKLHECGLPKLMALELFKPFVMK
FT                   RLVENDYAQNIKSAKRMVERQRPEVWDVLEEAISEHPVMLNRAPTLHRLGIQAFEPKLV
FT                   EGKAIQLHPLACEAFNADFDGDQMAVHLPLSAEAQAEARILMLASNNILSPASGKPLAM
FT                   PRLDMVTGLYYLTMDKTEGEIGGQGAYQPATEDGPATGVYSSYAEALMARDRGVLGLQA
FT                   KIRVRISHLRPPVEVEAEQFPEGWEQGQTWLADTTLGRIMFNELLPWNYPYLEGVMVRK
FT                   GGGSNKILLGDVINDLAATYPMITVAQTMDKMKDAGFYWATRSGVTITMSDVLVLPNKE
FT                   EILDRYEAEAAKIERKYWEQGALTERERYDRLVELWKEATDEVGNAVEKLYPDDNPIPM
FT                   IVKSGAAGNMRQIWTLAGMKGMVVNSKGDYITRPIKTSFREGLSVLEYFNNSHGSRKGL
FT                   ADTALRTADSGYLTRRLVDVAQDVIVREDDCGTKQGIRVPVAVEVKDAQGNVTGYTGHS
FT                   LIETSVAGRVASVDIKDSEGNVLVPAGENLTDQLIEKLIAAGVAEVKVRSVLTCQTPTG
FT                   VCAKCYGKSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGGDITGGLPRVQ
FT                   ELFEARVPKNRAPIASVAGTVHLEDEGNFYTLTINPDDGSDVVVYEKLSKRQGLATVRV
FT                   PMESNPGAMIERTLSEGDHVNVGDRLLRGPADPHDVLEVLGRRGVEQHLVDEVQDVYRA
FT                   QGVAIHDKHIEIIIRQMLRRGTVIESGATEFLPGTLVDLSEAKAANAEAIAAGGHPAEL
FT                   RSEIMGITKASLATESWLSAASFQETTRVLTDAAINKRSDKLIGLKENVIIGKLIPAGT
FT                   GISRYRNISVKPTEAARNAAYSIPTYGDSIYGDDSYGEFTGASVPLDEAYDL"
FT   gene            346966..348237
FT                   /locus_tag="CPC231_01670"
FT                   /old_locus_tag="CpC231_0328"
FT   CDS_pept        346966..348237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01670"
FT                   /old_locus_tag="CpC231_0328"
FT                   /product="histidine kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09821"
FT                   /db_xref="GOA:D9QE98"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE98"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400977.1"
FT                   /protein_id="ADL09821.2"
FT                   /translation="MFIMKYFSALTRRIGAHGWIWDHGFWLQLITQILVGGFLFLMAVQ
FT                   NMMRPEGPHSALVYHSVVFILLWIGGGALFIGLLVQRARKILGLGIVIAALLLLALGPP
FT                   LVAPLGYVVVCYQSWFISAYIQRHRWAWGIALVFGSAIGLTLIPLSNALRGKAFLTSHA
FT                   VKEPNFWVGGAGVLIIIIISISLWWQIGLNTKRKNQALEELRAKAELAALAERNRIARE
FT                   MHDIVAHSLTVVIAQADGGRYAGKKDPMIAIEALETISSVGRDALSQMRGLLTVLREAT
FT                   GEKDEREINATPGFAEIGRLIDEACSAGLQVNFSVYGEPVAVDESRGLTVFRVIQESLT
FT                   NVLKHAGKTVVDVTLDWGVPKDKTLHISVDNAHGEALVNYKSDSVGRGLSGIKERALLH
FT                   GGKATWGASLSNAGGWRVNVEIPL"
FT   gene            348251..348955
FT                   /locus_tag="CPC231_01675"
FT                   /old_locus_tag="CpC231_0329"
FT   CDS_pept        348251..348955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01675"
FT                   /old_locus_tag="CpC231_0329"
FT                   /product="response regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09822"
FT                   /db_xref="GOA:D9QE99"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D9QE99"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366481.1"
FT                   /protein_id="ADL09822.1"
FT                   /translation="MINVGLVDDQQLVRAGFNMVLSSQDDIQIAWEANNGAEALERIEV
FT                   EPVDVVLMDVQMPIMDGISATKELVTRGLMGPNDEPLRVIILTTFDSENYVMEAVENGA
FT                   SGFLLKDTAPEELIEAVRSVGEQSAVISPAATAKLFRRIRSGQTDKKPDGLKHINEDLI
FT                   EPLTPRELEILELIAMGKSNAEIAAELFISLPTVKTHVGRVLTKTGSRDRVHAVLFAFK
FT                   RGVVTQDALLDN"
FT   gene            349095..349340
FT                   /locus_tag="CPC231_01680"
FT                   /old_locus_tag="CpC231_0330"
FT   CDS_pept        349095..349340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01680"
FT                   /old_locus_tag="CpC231_0330"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09823"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEA0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241183.1"
FT                   /protein_id="ADL09823.2"
FT                   /translation="MHTIFSLCTICFDLLKKLNKRVSVIPYAFYPYLGRFLSKRIGLEI
FT                   EKFWQRIYIVWLVLISRIMMLGKAVLLGEEEQYCAQ"
FT   gene            349445..350435
FT                   /pseudo
FT                   /locus_tag="CPC231_01685"
FT                   /old_locus_tag="CpC231_0331"
FT   CDS_pept        349445..350435
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01685"
FT                   /old_locus_tag="CpC231_0331"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241184.1"
FT   gene            350474..351235
FT                   /locus_tag="CPC231_01690"
FT                   /old_locus_tag="CpC231_0332"
FT   CDS_pept        350474..351235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01690"
FT                   /old_locus_tag="CpC231_0332"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09824"
FT                   /db_xref="GOA:D9QEA1"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEA1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800016.1"
FT                   /protein_id="ADL09824.1"
FT                   /translation="MINALRSEITKLLTLRSTWVWAILLTGSLYGPVVLIGLFSGEVSD
FT                   YDWGFALPGAMIFVMLAVSFSASAMAGEFNDRMHAQAFLTQPRRSLWFNARTLVISGFL
FT                   LINYLVGVGLIYLVFLVFPKITLVNEKTVLILVDGVLFLVFSFIAIGVAALTRNRVAAM
FT                   AVPLAWFLAIERLITVAASQIAAFMPLWLVTPGERVSQLAKYGKDNAEFSSIGWDFMDV
FT                   QPLGYNIGIIVAWTVVSLLLGLWVNAKRDVR"
FT   gene            351357..352082
FT                   /locus_tag="CPC231_01695"
FT                   /old_locus_tag="CpC231_0333"
FT   CDS_pept        351357..352082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01695"
FT                   /old_locus_tag="CpC231_0333"
FT                   /product="TIGR03943 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09825"
FT                   /db_xref="GOA:D9QEA2"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEA2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400979.1"
FT                   /protein_id="ADL09825.1"
FT                   /translation="MNIGQSHTGPAKGTAVGAFVIAALGVLLLTESITGGINNYLQPAF
FT                   RPWTLLSGVLLIGLGCWSIYSARRYPCSHSPMHTTSWLLLIPVILVALCAPTALGAASL
FT                   RYTAESTSATVRRNSLDDLAMEPLRGYGTNEITLEELTARFLRSDNTSMLAKTVSVAGF
FT                   ASRSIDGTWRLSRYKIFCCAADAMAYTASLAGATELVEDEWYEITAEVIAPPEGFNPQF
FT                   PVLKVDRATQIPQPEQPYL"
FT   gene            352079..353041
FT                   /locus_tag="CPC231_01700"
FT                   /old_locus_tag="CpC231_0334"
FT   CDS_pept        352079..353041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01700"
FT                   /old_locus_tag="CpC231_0334"
FT                   /product="permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09826"
FT                   /db_xref="GOA:D9QEA3"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEA3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400980.1"
FT                   /protein_id="ADL09826.1"
FT                   /translation="MRKGLGQYGAVAALLILIALFIFGPLIQLHGIAEAWAQISIAIIL
FT                   QAIPFLILGVIISGFIEVFVPEAAFRRLPRSQHLAVPTAAASGMLLPACECASVPITQS
FT                   LIRRGVPPAAALAFLLASPAINPVVLVSTAVAFGGDTRMMLARFVASLSAAVLVGWIWI
FT                   SGRAELSSGESRSHEHQHHAPSAWERLRESFLHDLLNAGGYLVLGALLAGMLKLFIPRD
FT                   WFLVLGDKPVLACLAMAVLAVLLALCSEADAFIAASFTMMPPTAQLVFLVVGPMVDVKL
FT                   MAMQRGAWGNGFIARFVPLTFAVALLTAIGVGALFFGDI"
FT   gene            complement(353038..353697)
FT                   /locus_tag="CPC231_01705"
FT                   /old_locus_tag="CpC231_0335"
FT   CDS_pept        complement(353038..353697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01705"
FT                   /old_locus_tag="CpC231_0335"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09827"
FT                   /db_xref="GOA:D9QEA4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEA4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523047.1"
FT                   /protein_id="ADL09827.2"
FT                   /translation="MLNQTAAELPIAGIIPFSATDWPGKLVAAAFTQGCPLRCVYCHNS
FT                   QLQAFTPGAHSLAEFLSLLSSRHGLIDAAVISGGEPTAVRGLGDAIAAIHNIGFPVGIH
FT                   TCGYAPSRIAELLRDPATTPDWVGLDIKALPRHMREVTGCSPRVATAVWDSLRILQESE
FT                   IDVTLRTTLWEGSVIEQNIDELRSVVKNRSMDSSVELVIQHARAADGSPWTPDCCF"
FT   gene            complement(353690..355486)
FT                   /locus_tag="CPC231_01710"
FT                   /old_locus_tag="CpC231_0336"
FT   CDS_pept        complement(353690..355486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01710"
FT                   /old_locus_tag="CpC231_0336"
FT                   /product="ribonucleoside triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09828"
FT                   /db_xref="GOA:D9QEA5"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEA5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800020.1"
FT                   /protein_id="ADL09828.1"
FT                   /translation="MLFPMTESHVNSRSTIEEYLDRSDWRVNANANQDYSLGGMILNSA
FT                   GKITANYWLDNVFSPEAGQAHRDGTIHIHDLDMLSGYCAGWSLRQLLEQGFNGVSGTIS
FT                   SHPPKHFSSACGQIVNFLGTLQNEWAGAQAFSSFDTYMAPFVRLDNLSYNDVVQQMQEF
FT                   IFNLNVPSRWGTQTPFTNLTFDWTCPEDLQDQVPFIGEEPQPFTYGDLQSEMDIINRAF
FT                   IEVMSAGDADGRPFTFPIPTYNITKDFDWDSSNSKALFTMTAKYGLPYFQNFINSDLDP
FT                   GMIRSMCCRLQLDLRELLKRGNGLFGSAELTGSIGVVTLNCARLGYLHADDEEGLLANV
FT                   DKLVQLGIETLERRRAFVAKQMDAGLYPYSSRWLPSLDNHFSTIGVNGCNEMIRNFTHD
FT                   AYDLTDPQGHAQVARLLDHINDLLVKAQERTGHLFNLEATPAEGATYRLAKEDIKRYPG
FT                   ILHAGTEEEPYYTNSSQLPVSHTPDPFEALALQEDLQSKYTGGTVLHLYMGAAMSDGEA
FT                   CAKLVRRSLENFRLPYVTITPTFSICPTHGYISGEHPECPDCGEHTEMWTRVMGYFRPV
FT                   QSFNTGKKGEFHERTYFAETLA"
FT   gene            355758..356141
FT                   /locus_tag="CPC231_01715"
FT                   /old_locus_tag="CpC231_0337"
FT   CDS_pept        355758..356141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01715"
FT                   /old_locus_tag="CpC231_0337"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09829"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEA6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300461.1"
FT                   /protein_id="ADL09829.2"
FT                   /translation="MSYNSYVAVEDWILDDLRIKDDDLVEALYMGDHGELFDVAAAWMD
FT                   VQEFLHSEGLSTAAVDGEEIIVGDPMVGIVAPQRVEKVLSDLSSVDDAAVREAGLGEAI
FT                   RSFTDFYEGARSSGLGVVVLAGE"
FT   gene            356577..356948
FT                   /locus_tag="CPC231_01720"
FT                   /old_locus_tag="CpC231_0338"
FT   CDS_pept        356577..356948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01720"
FT                   /old_locus_tag="CpC231_0338"
FT                   /product="30S ribosomal protein S12"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09830"
FT                   /db_xref="GOA:D9QEA7"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEA7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_018297794.1"
FT                   /protein_id="ADL09830.2"
FT                   /translation="MPTIQQLVRKGRHDKTAKVSTAALKGSPQRRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLTSGIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGALDT
FT                   QGVKDRKQARSRYGAKKEK"
FT   gene            356952..357419
FT                   /gene="rpsG"
FT                   /locus_tag="CPC231_01725"
FT                   /old_locus_tag="CpC231_0339"
FT   CDS_pept        356952..357419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="CPC231_01725"
FT                   /old_locus_tag="CpC231_0339"
FT                   /product="30S ribosomal protein S7"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09831"
FT                   /db_xref="GOA:D9QEA8"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEA8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_016458991.1"
FT                   /protein_id="ADL09831.1"
FT                   /translation="MRKNAAPKRPIVKDPVFGSEVVTQLVNKVLLDGKKSTAERIVYGA
FT                   LDICKEKTGTDPVLTLEKALGNIKPDLEVRSRRVGGATYQVPVEVRPGRANTLALRWLV
FT                   TFTRQRRENTMIERLANEILDAANGLGASVKRREDTHKMAEANRAFAHYRW"
FT   gene            357708..359834
FT                   /gene="fusA"
FT                   /locus_tag="CPC231_01730"
FT                   /old_locus_tag="CpC231_0340"
FT   CDS_pept        357708..359834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="CPC231_01730"
FT                   /old_locus_tag="CpC231_0340"
FT                   /product="elongation factor G"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09832"
FT                   /db_xref="GOA:D9QEA9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEA9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004566710.1"
FT                   /protein_id="ADL09832.1"
FT                   /translation="MAQEVLKDLNKVRNIGIMAHIDAGKTTTTERILFYTGINRKVGET
FT                   HDGASTTDWMEQEKERGITITSAAVTCFWNGNQVNIIDTPGHVDFTVEVERSLRVLDGA
FT                   VAVFDGKEGVEPQSEQVWRQAAKYDVPRICFVNKMDKLGADFYFTVQTIIDRLGAKPLV
FT                   MQLPIGAEDDFDGIVDLLEMKAITWRGKVETGAEPVIEEIPADLADKAAEYREKLVETV
FT                   AESDEALMEKYFGGEELTIEELKAGIRKLTVNSEVYPVLCGTAYRNKGVQPLLDAVIDY
FT                   LPTPLDIGEVHGHKVGDESVDLVRKPSVDEPFSALAFKIAAHPFFGKLTFVRVYSGIVE
FT                   PGAQVANSTKGKNERIGKLFQMHANKENPVDEARAGNIYAFIGLKDTTTGDTLCDKNNQ
FT                   IILESMDFPDPVIKVSIEPKTKSDQEKLGTAIQKLSEEDPTFTVELDEESGQTVIGGMG
FT                   ELHLDVLVDRMKREFKVEANVGNPQVAYRETIRKPVEKLEYTHKKQTGGSGQFAKVIIG
FT                   IEPYAPEQETLEEGESAIYKFENAVTGGRIPKEYIPSVDAGIQDAMQYGYLAGFPLVNI
FT                   KATLIDGAYHEVDSSEMAFKLAGSQALKEAVAKAKPVLLEPLMAVEVITPEEYMGDVIG
FT                   DINSRRGQVSAMDDRAGAKVVKAKVPLSEMFGYVGDLRSRTQGRANYTMIFDSYAEVPT
FT                   NVATEIVAERNGTA"
FT   gene            360142..361332
FT                   /gene="tuf"
FT                   /locus_tag="CPC231_01735"
FT                   /old_locus_tag="CpC231_0341"
FT   CDS_pept        360142..361332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="CPC231_01735"
FT                   /old_locus_tag="CpC231_0341"
FT                   /product="elongation factor Tu"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09833"
FT                   /db_xref="GOA:D9QEB0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEB0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005527719.1"
FT                   /protein_id="ADL09833.1"
FT                   /translation="MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPDLNE
FT                   AFAFDAIDKAPEEKERGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGA
FT                   ILVVAATDGPMPQTREHVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEIRELLAEQ
FT                   DYDEEAPIIHISALKALEGDEEWTKSILELMQACDDSIPDPERETDKPFLMPIEDIFTI
FT                   TGRGTVVTGRVERGQLNVNEDVEIIGIKEKSTQTTVTGIEMFRKLLDYTEAGDNCGLLL
FT                   RGIKREDVERGQVVVKPGAYTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDV
FT                   TGVVKLPEGTEMVMPGDNVDMSVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK"
FT   gene            361428..362057
FT                   /locus_tag="CPC231_01740"
FT                   /old_locus_tag="CpC231_0342"
FT   CDS_pept        361428..362057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01740"
FT                   /old_locus_tag="CpC231_0342"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09834"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEB1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522346.1"
FT                   /protein_id="ADL09834.1"
FT                   /translation="MMDRPHMDRMLDAVREVWEGQPDLDFAALMGMLNAHGLTWGISDS
FT                   DALDICMMISTTYPGALSKVAGQHSVLLANGTTAVLTSEQVVLLRGWQQPIWWNYESLV
FT                   QAQVGLPLVLKDREGIEHRLDMIHRIEKTMVVEGMDTRVIELVDASVILQRGHHARHFV
FT                   RRRRDLVTKDYQVPRAWVPGEGKPARLLTREQNIVELPAIATIILG"
FT   gene            complement(362199..362744)
FT                   /locus_tag="CPC231_01745"
FT                   /old_locus_tag="CpC231_0343"
FT   CDS_pept        complement(362199..362744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01745"
FT                   /old_locus_tag="CpC231_0343"
FT                   /product="alkaline shock response membrane anchor protein
FT                   AmaP"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09835"
FT                   /db_xref="GOA:D9QEB2"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEB2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241197.1"
FT                   /protein_id="ADL09835.1"
FT                   /translation="MKRSTASFDRLLCILVGVLLGALAVWTIALKFDLLWAQQLADLAE
FT                   FPQWHQASQQRWFDVALFFAAIFFLISGIWIVVANLRRNHISRVTQNNGKISVNIDHIA
FT                   ELAAEDLEELEPVISAHGHVESRGQETVIILDILLESVPHALSIQQSLQQLDQDVAVAL
FT                   PETPIRTEYRVHMAKVED"
FT   gene            complement(362746..363297)
FT                   /locus_tag="CPC231_01750"
FT                   /old_locus_tag="CpC231_0344"
FT   CDS_pept        complement(362746..363297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01750"
FT                   /old_locus_tag="CpC231_0344"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09836"
FT                   /db_xref="GOA:D9QEB3"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEB3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241198.1"
FT                   /protein_id="ADL09836.1"
FT                   /translation="MDSPSPTAIKGRPAARLAAILIGLAAIGIGFVAARELWWVRTEGN
FT                   HRHAWVDPILRFISAVTYQPWMLAAGVATAILALILIAIAFKPRPRTHVAFIDGVTCYM
FT                   RPLDIARLATLNAKQIPGVTQARTTVNSSARSIRVVASIDSQHLDEVKKYEERIRSVVE
FT                   PIALKLQTHPKLKVVVRGEG"
FT   gene            complement(363290..363751)
FT                   /locus_tag="CPC231_01755"
FT                   /old_locus_tag="CpC231_0345"
FT   CDS_pept        complement(363290..363751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01755"
FT                   /old_locus_tag="CpC231_0345"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09837"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEB4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241199.1"
FT                   /protein_id="ADL09837.1"
FT                   /translation="MTPPPVTITDRALTKLAKAAVHSVPGTVRVSRRAGRSLPRIDVRR
FT                   DDLHSPPTVEAFIAVTWPSPVTGVAENVAAAISTWFSAYAGIHDVPVNVVVTALNHGTR
FT                   FAATHEIQPPEVTHPQVPDHQVLMPIVTAPPRPLKPIAIRRIEPRRSHG"
FT   gene            complement(363751..363957)
FT                   /locus_tag="CPC231_01760"
FT                   /old_locus_tag="CpC231_0346"
FT   CDS_pept        complement(363751..363957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01760"
FT                   /old_locus_tag="CpC231_0346"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09838"
FT                   /db_xref="GOA:D9QEB5"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEB5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800025.1"
FT                   /protein_id="ADL09838.1"
FT                   /translation="MFQNKTLLGAILGVLVAFAILSGHVFLLLILAVAGGIGALIGAHC
FT                   DGKINLYKIFHDLIENVRRGGRG"
FT   gene            complement(363967..364305)
FT                   /locus_tag="CPC231_01765"
FT                   /old_locus_tag="CpC231_0347"
FT   CDS_pept        complement(363967..364305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01765"
FT                   /old_locus_tag="CpC231_0347"
FT                   /product="Asp23/Gls24 family envelope stress response
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09839"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEB6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241201.1"
FT                   /protein_id="ADL09839.1"
FT                   /translation="MSTPRPSGLPNLPSYESAQALAEKILGIDGVAELRGGRFGEVALL
FT                   YPRHKVIGLRLDDAQGHQTLEVNVAAYYGYSLTDLAQSIVAAVTDSGLCDAASIDVVVS
FT                   DVVKLTQL"
FT   gene            complement(364318..364785)
FT                   /locus_tag="CPC231_01770"
FT                   /old_locus_tag="CpC231_0348"
FT   CDS_pept        complement(364318..364785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01770"
FT                   /old_locus_tag="CpC231_0348"
FT                   /product="Asp23/Gls24 family envelope stress response
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09840"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEB7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241202.1"
FT                   /protein_id="ADL09840.1"
FT                   /translation="MSDAQNTPAADTSTAGSPTTLETTHGRTVIENTVVAKIAGLATRE
FT                   VSGVHAVGGNTARVVGALRDSIPGSRTNLQQGVEVEVGERQAAVDVAIVAEYGVAIHQL
FT                   AQAIRQNIINAIERMTGLEVTEVNVTVHDVHLDFDEDEGEANDSPTHTRVH"
FT   gene            365524..365829
FT                   /gene="rpsJ"
FT                   /locus_tag="CPC231_01775"
FT                   /old_locus_tag="CpC231_0349"
FT   CDS_pept        365524..365829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="CPC231_01775"
FT                   /old_locus_tag="CpC231_0349"
FT                   /product="30S ribosomal protein S10"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09841"
FT                   /db_xref="GOA:D9QEB8"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEB8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_009948626.1"
FT                   /protein_id="ADL09841.1"
FT                   /translation="MAGQKIRIRLKAYDHEAIDASARKIVETVTRTGARVVGPVPLPTE
FT                   KNVYAVIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ"
FT   gene            365862..366518
FT                   /gene="rplC"
FT                   /locus_tag="CPC231_01780"
FT                   /old_locus_tag="CpC231_0350"
FT   CDS_pept        365862..366518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="CPC231_01780"
FT                   /old_locus_tag="CpC231_0350"
FT                   /product="50S ribosomal protein L3"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09842"
FT                   /db_xref="GOA:D9QEB9"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEB9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_010189651.1"
FT                   /protein_id="ADL09842.1"
FT                   /translation="MSETEIKGILGTKLGMTQIFDEDNRVIPVTVVEAGPCVVTQIRTI
FT                   ETDGYNAIQIAYGDIDPRKANKPATGHFKKAGVTPRRHVAEIRMNDVSAYELGQDVTVE
FT                   IFEGITFVDVTGTTKGKGYAGAMKRHGFAGQGAAHGNQAAHRRVGGIGACATPGRVFKG
FT                   TRMAGRMGNDRVTTQNLKVQKIDADANLILIKGAIPGNRGGIVTVKTAVKGGAHA"
FT   gene            366515..367168
FT                   /gene="rplD"
FT                   /locus_tag="CPC231_01785"
FT                   /old_locus_tag="CpC231_0351"
FT   CDS_pept        366515..367168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="CPC231_01785"
FT                   /old_locus_tag="CpC231_0351"
FT                   /product="50S ribosomal protein L4"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09843"
FT                   /db_xref="GOA:D9QEC0"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEC0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599749.1"
FT                   /protein_id="ADL09843.1"
FT                   /translation="MTNLKLDVLTAEGKTDGQVELPAEIFDREASVALMHQVVNAQLAA
FT                   KRQGTHSTKTRAEVSGGGRKPFRQKGTGRARQGSIRAPHFTGGGISHGPKPRDYSQRTP
FT                   KKMIKAALYGALSDRARHERIHVITELVPGQTPSTKSARAFVERITDRRNVLLVVGRED
FT                   TTAQKSARNLPGVHILFADQLNTYDVLKSDDVVFSVEALNTFINRVTGAAQEEK"
FT   gene            367168..367473
FT                   /gene="rplW"
FT                   /locus_tag="CPC231_01790"
FT                   /old_locus_tag="CpC231_0352"
FT   CDS_pept        367168..367473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="CPC231_01790"
FT                   /old_locus_tag="CpC231_0352"
FT                   /product="50S ribosomal protein L23"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09844"
FT                   /db_xref="GOA:D9QEC1"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEC1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599750.1"
FT                   /protein_id="ADL09844.1"
FT                   /translation="MAKIADPRDIILAPVVSEKSYGLMEQNTYVFFVSPSANKTEIKIA
FT                   IEQIFGVKVASVNTANREGKRKRTRSGYGVRKATKRAYVTLREGSDAIDIFGGSAA"
FT   gene            367495..368337
FT                   /gene="rplB"
FT                   /locus_tag="CPC231_01795"
FT                   /old_locus_tag="CpC231_0353"
FT   CDS_pept        367495..368337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="CPC231_01795"
FT                   /old_locus_tag="CpC231_0353"
FT                   /product="50S ribosomal protein L2"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09845"
FT                   /db_xref="GOA:D9QEC2"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEC2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_011075029.1"
FT                   /protein_id="ADL09845.1"
FT                   /translation="MAIRKYKPTTPGRRQSSVSMFEEITRSTPEKSLVRPLPKKGGRNV
FT                   HGHITVRHKGGGHKRQYRVIDFRRNDKDGIPAKVAHIEYDPNRTANIALLHYVDGEKRY
FT                   IIAPKGMKQGQMIESGAAADIKVGNNLPLRNIPAGTTIHCVELKPGAGAKLARSAGASI
FT                   QLLGKAGKYAVLRMPSSEIRRVDIRCRATVGEVGNADQINIRWGKAGRMRWKGVRPTVR
FT                   GVVMNPVDHPHGGGEGKTSGGRHPVSPWGKKEGRTRNPNRYSNNMIVSRRRTNKSKKR"
FT   gene            368354..368632
FT                   /gene="rpsS"
FT                   /locus_tag="CPC231_01800"
FT                   /old_locus_tag="CpC231_0354"
FT   CDS_pept        368354..368632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="CPC231_01800"
FT                   /old_locus_tag="CpC231_0354"
FT                   /product="30S ribosomal protein S19"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09846"
FT                   /db_xref="GOA:D9QEC3"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEC3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013837842.1"
FT                   /protein_id="ADL09846.1"
FT                   /translation="MPRSLKKGPFVDEHLLAKVDAQNEKGTKQVIKTWSRRSTILPDFI
FT                   GHTFAVHDGRKHVPVFVDDSMVGHKLGEFAPTKTFKGHIKDDKKGRR"
FT   gene            368636..368998
FT                   /gene="rplV"
FT                   /locus_tag="CPC231_01805"
FT                   /old_locus_tag="CpC231_0355"
FT   CDS_pept        368636..368998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="CPC231_01805"
FT                   /old_locus_tag="CpC231_0355"
FT                   /product="50S ribosomal protein L22"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09847"
FT                   /db_xref="GOA:D9QEC4"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEC4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_018118340.1"
FT                   /protein_id="ADL09847.1"
FT                   /translation="MSESVTSARATARFVRVSPMKARRVIDLVRGKSIEEALAILKYAP
FT                   QAASEPVAKVVASAAANAENNFGLDRRSLVISEAFADEGPTMRRFSPRAQGCAFQIRKR
FT                   TSHITVVVESQKEGAK"
FT   gene            368998..369744
FT                   /gene="rpsC"
FT                   /locus_tag="CPC231_01810"
FT                   /old_locus_tag="CpC231_0356"
FT   CDS_pept        368998..369744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="CPC231_01810"
FT                   /old_locus_tag="CpC231_0356"
FT                   /product="30S ribosomal protein S3"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09848"
FT                   /db_xref="GOA:D9QEC5"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEC5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241209.1"
FT                   /protein_id="ADL09848.1"
FT                   /translation="MGQKIHPHGLRLGITSEWKSHWYADRNYSEYVAEDIRVREYLVKT
FT                   LDRAGIADIVIERTRDRVRVDIHTARPGIVIGRRGSEADRLRKELEKLTGKQVALNILE
FT                   VKNIDANAQLVAQSIAEQLTNRVAFRRAMRKAIQSAMRQPQVKGIKVVCSGRLGGAEMS
FT                   RTERYHEGRVPLHTLRAEIDYGTYEAHTTFGRIGVKVWIYKGDVVGGRRESEINAPAER
FT                   RRRGDRNARPRRGGQRRNRAEQKQEG"
FT   gene            369747..370163
FT                   /gene="rplP"
FT                   /locus_tag="CPC231_01815"
FT                   /old_locus_tag="CpC231_0357"
FT   CDS_pept        369747..370163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="CPC231_01815"
FT                   /old_locus_tag="CpC231_0357"
FT                   /product="50S ribosomal protein L16"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09849"
FT                   /db_xref="GOA:D9QEC6"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEC6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_020441956.1"
FT                   /protein_id="ADL09849.1"
FT                   /translation="MLIPKRVKYRRQHRPTRSGVSKGGNRITFGDYGIQALEPAYITNR
FT                   QIESARIAINRHVKRGGKVWINIFPDRPLTQKPLGVRMGSGKGPVEKWIANVKPGRILF
FT                   EMSFPNEEVALEALRRAGQKLPCKVRIVKKEDQF"
FT   gene            370163..370393
FT                   /locus_tag="CPC231_01820"
FT                   /old_locus_tag="CpC231_0358"
FT   CDS_pept        370163..370393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01820"
FT                   /old_locus_tag="CpC231_0358"
FT                   /product="50S ribosomal protein L29"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09850"
FT                   /db_xref="GOA:D9QEC7"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEC7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599756.1"
FT                   /protein_id="ADL09850.1"
FT                   /translation="MANGTPAHELRELNAEELKTRLTEAKEELFNLRFQAATGQLTNNR
FT                   RLRTVKRDIARIYTVIRERELGLSEVPGAEA"
FT   gene            370396..370674
FT                   /gene="rpsQ"
FT                   /locus_tag="CPC231_01825"
FT                   /old_locus_tag="CpC231_0359"
FT   CDS_pept        370396..370674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="CPC231_01825"
FT                   /old_locus_tag="CpC231_0359"
FT                   /product="30S ribosomal protein S17"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09851"
FT                   /db_xref="GOA:D9QEC8"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEC8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599757.1"
FT                   /protein_id="ADL09851.1"
FT                   /translation="MSEANVNKKEKGARKVRTGYVVSDKMQKTIVVELEDRKQHAKYGK
FT                   TIRTNSKVKAHDEDSIAGVGDLVRIEETRPLSKDKHFRLVEIIEKAK"
FT   gene            complement(370835..372511)
FT                   /locus_tag="CPC231_01830"
FT                   /old_locus_tag="CpC231_0360"
FT   CDS_pept        complement(370835..372511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01830"
FT                   /old_locus_tag="CpC231_0360"
FT                   /product="ABC transporter family substrate-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09852"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEC9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800027.1"
FT                   /protein_id="ADL09852.1"
FT                   /translation="MKLRSPSGKLAAVFAASALLLAGCGGDSSTSKNAQNADSISVADY
FT                   NPLDRDKVKQGGTFTTAIGEISEQQNRHHADSTRYTTMLWEWYNPSIIESTAEGESSFN
FT                   KNYVTDAKEESSGSKTKIVYTINDKAVFNDGTPIDWHAFETTWKINNGKNPAFSPSSTD
FT                   GYENIASVTKGANDKQAVVEFESTYPWWQGLFGIIAHPALNDPHNYNDYVKKVHPEWGA
FT                   GPYKVESIDFNRGEATFVPNEKWWGDTPKLDKRIFRQMDTAAAVNAFKNGEIDATAVPS
FT                   KDRYAAVKDMQGIELRTGRLPKNALLVLNAKSDVLQDIKVREAVSRGLDRKLLSSIWFQ
FT                   GVPYTEDPPGSLINFPFQKNYQDNFSKVATFDAGKAKALLDESGWAEGPDGIREKDGKP
FT                   LSLRYVLVGEDEQTTSIAKASQKMLKDIGIDLKIETHPSSDFSKLVSSDDYDIFPIGFT
FT                   ASDPFGVTYFGQTYLSDSQLNRSHAGTPELDAKIRELQALPTRDEQNKRANELEVEALA
FT                   RYGVIPQFNGVNIVAVKKGLANYGAYAFANVPVENIGWASE"
FT   gene            complement(372542..374614)
FT                   /gene="oppD"
FT                   /locus_tag="CPC231_01835"
FT                   /old_locus_tag="CpC231_0361"
FT   CDS_pept        complement(372542..374614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="CPC231_01835"
FT                   /old_locus_tag="CpC231_0361"
FT                   /product="oligopeptide ABC transporter ATP-binding protein
FT                   OppD"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09853"
FT                   /db_xref="GOA:D9QED0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QED0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241213.1"
FT                   /protein_id="ADL09853.1"
FT                   /translation="MTNPVLSVQNLNVTFPSEAGNVNAVRGVSFNLYPGQTLGIVGESG
FT                   SGKSVASMAVMGLLPDYATFTGSAQLHNRELIGLSDDAMSKIRGKEIGMIFQDPLSALT
FT                   PVFNVGSQIVEALRCHQKITKAKAWDTAIELLDLVGIPDPKRRALAFPHEFSGGMRQRV
FT                   VIAIAIANNPSVLIADEPTTALDVTIQAQILDLIKMAQKETNAATIMITHDMGVVAGTA
FT                   DNVMVMYAGRPVEYAGVHELFSEPKMPYTVGLLGSIPSVRKREKVSLTTIEGSPPIVVN
FT                   LPDECSFAPRCPIATAECLKTEPGLLSINDKHQAACIRSTEISHGELNGAPIFPTPPVH
FT                   EGALMRIPREKRSCVLSVSDLTKTFPLVKGALLKRTVGEVRAVNGLTFDIKEGECFAIV
FT                   GESGCGKTTTLLEIMDLAPQAPTQIQLGEKDVAGISKRQRRLLRKDIQIVFQDPMGALD
FT                   PRLTVAEILREPLDSLGWDGDKNERIRELIQLVGLNPAHIHIDRFPGHFSGGQRQRISL
FT                   ARALAANPKLIVLDEPVSALDVSVQAGMLNLLDELKARLGISYLFVAHDLSVIRHISDR
FT                   AAVMYLGRFVEQGDTDSLFDNPQHPYTKALLSAIPLADPIAERNRRRIILTDSQPSPTE
FT                   EITGCAFRGRCPLYVTLGDAHQRRCRTEEPEVRSLDNSDNPDHLHACHFAGTPLN"
FT   gene            complement(374618..375658)
FT                   /locus_tag="CPC231_01840"
FT                   /old_locus_tag="CpC231_0362"
FT   CDS_pept        complement(374618..375658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01840"
FT                   /old_locus_tag="CpC231_0362"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09854"
FT                   /db_xref="GOA:D9QED1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9QED1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241214.1"
FT                   /protein_id="ADL09854.1"
FT                   /translation="MRKEYRNNGEDRHEDLSPNVLPTADLTVSSSPLTQTNTSSVTESE
FT                   ILNAQQGIETAHVTGKNPMRKYRLYLRRFLRNKMAVIGSIILFLLFLLAVFGSLVAQWS
FT                   FDDPDFLALSSPPSPEHWFGTSSSGNDLFAMVVHGLGRSLTIAITVSLATTLISAFVGS
FT                   TAALLGGRPERAILGIIHFLLVIPSFLIIALIVSGSGGDWKLLIVVLIVFGWMYYARVI
FT                   WSMALSLREREYIKAARYMGVSNFTIIRRHLIPNIGSLLVINATLGVVSAVMSETGLSF
FT                   LGLGVKIPDVSLGTLLSTGANSLLSSPWEFYFPAAVLTLLTVSMAFIADGLRDALDPNS
FT                   AAVGKA"
FT   gene            complement(375660..376643)
FT                   /locus_tag="CPC231_01845"
FT                   /old_locus_tag="CpC231_0363"
FT   CDS_pept        complement(375660..376643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01845"
FT                   /old_locus_tag="CpC231_0363"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09855"
FT                   /db_xref="GOA:D9QED2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9QED2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522347.1"
FT                   /protein_id="ADL09855.1"
FT                   /translation="MIKFLVKKTLGWLAMIFLAVNLTYFLASFFLDPRSNYAGRRPPVP
FT                   ESRIDAILTPLNLNDKESIFERWWHWLSNVVLHWDWGSSPLGDPINSQISYRIWVSAQL
FT                   LLLATIISVLLGVGIGVFTASRQYKADDRVFQFISILAMNIHVIVASIVVVWIAIKTNQ
FT                   ALGTNLFFVTGSSSVGVEGFIPKLIDYAQHLILPTVSLIIISYASYHFLQRSILLDNID
FT                   ADYVRTARAKGLTRAQAVRRHALRTSIIPVATTVAFSIPGIFTGAIMTETIFGWQGMGQ
FT                   YFVSTINKNDIHGVVAVAAFGALMTAIGAVLADIFVVILDPRVRVS"
FT   gene            377356..377724
FT                   /gene="rplN"
FT                   /locus_tag="CPC231_01850"
FT                   /old_locus_tag="CpC231_0366"
FT   CDS_pept        377356..377724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="CPC231_01850"
FT                   /old_locus_tag="CpC231_0366"
FT                   /product="50S ribosomal protein L14"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09858"
FT                   /db_xref="GOA:D9QED5"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D9QED5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_010189586.1"
FT                   /protein_id="ADL09858.1"
FT                   /translation="MIQQESRLRVADNTGAREILCIRVLGGSTRRFAGIGDVIVATVKE
FT                   ATPGGNVKAGEVVKAVIVRAKKETRRADGSYIRFDENAAVLIKNDNEPKGTRIFGPVAR
FT                   ELRDKRFMKIVSLAPEVI"
FT   gene            377727..378041
FT                   /gene="rplX"
FT                   /locus_tag="CPC231_01855"
FT                   /old_locus_tag="CpC231_0367"
FT   CDS_pept        377727..378041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="CPC231_01855"
FT                   /old_locus_tag="CpC231_0367"
FT                   /product="50S ribosomal protein L24"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09859"
FT                   /db_xref="GOA:D9QED6"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D9QED6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_020441932.1"
FT                   /protein_id="ADL09859.1"
FT                   /translation="MKVHKGDMVLVISGPDKGAKGKVIQAFPQTEKVLVEGVNRVKKHV
FT                   ANSAPERGAESGGIVTQEAPIHVSNVMVLDSDGNPTRIGYRFDENGKKVRISRRNGKDI
FT                   "
FT   gene            378044..378607
FT                   /gene="rplE"
FT                   /locus_tag="CPC231_01860"
FT                   /old_locus_tag="CpC231_0368"
FT   CDS_pept        378044..378607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="CPC231_01860"
FT                   /old_locus_tag="CpC231_0368"
FT                   /product="50S ribosomal protein L5"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09860"
FT                   /db_xref="GOA:D9QED7"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D9QED7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241219.1"
FT                   /protein_id="ADL09860.1"
FT                   /translation="MSENYTPRLKTRYREEIRTALNEEFSYENVMQIPGVTKVVVNMGV
FT                   GDAARDSKLINGALEDLTLITGQKPELRRAKKSIANFKLREGMPIGARVTLRGDRMWEF
FT                   LDRLLTVALPRIRDFRGLSDQQFDGHGNYTFGLAEQTMFYEIDVDKVDRPRGMDITVVT
FT                   TATNNEEGRALLRELGFPFKKAEN"
FT   gene            379301..380644
FT                   /locus_tag="CPC231_01865"
FT                   /old_locus_tag="CpC231_0369"
FT   CDS_pept        379301..380644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01865"
FT                   /old_locus_tag="CpC231_0369"
FT                   /product="HAAAP family serine/threonine permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09861"
FT                   /db_xref="GOA:D9QED8"
FT                   /db_xref="UniProtKB/TrEMBL:D9QED8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525334.1"
FT                   /protein_id="ADL09861.1"
FT                   /translation="MSQTISVPANSGSADSSSSDSSPSHSTSAPKWRKSDTVWALSLFG
FT                   TAIGAGVLFLPINAGIGGIIPLIVMTIVAFPMTYWAHRGLTRFVLSSSRGGGDLTDAVE
FT                   EHFGRKAGAFMTILYFLSVYPILLVYSVTITNTVNSFLEHQLGVTPWPRWLMSLILVGG
FT                   LIFVVSLGRDVIVKAMSVLVFPFIGILVLLSLYLVPKWNTSLFETFSLESASAATGHSI
FT                   WVTLLLLVPVMVFSFNHSPIISSFAVEKREEYGIYADEKTGKVLRVAQILMVCVVMFFV
FT                   FSCALSLSPQNLAEAKSQNITILSYLANHFDNPVIQWAAPVIAMIAVAKSFLGHYLGAA
FT                   EGFQGLISKKGAEAPAGAKGDRKLALITLSFILVTAWLVGWLNPSILGMIETLCGPTIA
FT                   ILLFLMPMYAIHKVPALQKYRGRLSNYFIFFMGLVAFGTIFYNIVQAI"
FT   gene            380696..382072
FT                   /locus_tag="CPC231_01870"
FT                   /old_locus_tag="CpC231_0370"
FT   CDS_pept        380696..382072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01870"
FT                   /old_locus_tag="CpC231_0370"
FT                   /product="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09862"
FT                   /db_xref="GOA:D9QED9"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:D9QED9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366504.1"
FT                   /protein_id="ADL09862.1"
FT                   /translation="MFISSFDMFKIGIGPSSSHTLGPMKAGKAFADELETRGLLDATVR
FT                   VQADVYGSLSLTGVGHATDKAIIMGLAGFEPESVDIDAMPSFLEEVASLQRLPLSGGKK
FT                   LVNFPRGKDIVFHNTCLQLHENGMTITAFSEEEVLLHKTYFSIGGGFIVDEEHFGVVDE
FT                   DTSSVPFAYRSAEEFLTMCDIEGLSIPELEWRNETAAASEEEVRAHLAKAWNVMRTGIE
FT                   RGSSAEGILPGELRVPRRAKALRTRLENTSENEPLRMMSWLNMFALAVNEENAAGGRVV
FT                   TSPTNGACGVLPAVLSYWDKLVKPVDEKMYTDYFLTCKVVGALYKMNASISGAEVGCQG
FT                   EVGVACSMAAAGIAQLMGGTPQQVFIAAEIAMEHNLGLTCDPVCGQVQVPCIERNAVAA
FT                   VEAVNAANMALQRESNPTVSLDQIIATMYQTGKDMDSKYRETSLGGLAKVVLPKLMPCS
FT                   "
FT   gene            382281..383357
FT                   /locus_tag="CPC231_01875"
FT                   /old_locus_tag="CpC231_0371"
FT   CDS_pept        382281..383357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01875"
FT                   /old_locus_tag="CpC231_0371"
FT                   /product="asparaginase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09863"
FT                   /db_xref="GOA:D9QEE0"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEE0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241223.1"
FT                   /protein_id="ADL09863.1"
FT                   /translation="MTQIFSRRRFLGATALAATGGIGVLTACAQEEAKPKLGKEEATKD
FT                   VDYSAISGHLVVLSTGGTIASTNVDGALVPTVSGEDLVAPVYKKFSKDKLTIEVRQVSQ
FT                   LDSSAMTLKDTDNIIREVLKTVKEDKVTGVIVTHGTDSMEESAIAVDTFLSGDKPVVFT
FT                   GSMLPFDDPHTDGPDNLTLAVTAATDSKNQGKGAFIAFGGTLIRARGAYKSHTSENDGF
FT                   RTNASEDLVRPKALDFKPLESHRVDIIAAYPGAPRELIDAAISTGAEALVIEGMGAGNV
FT                   GGDIAEGIVAAAEKNIPVVMTTRVDAGLVEGTYGGAGGGATLAQKGVIGSNYLRAGQSR
FT                   IVLAAALATGADPKTLFS"
FT   gene            383823..385055
FT                   /locus_tag="CPC231_01880"
FT                   /old_locus_tag="CpC231_0372"
FT   CDS_pept        383823..385055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01880"
FT                   /old_locus_tag="CpC231_0372"
FT                   /product="phosphatase PAP2 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09864"
FT                   /db_xref="GOA:D9QEE1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001011"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEE1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400988.1"
FT                   /protein_id="ADL09864.1"
FT                   /translation="MSKTKCRLLGVLSSATFILSLVTPVNAQPVLQVPSDSSVGASLAS
FT                   PSVLHPGAPIPQPFGPADYIGYISDISSYSGGIYYDVVSNFEDLRQNHPKAMEENSATS
FT                   IRINNEATAESVARAQRDALTEHDGVLVAFSDALGPRLGEHLRTALAENRLPKLQMLLG
FT                   GWTARAGGLASSTFVEKNIFRNPRPYIAHAGSIRQYRVSHHDLYPTSGSFPSGHTNQAT
FT                   WTTALWAYMLPEFSAQILDRGSEAGFNRVVLGVHYPLDVIGGRMTGNAAAADRLNDPKM
FT                   RIALDAAAAELRAELEWRCGKSLLECATDTRSKEQAVQKYTERMTYGMKTRVYSSEAPM
FT                   VVPQAAPVLLASAFPSLTWGQRAEVLRQTAFEAGYPLDDQSTRGSWQRINLARAMAASV
FT                   TVGANGVVSVN"
FT   gene            385348..385746
FT                   /gene="rpsH"
FT                   /locus_tag="CPC231_01885"
FT                   /old_locus_tag="CpC231_0373"
FT   CDS_pept        385348..385746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="CPC231_01885"
FT                   /old_locus_tag="CpC231_0373"
FT                   /product="30S ribosomal protein S8"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09865"
FT                   /db_xref="GOA:D9QEE2"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEE2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_003854344.1"
FT                   /protein_id="ADL09865.1"
FT                   /translation="MTMTDPIADMLSRVRNANHARHDVVSMPSSKLKANIAEILKQEGY
FT                   IADYKVEEVKVGKTLTLNLKYGPNRQRSIEGVRRVSKPGLRVYAKSTNLPKVLGGLGVA
FT                   IISTSQGLLTDRQATEKGVGGEVLAYVW"
FT   gene            385763..386299
FT                   /gene="rplF"
FT                   /locus_tag="CPC231_01890"
FT                   /old_locus_tag="CpC231_0374"
FT   CDS_pept        385763..386299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="CPC231_01890"
FT                   /old_locus_tag="CpC231_0374"
FT                   /product="50S ribosomal protein L6"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09866"
FT                   /db_xref="GOA:D9QEE3"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEE3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599777.1"
FT                   /protein_id="ADL09866.1"
FT                   /translation="MSRVGKAPIAIPSGVETKIDGQLVEVKGPKGTLSFELPEPIRASI
FT                   EDGQISVVRPDDHRKNRSLHGLSRSLVNNMVVGVSEGYTIKMEIFGVGYRVALKGQNLE
FT                   FSLGYSHPVLIEAPEGITFAVDGNTKLSVSGIDKQKVGQIAAIIRRLRKDDPYKGKGIR
FT                   YEGEQIRRKVGKTGK"
FT   gene            386303..386710
FT                   /gene="rplR"
FT                   /locus_tag="CPC231_01895"
FT                   /old_locus_tag="CpC231_0375"
FT   CDS_pept        386303..386710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="CPC231_01895"
FT                   /old_locus_tag="CpC231_0375"
FT                   /product="50S ribosomal protein L18"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09867"
FT                   /db_xref="GOA:D9QEE4"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEE4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599778.1"
FT                   /protein_id="ADL09867.1"
FT                   /translation="MSNNENNNGKRLPVGKDISTRRRIARARRHNRIRKNLCGTAETPR
FT                   LVVHRTSRHMHVQVIDDFAGHTLAAASTLEAEVRAIEGDKKAKGAKVGQLIAERAKAAG
FT                   IESIVFDRAGYKYHGRVAALADAAREGGLKF"
FT   gene            386751..387377
FT                   /gene="rpsE"
FT                   /locus_tag="CPC231_01900"
FT                   /old_locus_tag="CpC231_0376"
FT   CDS_pept        386751..387377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="CPC231_01900"
FT                   /old_locus_tag="CpC231_0376"
FT                   /product="30S ribosomal protein S5"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09868"
FT                   /db_xref="GOA:D9QEE5"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEE5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599779.1"
FT                   /protein_id="ADL09868.1"
FT                   /translation="MPGRERRDGGRSADDNQKKNDRRGGRRDDRRNQQQDERSQYIERV
FT                   VTINRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVPAAIQKGAEEARKNFFRV
FT                   PMVAGTITHPVQGEAAAGIVMMRPAAPGTGVIAGGAARPVLECAGVQDILCKSLGTDNA
FT                   INVVHATVAGLKQLNRPEEVAARRGKTMEEVAPARMLRARAGQEA"
FT   gene            387380..387565
FT                   /gene="rpmD"
FT                   /locus_tag="CPC231_01905"
FT                   /old_locus_tag="CpC231_0377"
FT   CDS_pept        387380..387565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="CPC231_01905"
FT                   /old_locus_tag="CpC231_0377"
FT                   /product="50S ribosomal protein L30"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09869"
FT                   /db_xref="GOA:D9QEE6"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEE6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004566826.1"
FT                   /protein_id="ADL09869.1"
FT                   /translation="MALKITQHKGLVGANPKQRKNMAALGLKRINHSVVHEDTPAVRGM
FT                   INVVRHMVSVEEVAGE"
FT   gene            387569..388015
FT                   /gene="rplO"
FT                   /locus_tag="CPC231_01910"
FT                   /old_locus_tag="CpC231_0378"
FT   CDS_pept        387569..388015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="CPC231_01910"
FT                   /old_locus_tag="CpC231_0378"
FT                   /product="50S ribosomal protein L15"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09870"
FT                   /db_xref="GOA:D9QEE7"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEE7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013889193.1"
FT                   /protein_id="ADL09870.1"
FT                   /translation="MSEPIKLHDLRPAKGANKPKTRVGRGEASKGKTAGRGTKGTKARK
FT                   QVSAAFEGGQMPIHMRLPKLKGFKNPSKVYYQVVNVADLEKAFPNGGEIAAADIAAAGL
FT                   VRAKQPVKVLGEGEISVKLTVSGVKFSKSAKEKIEAAGGSIAEA"
FT   gene            388242..388697
FT                   /locus_tag="CPC231_01915"
FT                   /old_locus_tag="CpC231_0379"
FT   CDS_pept        388242..388697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01915"
FT                   /old_locus_tag="CpC231_0379"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09871"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEE8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241231.1"
FT                   /protein_id="ADL09871.1"
FT                   /translation="MQKIKVSLIAGAVCCLTLGGSVAGASQILLTEDGGRETNVRESVE
FT                   KLGDTWSCKREWDVTDRGGSYPVVFQRPCTVSLLGSAYEKLQSSDKQETRGLRADLREA
FT                   SAERDYYKKLSKDQWDLIEKLAKNDDTYKAEVEKLKPRLSGPSQTGR"
FT   gene            389168..390415
FT                   /locus_tag="CPC231_01920"
FT                   /old_locus_tag="CpC231_0380"
FT   CDS_pept        389168..390415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01920"
FT                   /old_locus_tag="CpC231_0380"
FT                   /product="extracellular solute-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09872"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEE9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366510.1"
FT                   /protein_id="ADL09872.1"
FT                   /translation="MKIHAKKALSVLAISTLVLAGCSSDKDSKGANGSGDSKGGKITLS
FT                   VWSSQEDQDGSDGWLQSVEKKFEEAHPDYDITWKNSVVGADQAATTVNQDPSAAADVYV
FT                   YANDRLGSLLDSGSVGELSDASMKQLSEQAEDTIAASVKGQDGKAYGLPIEPNTWFMYY
FT                   NKAKLNQEDIKSFDTMLSKAKVSFPMSNSWYYPAFYAGAGASFFGKDGLDEKAGIKLGD
FT                   KAGEVTKYLTSVVKNPNFVNDSEGSGIGGLANGSVDVVFSGSWDAKNIKKALGDNYGVA
FT                   SLPTFKLDGQDVQMKAFSGSKAIAYNPNTKNPKAASEFAAFLASTESQKSHFDKNGVIP
FT                   ADKSLAKDAAIAADPVAVALFETVSNASILQPTLKPMTDFWDPATTFGKALVNGEVNSE
FT                   NAVAKTDAWTSSFSKK"
FT   gene            390525..391931
FT                   /locus_tag="CPC231_01925"
FT                   /old_locus_tag="CpC231_0381"
FT   CDS_pept        390525..391931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01925"
FT                   /old_locus_tag="CpC231_0381"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09873"
FT                   /db_xref="GOA:D9QEF0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEF0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522119.1"
FT                   /protein_id="ADL09873.1"
FT                   /translation="MKAGVHRSGVLTKSKSKTQKRNDEPSLYSLSRAWANGDNVTKASF
FT                   VVFGLGNLVRKQFLKGIVLLAIEIVAIALFCDKGIKALQELPGLGTGEQGRVKVDGFWV
FT                   YKNSEPSVVLLLEGVATIFLIIVFLWLATIALRSAYKAQTFVEKQGRARTLKEDLHALT
FT                   DEDAPITLMSLPTAGILIFTVLPLIFMISMAFTSYDSRNVQKFDWVGLENFGKVFSNTG
FT                   GEVNLQIFIGVLTWTLVWAFFATFLNYFLGMFLAMIIQRKTTRGKTFWRAIFSLSVAVP
FT                   QFVTLLVLRSMLQPEGIVNRLLLNWGWIDSSLPFFTDATWARVTVIIVNLWIGIPYTIM
FT                   QVTGILQNIPGELYEAARLDGASWWQTYRNVTLPYMFFVMTPYLITTFTANVNNFNVIY
FT                   MLSRGDPTPIGASAGKTDLLITWLYKLTVDRGDYNVGAVIGILTFIVLSTVALITYRRS
FT                   GSYRNEEGFQ"
FT   gene            391931..392809
FT                   /locus_tag="CPC231_01930"
FT                   /old_locus_tag="CpC231_0382"
FT   CDS_pept        391931..392809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01930"
FT                   /old_locus_tag="CpC231_0382"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09874"
FT                   /db_xref="GOA:D9QEF1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEF1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241234.1"
FT                   /protein_id="ADL09874.1"
FT                   /translation="MSTKQVGIRGSQRRTRQLVDFFVHLFLTVLAIIWVIPIVWVVAES
FT                   FNKNTAPYTNTFLPTEYSVDNYVQLFTDHSVLNFPKMFVNTLIIACFTCAISIVFVLFV
FT                   SYSLSRLRFRFRKVYMNTALILGMFPGIMSVVAIYFILKAIGLTQDWTTTFALIIVYSA
FT                   GTGMGFYVMKGFMDTIPISLDEAALLDGCTRWQVFTKIILPISKPMIVYQAIVGFLTPW
FT                   LDFVLAKAIARTQENYTVSLGLWKMLEKEYIYDWFARFAAGAVCISIPITILFIVMQRY
FT                   YQESMAGSVKG"
FT   gene            392942..393685
FT                   /locus_tag="CPC231_01935"
FT                   /old_locus_tag="CpC231_0383"
FT   CDS_pept        392942..393685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01935"
FT                   /old_locus_tag="CpC231_0383"
FT                   /product="traX"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09875"
FT                   /db_xref="GOA:D9QEF2"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEF2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241235.1"
FT                   /protein_id="ADL09875.1"
FT                   /translation="MNVQLRQRGLNAHKLAGLAGFFILASSLGSLMVRPTDTGYVDAGL
FT                   GLLTVGIVMEVISWCAIPLVAWLYTWAIKRGINRWRLAAWTFVIAAVSEVPYDLALDRR
FT                   AWSTESQNPAWVLLVALVVLAAIDITAQLSTALRWAVMLGVTLAAVFWIVALSLGTRLG
FT                   ILPMGIALLGFVIIFYLFWGAENRMMYSAGAFGAAMFISPALGTVFLHYRQPLLDQEGT
FT                   LPAAWVPWAYPVILLFTGLIATVLL"
FT   gene            393854..394651
FT                   /locus_tag="CPC231_01940"
FT                   /old_locus_tag="CpC231_0384"
FT   CDS_pept        393854..394651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01940"
FT                   /old_locus_tag="CpC231_0384"
FT                   /product="formate/nitrite transporter family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09876"
FT                   /db_xref="GOA:D9QEF3"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEF3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300470.1"
FT                   /protein_id="ADL09876.1"
FT                   /translation="MTAPVSLTNKVSSAVAKKVVLFETDFWRYSVRCIFAGVYLTLGTA
FT                   FAVTLGQKLDHVVHGVGYPIFGLMFFVGLYTIVLLNAELATSNMMYLGFGVVHKKLSLP
FT                   KATQILLVCTFFNLVGAVLVAFLLSRAVVFSHVDAESLVSTITETKLGKSSLGLLVEGI
FT                   LANVAVNMGIIGVAMVKEFSGKFLTLVVTISMFTVMGLEHVIANFSLVSLVGFSAESLP
FT                   SHFDAAHIARNWAIVFIGNLIGGGVCMGAAYAWLNRGNEKYRD"
FT   gene            complement(394672..395918)
FT                   /pseudo
FT                   /locus_tag="CPC231_01945"
FT                   /old_locus_tag="CpC231_0385"
FT   CDS_pept        complement(394672..395918)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01945"
FT                   /old_locus_tag="CpC231_0385"
FT                   /product="DUF4032 domain-containing protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800039.1"
FT   gene            complement(396034..397170)
FT                   /gene="ugpC"
FT                   /locus_tag="CPC231_01950"
FT                   /old_locus_tag="CpC231_0386"
FT   CDS_pept        complement(396034..397170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpC"
FT                   /locus_tag="CPC231_01950"
FT                   /old_locus_tag="CpC231_0386"
FT                   /product="sn-glycerol-3-phosphate ABC transporter
FT                   ATP-binding protein UgpC"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09877"
FT                   /db_xref="GOA:D9QEF4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEF4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300472.1"
FT                   /protein_id="ADL09877.1"
FT                   /translation="MASVTFEKASRVYPGANKPAVDEFDLHIEDGEFLVLVGPSGCGKS
FT                   TTLRMLAGLEEVNSGRVSIGNRDVTDIPPRDRDIAMVFQNYALYPHMTVRENMGFALKI
FT                   DKKPKEEINRRVEEAARTLDLTEYLDRKPKALSGGQRQRVAMGRAIVRKPEVFLMDEPL
FT                   SNLDAKLRVQTRTQIAALQRELGVTTLYVTHDQTEALTMGDRIAVLKFGVLQQVGTPRE
FT                   LYDFPANEFVAGFIGSPAMNLGTFTVEGDHAVLGKARVPLSPATRAAITPSDNGKITIG
FT                   FRPEALEVVSENEPNTIPVKLHMVEELGSDAYMYGKLEGGGSLGSGTDANPDDESTDEI
FT                   IIRTAPHAAPPIGSIIHVRIREGAQHNFSKSTGMRLPE"
FT   gene            397873..399195
FT                   /gene="secY"
FT                   /locus_tag="CPC231_01955"
FT                   /old_locus_tag="CpC231_0387"
FT   CDS_pept        397873..399195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="CPC231_01955"
FT                   /old_locus_tag="CpC231_0387"
FT                   /product="preprotein translocase subunit SecY"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09878"
FT                   /db_xref="GOA:D9QEF5"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEF5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599793.1"
FT                   /protein_id="ADL09878.1"
FT                   /translation="MSAIFQAFRDADLRKKILITLALIVLYRIGAQIPSPGVDYASISG
FT                   RLRELTSDSSSVYSLINLFSGGALLQLSIFAIGVMPYITASIIVQLLTVVIPRFEELKK
FT                   EGQSGQAKMDQYTRYLTLGLALLQSSGIVALADRKQLLGAGVQVLMPNAGLWTLIMLVL
FT                   VMSAGAMLVMWLGEIITERGVGNGMSLLIFAGIATRLPSDGANILNSSGGVVFAVVLVA
FT                   VIILVVGVVFVEQGQRRIPVQYAKRMVGRRQYGGSSTYLPLKVNQAGVIPVIFASSLIY
FT                   MPVLITQIINSGSHEVSDNWWQRNVIQYLQTPSSWQYIVLYFVLIIFFSYFYVSVQYDP
FT                   NEQAENMKKYGGFIPGIRPGRPTAEYLGFVMNRLLFVGALYLGIIAVLPNIALDLGVGA
FT                   SSAGSTPFGGTAILIMVSVALTTVKQIESQLLQSNYEGLLK"
FT   gene            399195..399740
FT                   /locus_tag="CPC231_01960"
FT                   /old_locus_tag="CpC231_0388"
FT   CDS_pept        399195..399740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01960"
FT                   /old_locus_tag="CpC231_0388"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09879"
FT                   /db_xref="GOA:D9QEF6"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEF6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599794.1"
FT                   /protein_id="ADL09879.1"
FT                   /translation="MRLVLLGPPGAGKGTQAAILSEKLGIPHISTGDLFRANIGEGTPL
FT                   GIEAKQYIDNGKLVPTDVTARMVKSRLEEEDAKDGFLLDGFPRTVEQAEILEGFLEEFG
FT                   TTLDGVINYQVSEDVVVERMLARGRADDNESTIRTRLQVYREETAPLIDHYGEQIIAIT
FT                   AEGTVEDINSRTLEALGK"
FT   gene            399902..400686
FT                   /pseudo
FT                   /gene="map"
FT                   /locus_tag="CPC231_01965"
FT                   /old_locus_tag="CpC231_0389"
FT   CDS_pept        399902..400686
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="CPC231_01965"
FT                   /old_locus_tag="CpC231_0389"
FT                   /product="type I methionyl aminopeptidase"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014318692.1"
FT   gene            401074..403158
FT                   /locus_tag="CPC231_01970"
FT                   /old_locus_tag="CpC231_0390"
FT   CDS_pept        401074..403158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01970"
FT                   /old_locus_tag="CpC231_0390"
FT                   /product="exo-alpha-sialidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09880"
FT                   /db_xref="GOA:D9QEF7"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR026856"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEF7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241243.1"
FT                   /protein_id="ADL09880.1"
FT                   /translation="MTDSHRRGTRKALVTLTAALALTTQGLTAPATLAEEGSTIVPAPI
FT                   DNNGLFDAAPPAPVARGAVGEGKLPDPVTSEFFDSKVIRDVDPAGQRCFRIPAIATAVD
FT                   GTLLVAFDNRYGPDAQSRTWCRDAPYENTKRNSREKQTDIEIYRSHDSGKSFEEGDFIA
FT                   KGTEDPRDLSYTDPSIVVDHETGKIFAVFVRGYDYRFFDATAGVNRGSVEDPIQKRSVQ
FT                   DTVIIESNDNGQTWGNMKLLSELTEKIKVRHKPGQELAGRGRFATSGNGIQLKYGENAG
FT                   RLLFPMSVHYSPNGAGAVANVALYSDDHGATWNVGQGVGGEGETNGDENKLVELSDGRI
FT                   MMNSKSTGSNPSNPRGAERWRSYSEDQGETWSKPEPVIVAPPQHPLQRNTGINVSLIKA
FT                   YPSAPEGSAAARVLLYSAPIDTRIKGEYGQDGRSNGWVMASCDDGRSWTHGRQIEAGRF
FT                   QYSVMTPMADGNIGMVYESGDKERGMTLKFAKFNMAWLGADCLSNKALGITDLPDPALA
FT                   KAIEDAKAATAKAEEATANVLKLTKELEEAELENEELAQALAEAKSAAQDAIAAAEEAN
FT                   ARVKAAEGATIEAEEAAMKAENEAKALAEQLAKVEAELANSQDQAKALAEAKEAAEIAR
FT                   KAAEEALKLEKEKSGKAGGTDNTENKGFWQELLRIFPGFAPIFSFLASIWGGMQKLLAF
FT                   "
FT   gene            403334..404074
FT                   /locus_tag="CPC231_01975"
FT                   /old_locus_tag="CpC231_0391"
FT   CDS_pept        403334..404074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_01975"
FT                   /old_locus_tag="CpC231_0391"
FT                   /product="L,D-transpeptidase family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09881"
FT                   /db_xref="GOA:D9QEF8"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEF8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523066.1"
FT                   /protein_id="ADL09881.2"
FT                   /translation="MSYKPRHAKQSVARRRIAAMVGTAATSAALLVSQAATSSAQDFGS
FT                   SNLSSSFDQQLQNIGRQTRDGAWDLRNNLRAQADAGLPVDAAAAVKQSVDNAVNFAFPG
FT                   LIQERTAPPVVPAPAPAPVPTPPAFDTGSCPAFARACIDLAGQRSWLQNNGQVSYGAVP
FT                   ISSGRVGHETPKGVFYVNRKIKDEISREFNNAPMPFSVYFTHNGIAFHEGSPQVPSHGC
FT                   IHLNHKDAVTFFNQLQVGDVVYVY"
FT   gene            404372..404590
FT                   /gene="infA"
FT                   /locus_tag="CPC231_01980"
FT                   /old_locus_tag="CpC231_0392"
FT   CDS_pept        404372..404590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="CPC231_01980"
FT                   /old_locus_tag="CpC231_0392"
FT                   /product="translation initiation factor IF-1"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09882"
FT                   /db_xref="GOA:D9QEF9"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEF9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005519800.1"
FT                   /protein_id="ADL09882.1"
FT                   /translation="MAKEGAIEVEGRIIEPLPNAMFRVELDNGHKVLAHISGKMRQHYI
FT                   RILPEDRVVVELSPYDLNRGRIVYRYK"
FT   gene            404784..405152
FT                   /gene="rpsM"
FT                   /locus_tag="CPC231_01985"
FT                   /old_locus_tag="CpC231_0393"
FT   CDS_pept        404784..405152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="CPC231_01985"
FT                   /old_locus_tag="CpC231_0393"
FT                   /product="30S ribosomal protein S13"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09883"
FT                   /db_xref="GOA:D9QEG0"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEG0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_020441897.1"
FT                   /protein_id="ADL09883.1"
FT                   /translation="MARLAGVDLPRNKRMEVALTYIYGIGPARAAQLLKETGISPDLRT
FT                   DNLTDEQVSALRDVIEATWKVEGDLRRQVQADIRRKIEIGCYQGLRHRRGLPVRGQRTK
FT                   TNARTRKGPKKTIAGKKK"
FT   gene            405156..405560
FT                   /gene="rpsK"
FT                   /locus_tag="CPC231_01990"
FT                   /old_locus_tag="CpC231_0394"
FT   CDS_pept        405156..405560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="CPC231_01990"
FT                   /old_locus_tag="CpC231_0394"
FT                   /product="30S ribosomal protein S11"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09884"
FT                   /db_xref="GOA:D9QEG1"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEG1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_011075047.1"
FT                   /protein_id="ADL09884.1"
FT                   /translation="MPPKTRSTARRTGRRVVKKNVAQGHAYIKSTFNNTIVSITDPSGA
FT                   VIAWASSGHVGFKGSRKSTPFAAQLAAENAARKAMDHGMKKVDVFVKGPGSGRETAIRS
FT                   LQAAGLEVTSISDVTPQPFNGCRPPKRRRV"
FT   gene            405584..406189
FT                   /gene="rpsD"
FT                   /locus_tag="CPC231_01995"
FT                   /old_locus_tag="CpC231_0395"
FT   CDS_pept        405584..406189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="CPC231_01995"
FT                   /old_locus_tag="CpC231_0395"
FT                   /product="30S ribosomal protein S4"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09885"
FT                   /db_xref="GOA:D9QEG2"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEG2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_010119835.1"
FT                   /protein_id="ADL09885.1"
FT                   /translation="MARYTGPATRKSRRLRVDLVGGDMAFERRPYPPGQAGRARIKESE
FT                   YLLQLQEKQKARFTYGVMEKQFRRYYAEANRLPGKTGDNLVILLEARLDNVVYRAGLAR
FT                   TRRQARQLVSHGHFTVNGKKINVPSYKVSQYDIIDVREKSRKMIWFEEAQENLLDAVVP
FT                   AWLQVVPSTLRILVHQLPERAQIDVPLQEQLIVEFYSK"
FT   gene            406329..407345
FT                   /locus_tag="CPC231_02000"
FT                   /old_locus_tag="CpC231_0396"
FT   CDS_pept        406329..407345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02000"
FT                   /old_locus_tag="CpC231_0396"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09886"
FT                   /db_xref="GOA:D9QEG3"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEG3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599801.1"
FT                   /protein_id="ADL09886.1"
FT                   /translation="MLISQRPTLTEEYVDSARSRFIIEPLEPGFGYTLGNSLRRTLLSS
FT                   IPGAAVTSVKIDGVLHEFTTINGVKEDVSDIILNIKGLVLSSDSDEPVVMYLRKEGAGV
FT                   VSAGDIEPPAGVEIHNPDLHIATLNEQGRLDIEMIVERGRGYVPASLYAGTNEIGRIPV
FT                   DQIYSPVLKVSYKVEATRVEQRTDFDKLIIDVETKNSIAPSDALASAGKTLVELFGLAR
FT                   ELNTAAEGIEIGPSPQETEYIAAYSMPIEDLNFSVRSYNCLKRQEIHTVGELAECTESD
FT                   LLDIRNFGQKSINEVKIKLAGLGLFLKDSPEDFDPTQLEGYDAATGDYVDTDLEDSE"
FT   gene            407421..407906
FT                   /gene="rplQ"
FT                   /locus_tag="CPC231_02005"
FT                   /old_locus_tag="CpC231_0397"
FT   CDS_pept        407421..407906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="CPC231_02005"
FT                   /old_locus_tag="CpC231_0397"
FT                   /product="50S ribosomal protein L17"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09887"
FT                   /db_xref="GOA:D9QEG4"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEG4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599802.1"
FT                   /protein_id="ADL09887.1"
FT                   /translation="MPTPKKGARLGGSASHQKHILSNLAAQLFEHGAIKTTDAKAKLLR
FT                   PYAEKLITKAKKGSVADRRNVLKAVPNKDVVAYLFNELAPKFENREGGYTRIIKLENRK
FT                   GDNAPMSQISLVLEETVSAEASRATRAAASKEAEKIEEPAAEEAVAETSTDEAAEEK"
FT   gene            408122..408997
FT                   /gene="truA"
FT                   /locus_tag="CPC231_02010"
FT                   /old_locus_tag="CpC231_0398"
FT   CDS_pept        408122..408997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="CPC231_02010"
FT                   /old_locus_tag="CpC231_0398"
FT                   /product="tRNA pseudouridine(38-40) synthase TruA"
FT                   /EC_number="5.4.99.12"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09888"
FT                   /db_xref="GOA:D9QEG5"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEG5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241251.1"
FT                   /protein_id="ADL09888.1"
FT                   /translation="METNQPTVRIRLDLAYDGTHFHGWARQGTSQLRTVQRVLEDSLEL
FT                   ILRHPIQLTVAGRTDAGVHAAGQVAHFDVPAIALDTRSIDGDPRNLVRRLARLLPEDVR
FT                   VHACTLAPEGFDARFSALRRHYVYRLTTHPRGALPTRATDTAHWPKRIDIDAMQAAADV
FT                   LIGLHDFAAFCKHREGATTIRDLQEFTWHDVSTSLEPQLYEAHVTADAFCWSMVRSLVG
FT                   SCLVIGEGKRPEGFVDSLLTETSRSSQVPVAPAKGLSLVGVDYPVDSELLARANTTRAV
FT                   RTAEDISGNL"
FT   gene            409056..410414
FT                   /gene="eccB"
FT                   /locus_tag="CPC231_02015"
FT                   /old_locus_tag="CpC231_0399"
FT   CDS_pept        409056..410414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eccB"
FT                   /locus_tag="CPC231_02015"
FT                   /old_locus_tag="CpC231_0399"
FT                   /product="type VII secretion protein EccB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09889"
FT                   /db_xref="GOA:D9QEG6"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEG6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800043.1"
FT                   /protein_id="ADL09889.1"
FT                   /translation="MRMRTDDMAKRITTPHEDVRQRKGIAPATKAQVSGHRFLVRRAEL
FT                   GLLLGDVRMIHDPLGRLRRAIAFGLSAVGLVALGAGALALFSPNPDPGDARILSSQRGD
FT                   LFVRVGEQLHPVTNLTSARLAVEEAATPVKAGDSVLGSKHIAVPIGIADAPSIFNNTSD
FT                   TEPVWQICTSTPGPTESHSPRTTFLINHTTPFEQTPQLEADEALLATSHMGDVVVTAAN
FT                   RRLLPPAETPEGRSIRRRLGIGFETPRWHPEADVLAIIPEAPQFHLPVGNLELFVADGE
FT                   YWLKNDSGVVRITSLQKDILTDLGWELKTVSKTEMTALPDIDLHIAFPDKPLRWQDSDK
FT                   AHTCISVSFTQTDTEPSTSVGITNSAATFASAVELSGESVATHFVGGGGAVAVETGAGV
FT                   HLISEHGLRHQLAHNAVLEHLGIQKVRRASWFLLRLLPAGTTLSKEAALTPLY"
FT   gene            410499..410921
FT                   /locus_tag="CPC231_02020"
FT                   /old_locus_tag="CpC231_0400"
FT   CDS_pept        410499..410921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02020"
FT                   /old_locus_tag="CpC231_0400"
FT                   /product="TIGR02611 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09890"
FT                   /db_xref="GOA:D9QEG7"
FT                   /db_xref="InterPro:IPR013434"
FT                   /db_xref="InterPro:IPR019099"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEG7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241253.1"
FT                   /protein_id="ADL09890.1"
FT                   /translation="MSSMRDAVADKLAQINQHYENLKRHRFGFLVRPTVLILGWIVVIV
FT                   GIITIPFPGPGWLTVFVGIGILSLELHWASGLLAWGVKLYDRFFSWYRVQPKKTCYSLI
FT                   AGTIVAAWIAGIAIVLVLWKLGFVPFLDPLLPILIG"
FT   gene            complement(410942..412120)
FT                   /gene="mycP"
FT                   /locus_tag="CPC231_02025"
FT                   /old_locus_tag="CpC231_0401"
FT   CDS_pept        complement(410942..412120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mycP"
FT                   /locus_tag="CPC231_02025"
FT                   /old_locus_tag="CpC231_0401"
FT                   /product="type VII secretion-associated serine protease
FT                   mycosin"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09891"
FT                   /db_xref="GOA:D9QEG8"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEG8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241254.1"
FT                   /protein_id="ADL09891.1"
FT                   /translation="MPILRFSRLTCALFIISLGIVFCPLGYAQERSCVQAAHASTENIH
FT                   NQAAASQKFRRAHRYATGAGIRVAIIDTGVSPHPRLGPVEDGGSFINDGMRRTGLYDCD
FT                   AHGTTVAGIIATRDGPDGVIGIAPAATIISVKQMSARHNYSPGAAPTASGNLSTLAQSI
FT                   HAAIDHGAHVINISVVSCVRRDTVVDLSDLHTALDRAENANVVVVSAAGNASSSSCEPG
FT                   DHVYPAHLDRVLAVSALHSNGLPTQYSLPSPHPMLSASGHVAAALSHEGDVLSQGTHKD
FT                   REIVPFEGTSFAAPVVAGTASLLRERYPQATAADIRALLYHSVDPMTGAIDPELAVTQV
FT                   FPRDSPPSHPSLVTVTQPSQYGTQGRMIAIIMTSLLLITFTATALLLSRVRP"
FT   gene            complement(412123..413559)
FT                   /gene="eccD"
FT                   /locus_tag="CPC231_02030"
FT                   /old_locus_tag="CpC231_0402"
FT   CDS_pept        complement(412123..413559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eccD"
FT                   /locus_tag="CPC231_02030"
FT                   /old_locus_tag="CpC231_0402"
FT                   /product="type VII secretion integral membrane protein
FT                   EccD"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09892"
FT                   /db_xref="GOA:D9QEG9"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEG9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523068.1"
FT                   /protein_id="ADL09892.1"
FT                   /translation="MIDQDIRLHFRIELSRDESTDLSEDCASPAACVNVDISVPRSSAL
FT                   VEVIPDILSLAGVEVGTTPWQSITASGLRIDASDPLHTTGLPDGAVVLLRPRQASKAPV
FT                   VRDSAETLAHSSKSSLPPRGIAAATELLGIVGCACLIMRMNSIGLPEFRWLILCCLAAL
FT                   AYLWTRNALVLVTFAAFCACAAFFFVVDFPVSEARAPDIAAAVLAANFASIASSVSLHL
FT                   FAFRRPSRATTPFDEKPLGHLRCLSAIISCALSASPVAAVGLLYQSPESQPHGWFLGAA
FT                   SAVIVCSLTAVVLAPTLAVKLAGVQVPRLPSAGEDLSVAYSQISAEHLKYLARKSLLLM
FT                   EGILMGASASATTALLVIGYLSNGNGYACGLCVCVIICSAAHSHRHATGVSVWMLWLIA
FT                   LGGIIGLSLAIDVSTHWLAIVSLSVSLCALTASLWAKLLPRFTPVTALWIGRCEALALA
FT                   AVFPLSCQLIGVFSLIRGLG"
FT   gene            413706..417557
FT                   /locus_tag="CPC231_02035"
FT                   /old_locus_tag="CpC231_0404"
FT   CDS_pept        413706..417557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02035"
FT                   /old_locus_tag="CpC231_0404"
FT                   /product="type VII secretion protein EccC"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09894"
FT                   /db_xref="GOA:D9QEH1"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEH1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522125.1"
FT                   /protein_id="ADL09894.1"
FT                   /translation="MVGTNVSTIQKNDDAKLSEQQFLFKGESSCASATPQKNESNNKAD
FT                   RGIIPQLSEDERLPAPPLPTGSLKPEPVPEAARAQPVPLLKMLMPLAMVVAVIAMVGLL
FT                   VISGGALNPMMLTLPLMMGMSLLMMFSPAPGEDTAEMRRTYLRHLVALREKAIENADAQ
FT                   RAHELYRHPLTCELWSIVGTEWMWERLGDASDALEVRIGTGSTALCTPFEISDSGATED
FT                   LDPVCAVSLRSMVQSLSSVHDMPLIIQLQAFRVINILGDAAPDLARAIAAQLCFYHGPE
FT                   AVGIGLVARTETASVYPDAEESWAFIKWLPHHREPQNAQHKIFIVDCAGAKTSELDVLD
FT                   IGSWDVIIAVNAHPSSDLGVWAEEEGIVLQADSNLGVITENGFESIGTPESLSNSGALL
FT                   LARLLTRYKRAESENTASSDLRALLKLHSLEGQLDVGSLWEHWNTKSAKNRRLSIPFGL
FT                   NASGKPVVLDIKESAHGGMGPHGLCLGSTGSGKSELLRTLVVGLAATHSPEDLNFVLVD
FT                   FKGGATFLGLDQLPHTSAVITNLAQETVLVERMHDAISGEMNRRQEMLRQAGNFSNVSE
FT                   YTAARQHRQELPPMPALLIIVDEFSELLGQHPDFADLFVAVGRLGRSLHIHLLLASQRL
FT                   DEGRLRGLDSHLSYRIGLKTFSAAESRQILGVPDAHELPNQPGVGFLSTGAGELQRFRA
FT                   SYVSGPMQNLDAENNRSRTVRLWTGWEDPEPQSERTPQNIHAKGKTLVDAIVSASVHAA
FT                   AQQQLRAHRIWLPPLPKTISLSSLAPNQAFLTASVGVIDRPYLQRQDSLIMNFLGQSGH
FT                   AALCGGPQTGKSNALHTIMASLAIAHSTHDLRFYVLDLAGTSLAATVALPHVAGVAHRT
FT                   EVEKVRRIVDEVVSFIDAPEERHTFLVIDGWHVVGQNFEDLLEPLARIASDGLSAHVHL
FT                   LISTPRWTALRPEIRDLIPQRIELKLAESLDSLIDRKAQSKLPLAAGRGLNTDKEHILF
FT                   AFSTPQDLEQAALASARRGDSVVPKLKMLPSLVCVSELTAGLEKQEIPFGIGGKNLSPL
FT                   TWKFQHSSHLLCVGNQGCGKSTLMRAITTGIEAMGKEHARIVMIDHRRAHLGAIHEDML
FT                   AAYSATSQDTERLISDVIVTLRSRLPNSDVTAEQLKNRSWWCGPDIFLLIDDLDILPDG
FT                   CLYPLLELLPHSKDIGLHVVVCRKLGGMQRALYQPFLAELRDQQPTVIILDGDRDEGPI
FT                   FGVRPSQWPPGRGILVERGSNMGVFQIAVAGTCSTTQPDGPQEAGSARANGCGEEEHV"
FT   gene            417550..418605
FT                   /locus_tag="CPC231_02040"
FT                   /old_locus_tag="CpC231_0405"
FT   CDS_pept        417550..418605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02040"
FT                   /old_locus_tag="CpC231_0405"
FT                   /product="type VII secretion-associated protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09895"
FT                   /db_xref="GOA:D9QEH2"
FT                   /db_xref="InterPro:IPR023840"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEH2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522126.1"
FT                   /protein_id="ADL09895.2"
FT                   /translation="MSKSHDLVITVLDTATVFEGTEEAFRYDLTGAGIVEGWAIEKIIE
FT                   QAKQLLPQWPAVTIHITAESKIKEILTECVLEHGAAVTSVAAEEISYIKNDPMEGERLA
FT                   YMREPQLGEPQLDKETKGVRRKTGRARTSVFRRIAGTEKLHPLHGVLVVLVVVVAAVSW
FT                   WAMGKGLKNPSIGASAAHIAEDRELVDKPQNAHTEVTPIPTTSAYPPPSNDVMLHHARI
FT                   QVSLPSSYHLSEKEGMNGMVIAAGDDPDLRILLSIDPMGSADIDAVYAELETMITHDPT
FT                   LTKGQALGVTKPTRLVAYEERPGDGSYARWWSWVDNGHIYSVGCHSKRMSTIPQRAVCR
FT                   KAVESMSLRSF"
FT   gene            418752..419069
FT                   /locus_tag="CPC231_02045"
FT                   /old_locus_tag="CpC231_0406"
FT   CDS_pept        418752..419069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02045"
FT                   /old_locus_tag="CpC231_0406"
FT                   /product="WXG100 family type VII secretion target"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09896"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEH3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004601406.1"
FT                   /protein_id="ADL09896.2"
FT                   /translation="MSGQFRTEADVMVATASRVDNTNAEVQSELARLRGIVDGVRGSWA
FT                   GSAQASFDNLMQRWDASAGKLRMALQSISDNIRSNATSFDQTEADNKAAFASVGAQGLT
FT                   L"
FT   gene            419094..419375
FT                   /locus_tag="CPC231_02050"
FT                   /old_locus_tag="CpC231_0407"
FT   CDS_pept        419094..419375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02050"
FT                   /old_locus_tag="CpC231_0407"
FT                   /product="WXG100 family type VII secretion target"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09897"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEH4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241259.1"
FT                   /protein_id="ADL09897.1"
FT                   /translation="MIKYGFAAIEGAAGDIQSTSVRISSLLEELKAGIRPMVSTWEGDS
FT                   ALAYQEAQSQWDQAAYELNTILSTISQTVRAGNERMSEINRVAAASWG"
FT   gene            419708..420151
FT                   /gene="rplM"
FT                   /locus_tag="CPC231_02055"
FT                   /old_locus_tag="CpC231_0408"
FT   CDS_pept        419708..420151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="CPC231_02055"
FT                   /old_locus_tag="CpC231_0408"
FT                   /product="50S ribosomal protein L13"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09898"
FT                   /db_xref="GOA:D9QEH5"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEH5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004566874.1"
FT                   /protein_id="ADL09898.1"
FT                   /translation="MSTYHPKSGDITRKWYVIDATDVVLGRLATHAADLLRGKGKPQFA
FT                   PNVDCGDHVIVINADKVHISSNKREREMRYRHSGYPGGLKTMTLGRSLEVHPERVIEES
FT                   IRGMMPHNRLSRASVKKLHVFAGSEHPYAAQKPETYEIKQVAQ"
FT   gene            420148..420681
FT                   /gene="rpsI"
FT                   /locus_tag="CPC231_02060"
FT                   /old_locus_tag="CpC231_0409"
FT   CDS_pept        420148..420681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="CPC231_02060"
FT                   /old_locus_tag="CpC231_0409"
FT                   /product="30S ribosomal protein S9"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09899"
FT                   /db_xref="GOA:D9QEH6"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEH6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004566875.1"
FT                   /protein_id="ADL09899.1"
FT                   /translation="MSDQNVTENFEADAADIAAAVAASEEFTNTIGDVVAPEAEVETAA
FT                   PVLHEGPIQTVGRRKRAIVRVRMVEGSGQFTCNGRTLEEYFPNKLHQQLIKAPLALIDR
FT                   DGQFDIQATLTGGGPTGQAGAFRLAIARALNVYNPADRAALKKAGFLTRDARAVERKKA
FT                   GLHKARRAPQYSKR"
FT   gene            420879..422222
FT                   /locus_tag="CPC231_02065"
FT                   /old_locus_tag="CpC231_0410"
FT   CDS_pept        420879..422222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02065"
FT                   /old_locus_tag="CpC231_0410"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09900"
FT                   /db_xref="GOA:D9QEH7"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEH7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599819.1"
FT                   /protein_id="ADL09900.1"
FT                   /translation="MTRLFGTDGVRGLANKKLTASLALKLGAAAAEVLTKDNRSGSRRP
FT                   VAVVGRDPRASGEMLAAALSAGMASRGVDVLRVGVLPTPAVAYLTDFYGADMGVVISAS
FT                   HNPMPDNGIKFFSKGGHKLPDSVEDEIEMMMETISDGGPTGHGIGRVIEEAVDAQESYL
FT                   KHLKGAIQQSLEGITVVVDCANGAASEVAPLAYSTAGANVIAIHNHPNAYNINDNCGST
FT                   HIDQVIAAVKEHGADLGLAHDGDADRCLAVDAEGNVVDGDQIMAILALAMKENGELRKS
FT                   TLVATVMSNLGLRLAMKESGINLITTQVGDRYVLEALNAGGYSLGGEQSGHIVLPDHGT
FT                   TGDGTLTGLSLMARMAETGLSLKVLAGAMAVLPQVLINVPVSDKTIIMEHPEVIAALEQ
FT                   ATDALGETGRVLLRASGTEELFRVMVEAAEEETARRIAGELAALVAKI"
FT   gene            422293..422592
FT                   /locus_tag="CPC231_02070"
FT                   /old_locus_tag="CpC231_0411"
FT   CDS_pept        422293..422592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02070"
FT                   /old_locus_tag="CpC231_0411"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09901"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEH8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241263.1"
FT                   /protein_id="ADL09901.1"
FT                   /translation="MFDVLIEPTTAVRIIKGFIRELDSQERKHGQPPEFDPEALGKAFA
FT                   HHGEKISEALWLIHRSNGTRLQRLNAGVTKALADTQKLIDADLMHSASLKASGE"
FT   gene            422627..423769
FT                   /locus_tag="CPC231_02075"
FT                   /old_locus_tag="CpC231_0412"
FT   CDS_pept        422627..423769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02075"
FT                   /old_locus_tag="CpC231_0412"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09902"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEH9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400999.1"
FT                   /protein_id="ADL09902.2"
FT                   /translation="MAKPDLRQYERAITMLRMVSEGTYSGPLVSSSEVEQAASSTEGLN
FT                   TKALRQAAIGAVGKTNFSAKNKLWPVLFNVVKQFAMTLIASGIAELAMTWLGGLSGAKN
FT                   LAQEANQAGDAIDEVDAHANKAITTVLSQLTVAIERLAEQIGTIDKKEDPNGFLHCVQA
FT                   GADCIDSAAKTITLTCRDRDKAIEACYSQLGASLSKECGRQDAQKASGAVKGQGITVMA
FT                   QAESILLGTFAASTEEQMSEPASQPCAQEKSMEKTRELKAEALARHTMHGETNEGLCGV
FT                   LGIFGVGVALIGLSLIVEAVCGGLDSDVGCEEKAPDNPEKPEPEPAPPPRTEEPTKISK
FT                   VPPPAVEQAEGFDKQKFMPKQQECVPQENKGVTIKKAGAW"
FT   gene            423763..424068
FT                   /locus_tag="CPC231_02080"
FT                   /old_locus_tag="CpC231_0413"
FT   CDS_pept        423763..424068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02080"
FT                   /old_locus_tag="CpC231_0413"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09903"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEI0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241266.1"
FT                   /protein_id="ADL09903.1"
FT                   /translation="MVNAEEEFQRRVENLEKQRQAAVNNYADFAKEFRATVARRMEEFE
FT                   RELKKSQEIVEKARQRGEARAAEKFRSDRIDNASSLRGMAPDRGRRGRVKSVLRRV"
FT   gene            complement(424118..424960)
FT                   /locus_tag="CPC231_02085"
FT                   /old_locus_tag="CpC231_0414"
FT   CDS_pept        complement(424118..424960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02085"
FT                   /old_locus_tag="CpC231_0414"
FT                   /product="alpha/beta hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09904"
FT                   /db_xref="GOA:D9QEI1"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR041127"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEI1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241267.1"
FT                   /protein_id="ADL09904.1"
FT                   /translation="MADKFSKHLATLSKRGRHRVLVGDLDYAGLPGKIYTPAEGNGLPA
FT                   IVFAHDWLKDISVYHATLRHLASWGFVVAAPNTEKGFSPNHRGFAADIETSLQILTGVK
FT                   LGSGNITVAPGRLGIVGHGMGAGAAVLAAVNRPQLAAIAALYPSQTTPSAELASGNVEA
FT                   PGLILGTEDNALFDYGNAAKLAAHWKGEVAYREIDGTSHNAITEDTFFKLVTGQGRSKA
FT                   TSREKIRGLVTGFLLHRLTNENKYSAFSQPEAESKKITSYWGDALEKRALISAEPESI"
FT   gene            425116..426228
FT                   /locus_tag="CPC231_02090"
FT                   /old_locus_tag="CpC231_0415"
FT   CDS_pept        425116..426228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02090"
FT                   /old_locus_tag="CpC231_0415"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09905"
FT                   /db_xref="GOA:D9QEI2"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEI2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014401000.1"
FT                   /protein_id="ADL09905.1"
FT                   /translation="MNLLEARIDLAAIAHNTRLIKDKAAAQGAQLMCVVKADGYNHGAV
FT                   EVATVMEENGADQFGVATIGEGLALREGGIESSILSWIWSPEQDLGAAITAEIDLAAIS
FT                   LEHVKALVRASESYGKKPVRVTVKVDTGLHRSGVDKQDWRESFCMLRDAENIQVTGVFS
FT                   HFSSADESDSTETEQQERAFLNAIELGRSLGLELPVNHIANSPATLNRPDLYFDMVRPG
FT                   LALYGHEPIPGESHGLREAMSWVGRVTVVKPIARGEGTSYGLTWRAEQDGYLCVVPVGY
FT                   ADGLPRSAQGHLEITIGGRRYPQVGRVCMDQIVVALGENPYGVAQGDEAVILGPTGMTA
FT                   TELATAMGTINYELVCRPCGRTVRVFEHSD"
FT   gene            426380..426874
FT                   /gene="tsaE"
FT                   /locus_tag="CPC231_02095"
FT                   /old_locus_tag="CpC231_0416"
FT   CDS_pept        426380..426874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsaE"
FT                   /locus_tag="CPC231_02095"
FT                   /old_locus_tag="CpC231_0416"
FT                   /product="tRNA
FT                   (adenosine(37)-N6)-threonylcarbamoyltransferase complex
FT                   ATPase subunit type 1 TsaE"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09906"
FT                   /db_xref="GOA:D9QEI3"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEI3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241269.1"
FT                   /protein_id="ADL09906.1"
FT                   /translation="MRDSFPSSGERRLELPADTQALAEQLGAALEPGDVLILDGPLGAG
FT                   KTTFTQGLAKGLQVKGRITSPTFVIAREHKSLIGGPTLIHVDAYRLIDETAGAADPIGA
FT                   LDSLDLETELEDAVVVAEWGGDLVEQISDSYLRISIDRTTAHMENPDSEARIIRWEKIV
FT                   S"
FT   gene            427416..429023
FT                   /locus_tag="CPC231_02100"
FT                   /old_locus_tag="CpC231_0417"
FT   CDS_pept        427416..429023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02100"
FT                   /old_locus_tag="CpC231_0417"
FT                   /product="transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09907"
FT                   /db_xref="GOA:D9QEI4"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEI4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655091.1"
FT                   /protein_id="ADL09907.1"
FT                   /translation="MLDYLATQPLITLVLILALGLALGKIRLFGISLGAAAVLFVALAL
FT                   STIHPALQLPPLIFQLGLAMFVYAIGLNAGAAFFAEFRHRGWKLTLYVIGLLVVLMGIS
FT                   YALITTFDLGSRAAGAGMFAGAISSTPGMAAMVAILEGIDDSLVAEPVVGYSLAYPGAV
FT                   IGSILVAAIGARVLKVNHTQDAEEEGLVMDPLEWTGVRIGPRITGTIAQLPSIVGEEII
FT                   ATRVVHSDSFHSLADPNDRLFEGMVLVINGTTEALDRAIAKLGAPVEVKIEDTDLEYLR
FT                   VTVSSKHVVGRKISELDTVRSGFIIARLRRGDAEVVPEADDVLHYSDRVRVIAPKNRMS
FT                   EVRRFLGDSERQLADVDLLPFAIGLSLGLLIGAIPIPLPGGNTLSLGFGGGPIVVGLIL
FT                   GAMHRTGPIRWSLPYHANRTISTFGLAIFLAGVGTSAGVGFRHALTDPSSLKLIAAGFV
FT                   VTLASALITAAVCMPLLKLKWDEAMGVAAGVTTNPAIISYLNGQTGTELATRGYATVYP
FT                   TAMIGKIVASQMLLLLLL"
FT   gene            429210..429686
FT                   /locus_tag="CPC231_02105"
FT                   /old_locus_tag="CpC231_0418"
FT   CDS_pept        429210..429686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02105"
FT                   /old_locus_tag="CpC231_0418"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09908"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEI5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523074.1"
FT                   /protein_id="ADL09908.1"
FT                   /translation="MNKLARGLFAAIIVAFLVVIIAMIAMAHGRSGTTNKEGALESTLH
FT                   KIGSSNVHVTALSLSDLYGPEWVAGAMICPGATEQSIAQNYGIDTTDLHLNGGQVPEDV
FT                   NYIVMASGDGDIRFEQLNRNEIDVCSVGPQGGFETSSLIPFIKQDGVWKIGTGH"
FT   gene            429804..430478
FT                   /gene="tsaB"
FT                   /locus_tag="CPC231_02110"
FT                   /old_locus_tag="CpC231_0419"
FT   CDS_pept        429804..430478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsaB"
FT                   /locus_tag="CPC231_02110"
FT                   /old_locus_tag="CpC231_0419"
FT                   /product="tRNA
FT                   (adenosine(37)-N6)-threonylcarbamoyltransferase complex
FT                   dimerization subunit type 1 TsaB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09909"
FT                   /db_xref="GOA:D9QEI6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEI6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523809.1"
FT                   /protein_id="ADL09909.1"
FT                   /translation="MLVLALDTATPDLIVGLVRVPSDTDTGVVVAQRILTDSRQHNELL
FT                   TPTVVEILEESGQKFADIDRIVVGCGPGPFTGLRVGMVTAAAFGDALGIPVHGVCTHDA
FT                   IANQLDGQALVATDARRKEIYWSLYSDGVRTMGPGIVAPAELSIPSRISTVSIPEKLGQ
FT                   LLPGPLRDVPQVNLRPLPECLVAVADFSQTPEPLEPLYLRRPDAKEPAPKPRSSAIPKV
FT                   EI"
FT   gene            430479..430970
FT                   /gene="rimI"
FT                   /locus_tag="CPC231_02115"
FT                   /old_locus_tag="CpC231_0420"
FT   CDS_pept        430479..430970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="CPC231_02115"
FT                   /old_locus_tag="CpC231_0420"
FT                   /product="ribosomal protein S18-alanine
FT                   N-acetyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09910"
FT                   /db_xref="GOA:D9QEI7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEI7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366541.1"
FT                   /protein_id="ADL09910.1"
FT                   /translation="MFLRELTAADAPRCAELETLLFSEENPWSVEDLRAAINHPHTLYI
FT                   AVVDSLEKGLILGYAGLAMLGPAHDPEFEIHTIGVDPQFQRQGVARLMMDNITFVADRA
FT                   AGPVFLEVRTTNEPAIRLYESYGFERQGVRKNYYQPSGADAYVMMRTPSAVESNEESGK
FT                   "
FT   gene            430972..432027
FT                   /gene="tsaD"
FT                   /locus_tag="CPC231_02120"
FT                   /old_locus_tag="CpC231_0421"
FT   CDS_pept        430972..432027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsaD"
FT                   /locus_tag="CPC231_02120"
FT                   /old_locus_tag="CpC231_0421"
FT                   /product="tRNA
FT                   (adenosine(37)-N6)-threonylcarbamoyltransferase complex
FT                   transferase subunit TsaD"
FT                   /EC_number="2.3.1.234"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09911"
FT                   /db_xref="GOA:D9QEI8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEI8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522127.1"
FT                   /protein_id="ADL09911.1"
FT                   /translation="MIVLGIESSCDETGVGIIELSPDGSMRILADAVASSMEEHARFGG
FT                   VVPEIASRAHLEAMVPVMRQALDAAGVDKPDAVAATVGPGLAGALLVGASAAKAYAAAW
FT                   DVPFYGVNHLGGHVAVANLEGEELPHSIALLVSGGHSQLLEVQAVGKPMKELGSTLDDA
FT                   AGEAYDKVARLLGLGYPGGPVIDKLAARGNRKAIRFPRGLSRADDLRGEHRYNFSFSGL
FT                   KTSVARYVEKAEREQSVISVEDVCASFQEAVCDVLTHKAILACQDTGAKVLLLGGGVAA
FT                   NSRLRELAAARCQTAGIELRVPRFKLCTDNGVMIAAVAAQLIHEGAPQSGLRIGTDTSL
FT                   EVEIPLVYAAT"
FT   gene            432189..432485
FT                   /locus_tag="CPC231_02125"
FT                   /old_locus_tag="CpC231_0422"
FT   CDS_pept        432189..432485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02125"
FT                   /old_locus_tag="CpC231_0422"
FT                   /product="co-chaperone GroES"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09912"
FT                   /db_xref="GOA:D9QEI9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEI9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_010271321.1"
FT                   /protein_id="ADL09912.1"
FT                   /translation="MANVNIKPLEDRVLVQISEAETTTASGLVIPDSAKEKPQEGVVVA
FT                   AGPGRFDGDDRVPMDIKEGDTVVFSKYGGTELKYNGEEYLLLNARDVLAIIEK"
FT   gene            432497..434119
FT                   /gene="groL"
FT                   /locus_tag="CPC231_02130"
FT                   /old_locus_tag="CpC231_0423"
FT   CDS_pept        432497..434119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="CPC231_02130"
FT                   /old_locus_tag="CpC231_0423"
FT                   /product="chaperonin GroEL"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09913"
FT                   /db_xref="GOA:D9QEJ0"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEJ0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241276.1"
FT                   /protein_id="ADL09913.1"
FT                   /translation="MAKLIAFNQEAREGILKGVDTLANAVKVTLGPRGRNVVLEKAFGS
FT                   PTVTNDGVTIAREIDVEDRFENLGVQLVKSVAVKTNDIAGDGTTTATLLAQAVITEGLR
FT                   NVAAGANPVELNRGILAAADKAVEKLGERAAEVASAADIANVATVSSRDAEIGDMVAAA
FT                   MEKVGKDGVVTVEESQSIESYLDVTEGVSFDKGYLSPYFITDTDSQRAELDDPYILLVR
FT                   NKISSLPDFLPLLEKTVEANKPVLIIAEDVEGEPLQTLVVNSIRKTLRAVAVKSPYFGE
FT                   RRKAFMDDLAVVTNATVVDPEVGINLNEAGVEVFGTARRVTVTKDETIIVDGAGTSEAV
FT                   ENRRQQIRREIENTDSSWDREKAEERLAKLSGGVAVIKVGAATETEVSERKLRVEDAIN
FT                   AARAAAQEGVIAGGGSALVQIAKELRVYAEEFEGDAKVGVNALANALSKPAYWIADNAG
FT                   LDGAVVVSKIADLPNGEGFNAATLEYGNLIEQGIIDPVKVTHSAVVNATSVARMVLTTE
FT                   ASVVEKPVEAKPQAGGHHHHHHH"
FT   gene            complement(434216..434497)
FT                   /locus_tag="CPC231_02135"
FT   CDS_pept        complement(434216..434497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02135"
FT                   /product="WhiB family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910854.1"
FT                   /protein_id="QHI00961.1"
FT                   /translation="MNNTDLLPAPQTQLWDWQLHGACRGTQSEIFYHPEGERGLARRSR
FT                   ERQAKEICSLCPVLRNCRQHALQYAEPYGIWGGLSESERATMLSRRYG"
FT   gene            434797..435387
FT                   /locus_tag="CPC231_02140"
FT                   /old_locus_tag="CpC231_0424"
FT   CDS_pept        434797..435387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02140"
FT                   /old_locus_tag="CpC231_0424"
FT                   /product="sigma-70 family RNA polymerase sigma factor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09914"
FT                   /db_xref="GOA:D9QEJ1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEJ1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241279.1"
FT                   /protein_id="ADL09914.1"
FT                   /translation="MRMMEEKGLAVAETETELSSLVPRAAGGDSRSLQRVISIIYPKVL
FT                   SYARIRLSGGRHPTPEDVAQEICLAVATSISKFVDQGKPFMAFVYGIASNKVADAHRAY
FT                   SRDVANPTEDVPETEVELETPESFALVAAGSNRVKELLDLLGDKPREIITLRVFVGLSA
FT                   EETAEIVGSTPGAVRVAQHRALATLRKALEQEN"
FT   gene            435390..436271
FT                   /locus_tag="CPC231_02145"
FT                   /old_locus_tag="CpC231_0425"
FT   CDS_pept        435390..436271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02145"
FT                   /old_locus_tag="CpC231_0425"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09915"
FT                   /db_xref="GOA:D9QEJ2"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEJ2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366545.1"
FT                   /protein_id="ADL09915.1"
FT                   /translation="MTERRWARDGVEAAQSVEQLRADDQFLTHLSQGVDPTDGQDPLAR
FT                   LFLDARAEIQTNVPQAPTLAMLGLGSAEEFPTGELAPVTNESVDSSQLIDAPAAKVIEL
FT                   PRRRWNNAFAHALVGAAAATLIIAGGGTAIYNAGEGSALYALNQKFFGQTTNTEAVVAL
FT                   ASKLDQANDLNAKGDKEGARQLLEQARELVNMLNARDRAQAEERIKEAERGSNVAPVPP
FT                   PAEPEASSETVVTTMTTTVTETVTVEPTPARSTSTAPSTDRSATSSTSPVASTPSLTPA
FT                   FELPQPEHSQAH"
FT   gene            complement(436285..436697)
FT                   /pseudo
FT                   /locus_tag="CPC231_02150"
FT                   /old_locus_tag="CpC231_0426"
FT   CDS_pept        complement(436285..436697)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02150"
FT                   /old_locus_tag="CpC231_0426"
FT                   /product="hypothetical protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366546.1"
FT   gene            436837..438357
FT                   /gene="guaB"
FT                   /locus_tag="CPC231_02155"
FT                   /old_locus_tag="CpC231_0427"
FT   CDS_pept        436837..438357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="CPC231_02155"
FT                   /old_locus_tag="CpC231_0427"
FT                   /product="IMP dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09916"
FT                   /db_xref="GOA:D9QEJ3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEJ3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800061.1"
FT                   /protein_id="ADL09916.1"
FT                   /translation="MTQQRVSTGGDNPDKVALVGLTFDDVLLLPDASDVIPSEVSTSTQ
FT                   LTRNISLNIPIISAAMDTVTESRMAIAMAREGGMGVLHRNLSIEEQAQHVETVKRSESG
FT                   MVTDPVTCSPDMSIAEVDALCARFRISGLPVVDDNGTLLGICTNRDMRFEQDFSIKVSE
FT                   IMTRMPLVVAEEGVTKQQALNLLSANKVEKLPIVDKQGKLVGLITVKDFVKTEQYPHAS
FT                   KDSTGRLLVGAGIGVGEESWTRAGALVDAGVDVLVVDSAHAHSSGVLDMVSRVKKEWGD
FT                   RVDVIGGNLATRSAAKAMIEAGADAIKVGIGPGSICTTRVVAGVGAPQITAIMEASVPA
FT                   HAAGVPIIADGGMQFSGDLAKALAAGASSVMLGSMLAGTAEAPGEIVVVGGKQYKRYRG
FT                   MGSMGAMQGRGLSGEKRSYSKDRYFQADVKSEDKLVPEGIEGRVPFRGSIEAITHQLVG
FT                   GLRASMGYTGSATINDLWNARFVQITSAGLRESHPHHIQQTVEAPNYH"
FT   gene            438385..439527
FT                   /locus_tag="CPC231_02160"
FT                   /old_locus_tag="CpC231_0428"
FT   CDS_pept        438385..439527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02160"
FT                   /old_locus_tag="CpC231_0428"
FT                   /product="GuaB3 family IMP dehydrogenase-related protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09917"
FT                   /db_xref="GOA:D9QEJ4"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005992"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEJ4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241284.1"
FT                   /protein_id="ADL09917.1"
FT                   /translation="MRDYVEIGIGREARRTYDLDDIAVVPARRTRSSKDVDTTWHIDAY
FT                   TFKVPFMSHPTDALASPEFVIEMDKQGGLGVINAEGLWGRHEDLDSVIKEIVEAHGQDE
FT                   LDLASFGRATKKLQELHAAELDKDLLTERIAQVRDSGAVVAVRVSPQKCRELAPLLIKA
FT                   GVDLLIIQGTIISAEYVETSGEPLNLKEFIGSIDVPVIAGGVSDYTTALHLMRAGAVGI
FT                   IAGGGSNTNDLALGIDDSLATAIADVAAARRDYLDETGGRYVHVIADGNINNSGQAVKA
FT                   IACGADAVILGEPLARATEAAGKGLFWPSAAAHPRFPRGIVGTVGIIPTTERVSLEVVL
FT                   HGPSANVFGEENFVGGLKRALAKCGYTDLKSFQKVELTIR"
FT   gene            439690..441543
FT                   /locus_tag="CPC231_02165"
FT                   /old_locus_tag="CpC231_0429"
FT   CDS_pept        439690..441543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02165"
FT                   /old_locus_tag="CpC231_0429"
FT                   /product="amino acid transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09918"
FT                   /db_xref="GOA:D9QEJ5"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEJ5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014401007.1"
FT                   /protein_id="ADL09918.1"
FT                   /translation="MTHLVKRDRRLQESPATKHPWWKVMCLTGVDYYSTLGYQPGIAVV
FT                   AAGVLAPIATLVLVAVTMLGAVPVYRRIARESPDGQGSIAVLSHFVHGWKGKFLILVLL
FT                   GFAATDFTITMTLSASDATAHLLHTTSSPWTIPLTIAMLASLALVFYRGFTEAIRVSVV
FT                   LVSVYLFLTFVIVLAGLIRIGSHPSTVENWWHSVLVAHPQPLSIALVALLVFPKLALGL
FT                   SGFETGVAVLPQIDGGAEGRAGRVRAGRKLLLVAASIMSVFLITSSIVVTLLVPAEALT
FT                   GPASGRALAYLAHEQFGPLFGGAYDLVTVVILWFAGASAMAGMINLIPRYLPRYGMAPA
FT                   WVVKTRPMVKVVAVITFAVAIIFRANVDKQSGAYATGVLVLLLSGALAVTLSSAADARR
FT                   KVGPRWKPYAYGLVTLVLGYTTVTNMVVRPEGLKVAFWFIVAIIVVSVASRMRRAFELR
FT                   SPIIAYDEKALRIIDSACGPFAIIAHSLGAADPAEYERKEHEVRTRNHIPDLQSVIFLE
FT                   VGVRDASEFNSALMVTGHVCGDHRILRTEAAAVPNAIAALATDLHHRGNVDLYFSWSPG
FT                   SPVRDMLRYLAIGKGQNAVVVHEIIRRANKDGKPHPHVHLG"
FT   gene            441604..443181
FT                   /gene="guaA"
FT                   /locus_tag="CPC231_02170"
FT                   /old_locus_tag="CpC231_0430"
FT   CDS_pept        441604..443181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="CPC231_02170"
FT                   /old_locus_tag="CpC231_0430"
FT                   /product="glutamine-hydrolyzing GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09919"
FT                   /db_xref="GOA:D9QEJ6"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEJ6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599843.1"
FT                   /protein_id="ADL09919.1"
FT                   /translation="MTQQTPQKHNPVLVVDFGAQYAQLIARRVREAKIYSEVVPHTATV
FT                   EEIKAKNPAALVLSGGPSSVYETGAPSLDPALLELGIPVFGICYGFQAMTHALGGTVAN
FT                   TGNREYGCTELIVDGGILHDGLEKAHKVWMSHGDAVSQAPEGFVVSAHSEGAPVAAFEC
FT                   AEKRMAGVQYHPEVLHSPHGQEVLVRFLTEIAGLEQNWTAANIAEELIQAVREQVGPEG
FT                   RAICGLSGGVDSAVAGALVQRAIGDRLTCVFVDHGLLRAGEREQVEKDFVASTGAKLVT
FT                   VDERAAFLNKLAGVTDPEAKRKAIGAEFIRSFERAVAGVLESAPEGSSVDFLVQGTLYP
FT                   DVVESGGGAGTANIKSHHNVGGLPDDVEFKLVEPLRLLFKDEVRAVGRELGLPEEIVNR
FT                   QPFPGPGLGIRIIGEVTEDRLETLRAADLIARTELTAAGLDDQIWQCPVVLLADVRSVG
FT                   VQGDGRTYGHPIVLRPVSSEDAMTADWTRLPYEVLEKISTRITNEVPDVNRVVLDCTSK
FT                   PPGTIEWE"
FT   gene            443323..443772
FT                   /locus_tag="CPC231_02175"
FT                   /old_locus_tag="CpC231_0431"
FT   CDS_pept        443323..443772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02175"
FT                   /old_locus_tag="CpC231_0431"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09920"
FT                   /db_xref="InterPro:IPR028276"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEJ7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525364.1"
FT                   /protein_id="ADL09920.1"
FT                   /translation="MIIDTYWGKFFGDSADSRTLTQYLGSKSEVVTVEEIFQDFNLDEL
FT                   HGNYTEASLDGAGFHFDSAFQVVLDLSVLILESKKVGRFNLARIGGPHDRMMRIDATSE
FT                   RILPLAIALKHFALSPEDYRLEHIDESDWYELGNLCEEIRAQLDS"
FT   gene            complement(443778..444830)
FT                   /locus_tag="CPC231_02180"
FT                   /old_locus_tag="CpC231_0432"
FT   CDS_pept        complement(443778..444830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02180"
FT                   /old_locus_tag="CpC231_0432"
FT                   /product="PspC domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09921"
FT                   /db_xref="GOA:D9QEJ8"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEJ8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366550.1"
FT                   /protein_id="ADL09921.1"
FT                   /translation="MESMNETLHQMWDARPVRLPREQGSEAKFLGVCEGIGVRYQIDPT
FT                   LVRIFFVLFAFFGGGFLLYLIAWLIMPKYSLVKAPVDLTLHQDDSVKNSKILRSERNTG
FT                   WILILVIFLIIFSSSSSGTAFFRTGYFTSFIVFFLAWYLLHQRTPEPPVGLLQRHPDSS
FT                   GPQVDLSAYSPIEGFDAPLAAPQPPAWDPLETAPFAWDLPEPGPAPQQKKPRNPLIRGL
FT                   AWFAGGLVIVGIIIAAMAGAPERIDDSFGDIDAHPTNAAQLADSYILRAGDIDLDLSRM
FT                   ADLDKPRHVRVQTKIGDVHVRLPQNIRVQVSCGTRIGDKRCSEGLHNPDAQGETLNLRV
FT                   TSGVGDVTVQ"
FT   gene            444935..446095
FT                   /locus_tag="CPC231_02185"
FT                   /old_locus_tag="CpC231_0433"
FT   CDS_pept        444935..446095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02185"
FT                   /old_locus_tag="CpC231_0433"
FT                   /product="PspC domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09922"
FT                   /db_xref="GOA:D9QEJ9"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEJ9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910866.1"
FT                   /protein_id="ADL09922.2"
FT                   /translation="MQQAYPPFYRDRDNNVIGGVAAGLARYFGLSMMQVRIGLAALALL
FT                   NGAGVMVYAALWIFTTSRSFRKESSILSGKTSETSAWAKPTNLLLAIAALAGAFGVSGF
FT                   FGKSVGISSGVVAAFAVIGAGVLLAWLAYDRINSDYAVVMIGVGASLVFAGVLFAAVQW
FT                   QDRQFFGSAVITVVLTLAGVAALVAPFVVRVVQKLNAGQVEKAAADERAEIAARIHDSV
FT                   LQTLALIQKRSEDPEVRRLARGQERELRQWLFSPREDATVFKAIERACGEVEDMFAITI
FT                   SPVIVGEDRPLEASTKSAVLAAREAMVNAAKHSGQDSADVYAECFDELAIFVRDRGPGF
FT                   DLETVDESRHGVRDSILGRVKRAGGDVQIHNSAGTEVAIRMPFKKQ"
FT   gene            446100..446777
FT                   /locus_tag="CPC231_02190"
FT                   /old_locus_tag="CpC231_0434"
FT   CDS_pept        446100..446777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02190"
FT                   /old_locus_tag="CpC231_0434"
FT                   /product="response regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09923"
FT                   /db_xref="GOA:D9QEK0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEK0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241290.1"
FT                   /protein_id="ADL09923.1"
FT                   /translation="MKVFLVDDHSVFRAGVRAEIGGAVEIVGEAGTVSEAVADIDATRP
FT                   DVVLLDVHMPDGGGVAVLRGVTSPARFLALSVSDAAEDVISVIRAGARGYVTKTISGAE
FT                   LIDAITRVHTGDAVFSPRLAGFVLDAFARPDPMGAGVVDSPETDREVEEGKQVSDPIVD
FT                   ALTRRELEVLRLLARGYTYKEIGAQLFISVKTVETHASNILRKTQQSNRHALTRWAHSR
FT                   DLD"
FT   gene            complement(446781..447413)
FT                   /locus_tag="CPC231_02195"
FT                   /old_locus_tag="CpC231_0435"
FT   CDS_pept        complement(446781..447413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02195"
FT                   /old_locus_tag="CpC231_0435"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09924"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEK1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241291.1"
FT                   /protein_id="ADL09924.1"
FT                   /translation="MNEHPVSSCSRWKLPAAAFAVALSITGLTACSTDKASAPTDAVDS
FT                   ASTHSDLPSAPASSSNAGLTPLGDANKEAKTQRPEKSESIVTGVRVGHHETFDRVVFNI
FT                   EGSGNPGWFVDYTSSPTQQASGKPIQVRGKTALNVNIDGTLLPFELGKQDPRIGTVQGV
FT                   GNITEVKAAGTVEGRSQFVIGLDAEHPYSVQIVPNPTRVVIDIRSQS"
FT   gene            447592..448464
FT                   /locus_tag="CPC231_02200"
FT                   /old_locus_tag="CpC231_0436"
FT   CDS_pept        447592..448464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02200"
FT                   /old_locus_tag="CpC231_0436"
FT                   /product="sucrase ferredoxin"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09925"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="InterPro:IPR010350"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEK2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241292.1"
FT                   /protein_id="ADL09925.1"
FT                   /translation="MVMTDLCSDVHIEPLPGTSRVGDTYVLLEHTGAWSHDILDGKTFT
FT                   AEVSSQLKALDVGLYLIRKPGRAGHVDKPLKTVYLVFGSVGIAETLVVEKAEDICSLDL
FT                   SGPGKNGAVRVEDPILLICTHAKRDACCAIKGRPIAASLCRAFPEAPIWECSHTKGHRF
FT                   APSMVLMPWGYAWGRLNEVASQELYRTARRGELFLPGCRGRGLWEPEGQVAEIAVAEHV
FT                   ASNGEKPQLGQFVWERIDDSSLITEASGGRSWAVSMHEAEVEGVVASCGSPPTTGKAWF
FT                   VDSVVQQRR"
FT   gene            complement(448596..449273)
FT                   /locus_tag="CPC231_02205"
FT                   /old_locus_tag="CpC231_0437"
FT   CDS_pept        complement(448596..449273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02205"
FT                   /old_locus_tag="CpC231_0437"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09926"
FT                   /db_xref="GOA:D9QEK3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEK3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599869.1"
FT                   /protein_id="ADL09926.1"
FT                   /translation="MTTQILAANWSRLGDTFTSAIVDTLIMVSVTLVVGGLLGLALGIL
FT                   LYTTRAGGILHNKFIYTIINILVNFVRPIPFIIMITAFGPLTLAVVGTTIGREAAMFIM
FT                   SIAATFAVARIVEQNLVTIDPGVIEAARSMGASPWKIITSVIVPEALGPLVLGYTFIFI
FT                   AIVDMSAMAGYIGGGGLGDFAIVYGYRAYDWEVTYVATFVIILIVQIAQLFGNWLSKKI
FT                   MRR"
FT   gene            complement(449270..450292)
FT                   /locus_tag="CPC231_02210"
FT                   /old_locus_tag="CpC231_0438"
FT   CDS_pept        complement(449270..450292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02210"
FT                   /old_locus_tag="CpC231_0438"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09927"
FT                   /db_xref="GOA:D9QEK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEK4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_016829848.1"
FT                   /protein_id="ADL09927.1"
FT                   /translation="MNGTRIEFEDITKVFSSGKKNITALDGVTLTVEPGEILGVIGYSG
FT                   AGKSTLVRMINGLDFPTSGHLRLDGTDIVGMPEKKLRSIRAGIGMIFQQFNLFTSRTAA
FT                   GNIEYPLKLAGVDKQERKKRVDELLTFVGLSDRGGNYPEELSGGQKQRVGIARALANNP
FT                   ALLLADEATSALDPETTHEVLDLLRKVNRELGITIVVITHEMDVIRSIADKVAVMESGK
FT                   VVEYGSVYEVFSHPQTRVAQRFVATSLRNTPDAIESEDLLAHEGRLFTITLSEDSGFFT
FT                   AAAQAKDAGAGIGIVHGGITTLQKHSFGKVTVRLTGPDNVIDSFFDYLSTTTDIQEIQR
FT                   "
FT   gene            complement(450347..451204)
FT                   /locus_tag="CPC231_02215"
FT                   /old_locus_tag="CpC231_0439"
FT   CDS_pept        complement(450347..451204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02215"
FT                   /old_locus_tag="CpC231_0439"
FT                   /product="methionine ABC transporter substrate-binding
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09928"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEK5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014836019.1"
FT                   /protein_id="ADL09928.1"
FT                   /translation="MNIRHSIATIAAAAIAATGLVACSSDRIDDSVRIGTTDSTKKAWT
FT                   VWKDKAAEAGIALDVVEFSDFSTPNQALSQNQLDVNLFQHLKFLAEYNVKSGSDLVPVG
FT                   STEIIPLALFWKGHDSLDGIEGNSVAIPNDPTNQARALNVLVAAGLLKLKDGSPDLPAP
FT                   ADIDKEQSKVSVTPVEAASAPAAYGEGKPAVINNTFLDRAGIDAKTTIFQDDPSSAESE
FT                   PYINVLVAKKENKDDPRWQKLIELWHTPEVQDALAEDSKGTSVEVKRSPEELQQILDRL
FT                   QKQS"
FT   gene            complement(451417..452286)
FT                   /locus_tag="CPC231_02220"
FT                   /old_locus_tag="CpC231_0440"
FT   CDS_pept        complement(451417..452286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02220"
FT                   /old_locus_tag="CpC231_0440"
FT                   /product="methionine ABC transporter substrate-binding
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09929"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEK6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366558.1"
FT                   /protein_id="ADL09929.2"
FT                   /translation="MKLRRSLAIIAASTLAATGLVACSSDAKDGTTTIKIGTTDSTKKA
FT                   WSAFEDKAKEAGIKLSIVDFSDYSTPNDALNQNQIDVNLFQHLKFLAEYNTGKGADLTP
FT                   IGATEIVPLALFWKDHDSLDGIEGESIAIPNDSSNQGRAINVLVQAGLLKLKHDGIVTP
FT                   APADIDEGASKVKVTPIDAAQTTAAYGEGKPAIINNSFLDRAGIDPKLAVFQDNPESQE
FT                   AEPYINAFVTKADKKDDPNINKLVELWHSPEVQEGVKEDSKGTSVEVKRSPEELQKILK
FT                   RLEEAQGK"
FT   gene            complement(453127..453714)
FT                   /locus_tag="CPC231_02225"
FT                   /old_locus_tag="CpC231_0441"
FT   CDS_pept        complement(453127..453714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02225"
FT                   /old_locus_tag="CpC231_0441"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09930"
FT                   /db_xref="GOA:D9QEK7"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEK7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241297.1"
FT                   /protein_id="ADL09930.3"
FT                   /translation="MGTTLIDRNAEVCAYGVVTKTVRCGHFSTHSTATFNDGIENGGIA
FT                   HYNSTPHSKPGDSGGPVWLKETKELIGVHYGAQTGYSRVTLLPRKNGKVKLPDDAAIPG
FT                   RDSDMPPITSVPSTSEIADPIIPVEPGIIAPEDIPSSDTDQKTPSTPSHKVSSPGPIIG
FT                   IIAAVAAVFGIAAFGMAQVFGLPGISLLPRNF"
FT   gene            complement(453695..454177)
FT                   /locus_tag="CPC231_02230"
FT                   /old_locus_tag="CpC231_0441a"
FT   CDS_pept        complement(453695..454177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02230"
FT                   /old_locus_tag="CpC231_0441a"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0441a"
FT                   /db_xref="EnsemblGenomes-Tr:AEK49238"
FT                   /db_xref="UniProtKB/TrEMBL:F9Y340"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241298.1"
FT                   /protein_id="AEK49238.1"
FT                   /translation="MLNSWKSQVSRAFSARFGRQILVAIMATALISTGHSAVPSAVAVE
FT                   PFRMERTADNKPILRQGDKFRIKWGSRGHKVGTFCTVGYIDQERKLIFSAAHCVGSRRA
FT                   TFHLADWSDLGTLAYMPKDINPLIGGDFIAIDYSKNADRIVVENPYADHLHGDNPY"
FT   gene            454523..455479
FT                   /locus_tag="CPC231_02235"
FT                   /old_locus_tag="CpC231_0443"
FT   CDS_pept        454523..455479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02235"
FT                   /old_locus_tag="CpC231_0443"
FT                   /product="zinc ABC transporter solute-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09932"
FT                   /db_xref="GOA:D9QEK9"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEK9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014401009.1"
FT                   /protein_id="ADL09932.1"
FT                   /translation="MSKLVRGLAAGMVVSLALVGCSSAGNNKDKSHNKLGIVATTTQIC
FT                   DYVKNIDADVNLTCLLAPNASAHEHEMTREQMDALSKADLLLKNGIDLESFLDNAVTSS
FT                   GFAGTTVDTSEGVSVAKWPFPPEEGESQPEFTHDPHIWTSPRNAKIQVENIGKALEKAD
FT                   PDNAAEYKKHVDGYVKKLVDLDKWISESLASVPEPERILFTSHDAFGYFSRDYNVKFIG
FT                   AALSDFNSQQDATADHINSAAAQVRESGTKVIFAENSNSSRSIEAVAKAAGVKLGGELY
FT                   GDSLGPDVSYIQSIVHNVETLVEGWGGKLAEKPASLG"
FT   gene            455561..456319
FT                   /locus_tag="CPC231_02240"
FT                   /old_locus_tag="CpC231_0444"
FT   CDS_pept        455561..456319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02240"
FT                   /old_locus_tag="CpC231_0444"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09933"
FT                   /db_xref="GOA:D9QEL0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEL0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014836023.1"
FT                   /protein_id="ADL09933.2"
FT                   /translation="MNTDNTTTRNTDVNSPVLQFDNASFAYGKGPSRNVALQGVTGKLY
FT                   PGEALALIGPNGAGKTTLLKGIVGIVDSFQTIVDRGANNSIGYVPQSADLDLTFPVTAR
FT                   DVVAMGLYNESGWKPTFLRKNPAKDPRVDAALTRVGLLDRASKRFGELSGGQRQRVLIA
FT                   RALVATPKLVLLDEPFNGLDEPNRKELLRIIDAAKREGVAVVVSTHDLLLAEETCDKAL
FT                   LLAGRQIAFGAINDVMTPDLISRAYGGTRG"
FT   gene            456312..457154
FT                   /locus_tag="CPC231_02245"
FT                   /old_locus_tag="CpC231_0445"
FT   CDS_pept        456312..457154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02245"
FT                   /old_locus_tag="CpC231_0445"
FT                   /product="iron chelate uptake ABC transporter family
FT                   permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09934"
FT                   /db_xref="GOA:D9QEL1"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEL1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241301.1"
FT                   /protein_id="ADL09934.2"
FT                   /translation="MVNELAQLLNIPPYLLRPIILLTVLGIVSGLVGVIVNLRKLEFNA
FT                   EAVVHAVFPGIVAGAVFGGRESIIPYASVVAVVVAVVLTFASRRSEAGTAIVLTSFFSV
FT                   GIVLSLRKGDLSGQLEALMFGRLLESTDKRLGEALIVCAIAILIMVITWRNQIFVAFDR
FT                   LGAKATGVNVVLYDAAINVAIAAVVVSASTAIGTLLVIGYLVIPGAAARLVSTRIRYMV
FT                   PLAMAVGLIGGYIGLWITGVSARISPQAAVALSVVAMYFLALGLSKVGRRTEKSDASC"
FT   gene            457148..457957
FT                   /locus_tag="CPC231_02250"
FT                   /old_locus_tag="CpC231_0446"
FT   CDS_pept        457148..457957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02250"
FT                   /old_locus_tag="CpC231_0446"
FT                   /product="metal ABC transporter permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09935"
FT                   /db_xref="GOA:D9QEL2"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEL2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014401011.1"
FT                   /protein_id="ADL09935.1"
FT                   /translation="MLIDVLTVPILELIIVGALCGLVGVFALLKQRVFFTESVTHATFP
FT                   GAIVGVVILGRDGLYLGALIMCVFMAVAMRWLTRIHGQSSQASAGIILTVSFALGYFLN
FT                   KWFAPLPIRIEGFLAGSVLTVRILDAVIAGVVLVVSVGIVNSFQKHLIYYSFDEMGFRA
FT                   AGGNVKLAESLILGMIVATVVCVIPAIGTILSIALIAAPTAGLLLLVSSPSKLLWLAPM
FT                   VGVIIGLAGLGIAVVFNLSAGGTIAVVAGVFYGVCMSLSSLKSPRTT"
FT   gene            457915..458595
FT                   /locus_tag="CPC231_02255"
FT                   /old_locus_tag="CpC231_0447"
FT   CDS_pept        457915..458595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02255"
FT                   /old_locus_tag="CpC231_0447"
FT                   /product="metal-dependent transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09936"
FT                   /db_xref="GOA:D9QEL3"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEL3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014306562.1"
FT                   /protein_id="ADL09936.3"
FT                   /translation="MHVSELPQKSQDYLKNVWDLHEATGKPVPLGELATRMSEKTSTAS
FT                   EAVKKLVARGFLDHERYGGILLTEAGNALATQVVRRHRLIEMFLFDTLGYTWDEVHEEA
FT                   EVLEHALSDRLLERIDAHLGHPTRDPHGDPIPSQEGIVDSIPTRELGEFEIGETVIVER
FT                   IHDRDPDLLRYLAGHGVLPGVSVTIKQPVYPGMSLISVDGKDVPLADASLWAINVTEAE
FT                   ASKG"
FT   gene            complement(458614..459144)
FT                   /locus_tag="CPC231_02260"
FT                   /old_locus_tag="CpC231_0448"
FT   CDS_pept        complement(458614..459144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02260"
FT                   /old_locus_tag="CpC231_0448"
FT                   /product="tRNA (cytidine(34)-2'-O)-methyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09937"
FT                   /db_xref="GOA:D9QEL4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEL4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366562.1"
FT                   /protein_id="ADL09937.1"
FT                   /translation="MHFLERIVDSFQNRSKITFMSAFAHIIFDQPVIPPNTGNAIRMCA
FT                   GTGAHLHLAGPLGFNLEEKNLRRAGLDYHDLAEVSIHENLERCFDSLPHTRIFAFTTHG
FT                   KTHHSDIRWESGDALLFGTEPTGLAEETLVHPRITQLVRIPMLPGRRSMNLSNAAAVAA
FT                   YEVWRQLGYQGGV"
FT   gene            459156..460001
FT                   /locus_tag="CPC231_02265"
FT                   /old_locus_tag="CpC231_0449"
FT   CDS_pept        459156..460001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02265"
FT                   /old_locus_tag="CpC231_0449"
FT                   /product="bifunctional methylenetetrahydrofolate
FT                   dehydrogenase/methenyltetrahydrofolate cyclohydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09938"
FT                   /db_xref="GOA:D9QEL5"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEL5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525380.1"
FT                   /protein_id="ADL09938.1"
FT                   /translation="MTAIKLDGKLYRDEIFADLEDRVQTLKEKGIVPGLATVLVGDDPA
FT                   SHSYVKMKHSDCEQIGIRSIRRDLPADISQEELLNVIDELNNDPSCTGYIVQLPLPKHL
FT                   DENAVLERIDPDKDADGLHPVNLGKLVLNEDAPLPCTPNGAIHLLKRFGIEIAGKKVVV
FT                   IGRGVTVGRPIGLMLTRRSENATVVLCHTGTKDLTKETLQADIIVAAAGQPHMITADMV
FT                   KPGAAILDVGVSRKDGKLLGDVHPDVWDIAGAISPNPGGVGPLTRAFLIRNVVERAELG
FT                   "
FT   gene            459994..460320
FT                   /locus_tag="CPC231_02270"
FT                   /old_locus_tag="CpC231_0450"
FT   CDS_pept        459994..460320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02270"
FT                   /old_locus_tag="CpC231_0450"
FT                   /product="DUF3017 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09939"
FT                   /db_xref="GOA:D9QEL6"
FT                   /db_xref="InterPro:IPR021385"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEL6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523080.1"
FT                   /protein_id="ADL09939.2"
FT                   /translation="MVKISPLDNPHDIGRKESKIPSGIQYIGLSLFVIAVAISGVYSLT
FT                   EHWRRATFVLGTALLWLAVLRLTCDSKVLGVLSIRSRAFDVMYASAVGGAMVFLSYSID
FT                   SLGS"
FT   gene            complement(460327..461427)
FT                   /locus_tag="CPC231_02275"
FT                   /old_locus_tag="CpC231_0451"
FT   CDS_pept        complement(460327..461427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02275"
FT                   /old_locus_tag="CpC231_0451"
FT                   /product="HNH endonuclease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09940"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEL7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241306.1"
FT                   /protein_id="ADL09940.1"
FT                   /translation="MVGFRHTDTSNSVSAFQMSINRQLITFWLHQVPEKEEDFHTQVDA
FT                   LSISMNISRHEAKSGLRVGVMLRNFPKLLSCLQTHWHLDMPRLVILEKHLMAINKNLLP
FT                   QVDSYLCEYFTPQVSGQVIPQKATLSKHIRNYIEGIDPPAAQRPQDQQQRTASFKRGLD
FT                   GYTRLSVTMTDAEACVLQQALKKQPGAELIDSFMNLIDKKITTKVILNVFKGTDGLMRM
FT                   VDGGIIDSSAIDATRVIDADAYTDSYHPTDEIRAAVQLLDGSCRYPNCTVSAQHCDIDH
FT                   VINHDENGPTTPDNLACLCRFHHNFKTEQRVHYSIDENRVATWYFPNGVIKKSQPGGVK
FT                   RPPRFGQSWKKHEEQRMRARRQANRS"
FT   gene            complement(461710..462801)
FT                   /pseudo
FT                   /locus_tag="CPC231_02280"
FT                   /old_locus_tag="CpC231_0452"
FT   CDS_pept        complement(461710..462801)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02280"
FT                   /old_locus_tag="CpC231_0452"
FT                   /product="homoserine O-acetyltransferase"
FT                   /note="internal stop; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366566.1"
FT   gene            complement(462880..463383)
FT                   /locus_tag="CPC231_02285"
FT                   /old_locus_tag="CpC231_0453"
FT   CDS_pept        complement(462880..463383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02285"
FT                   /old_locus_tag="CpC231_0453"
FT                   /product="hemin receptor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09941"
FT                   /db_xref="GOA:D9QEL8"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEL8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800078.1"
FT                   /protein_id="ADL09941.1"
FT                   /translation="MNTSTTSAFKNLYPDVDPTQGLPLNWSERLSITFSCATLAFGAVF
FT                   GDLIIVGAGLIFILFSTIAPAQKTARRIRTEAKNRFPTQPWAENAKSSGRRQILLIVLF
FT                   WVAITAVCIGLFLAAPHISQLLAASIAAAITGILTWFMPGMSSIWRKGSGGRRQARKHM
FT                   RTAA"
FT   gene            463584..465431
FT                   /locus_tag="CPC231_02290"
FT                   /old_locus_tag="CpC231_0454"
FT   CDS_pept        463584..465431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02290"
FT                   /old_locus_tag="CpC231_0454"
FT                   /product="hemin receptor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09942"
FT                   /db_xref="GOA:D9QEL9"
FT                   /db_xref="InterPro:IPR007331"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEL9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241310.1"
FT                   /protein_id="ADL09942.1"
FT                   /translation="MLKPRKLVLGLMSVAALATAPLSVVFASHAYAAEEQCSFDWGIKQ
FT                   TFRYYMLKGAAGQTGGQWATEGIGFSGSDTGHDGAFNFTPSKARVEGTTATIPFGGLIH
FT                   FKGHDHGGGVYLLDMTLSDWKVVTNGSSAEIKVDYVSYESDMSNTHERGAQITGDDVTI
FT                   ATINLSNYADPSSGSVDLSGTTTLTSEGAKLFIAYQAGETMDDTRGHVRLDGQCSPSIE
FT                   GGNGSGGSTGGKKRALSSIKGNFTGFNKEAMSILSETNDTMNATTIFMDNAGHFLDSLK
FT                   DFETRGTGAGKTNSTTRTTRGSNATAANGQDSGKNRQFLPKTENQTPPSPSQQTAGNTT
FT                   PQTCESDSKGIESATARWGVKKSFQSYITGSIAKGKWSLDQTTHSGGQFVFSGKSGAVD
FT                   VAKRSGKIKFAGGVNFSGHNGILDLRISNIAIGFNGNSGVMYADVRSSDLQGNKSDYGH
FT                   IPLANLSFASLDLSDSKVSGKASATLTKEGAGAFAGFYEAGTELDPVDFDAGLGGSADC
FT                   DSSVAKAGANTATSNGAKKASGTTASAKQGDKDDSEESSIDSQNPQETGYKNGAKNFKI
FT                   RQASDDKDGIDPNMYLLLIVAGFVIAGGSMGRLVLNNPS"
FT   gene            465557..466612
FT                   /locus_tag="CPC231_02295"
FT                   /old_locus_tag="CpC231_0455"
FT   CDS_pept        465557..466612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02295"
FT                   /old_locus_tag="CpC231_0455"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09943"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEM0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525386.1"
FT                   /protein_id="ADL09943.1"
FT                   /translation="MNKFVRVAASVACALALVSCGVQGSYDSTKELRESFPTDVKDPRS
FT                   FKGVSEVKNFDDVQPVADSVSPKLPVKLTDADGYEVEVTDVSRILALDIYGTYTKTLEG
FT                   LGLTKNIVGRTVSSTENALKDLPVVTEGGHTINVEAVLNLRPSLVIVDHSIGPRDAIDQ
FT                   IRAAGVTTVVMEPTRTIDSVSEDIKNLGGVVGLNDEAVKLAERSVNEIHSAQEAIKEIA
FT                   PKDPMKMAFLYARGNGGVFFIMGDGTGAKDLIEGLSAVDLAAEHKLSYAEPANAEALAK
FT                   INPEAIIMMSGGLESTGGIDGLLSRPGVAQTTAGKNKRVITIPDGQSLAFGPLTGQTLL
FT                   RTAQALYAPQT"
FT   gene            466596..467648
FT                   /locus_tag="CPC231_02300"
FT                   /old_locus_tag="CpC231_0456"
FT   CDS_pept        466596..467648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02300"
FT                   /old_locus_tag="CpC231_0456"
FT                   /product="iron chelate uptake ABC transporter family
FT                   permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09944"
FT                   /db_xref="GOA:D9QEM1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEM1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655115.1"
FT                   /protein_id="ADL09944.2"
FT                   /translation="MLRKRSTSVRDVFEHRARRRAILFIVLAGLAFVAFVTSLALGQYY
FT                   VPLQDLPFILFNRGDEGLTTSVVWEIRLPRIVLGLLVGACLGVAGTLMQAVFANPLAEP
FT                   SIIGVTSGAGVGAAAVIVFNIGFLGTFTVPVAAFISAVLVTVIIYQLARHQGKVAVVNL
FT                   ILTGIAINAVCNALISFLVYLAPTANREQIVFWQMGSLNGSQWKHVWVVLPIAIAGVLI
FT                   AVRLGRQLDVLALGERAAVHTGIHVSRLRIIAIAASTILTAGAVSFAGLIGFVGLIVPH
FT                   LLRSLVGPENKILLPASALTGAVLIAFADVAARTLIPFADLPIGIFTAIVGGPTFFILL
FT                   RRMLKKGSVH"
FT   gene            467645..468487
FT                   /locus_tag="CPC231_02305"
FT                   /old_locus_tag="CpC231_0457"
FT   CDS_pept        467645..468487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02305"
FT                   /old_locus_tag="CpC231_0457"
FT                   /product="heme ABC transporter ATP-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09945"
FT                   /db_xref="GOA:D9QEM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEM2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241313.1"
FT                   /protein_id="ADL09945.1"
FT                   /translation="MSKQPAVVVRDLTVAIGEKILLDKVTFEARRGEITGLIGPNGAGK
FT                   STLLAAISGDLERSSGTIDILGHDPATSSPKSLARIRAVMMQDVSVSFEFLVRDVVAMG
FT                   RRPWEGTEKQLFDDPLIDAALAATDAAHLAGRDVITLSGGERARVALSRVLAQQTPVVM
FT                   LDEPTAALDIRHQEQVLGLMRTIARETDVAVIVVLHDLNAAAAYCNRIVCLANGSVAQE
FT                   GNVDSVYTDENLSTVYGWPIHVEKREDDSLFVHPARDQGGKQEADFVALANQAAAATT"
FT   gene            468633..469541
FT                   /locus_tag="CPC231_02310"
FT                   /old_locus_tag="CpC231_0458"
FT   CDS_pept        468633..469541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02310"
FT                   /old_locus_tag="CpC231_0458"
FT                   /product="hemin receptor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09946"
FT                   /db_xref="GOA:D9QEM3"
FT                   /db_xref="InterPro:IPR007331"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEM3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241314.1"
FT                   /protein_id="ADL09946.1"
FT                   /translation="MFKRLAVPLAATMFAASIAVPQAVASEKCSIEVVGGTLSWGVKHS
FT                   WRSYIQGPIARGKWETAGAVTEKGTNKSGADFAFTFDVDPHASQVTVDTEGKVTSAEIK
FT                   TKTSSLTFTGHGDALQSIMKDPYVSIEGQSVKAGSSYEGYYVEGKEMTSYKASDRTEAN
FT                   KKTGTDTFAAGQLQGWKLDNEKLSFSGKNMKYTPKPLTDAKKNIIEGIDILFMGIYNDE
FT                   YKPEIDDVNVELTVKKDCVIKQNQASGVAKGNSSKDASLGDFPKIWSIVLGVAGLAATV
FT                   AILFQVLVKSGLLRNLPFIQK"
FT   gene            complement(469609..470923)
FT                   /pseudo
FT                   /locus_tag="CPC231_02315"
FT                   /old_locus_tag="CpC231_0459"
FT   CDS_pept        complement(469609..470923)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02315"
FT                   /old_locus_tag="CpC231_0459"
FT                   /product="O-acetylhomoserine/O-acetylserine sulfhydrylase"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523085.1"
FT   gene            complement(471106..473316)
FT                   /locus_tag="CPC231_02320"
FT                   /old_locus_tag="CpC231_0460"
FT   CDS_pept        complement(471106..473316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02320"
FT                   /old_locus_tag="CpC231_0460"
FT                   /product="NADP-dependent isocitrate dehydrogenase"
FT                   /EC_number="1.1.1.42"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09947"
FT                   /db_xref="GOA:D9QEM4"
FT                   /db_xref="InterPro:IPR004436"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEM4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599896.1"
FT                   /protein_id="ADL09947.1"
FT                   /translation="MAKIIYTRTDEAPLLATYSLKPVVEAFASTAGIEVETRDISLAGR
FT                   ILSQFPEFLTEDQKVDDALAELGELAKTPEANIIKLPNISASVPQLKAAVTELQSQGYK
FT                   LPNYPDSPSTEEEKDIRARYDAVKGSAVNPVLREGNSDRRAPIAVKNFAKKHPHRMGAW
FT                   SADSKTNVVTMESNDFRHNEKSVIMPDNDTLTIKLVTDNGEKVLKDGLKVLKGEVVDGT
FT                   FISARALDEFLADQVKRAKDEGVLFSAHLKATMMKVSDPIIFGHVVRAYFADVFAKYGE
FT                   QLEAAGLNGENGLAAIYSGLESLPNGAEIKAAFDEALESGADIAMVNSAKGITNLHVPS
FT                   DVIIDASMPAMIRTSGHMWNKNDEEQDTLAVIPDSSYAGVYQTVIADCKKNGAFDPTTM
FT                   GTVPNVGLMAQKAEEYGSHDKTFKIEANGTVQVVSSAGEVLIEHNVEAGDIWRACQAKD
FT                   APIQDWVKLAVTRSRLSGMPAVFWLDPERAHDRNLAALVEKYLADHDTEGLDIHIMSPV
FT                   EATQFSIDRIRRGEDTISVTGNVLRDYNTDLFPILELGTSAKMLSVVPLMAGGGLFETG
FT                   AGGSAPKHVQQLVEENHLRWDSLGEFLALAESLRHFANTEGNTKAGILADTLDRATETL
FT                   LNEGYSPSRKAGEIDNRGSHFFLTKFWAKELSIQSEDADLAATFTPVAEALETHSEDIA
FT                   DALLAVQGAPADLGGYYHPDDAKTTAVMRPVASYNDIISSIK"
FT   gene            473569..474798
FT                   /locus_tag="CPC231_02325"
FT                   /old_locus_tag="CpC231_0461"
FT   CDS_pept        473569..474798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02325"
FT                   /old_locus_tag="CpC231_0461"
FT                   /product="MFS transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09948"
FT                   /db_xref="GOA:D9QEM5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEM5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800084.1"
FT                   /protein_id="ADL09948.1"
FT                   /translation="MQKMMRRPIPRQTDISEQRRLATMIALALGTFGLGITEFVTMGLL
FT                   NQIAADFSVSEDTAGHVIAAYALGVMIGAPLITALTGMIPRRRLLLILTFAFVAGNALT
FT                   FFASSFSVLIVARVIAGLPQGAFFSVASLAVASMAPEGQRGRSLAFVGMGLPLATVLGV
FT                   PAAQALGHATSWHAAYLLVTIVGVVTLGLLWFLMPHMTKMKPTSPLTELGALARGQVWA
FT                   SLLIGSVGFGGMFAVYTYISWTMTQQAGLQENLMWLVLMAYGIGMIAGNWLGGRLSDWS
FT                   VEYGIFWALIAIVVTLAGFFFTSHNAVLATINFGLIGLSGSLLIPSLQIRLMDVAGQAQ
FT                   TLAAALNQSALNIANAAGAQFGGIVIAAGYGYSAPALAGAALGIAAIILWIPAHIFRMR
FT                   AEQKPTASAS"
FT   gene            complement(474795..475565)
FT                   /locus_tag="CPC231_02330"
FT                   /old_locus_tag="CpC231_0462"
FT   CDS_pept        complement(474795..475565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02330"
FT                   /old_locus_tag="CpC231_0462"
FT                   /product="MerR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09949"
FT                   /db_xref="GOA:D9QEM6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEM6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800085.1"
FT                   /protein_id="ADL09949.1"
FT                   /translation="MNELTIGEAAEFLGITTRALRHWDTIGLLEPQWRNHSDYRLYTEE
FT                   DLTKAFTILVYREAGLSLKTIQNILEEPSTEKEHLQRQLKLLKQEIFRKESAILSVEKL
FT                   LRGETSMTPQDFANAFSHDWSENYADYRDEAESRWGESEEWAASQSKVRSMSTNDWQNA
FT                   QASDAAFVSELHSAWQAGVRPGSAAADRIVALHREQIDQWYESSLSKQLILAQMYVSDD
FT                   RFAAHYQGLAPYLLELVRDAAQRGGVDVDNPSWV"
FT   gene            475635..476534
FT                   /locus_tag="CPC231_02335"
FT                   /old_locus_tag="CpC231_0463"
FT   CDS_pept        475635..476534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02335"
FT                   /old_locus_tag="CpC231_0463"
FT                   /product="exodeoxyribonuclease III"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09950"
FT                   /db_xref="GOA:D9QEM7"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEM7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910896.1"
FT                   /protein_id="ADL09950.1"
FT                   /translation="MQITTVNVNGIRAAVKERSETNKGMLPWLDGSGSDVVLLQEVRAS
FT                   EKDTLTALAPALDAGWHYVGAPAAAKGRAGVGILSRSELFDVHVGIEGFEDSGRYIQAT
FT                   LHDGTDDVTVGSLYLPSGSAQTEKQDEKYRFLDVFEPFLEQAAKDHKYMVIGGDWNICH
FT                   RREDLKNWKTNRKKSGFLPDERAFMDSVFGTFPDAASQVEDAGQWAGAVDYASDGKRKP
FT                   ALNPQWFDVARRLHPQDAPYTWWTYRGQAFDTNAGWRIDYQAATQAMLDRAEKTWVDKA
FT                   EAYDLRWSDHSPLSVIYH"
FT   gene            476621..476800
FT                   /locus_tag="CPC231_02340"
FT                   /old_locus_tag="CpC231_0464"
FT   CDS_pept        476621..476800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02340"
FT                   /old_locus_tag="CpC231_0464"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09951"
FT                   /db_xref="GOA:D9QEM8"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEM8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241321.1"
FT                   /protein_id="ADL09951.1"
FT                   /translation="MRVKSLIAMVVGLVLFVGAHFMIGAYDVSSMLWSIIMGVGGAMAV
FT                   GGLVGALCKEPRKQ"
FT   gene            476970..477998
FT                   /gene="trpS"
FT                   /locus_tag="CPC231_02345"
FT                   /old_locus_tag="CpC231_0465"
FT   CDS_pept        476970..477998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="CPC231_02345"
FT                   /old_locus_tag="CpC231_0465"
FT                   /product="tryptophan--tRNA ligase"
FT                   /EC_number="6.1.1.2"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09952"
FT                   /db_xref="GOA:D9QEM9"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEM9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014836042.1"
FT                   /protein_id="ADL09952.2"
FT                   /translation="MTESKAVKKQRVLSGIQPTADSYHLGNYLGALKQWIDLQDGYDAF
FT                   YFIPDLHAITVDQDPKELRQRTIAGAAQLLALGIDPEKSTLFVQSHVPEHAELGWIMTC
FT                   LTGFGEASRMTQFKDKSAKRGADRTSAGLFTYPMLMAADILLYRPQLVPVGEDQRQHLE
FT                   LTRTLAERFNSRFKKTFVVPEGIIPEGAAKIYDLQDPTSKMSKSGTNPKGLINLLDEPK
FT                   VSIKRIKSAVTDSDGEIRYDKANKPGVSNLLVIQSALTGKSIDDLVAGYQGQGYGALKT
FT                   DTADALEAFVTPLKAKYDMYMSDRAELERVLALGASKAREVASRTLADAYERIGFLKVG
FT                   KE"
FT   gene            478134..479219
FT                   /locus_tag="CPC231_02350"
FT                   /old_locus_tag="CpC231_0466"
FT   CDS_pept        478134..479219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02350"
FT                   /old_locus_tag="CpC231_0466"
FT                   /product="inner membrane protein YhjD"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09953"
FT                   /db_xref="GOA:D9QEN0"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEN0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241323.1"
FT                   /protein_id="ADL09953.1"
FT                   /translation="MPTVSTSTRQDKHKTDEYGIERSNADEPGFVDKYRAKWSWFDHIM
FT                   RMNERYGKEGGNQYSAGITYFSVLSMFPLLMLIMAIAASMLAQRPDLLAQLQEKIVASV
FT                   DGSIAETLTKILDTAIAQRGAMFGIGGLTALWSGLGWMSNLRYGASKMWCYPVTGENFF
FT                   KAKLQDLLGLVGLIFAFMVAFGVTAIGSSGLTERLLVVVSLDKVPGIFLLTFAVSILLG
FT                   LIANFCVFLWMLKYLPRGEVPMKSAVRASIIGAVLFEVFKQLAAQFFSNALNNPAGATF
FT                   GPIIGVMVLFYFVWRILMYCSAWAATTEESLAIAKLDVPAPAVIRVREEVRVSNDKGKG
FT                   IGIGVATGAVAAAIVAALRKK"
FT   gene            complement(479317..480531)
FT                   /locus_tag="CPC231_02355"
FT                   /old_locus_tag="CpC231_0467"
FT   CDS_pept        complement(479317..480531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02355"
FT                   /old_locus_tag="CpC231_0467"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09954"
FT                   /db_xref="GOA:D9QEN1"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEN1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241324.1"
FT                   /protein_id="ADL09954.1"
FT                   /translation="MKVSSTIAALTASSFTLAFVLTPAALADPTPRSSAPNTNNCEYAL
FT                   TPPPAETTSEQLKPGQTSPTPRPTVINEYRGGCGVTKAKGFNEPANTASAWMVFDLDNG
FT                   DVIATKDPHGRYRPASVIKALLALVALDELNLKAKVKITAEDANQEGSAVGYVDGVEYT
FT                   NEQLLYGLLLNSGNDAAHALAQRLGGDNKTLEKVNALAHSLGTVDTYAASYSGLDAPGM
FT                   STSAHDLALIYSHAWENPTFAKMVATEHIELPGNAATPTFQVWNDNGLFLNDEHGIGGK
FT                   TGYTDDAHHTFVGAKNIDGRRLAAVILDTTVEQGRPWQQAQKLIDAAYAVPRGEKVGNL
FT                   KETSIPSQPSPSELPTPPTPEEGDAPSRDRNHAPVLVIGGATLGLVVLGILTWFLGRKK
FT                   HDRKA"
FT   gene            480567..481457
FT                   /locus_tag="CPC231_02360"
FT                   /old_locus_tag="CpC231_0468"
FT   CDS_pept        480567..481457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02360"
FT                   /old_locus_tag="CpC231_0468"
FT                   /product="adenosine deaminase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09955"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEN2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241325.1"
FT                   /protein_id="ADL09955.1"
FT                   /translation="MYDTPDFRTEFKILQPELLHAMPKIILGDAGDAAYLNARIRELGD
FT                   DTVAYYECTVPLDSADAAIAAAESAPFPVGIVLDLDDKPAPLKQLKNPVVLACRTSNPG
FT                   TARVLRENLIAYDFVGPLEHQIHAGATRILHGIELFDDFCVTDGDLKPGRLSAWVLDRR
FT                   IPVLTNPSEDLNSGDISDLSDHPLPLMHKLGFQAAPALLSTDRMLELVEHFDYSIEDLY
FT                   SLTMTAVFVSYAPEFVRSQLIESTIAPFFASLGDEYGGEAEDVEVGKESTILSQPPLEL
FT                   VTEMGIDLKDLGFNQ"
FT   gene            complement(481519..482754)
FT                   /locus_tag="CPC231_02365"
FT                   /old_locus_tag="CpC231_0469"
FT   CDS_pept        complement(481519..482754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02365"
FT                   /old_locus_tag="CpC231_0469"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09956"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEN3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014836044.1"
FT                   /protein_id="ADL09956.1"
FT                   /translation="MANKGIVPVKLSLTEGDFYTLWAPEWREHGAVWQAFLGKGDDLYV
FT                   FSSPEEVLLFLESGAKHDLSDHPKWNSFNAGAANRVVPTARQEFDIVGTPQLLSERPSY
FT                   DNVSAVARNFKIARSLGDVTGTTDILVFFSSHSILSNPERGVDHFAGEGGLGEWSAIGR
FT                   VILSNWGMVVDSLDKLITVKDLTTESAAIDDAASRIKDAEEAARIAREKAEEQKKAEAE
FT                   KVDPYDTTPWAAAGIDPIKISIDGRTLYTLRTYVEAQPVFLGKFGEIFTFSSSKALLRW
FT                   LVEHEDHDLAKVSTWEDLMVPLNAGELDVTVHADNVYSFNGLVRDINSSVEAVDTAQMG
FT                   RAYELLADAADWAADDSLNSYFLANPRMQDYISYMLGSSEVSGYTPTPPFDDHAEGWKE
FT                   LEAMLTKRFSKF"
FT   gene            complement(482775..483641)
FT                   /locus_tag="CPC231_02370"
FT                   /old_locus_tag="CpC231_0470"
FT   CDS_pept        complement(482775..483641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02370"
FT                   /old_locus_tag="CpC231_0470"
FT                   /product="NlpC/P60 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09957"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEN4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800090.1"
FT                   /protein_id="ADL09957.1"
FT                   /translation="MINLAAVVSMLSTLAPPSQLLTLPCVPLFRAALPLAATFGAHPKL
FT                   VDDAHRLATDIEHAHRLLPRAHTEIDAVRTELGHMAADFLKESALLLPRVFSPVPAISV
FT                   PALAEIAALPGIYVQLAYARLHTASIKLAGVTAELNRLAGIEIDSVESSGDKPDSHAPP
FT                   MHGTTQSAGMSQTPGALAVTAAKSALGTPYRWGGTSTAGFDCSGLTQWAWRQAGVELPR
FT                   LAEQQTVGTQVTREQLLPGDLVVWDGHVAMYAGDGTIIEAGNPVQINPLRTTNMGMAFK
FT                   GYFRPTD"
FT   gene            complement(483638..483907)
FT                   /locus_tag="CPC231_02375"
FT                   /old_locus_tag="CpC231_0471"
FT   CDS_pept        complement(483638..483907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02375"
FT                   /old_locus_tag="CpC231_0471"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09958"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEN5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366579.1"
FT                   /protein_id="ADL09958.1"
FT                   /translation="MRIDPDHARTLIAQLANDAASLVPIAHSVGASLPELGSFFAAYNS
FT                   CLDAFMARSTAQCTRAEILVDKALHSLEAVENADTSLAFSLETL"
FT   gene            483972..484607
FT                   /locus_tag="CPC231_02380"
FT                   /old_locus_tag="CpC231_0472"
FT   CDS_pept        483972..484607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02380"
FT                   /old_locus_tag="CpC231_0472"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09959"
FT                   /db_xref="GOA:D9QEN6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEN6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004567014.1"
FT                   /protein_id="ADL09959.1"
FT                   /translation="MEITIVDHPLAASRLSIMRDKRTNNAGFRAALADLGAMLIYEASR
FT                   SLEVENFPMSTPVADTQGIRLQDPPIIVPIIRAGLGMVDPALSMIPDAQVGFLGLARDE
FT                   ETHEPVPYLEALPADLSGRTVFCVDPMLATGGSLLHAIKLLADRGATDITAVCMVSAQA
FT                   GVDALAGSGLPCRLVTATIDPELNENAYIVPGLGDAGDRLYGPRNIDL"
FT   gene            484809..485246
FT                   /locus_tag="CPC231_02385"
FT                   /old_locus_tag="CpC231_0473"
FT   CDS_pept        484809..485246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02385"
FT                   /old_locus_tag="CpC231_0473"
FT                   /product="helix-turn-helix domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09960"
FT                   /db_xref="GOA:D9QEN7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEN7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800092.1"
FT                   /protein_id="ADL09960.2"
FT                   /translation="MVNGWQQWPSFGHALSVRLRTLRKMRGLSQDRLAELSDVSRNQIS
FT                   NLERNENSVTKSADPTMSTVYRLARALHVPPAVLLPAATDIVQDICKDNAADLGVDLVW
FT                   PAAPEDTLAFDIQHLYGLRMGENPRFVDPSGPKATPGDATG"
FT   gene            complement(485269..486870)
FT                   /locus_tag="CPC231_02390"
FT                   /old_locus_tag="CpC231_0474"
FT   CDS_pept        complement(485269..486870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02390"
FT                   /old_locus_tag="CpC231_0474"
FT                   /product="phospho-sugar mutase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09961"
FT                   /db_xref="GOA:D9QEN8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEN8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800093.1"
FT                   /protein_id="ADL09961.1"
FT                   /translation="MSLRFGTAGVRAPVGPASNQMNVGNVTKFTSAVAMWLAEQAAASP
FT                   TPHARTYPQDLIKGIGDVFHDDAAPLRVAVGYDARYGSHAFATTTAEVFAGAGFEVFLM
FT                   PMPAPTQLIPWLIRKWELDGGVQITASHNPAADNGYKVYCHNGRQLIDASARSIEAIYD
FT                   GIDDSSQIPRVSVRPSSDLLRRYIDDAVSTIIPAQADLLRVNSDRANLRVAFTAMHGVG
FT                   GRTLQVCLQAAGFAQVFPVRSQLYPDPTFPTVDFPNPEEPTAVAALLEHGEAVDADVLI
FT                   ALDPDADRCAVGIRTEHGTLRMLRGDELGPLLAARLVPNWSPEDAIPQPVVATTTVSSQ
FT                   LLSVMAKDRGWLYQETPIGFKNLAAAAASAAQDGGIAYACEEANGVAPDLHRVGDKDGV
FT                   VTALVACAWAAELKGLGLGLHSALHDLYRQYGYFTGTQIAVRTIDPAELVSDWVANPPE
FT                   QLAGLAVTATQLPEIRGLKLSGSNEDASIRAIVRASGTESKVKMYLEVSQATSVEQAEE
FT                   LLAQLCDEMRSRALRF"
FT   gene            487148..488344
FT                   /locus_tag="CPC231_02395"
FT                   /old_locus_tag="CpC231_0475"
FT   CDS_pept        487148..488344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02395"
FT                   /old_locus_tag="CpC231_0475"
FT                   /product="amidohydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09962"
FT                   /db_xref="GOA:D9QEN9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEN9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241332.1"
FT                   /protein_id="ADL09962.1"
FT                   /translation="MATSISEHVNAWIADHQEEVIGWRRHLHRYPELSHMEFATTDFIA
FT                   KTLISYGLSPIRFPTTGLMVNVGPNTEEKVAFRADIDALPISEQNDLDYASLNAGVMHA
FT                   CGHDVHATIALATACALASAELNIGVRVIFQPAEEVMDGGAPDVIGYGALEGIANIFAI
FT                   HAEPKLKVGYVGVRTGAITSASDVVEVHVTGPGGHSSRPHLTVDVVYALSKLVVDLPGL
FT                   LSRRVDPRTGTVLVFGSINAGYAPNAIPESGSVTGTIRTADITVWRTMGELLRELIPQV
FT                   LMPTGCEVSIVHHKGVPPVLNDDVATALLADVARSIDPNAVVQAPQSSGGEDFSWYLEH
FT                   VPGSMARLGCWDGIGEPGDLHQADILIDERCIAVGVKLFGSVVDRYNHNAELFSQPSR"
FT   gene            488484..489893
FT                   /locus_tag="CPC231_02400"
FT                   /old_locus_tag="CpC231_0476"
FT   CDS_pept        488484..489893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02400"
FT                   /old_locus_tag="CpC231_0476"
FT                   /product="NAD(P)H-quinone dehydrogenase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09963"
FT                   /db_xref="GOA:D9QEP0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEP0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599920.1"
FT                   /protein_id="ADL09963.2"
FT                   /translation="MLTRIVIIGGGPAGYEAALAGAKYGADITIIEDRGLGGAAVINDC
FT                   VPSKSFIAGANIKTDLRRADDMGLNKGIGEANLLLDALNARVQALAGEQSGDIRRSVIN
FT                   QGVRVLDGRGSFDDYNPKQTLHYIKAELNDGTVETIECDLVLVATGATPRILPGAQPDG
FT                   ERILTWRQLYDLKDLPDHLIVVGSGVTGAEFVSAFAELGVKVTMVASRDRILPHDDADA
FT                   ADTLESVLAERGVSLEKHARVDSVSRTEDGGVCVRTSDGREIFGSHALMAVGSIPNTKD
FT                   LGLEKIGVEMTRSGHICVDRVSRTNVPGVYAGGDCTDLFPLASVAAMQGRIAMYHALGE
FT                   GVKPLRLKTVSTAVFTRPEIAAVGVTQHQIESGDVNARTVILPLETNPRAKMRSLRHGF
FT                   VKMFCRRHSGIVIGGVVVAPTASELILPIAVAVTNQLTVSDLAESFAVYPSMSGSITEA
FT                   ARQLVSHDDLE"
FT   gene            490417..493842
FT                   /locus_tag="CPC231_02405"
FT                   /old_locus_tag="CpC231_0477"
FT   CDS_pept        490417..493842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02405"
FT                   /old_locus_tag="CpC231_0477"
FT                   /product="pyruvate carboxylase"
FT                   /EC_number="6.4.1.1"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09964"
FT                   /db_xref="GOA:D9QEP1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEP1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523090.1"
FT                   /protein_id="ADL09964.1"
FT                   /translation="MHHSTQKTATHHPTSFSKILVANRGEIAVRAFRAAFETGASTVAV
FT                   YPMEDRNSFHRSFASEAVLIGEGGSAVKAYLDIDEVIRAAKQTGADAVYPGYGFLSENA
FT                   RLARECAENGLTFIGPPPSVLDLTGDKSAAVAAAREAGLPTLTETEPTDDPKELAILSK
FT                   DQVYPLFVKAVAGGGGRGMRFVEKPEDLEKLAAEASREAAAAFGDGRVYAERAVINPQH
FT                   IEVQILGDAEGNIVHLYERDCSLQRRHQKVVEIAPAQHLDPDLRDKICADAVAFARHIG
FT                   YMGAGTVEFLVDEDGNHVFIEMNPRIQVEHTVTEEVTQVDLVKSQIMIAAGATLEQLGL
FT                   RQEDIHTEGAALQCRITTEDPNNGFRPDTGTITAYRSPGGAGVRLDGAAMLGGEISPNF
FT                   DSMLVKMTCRGADFETAVARAQRALAEFVVSGVATNIGFLRALLREEDFQSKRIATGFI
FT                   ADHPWLLQAPPADDEQGRILDYLADVTVNKPHGIRPAVVNPVEKLPVESKGKLPRGSRD
FT                   RLLQMGPVEFARALRKQDALAVTDTTFRDAHQSLLATRVRSNTLIDAARHVARLTPELL
FT                   SVEAWGGATYDVAMRFLHEDPWERLDHLREAMPNINIQMLLRGRNTVGYTPYPDSVCAA
FT                   FVNEAARSGVDVFRIFDALNDVSQMRPAIDAVLNTGTTVAEVAMAYSGDLTNPKEKLYT
FT                   LDYYLNLAEQIVDSGAHILAVKDMAGLMKPAAATKLVTELRKNFDLPVHVHTHDTAGGQ
FT                   LATYWAAAAAGADAVDGASAPLSGTTSQPSLSAIVAAFDNTYRSTGLSLDAVGSLEPYW
FT                   EAVRKLYAPFESGTPGPTGRVYLHEIPGGQLSNLRAQATALGLADRFELIEDTYAAVNE
FT                   MLGRPTKVTPSSKVVGDLALYLVGAGVDPKDFAADPQKYDIPDSVIAFLRGELGTPPGG
FT                   WPEELRNKALSGRKESKDTLAELPAEEAAALADQATVRGTLDRLLFPKPAQEFSEHRRQ
FT                   FGDTTKLGDAEFLYGLVEGKETVIHTADNNVPMIVRLDAVGEPDEKGMRNVVCNVNGQI
FT                   RPILVRDRSVESITASAEKADTANVGHVAAPFSGVVTVTAEPGANVAAGDPVAVIEAMK
FT                   MEATISATKDGTIERIVMTQPTKVEGGDLLLVIS"
FT   gene            complement(493913..495370)
FT                   /locus_tag="CPC231_02410"
FT                   /old_locus_tag="CpC231_0478"
FT   CDS_pept        complement(493913..495370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02410"
FT                   /old_locus_tag="CpC231_0478"
FT                   /product="DHA2 family efflux MFS transporter permease
FT                   subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09965"
FT                   /db_xref="GOA:D9QEP2"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEP2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241335.1"
FT                   /protein_id="ADL09965.1"
FT                   /translation="MATSSQRIPEPSQAHVSSKPRVGLILGVVVVAAMIMILNETVLSV
FT                   ALPSIMADFGVTADVVQWLATGFLLTMSVVIPATGFLLQRFTTRMNFLTAVGLFILGTL
FT                   MCAIAPVFWVLVAGRIVQAMGTAIVLPLLMTMTITLVEPAKRGTMMGINSIVISVAPAF
FT                   GPTLSGFILNSLSWHWLFWVVIPVAGAVFILGFIVVTNVQDVSRVPFDIASLALSALAF
FT                   GGIIYGFSTIRELVDAHWPPAAVFLIGLTSLAFFVRRQLRLAQSGRALLDMSPFTIRNF
FT                   VLSTIVLMLGLTALLGMVNVIPIYLQEGIGVSALTTGLALLPGGLFQGLVSPFIGRIYD
FT                   RVGPRPLVIPGAVFMFVSMVVATLMFTAEASVMIVVVVHCLFCVGLAFVMTPLMTVSLS
FT                   SLPSRLYGHGSAIVNTLQQLGGAMGTAVMIGIMTIVAMRSTAAPAIAQSEGTTTAFVAG
FT                   TVFAGLILVTSLFITPVTVKVHVSKTE"
FT   gene            complement(495481..495867)
FT                   /locus_tag="CPC231_02415"
FT                   /old_locus_tag="CpC231_0479"
FT   CDS_pept        complement(495481..495867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02415"
FT                   /old_locus_tag="CpC231_0479"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09966"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEP3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014836054.1"
FT                   /protein_id="ADL09966.1"
FT                   /translation="MEPTDINGGRFYARPLHNDDRIDDTPAIRLIDAHFDVDQAHHRWH
FT                   DNSMYSWAVCEQTNIDMIALAVLHLTTTEHGLSGILDIAPAGDPARELPNDPILDQKTV
FT                   GDGVHEIRGPIERWCEAHGITLTR"
FT   gene            complement(495984..497759)
FT                   /locus_tag="CPC231_02420"
FT                   /old_locus_tag="CpC231_0480"
FT   CDS_pept        complement(495984..497759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02420"
FT                   /old_locus_tag="CpC231_0480"
FT                   /product="ATP-grasp domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09967"
FT                   /db_xref="GOA:D9QEP4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEP4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599932.1"
FT                   /protein_id="ADL09967.1"
FT                   /translation="MSVEQKKITKVLVANRGEIAIRVIRAARDAGIPSVAVYAEPDAEA
FT                   PFVSLADEAFALGGQTSAESYLVVEKILDAARKSGANAIHPGYGFLSENGDFAEAVIEA
FT                   GLIWIGPSPQSIRDLGDKVTARHIALKADAPMAPGTKEPVKNAAEVVAFAEEHGLPIAI
FT                   KAAFGGGGRGMKVAYTMDEVADLYESATREAVSAFGRGECFVERYLDKARHVECQVIAD
FT                   QHGNVVVAGTRDCSLQRRFQKLVEEAPAPFLTDQQRTSLHESAKRICREAGYYGAGTVE
FT                   YLVGADGLISFLEVNTRLQVEHPVTEVTTGLDLVREQFRIAEGHELHIKEDPTPRGHAF
FT                   EFRINGEDAGSNFMPAPGKITKYVEPSGPGVRMDSGIVEGSVIGGQFDSMLAKLIVYGE
FT                   TRDEALQRARRALSEYVVEGMPTVLPFHRHIVENPAFVGNDSGFDVYTKWIEEEWDNPI
FT                   PAYVDPADVAEDEEATPSQKVVVEIDGRRVEIALPGDLALGGAGGVKKKAKKRRAGGSK
FT                   AAVSGDAVAAPMQGTVIKVNVEEGAEVAEGDTVVVLEAMKMENPVKAHKSGTVTGLVAA
FT                   AGEGVTKGQVLLEIK"
FT   gene            complement(498004..498882)
FT                   /locus_tag="CPC231_02425"
FT                   /old_locus_tag="CpC231_0481"
FT   CDS_pept        complement(498004..498882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02425"
FT                   /old_locus_tag="CpC231_0481"
FT                   /product="sulfurtransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09968"
FT                   /db_xref="GOA:D9QEP5"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEP5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366587.1"
FT                   /protein_id="ADL09968.1"
FT                   /translation="MPAPYDPHPLFQDYAHPEKLVSASWLSARLGTKGLRVVESDEDSL
FT                   LYDIGHIPGAVRIDWAKDLNNKTIRDYITGEDFAALMSAKGIARDDTVVIYGDKSNWWA
FT                   AFTLWIFELFGHEDVRILNGGRDAWMAEERDTSYAVPEYPATDYPVIKRADHPDRIYVQ
FT                   ELLEKLGTPKLIDVRSPEEYNGTADADSPSSGVLRRGHVPTAVNIPWEKSVHPNSRFRS
FT                   AEELSALYAEIPKDAETVVYCQVGDRAAHTWFVLKHLLGYDFVRNYDGSWAEWGNMVKM
FT                   PIATGDEPGQV"
FT   gene            499601..500671
FT                   /locus_tag="CPC231_02430"
FT                   /old_locus_tag="CpC231_0483"
FT   CDS_pept        499601..500671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02430"
FT                   /old_locus_tag="CpC231_0483"
FT                   /product="Cj0069 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09970"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEP7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800100.1"
FT                   /protein_id="ADL09970.1"
FT                   /translation="MHKSIVVFEVEGGSDKQFNGHRKDTLPIVNAIKEKGWHSEVVFYR
FT                   PEWSEQLFDYVSQNFDGYISRVNPGNIPGGEKGYFELLTKLSDAGLVGMSTPVEMMEYG
FT                   AKDALVKLRDTDLVPSDTAAYYDVESFHSTFPTSLSYGERVLKQNRGSTGSGIWRVQLE
FT                   DKELAASIAPGTALPLDTKLRCTEAVDNHTELRELGEFMDFCDQYIIGDNGMLVDMRFM
FT                   PRIVEGEIRILLVGPHPVFVVHKKPAAGGDNFSATLFSGAKYTYDKPEAWQSLVDMFAN
FT                   ARPVIAEKLGGDNIPLIWTADFMLADGPNGEDTYVLGEINCSCVGFTSELDMGIQELVA
FT                   EEAIQRVEKKAEKENA"
FT   gene            500962..503076
FT                   /locus_tag="CPC231_02435"
FT                   /old_locus_tag="CpC231_0484"
FT   CDS_pept        500962..503076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02435"
FT                   /old_locus_tag="CpC231_0484"
FT                   /product="acyltransferase family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09971"
FT                   /db_xref="GOA:D9QEP8"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEP8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523092.1"
FT                   /protein_id="ADL09971.1"
FT                   /translation="MAAGTTQQSKAKATKYRFDLDGLRGIAIAFVVIFHVFVGRVSGGV
FT                   DVFLLLSGYFFLGSQLRYATKPNASLNPWWPVWRTIRRLFPALLVTLMSTILAVHLWIL
FT                   ELRTTNLSDQLLACIGYFQNWELATQGAAYGAASSTTSPLQHLWSMAVQGQFYLMAIAF
FT                   AWVLAVGIKLMHRRRRVVTTLRLAAGIPLILVTIGSFGYAVYLHWQDQSLNYYSTWSRL
FT                   WELSLGAVLVLYAEKLRLTQRLSVAFTYLGLLMVVSTGLLFDGAALFPGPAALFPLGGA
FT                   TLVILGGGQGASWLSNRFMLWLGKIAYPLYLWHWPILIVSTAYLGEKRPSVALGLGVVV
FT                   VSILLAQITHVFIEEPFKQHAKRPVSLEGRSRAAVASLSTPSGSIRAVAGLCVATLCGT
FT                   AVWIPSVWQEEIDRVSGTQLNPTLYPGAAALKGVRVPNVPFEPDPFVLANTLSPAWTDG
FT                   CISLLGDDPEVIANDKLGPDHCLYGDIHAKKVAYLVGGSHAEQWMAAWDEIGKQHGIKI
FT                   VPFVRQGCPIYEEEKDDVFSQECTTFNQKVIERIKEDRPNLVISNSTRPLLEKGHSQDE
FT                   VPQSYPTFWEFLKKEKIPFIGLRDNPWFVLAEGEGWMVSQCVENGGSIEECGLPRSQVY
FT                   ADTDPSQKFFTTDSMLSVDTADWFCPDDFCPAVIGNIYVYRDGNHISDAYALSLVPLLW
FT                   AQIGTFVGKV"
FT   gene            complement(503114..503530)
FT                   /locus_tag="CPC231_02440"
FT                   /old_locus_tag="CpC231_0485"
FT   CDS_pept        complement(503114..503530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02440"
FT                   /old_locus_tag="CpC231_0485"
FT                   /product="DUF3151 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09972"
FT                   /db_xref="InterPro:IPR014487"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEP9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241342.1"
FT                   /protein_id="ADL09972.1"
FT                   /translation="MTQFNDMLAPPPVMLPEDEAAAEPEITAAVVLRHPASPLAWALLA
FT                   ESRLDAITTTDADALAAAYAFARTGYHRSLDRLRAHGWKGWGPVPYSHEPNRGVLRAIA
FT                   ALARASQLIGDQSEYDRCRQMLSDADPESVATLL"
FT   gene            complement(503535..504164)
FT                   /locus_tag="CPC231_02445"
FT                   /old_locus_tag="CpC231_0486"
FT   CDS_pept        complement(503535..504164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02445"
FT                   /old_locus_tag="CpC231_0486"
FT                   /product="septum formation inhibitor Maf"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09973"
FT                   /db_xref="GOA:D9QEQ0"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEQ0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366591.1"
FT                   /protein_id="ADL09973.1"
FT                   /translation="MRIVLASASPSRRAILRSAGVDPIIDPAEIDEDSLLEQCQGQQPE
FT                   DIVAQLATAKAHAVASRHPGDVVIGGDSMLLLDGKLQGKPHTVERTIQRWLEQRGRTAH
FT                   LITGHCIINGAAGGASTSYQHVETSVTKIRFAPASDSDIEAYARTEEPLQCAGAFTLEA
FT                   LGGWFIDAIDGDPSSVIGLSLPVVRRALYSFGLNVSDFWNIQILEE"
FT   gene            complement(504184..505086)
FT                   /locus_tag="CPC231_02450"
FT                   /old_locus_tag="CpC231_0487"
FT   CDS_pept        complement(504184..505086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02450"
FT                   /old_locus_tag="CpC231_0487"
FT                   /product="ribokinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09974"
FT                   /db_xref="GOA:D9QEQ1"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEQ1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525408.1"
FT                   /protein_id="ADL09974.1"
FT                   /translation="MLKTVAVIGSINADLSVRVHRPPTPGETVLGMDSSISPGGKGANQ
FT                   AVAAALQGAKVVFIGAVGKDSYAEPAMELLRASSVSLEHVSAVDGPTGSAVITVSDDGE
FT                   NSIIVIPGANAAVDAAYVAKNAEAIAGADIVLLQGEIPADGFLEAIKAATGRIVVNLAP
FT                   VISVDREALLKADPLMANEHEANLILEQLGSSISSDDPHELAQELLAQGFASVVLTLGS
FT                   KGALVADPQASVIVPSPKVTAVDTTGAGDAFAGAFVAQLLSGASSVEAAQHAVRVAAYA
FT                   VQYRGTQVSYPNAGAELPR"
FT   gene            complement(505154..506188)
FT                   /locus_tag="CPC231_02455"
FT                   /old_locus_tag="CpC231_0488"
FT   CDS_pept        complement(505154..506188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02455"
FT                   /old_locus_tag="CpC231_0488"
FT                   /product="substrate-binding domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09975"
FT                   /db_xref="GOA:D9QEQ2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEQ2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241345.1"
FT                   /protein_id="ADL09975.2"
FT                   /translation="MEAPRTPSTSYPRRRRQSTTLKDIAAETGFSISTVSRALAHNPVI
FT                   PEPTRTIVAETAKRLNYRPNAQAKALRNQKTNLIGVLLPNICNPYFNTLAFEIQQAARA
FT                   KGYSTILSNTDESPSVLNGALDTMNSQQVDGIIVVPHIQSAEKITELANAGVPIVAADR
FT                   SVLGSSVPSVTSDPLPAMKEAIRLLSLNNHAKIGYLAGPQDTSTGRVRLEAITSIKEDL
FT                   RIPSPDVYFGGYHYDAGRAGTLELLDRGVNSILTGDMMMAVGALSAIYSRKLKIGKDVA
FT                   LIGFDNAAVFTLQESPLTVIDQQVETIGQKAFELLYSIMKNDTMPDSVVVPTVLKVRDS
FT                   HTLT"
FT   gene            complement(506368..506616)
FT                   /locus_tag="CPC231_02460"
FT                   /old_locus_tag="CpC231_0489"
FT   CDS_pept        complement(506368..506616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02460"
FT                   /old_locus_tag="CpC231_0489"
FT                   /product="acyl-CoA carboxylase subunit epsilon"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09976"
FT                   /db_xref="InterPro:IPR032716"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEQ3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910923.1"
FT                   /protein_id="ADL09976.1"
FT                   /translation="MSDTSTTTAEAAPAKKPFLTVVKGNPDNVQVAAITTVIASLAQDA
FT                   EKAAAKDRDRNLWGNVEERLQRPTTYNPTAFRNVSFY"
FT   gene            complement(506718..508349)
FT                   /locus_tag="CPC231_02465"
FT                   /old_locus_tag="CpC231_0490"
FT   CDS_pept        complement(506718..508349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02465"
FT                   /old_locus_tag="CpC231_0490"
FT                   /product="methylmalonyl-CoA carboxyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09977"
FT                   /db_xref="GOA:D9QEQ4"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEQ4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_006769581.1"
FT                   /protein_id="ADL09977.1"
FT                   /translation="MTAATINGQGASAPDLTTTAGKLADLRSRLAETVAPMGPASIEKV
FT                   HAAGKKTARERIEYLLDDNSFVEVDALARHRSKNFGLDAKHPVTDGVVTGYGTIDGRKV
FT                   CVFSQDGAVFGGALGEVYGEKIVKIMDLAIKTGVPLIGINEGAGARIQEGVVSLGLYSK
FT                   IFYRNTLASGVIPQISLIMGACAGGHVYSPALTDFIIMVDKTSKMFITGPDVIKTVTGE
FT                   EVTQEELGGAHTHMSTSGTSHYTASDDADALDWVRDLVGFLPSNNRAEAPREAADLMVG
FT                   SIQENITESDLELDTLIPDSPNQPYDMKDVISRIVDDGDFFEVQEHYAGNIIIGFGRVE
FT                   GRSVGIVANQPTEFAGCLDIKASEKAARFIRTCDAFNVPIIEFVDVPGFLPGTSQEYDG
FT                   IIRRGAKLLYAYSEASVGKITVITRKSYGGAYCVMGSKDMGADIVLAWPTAQIAVMGAS
FT                   GAVGFIYRKELKNAAANGQDVVALAKEYEKEYEETLVNPYMAAERGYVDAVIPPSETRG
FT                   QIIEGLRLLDRKVINMPAKKHGNIPL"
FT   gene            complement(508609..510240)
FT                   /locus_tag="CPC231_02470"
FT                   /old_locus_tag="CpC231_0491"
FT   CDS_pept        complement(508609..510240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02470"
FT                   /old_locus_tag="CpC231_0491"
FT                   /product="methylmalonyl-CoA carboxyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09978"
FT                   /db_xref="GOA:D9QEQ5"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEQ5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599940.1"
FT                   /protein_id="ADL09978.2"
FT                   /translation="MTLSSPFVDVAALKDMTTTAGKIADFKARRAEAGQPMGTKALDKV
FT                   KQAGRLTARERLDYLLDEGSFIETDQLARHRTFDFGMHKKRPVTDGIVTGWGTIDGREV
FT                   CIFSQDGTVFGGALGEVYGEKMIKIMKLAVATGRPLIGLYEGAGARIQDGAVSLDLIAQ
FT                   TFYHNINASGVVPQISVIMGSCAGGNAYSPALTDFVVMVDQTSKMFVTGPDVIKTVTGE
FT                   IISQEELGGANTHMSAAGNSHFTAANDEEALDFVQDLVSFLPSNNRSVTPREDYDQEAG
FT                   SIEDNLTPDDLRLDHIIPDSPSIPYDVRSVIESLTDDGGYLEIQADRAENVVVAFGRIE
FT                   GESVGFVANQPTQFAGCLDIDASEKAARFIRTCDAFNVPIVMLVDVPGFLPGAGQEHNG
FT                   ILRRGAKLLYAYGEATVPKITVTMRKAYGGAYCVMGSKGLGADVNLAWPTAQIAVMGAA
FT                   GAVGFLHRRELIAAAENGDDVVALSEALEREYEDHMLNPYLAAERGLIDAVILPSETRG
FT                   HISRNLRLLKNKHVQRPARKHGNIPL"
FT   gene            510516..511361
FT                   /locus_tag="CPC231_02475"
FT                   /old_locus_tag="CpC231_0492"
FT   CDS_pept        510516..511361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02475"
FT                   /old_locus_tag="CpC231_0492"
FT                   /product="biotin--[acetyl-CoA-carboxylase] ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09979"
FT                   /db_xref="GOA:D9QEQ6"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEQ6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241350.1"
FT                   /protein_id="ADL09979.1"
FT                   /translation="MDKDAAQSALVESDGGSRDSRTPLNVEWLREQLVVDGPFASILHS
FT                   ATTGSTNTDLVAAAHEGAPAWTVFLTEHQTLGRGRMGRRYEAPAGAQLTLSVLIRPPRE
FT                   SVFRLGTMPLATGLALIDALKGAEGVGLKWPNDLLREGRKLCGILAEAVSLGEEPAVVI
FT                   GLGLNTSLTREELPVPHATSLELEGIPYERNELAVRVLTALHRRLRQWEDNDPTLMAEY
FT                   RQVCTSIGADVRVVLSENEELLGVAESVSDAGLICVRDSQGELHELMAGDVTHLRLQDK
FT                   "
FT   gene            511362..511832
FT                   /locus_tag="CPC231_02480"
FT                   /old_locus_tag="CpC231_0493"
FT   CDS_pept        511362..511832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02480"
FT                   /old_locus_tag="CpC231_0493"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09980"
FT                   /db_xref="GOA:D9QEQ7"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEQ7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800108.1"
FT                   /protein_id="ADL09980.1"
FT                   /translation="MARVRVLPDEIVRVDVTRSLVSLIYPVCELLLITGVCWMLIGYLD
FT                   RDPQDSVQLRNAVVGLWAALALWRFALPVLRARKERVIVTDQRVILRAQGIMGASESIP
FT                   LRAVRHVGRKRKNISLAVSGYQRPIMLINVAKAKHVVASIEEGMNQGRGYWG"
FT   gene            511886..513091
FT                   /locus_tag="CPC231_02485"
FT                   /old_locus_tag="CpC231_0494"
FT   CDS_pept        511886..513091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02485"
FT                   /old_locus_tag="CpC231_0494"
FT                   /product="5-(carboxyamino)imidazole ribonucleotide
FT                   synthase"
FT                   /EC_number="6.3.4.18"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09981"
FT                   /db_xref="GOA:D9QEQ8"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEQ8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366597.1"
FT                   /protein_id="ADL09981.1"
FT                   /translation="MTHSNGNPAAHAPDMPILCVIGDGQLARMMHTEAIELGQSIRVLA
FT                   SSHDSSAAQVTADVIIGDYTNLDDLRRVVAGSNAVTFDHEHVPSEHLRTLIAEGYNVQP
FT                   QPDALLNAQDKLVMRTRLKEMGAPVPPFAPITSVEDARAFWESVDGQVCVKARRGGYDG
FT                   HGVWFPDSAMELEELVDKLLSAGTPLMGEKKVQLVRELSAMVARTPSGEAQSWPVVESV
FT                   QTDGICTEAVAPAPGLGEELEHQCRELSIRIATELGVTGALAVELFETRGEDGQSEIFV
FT                   NELAMRPHNTGHWTQDGCVTSQFEQHIRAVLDYPLGATDLTAPVTVMANILGAATDPAQ
FT                   PMGERVAEVMRRFPNAKVHLYGKTYRAGRKIGHVNLTGTDVETTRADARLAAQYLAHAT
FT                   WA"
FT   gene            513132..513632
FT                   /gene="purE"
FT                   /locus_tag="CPC231_02490"
FT                   /old_locus_tag="CpC231_0495"
FT   CDS_pept        513132..513632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="CPC231_02490"
FT                   /old_locus_tag="CpC231_0495"
FT                   /product="5-(carboxyamino)imidazole ribonucleotide mutase"
FT                   /EC_number="4.1.1.21"
FT                   /EC_number="5.4.99.18"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09982"
FT                   /db_xref="GOA:D9QEQ9"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEQ9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014319882.1"
FT                   /protein_id="ADL09982.1"
FT                   /translation="MSPLVGLIMGSDSDWPTVQPAAETLAEFGIPFEVGVVSAHRTPEK
FT                   MLAYAKSAHTRGLKAIIACAGGAAHLPGMVAAATPLPVIGIPRALKDLDGMDSLLSIVQ
FT                   MPGGVPVATVSIGGAKNAGLLAVRILSAGDPALTEKMVAYQDAMREEVEQKDANLKRQL
FT                   MGE"
FT   gene            513638..514105
FT                   /locus_tag="CPC231_02495"
FT                   /old_locus_tag="CpC231_0496"
FT   CDS_pept        513638..514105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02495"
FT                   /old_locus_tag="CpC231_0496"
FT                   /product="YdcF family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09983"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:D9QER0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522798.1"
FT                   /protein_id="ADL09983.1"
FT                   /translation="MSADCRKESTILTLGSKVRGAEPGHVLLWRLQHALELSQQTSGPV
FT                   VVSGKGEAAVMGDWLVRHGLDPHRLIIEPEATSTNENLENAHALLPETHTWIVVTSDFH
FT                   KLRTLAWARHLGIPITVSSAVTKPPFRVRNFVREIFALPHSLLRIAWRRVA"
FT   gene            complement(514167..514370)
FT                   /locus_tag="CPC231_02500"
FT                   /old_locus_tag="CpC231_0497"
FT   CDS_pept        complement(514167..514370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02500"
FT                   /old_locus_tag="CpC231_0497"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09984"
FT                   /db_xref="GOA:D9QER1"
FT                   /db_xref="UniProtKB/TrEMBL:D9QER1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241355.1"
FT                   /protein_id="ADL09984.1"
FT                   /translation="MKPRDTQPQETRKKLVRDSVLGFVGFFAFLSLVQAVVNLFQPQPS
FT                   LWPAFLALILVIATIALWRAWR"
FT   gene            complement(514410..515246)
FT                   /locus_tag="CPC231_02505"
FT                   /old_locus_tag="CpC231_0498"
FT   CDS_pept        complement(514410..515246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02505"
FT                   /old_locus_tag="CpC231_0498"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09985"
FT                   /db_xref="GOA:D9QER2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9QER2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525421.1"
FT                   /protein_id="ADL09985.1"
FT                   /translation="MNHKIRATLGNYIGVVFILIWGLAPFYWMLITALRNKDYTFETTP
FT                   WPTHVTLENFRDALSTDKGNDFLGAIINSLLVGLATTILAVLVGVFTAYALARIEFRGK
FT                   GIVTGVVLAASMFPGIALVTPLFQLFGNLGWIGTYRALIIPNISFALPLTIYTLVSFFR
FT                   QLPWELEEAALVDGATRSQAFRHVLLPLAAPALFTTAILAFIATWNEFMLARQLSTTAT
FT                   EPVTVAIARFSGPSAFEFPYAAIMAAGSLVTIPLIIMVLAFQRRIVSGLTAGGVKA"
FT   gene            complement(515243..516328)
FT                   /locus_tag="CPC231_02510"
FT                   /old_locus_tag="CpC231_0499"
FT   CDS_pept        complement(515243..516328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02510"
FT                   /old_locus_tag="CpC231_0499"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09986"
FT                   /db_xref="GOA:D9QER3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9QER3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366601.1"
FT                   /protein_id="ADL09986.1"
FT                   /translation="MDTTRPARKVPSREGIVEARRKQHRNAALLIAPTLIVLAIVIGYP
FT                   ILRAIYLSFQADKGLDPVTGLFTQGGFAGLEHYAYWLTQRCGTSSGSAIACPPGVIATD
FT                   FWPAVGNTLFFTVVTVTLEIVLGMGMALVMNREFRGRALVRAAVLIPWAIPTAVTAKLW
FT                   QFIFADKGIVNSLLHTPIQWTTDPWAARFAVIIADVWKTTPFMALLILAGLQMIPKDVY
FT                   EAARVDGANTWQQFLQITLPLVKPALMVAVLFRTLDALRMYDLPVILISSSSNSPTATI
FT                   SQLVVEDVRQNHFNSASALSTLIFLLIFAVAFLMIRVLGADVTGRENTPKQRRQRGQRR
FT                   RGKHQKRDNSMAPKERTATAP"
FT   gene            complement(516506..517765)
FT                   /locus_tag="CPC231_02515"
FT                   /old_locus_tag="CpC231_0501"
FT   CDS_pept        complement(516506..517765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02515"
FT                   /old_locus_tag="CpC231_0501"
FT                   /product="extracellular solute-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09988"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D9QER5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014836070.1"
FT                   /protein_id="ADL09988.1"
FT                   /translation="MNVSKTGASLAATALFASAALAGCSSDSSAPAPQNTDGRGPITFA
FT                   MGKNDTDKVIPIIEKWNSSHPEEKVTLKELAGETDDQRETLVQSLQAGNSDYDVMALDV
FT                   VWTADFAANQWLAPLKDDLKVDTSGLLKATVESATYNGTLYALPQNTNGQLLFRNTEIV
FT                   PEAPTTWKDLTASCEAAKAKHVDCLTTQLKQYEGLTVNTAGFIEGWGGHILDDSGAPAV
FT                   DSEDSKAGVQALVDAYKDGSISKNSISATEEETNLAFVAGETAYAINWPYMYTNAAEAT
FT                   SAVKGKFEVSPLVGKDGVGVSTLGGYNNGINVNSKNKATARDFIKFIVNEDNQKSFADN
FT                   SFPPVLASIYDDESLVAKYPYLPALKKSLENAAPRPVSPFYPAISKAIQDNAYAALKGD
FT                   KNVEEATKDMRAAIQNASKK"
FT   gene            complement(517924..518601)
FT                   /locus_tag="CPC231_02520"
FT                   /old_locus_tag="CpC231_0502"
FT   CDS_pept        complement(517924..518601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02520"
FT                   /old_locus_tag="CpC231_0502"
FT                   /product="TIGR03089 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09989"
FT                   /db_xref="InterPro:IPR017523"
FT                   /db_xref="UniProtKB/TrEMBL:D9QER6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800113.1"
FT                   /protein_id="ADL09989.1"
FT                   /translation="MELLRNLLSSDPAAPRLTVYNESTGARLDFSAQTLDNWAAKVANM
FT                   MREELDLDQGSLISLDLPASWQCVAIVLGAMAAEIEVEFCPIEQAQGAVAFVAPERIDA
FT                   SPAFPGDVVLVTQDPFGRGVVECEGTVPDGMIDFGPTVRFYGDQFFEPGTRIEESVDKQ
FT                   VYAELPSGSRALSTGWTTFAEMQRTVLAPLAVGGSAVVVTGVASDQRLEAIGRAEKATM
FT                   RLS"
FT   gene            complement(518718..520286)
FT                   /locus_tag="CPC231_02525"
FT                   /old_locus_tag="CpC231_0503"
FT   CDS_pept        complement(518718..520286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02525"
FT                   /old_locus_tag="CpC231_0503"
FT                   /product="LytR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09990"
FT                   /db_xref="GOA:D9QER7"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:D9QER7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523097.1"
FT                   /protein_id="ADL09990.1"
FT                   /translation="MTDKYRRNRDIQAPPSVMPDTKQMGPRPVKIFLALISSIVLVISG
FT                   AGYFTIGKLGNTVASAGNLSLGGDKGMKEAADGATDILLVGSDSRTDAQGNPLSPQEIE
FT                   LLHAGDEENDNTDTIMVIRIPNDGSSATAISIPRDTYVHDNNLGNLKINGVYKNYKDKE
FT                   ATKLLSEGIGDRKTLDERSKQAGRQALISAVSDLTGITVDHYAEVGLLGFVLLTEAVGG
FT                   VEVCLNNSVKDEYSGADFGAGRQTLKGGQALAFVRQRHGLPRGDLDRIVRQQAFMASLV
FT                   NKVLSSGTLTNPQKLADMGKAVERSVVIDQNWDVMSFANQLQNLAGGNVRFNTIPVTSI
FT                   DGTGDYGESVVTVDVQQVHKFFDQLLNGGPKEEPSSQTSSESAAPTARQNITVDVLNAT
FT                   TTSGLAAEVAGYLKTKGHTIAETGNAPQGLYSHSQILATDPESEDAKRLSQELGNIPVV
FT                   QHNGLDLNSYVVVAASDYAGPKSTESATSTSTTTSVVGQPGADEGQAIVSPEIDAGGNG
FT                   PRCVN"
FT   gene            520403..521353
FT                   /locus_tag="CPC231_02530"
FT                   /old_locus_tag="CpC231_0504"
FT   CDS_pept        520403..521353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02530"
FT                   /old_locus_tag="CpC231_0504"
FT                   /product="glycosyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09991"
FT                   /db_xref="GOA:D9QER8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9QER8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014732909.1"
FT                   /protein_id="ADL09991.1"
FT                   /translation="MNKSVADIDSQICPTKLKRVTTTDAKPIAVITVTFSPGDHLAAFL
FT                   DSVSGATVRGAYTVLADNGSTDGTPQAAAKERDNVEFFATGGNIGYGSAINAAARHLKD
FT                   KRLNGDIEPEFFVLANPDVVFDKGSIDVMLECAQRWPQAGAVGPYIRQSDGSAYPSARA
FT                   IPTLSNGIGHALFGAVWPNNPWTKAYKDDADMSTERTAGWLSGSCLLVRWDAFDAIGGF
FT                   DERYFMYMEDVDLGDRFGRAGFDNVLCPSSFITHAVGHAAGKHPEKMLPAHHESAYRFQ
FT                   ADRHPHAWQLPIRVVLKLGLQARAFVAVASAKLKK"
FT   gene            521528..522616
FT                   /locus_tag="CPC231_02535"
FT                   /old_locus_tag="CpC231_0506"
FT   CDS_pept        521528..522616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02535"
FT                   /old_locus_tag="CpC231_0506"
FT                   /product="NTP transferase domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09993"
FT                   /db_xref="GOA:D9QES0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9QES0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366605.1"
FT                   /protein_id="ADL09993.1"
FT                   /translation="MTTTTLRGNTDAVILVGGKGTRLRPLTVSTPKPMLPTAGVPFLSH
FT                   LLARIKAAGIKHVVLGTSFKAEVFEEYFGNGEDLGLEIEYVVEDKPLGTGGGIRNVYEK
FT                   LRADTVMVFNGDVLGGTDLGGILDAHHEKQADLTMHLVRVPDPRAFGCVPTDQDGRVSA
FT                   FLEKTEDPPTDQINAGCYVFRRELIESIPADRVVSVERETFPKLLEEGRRVFGYVDNAY
FT                   WRDMGTPADFVRGSSDLVRGIAPSPLLDGRTGESLIDESAGVKDGALLLGGTVIGRGTE
FT                   VGAGCRLDDTVVFDGVTIEPGAVIEDSIIAHGVRIGANARIKGCVIGEGAQIGARCELL
FT                   NGLRVWPGVEIPTAGIRFSSDA"
FT   gene            complement(522814..523116)
FT                   /locus_tag="CPC231_02540"
FT                   /old_locus_tag="CpC231_0507"
FT   CDS_pept        complement(522814..523116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02540"
FT                   /old_locus_tag="CpC231_0507"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09994"
FT                   /db_xref="UniProtKB/TrEMBL:D9QES1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366606.1"
FT                   /protein_id="ADL09994.1"
FT                   /translation="MMFTYASAYARKSRQLTTRHIDSQHTHAELAGYVQPYKKTMQRIT
FT                   YLKFNTPTQDVVNPKTVFPVQKMNFPSSQTSRVTSFTQHISRGRGSGVLDIVSLI"
FT   gene            523144..523434
FT                   /locus_tag="CPC231_02545"
FT                   /old_locus_tag="CpC231_0508"
FT   CDS_pept        523144..523434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02545"
FT                   /old_locus_tag="CpC231_0508"
FT                   /product="WhiB family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09995"
FT                   /db_xref="GOA:D9QES2"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:D9QES2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241363.1"
FT                   /protein_id="ADL09995.2"
FT                   /translation="MASNAAPRTRTPLELTLDDLFGAVEQEWQEQALCAQTDPEAFFPE
FT                   KGGSTREAKRICQACAVRDECLEYALEHDERFGIWGGLSERERRRLKRDIG"
FT   gene            complement(523539..523994)
FT                   /locus_tag="CPC231_02550"
FT                   /old_locus_tag="CpC231_0509"
FT   CDS_pept        complement(523539..523994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02550"
FT                   /old_locus_tag="CpC231_0509"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09996"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:D9QES3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910944.1"
FT                   /protein_id="ADL09996.1"
FT                   /translation="MDYRLNRDRHGRGLRGPTFPTAVPRYRSRRSLFDAAVLEAYAPIQ
FT                   QSFAQQLANLDIAVDTVPRMRLNLDAALLPDEVAADGPIPLGRVIPAGIDHLGRPTRAR
FT                   IVLFRMPIEQRTNSTQERQELLTMVLTSLVANYLNVSPTDIDPDFQW"
FT   gene            524089..524490
FT                   /locus_tag="CPC231_02555"
FT                   /old_locus_tag="CpC231_0510"
FT   CDS_pept        524089..524490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02555"
FT                   /old_locus_tag="CpC231_0510"
FT                   /product="DUF3499 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09997"
FT                   /db_xref="InterPro:IPR021888"
FT                   /db_xref="UniProtKB/TrEMBL:D9QES4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241365.1"
FT                   /protein_id="ADL09997.1"
FT                   /translation="MDVNQFRRCSRPGCGKPAVATLTYAYAHSTAVVGPLAPNSDPHSW
FT                   DLCEFHASKITAPLGWELLRVDAVDDDDEDLTALAEAVREAGRTTSGLIDSNQDFGVNH
FT                   PVHRAQRKQVSKNTKRGHLSVVPDPEDDC"
FT   gene            524677..526056
FT                   /locus_tag="CPC231_02560"
FT                   /old_locus_tag="CpC231_0511"
FT   CDS_pept        524677..526056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02560"
FT                   /old_locus_tag="CpC231_0511"
FT                   /product="phosphomannomutase/phosphoglucomutase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09998"
FT                   /db_xref="GOA:D9QES5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D9QES5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366609.1"
FT                   /protein_id="ADL09998.1"
FT                   /translation="MRTRESVTKVIKAYDVRGVVGVDIDADFIREVGSAFGHLMRNEGA
FT                   TKVAVGHDMRPSSPELTQAFADGLTAQGVDVVALGLTSTDQLYYASGVMDCPGAMFTAS
FT                   HNPAEYNGIKMCRSGARPVGQETGLGAIIDMLVEGVPAYDGKPGAITQKDTLADYGSFL
FT                   RELVDLSGIRPLVVAVDAANGMGGHTVPEVFAGLPLDVKPLYFELDGTFPNHEANPLDP
FT                   KNLVDLQKFTPEVKADIGLAFDGDADRCFVVDENGDPVSPSAICAIVAERYLAQHPGST
FT                   IIHNLITSKTVPEVIAENGGVAVRTRVGHSFIKAQMAEHGAAFGGEHSAHYYFSEFFNA
FT                   DSGILAAMHVLAALGGQDKPLSELMKEYSRYAASGEINSRLASAEEQAERTQAVLDAFA
FT                   DRTESVDRLDGVTVELQGTKAWFNVRASNTEPLLRLNVEAPTAEEVDALVTEILGVIRQ
FT                   Q"
FT   gene            526194..527180
FT                   /locus_tag="CPC231_02565"
FT                   /old_locus_tag="CpC231_0512"
FT   CDS_pept        526194..527180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02565"
FT                   /old_locus_tag="CpC231_0512"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADL09999"
FT                   /db_xref="UniProtKB/TrEMBL:D9QES6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366610.1"
FT                   /protein_id="ADL09999.1"
FT                   /translation="MNTQEIFHDSESAAVPTHSYDPEAVAFYDIAHEGAQLRVVAEFVR
FT                   SGGLDAVQGTQPRSVVVVTTEAIATHSAHVSIALHAPLKVPVIVTAELPRYVGPLDIVI
FT                   VATERSSSEHLSQALTTAMRRGCMVILVSASGGMLHKDAAQEAIVVPSLPLIEGPSPLR
FT                   IIAVVMAVLALLEQDQERTATVLEESASHVDAEIMQCSPEYGENANRARQLAQITGHII
FT                   HTGTTASAVAVANLIAVLWTSYGKESTSLPATELGAALGRFSYAVKDIFFDPDLDKAPT
FT                   GQSLKTIAWCEPEPDAWERTEHIDAGSTGTPLRMIARGFAATAFISS"
FT   gene            527236..528393
FT                   /gene="manA"
FT                   /locus_tag="CPC231_02570"
FT                   /old_locus_tag="CpC231_0513"
FT   CDS_pept        527236..528393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manA"
FT                   /locus_tag="CPC231_02570"
FT                   /old_locus_tag="CpC231_0513"
FT                   /product="mannose-6-phosphate isomerase, class I"
FT                   /EC_number="5.3.1.8"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10000"
FT                   /db_xref="GOA:D9QES7"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="InterPro:IPR018050"
FT                   /db_xref="UniProtKB/TrEMBL:D9QES7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014836074.1"
FT                   /protein_id="ADL10000.1"
FT                   /translation="MQLLSPSAQAYAWGSRTLIQNLRGEEQGTSPIAELWYGAHPGGPS
FT                   KIGDESLAEHIAAAPEQQLGHRVHSEFGERLPFLLKILAADQPLSLQAHPSLEQAQEGF
FT                   ARDNEQGIQLGAHNRNYKDDNHKPELLIALTEFHAMAGFRPLAKTLEMLRFLDCEELER
FT                   YIAMVVDNPLKESDSLRALFTTWITIPTANRRDLIVAVVSSAKEKAESAPEWMSAALKN
FT                   IVLLNEQYPGDVGVLGAILLNYVVLQPGEAIYLDAGNLHAYVRGLGVEIMANSDNVLRG
FT                   GLTSKHVDVPELVRVLKFASLENPIVEAESGVYPVPINEFAIKRIDLDKTAEKIAHDGP
FT                   AILLCTAGTVEVGGVTLNPTQALWLSAADAEVEARGQGQLFVATV"
FT   gene            complement(528463..529230)
FT                   /locus_tag="CPC231_02575"
FT                   /old_locus_tag="CpC231_0514"
FT   CDS_pept        complement(528463..529230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02575"
FT                   /old_locus_tag="CpC231_0514"
FT                   /product="lipase chaperone"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10001"
FT                   /db_xref="GOA:D9QES8"
FT                   /db_xref="UniProtKB/TrEMBL:D9QES8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241369.1"
FT                   /protein_id="ADL10001.1"
FT                   /translation="MDNTYTRRFLLFIAAGTTLAIAIGILVWKLGSPQTTASNATSDAG
FT                   PQKLEEAAVTSSASVAPQPQSSAPAPADSSPQEDPYVVRTQYPIAPNRVPHVRHDPLMP
FT                   PNAHLGSGKPRPPTTTVAVPTTPQEQTTIAIPEIDTPTLDDPAEETPQNQSSQPHPPTV
FT                   PVSEGSSANPAQSTEKPDQNTSSTSTEPSTAPTEIITEPTAPLVDPSTVQKMLGSAGTL
FT                   LSPQEKPHPTAAKETEPKPEAPAQNTEKVVLQP"
FT   gene            529853..530206
FT                   /locus_tag="CPC231_02580"
FT                   /old_locus_tag="CpC231_0516"
FT   CDS_pept        529853..530206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02580"
FT                   /old_locus_tag="CpC231_0516"
FT                   /product="DUF4259 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10003"
FT                   /db_xref="InterPro:IPR025355"
FT                   /db_xref="UniProtKB/TrEMBL:D9QET0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910950.1"
FT                   /protein_id="ADL10003.1"
FT                   /translation="MSTWEREIFSEEVNVDFLDELNDLDSDDVVEAVRDACVLATGTGR
FT                   VSEDEQLNGLAAATIAAIWAGAPFSDGDLVSTYPFIREYIGEGDEALHESAAKLLEEAD
FT                   TEEDLEAFLEALS"
FT   gene            530398..531837
FT                   /locus_tag="CPC231_02585"
FT                   /old_locus_tag="CpC231_0517"
FT   CDS_pept        530398..531837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02585"
FT                   /old_locus_tag="CpC231_0517"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10004"
FT                   /db_xref="GOA:D9QET1"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:D9QET1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910951.1"
FT                   /protein_id="ADL10004.1"
FT                   /translation="MTSFDFKVKDLSLAEAGRHQIRLAEYEMPGLMQLREEYREEQPLA
FT                   GARITGSIHMTVQTAVLIETLVALGAEVRWASCNIFSTQDEAAAAVVVGPEGTVDNPQG
FT                   VPVFAWKGETLQEYWDCVHKIFAWPGDQLPNMILDDGGDATMAVIRGQQYEQAGVVPPG
FT                   EEGDSDEYQAFLEMLRATLESDPGMWTAIASSVKGVTEETTTGVHRLYHFAEEGVLPFP
FT                   AMNVNDAVTKSKFDNKYGTRHSLIDGINRATDMLMGGKNVLICGYGDVGKGCAEAMAGQ
FT                   GARVKVTEADPINALQALMDGFPVVTVDQAISEADIVITATGNMGIISFEQMLKMKDHA
FT                   VLGNIGHFDNEIDMASLLHRNDVSRVTIKPQVDEFTLPNGNAIIVLSEGRLLNLGNATG
FT                   HPSFVMSTSFADQTIAQIELFQNDGRYRNEVYRLPKILDEKVARIHVEALGGEITELTK
FT                   EQAEYIGVDVAGPYKPEHYRY"
FT   gene            531837..532457
FT                   /locus_tag="CPC231_02590"
FT                   /old_locus_tag="CpC231_0518"
FT   CDS_pept        531837..532457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02590"
FT                   /old_locus_tag="CpC231_0518"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10005"
FT                   /db_xref="GOA:D9QET2"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D9QET2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014401029.1"
FT                   /protein_id="ADL10005.1"
FT                   /translation="MIIAIEGIDGAGKNTLVRALVEKLDARVLGFPRYQDSIHAHLAQK
FT                   ALYQEMGDVSDSIYAMALLFALDRREIAEELRSYKGSEDVILLDRYVSSNAAYSAARAQ
FT                   DWNLVAWVSHLEFEEFGLPTPDIQVLLNTSPEVAAQRAAKREEQDQDRSRDCYETDSSL
FT                   QVRTSDAYARLAEEKRFSPWIVAQPGDSVDDVALKIIQTLGTM"
FT   gene            532596..533273
FT                   /locus_tag="CPC231_02595"
FT                   /old_locus_tag="CpC231_0519"
FT   CDS_pept        532596..533273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02595"
FT                   /old_locus_tag="CpC231_0519"
FT                   /product="response regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10006"
FT                   /db_xref="GOA:D9QET3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D9QET3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241374.1"
FT                   /protein_id="ADL10006.2"
FT                   /translation="MPQKILVVDDDPAISEMLTIVLEAEGFNTVAVTDGALAVETFNRE
FT                   EPDLVLLDLMLPGMNGIDICRLIRQNSTVPIVMLTAKTDTVDVVLGLETGADDYITKPF
FT                   KPKELIARLRARLRRTDDAPADVIEISDLAIDVPGHVVSRGREVIQLTPLEFDLLLELA
FT                   SKPGQVFTREELLQKVWGYRNASDTRLVNVHVQRLRAKIEKDPENPQIVLTVRGVGYKT
FT                   GQE"
FT   gene            533387..534961
FT                   /locus_tag="CPC231_02600"
FT                   /old_locus_tag="CpC231_0520"
FT   CDS_pept        533387..534961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02600"
FT                   /old_locus_tag="CpC231_0520"
FT                   /product="HAMP domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10007"
FT                   /db_xref="GOA:D9QET4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9QET4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800125.1"
FT                   /protein_id="ADL10007.1"
FT                   /translation="MMILAFVLVSFVTQRLINTKLDIANSEIDRARVSVEQQIKATGAS
FT                   SSMQVRLNSARAALVNKVASAEDQAVYEPVILVNNPDGSVIASPEGYRIPERLRSFVDQ
FT                   RQVSYQFATIDRANGTTYKALIIGTPTNSDIPNTQVYLVMSMESDEATLALLRGLFSGA
FT                   AIVLVVLLVGITWLLTQQVITPVRSASRIAERFSSGHLRERMVVDGEDEMARLAMSFNS
FT                   MAESLSKQIAQLEEYGNLQRQFTSDVSHELRTPLTTVRMAADMIADGSEDLSPGVKRAS
FT                   ELMVRELDRFEALLADLLEISRHDAGVADLAENNLDIRACINAAWQQVEHLAQELGIEV
FT                   RFDIPAEPVNLVGDSRRIERVLRNLLANAIDHANGKPVDVHCAVTEDAVAVAVVDHGVG
FT                   LKPGQEELVFNRFWRADPSRVRHSGGTGLGLAISREDAVLHGGTLAAAGVLGHGTMFLL
FT                   TLPLIPRSDITTTPIELVAPGFSTPEGLEASGDAVLTVEEGLAEKSLGQDAHQKEDTEE
FT                   RLGKQNG"
FT   gene            534954..536690
FT                   /gene="lpqB"
FT                   /locus_tag="CPC231_02605"
FT                   /old_locus_tag="CpC231_0521"
FT   CDS_pept        534954..536690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpqB"
FT                   /locus_tag="CPC231_02605"
FT                   /old_locus_tag="CpC231_0521"
FT                   /product="MtrAB system accessory protein LpqB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10008"
FT                   /db_xref="GOA:D9QET5"
FT                   /db_xref="InterPro:IPR018910"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="InterPro:IPR023959"
FT                   /db_xref="UniProtKB/TrEMBL:D9QET5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655148.1"
FT                   /protein_id="ADL10008.2"
FT                   /translation="MARVARLGLAIGLVGVLVSACTTLPSSSDPQAIRGFDVSSSTEQQ
FT                   APIAGQEPDLLLRDFYEANTNPSQRYKHARGYLTDAASERWSPGTSVLVLDGIDINSSA
FT                   NSSASRRVFDVRGNIVGSLEEGGSYVSKNESYSTTITLERVNSEWRIAELPDQIVVQRN
FT                   ELWNHYDPKQLYFFDTSGSTLVADRRWVFKDSSASRNSVESALITLMVGGPSRNLTPGV
FT                   VNEVPSGASFAGLSNGFYQFTGMSGLGQDEIRRISAQFVWTLALSGSAGPFKFAFDGVP
FT                   IKSERRDSEELTVDDFAEYNPQAGASVSTEIYALTNGSLRSVVGGQAAPVAGSYGAVHD
FT                   IESVAISNKDKVTAAVRAVGSGDKKKSSLLLGTVGGNYSEVLSAKTMTKPTFEPGASSL
FT                   WTVQDGRKIIRLARSSSGGDIVETEVSMDGLAESASGISMLQLSRSGVRAAMIIGGRVY
FT                   IGIVSRPNAGERRITNIHEVMPAIQDTAVSLDWDSNGSLIVGTSSSEAPVWVIAQDGSI
FT                   ATKLSAGNIVAPVVSVASNSSTRYITDARVALELPNSDSATVYWREVQGLEGGRSVIVV
FT                   PR"
FT   gene            536712..537317
FT                   /locus_tag="CPC231_02610"
FT                   /old_locus_tag="CpC231_0522"
FT   CDS_pept        536712..537317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02610"
FT                   /old_locus_tag="CpC231_0522"
FT                   /product="ComF family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10009"
FT                   /db_xref="GOA:D9QET6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D9QET6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241377.1"
FT                   /protein_id="ADL10009.1"
FT                   /translation="MWEFLFPQACMGCGKPGLRMCEECKEEWSRAPQRVTTLTDPHVPV
FT                   WSLGEFGGVRRRTIINFKERGRTDAVRYLGPVVAAAVEHLAALGEVEEDIVLLPAPTRM
FT                   RAAQQRGGDPVELMCRASGLRTERVLWHRPSVADSVGLDVSQRRSNLSGNVFLTGVPSC
FT                   AVLIVDDVITTGATLAESVAVLTSANVKIRGALGLSNV"
FT   gene            537455..538117
FT                   /gene="raiA"
FT                   /locus_tag="CPC231_02615"
FT                   /old_locus_tag="CpC231_0523"
FT   CDS_pept        537455..538117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="raiA"
FT                   /locus_tag="CPC231_02615"
FT                   /old_locus_tag="CpC231_0523"
FT                   /product="ribosome-associated translation inhibitor RaiA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10010"
FT                   /db_xref="GOA:D9QET7"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:D9QET7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241378.1"
FT                   /protein_id="ADL10010.2"
FT                   /translation="MTTPTGNNETLSPDVQVSITGRNVEVPEHFAERVNTKLAKIARLD
FT                   PTLTFFHVELQHEPNPRRAEQSDRIQITATGKGHIARAEAKEDSFYAALETALARMERS
FT                   LRKVKARRSISLSGHRAPKGAGETAAELVHEAETARADSQYDHDPYADSVEEVLPGRVV
FT                   RHKEHPSTPMSVDDALSEMELVGHDFYMFVNEETGRPSVVYRRHAFDYGLISLAKED"
FT   gene            538272..540815
FT                   /gene="secA"
FT                   /locus_tag="CPC231_02620"
FT                   /old_locus_tag="CpC231_0524"
FT   CDS_pept        538272..540815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="CPC231_02620"
FT                   /old_locus_tag="CpC231_0524"
FT                   /product="preprotein translocase subunit SecA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10011"
FT                   /db_xref="GOA:D9QET8"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:D9QET8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014836081.1"
FT                   /protein_id="ADL10011.1"
FT                   /translation="MFGLSKMLRVGEGRAVKRLKKIAEDVIDLEPQFSELSDDELKAKT
FT                   KEFQDRIAAGETVDDLLLEAFAVAREASWRVLGQKHYLVQVMGGAALHFGNVAEMRTGE
FT                   GKTLTCVLPAYLNALEGKGVHVVTVNDYLAKRDAEWMGRVHRWLGLEVGVILANMQPTE
FT                   RRAAYNADITYGTNNELGFDYLRDNMVRSLDELVQRGHHYAIVDEVDSILIDEARTPLI
FT                   ISGPVDGSSQWYSVFAQITPRLTRDIHFEVDERKRTVGIKEEGVAYVEDQLGIENLYAP
FT                   EHSQLVSYLNNAIKAQELFTRDKDYIVRNGEVLIVDDFTGRVLDGRRYNEGMHQAIEAK
FT                   ENVEIKNENQTLATITLQNYFRLYDKLAGMTGTAETEASELHQIYKLDVIPIPTNRDNQ
FT                   REDMTDLVYKTQEAKFAAVVDDIAERVAKGQPVLVGTTSVERSEYLSRLLQRRGVKHSV
FT                   LNAKFHEQEAQIVAQAGLPGAVTVATNMAGRGTDIVLGGNPDIIADINLRERGLDPVET
FT                   PEEYEAAWDEELAKVKNRGERLAEEVRKAGGLYVLGTERHESRRIDNQLRGRAGRQGDP
FT                   GTTRFYLSMRDELMVRFVGQSMENMMNRLNVPDDVPIEAKMVTNSIKGAQASVENQNFE
FT                   MRKNVLKYDEVMNEQRKVIYSERREILESADIAENIQKMIDDTIGAYVDGATANGYVED
FT                   WDLDALWNALESLYGPSMQAQELIDGTEYGSAGELSESDLRAAVLEDAHKQYAELEENV
FT                   SAIGGEAQMRNIERMVILPVIDQKWREHLYEMDYLKEGIGLRAMAQRDPLVEYQKEGGD
FT                   MFNAMKDGIKEETVRQLFLLRKQFQAPAVDETVEA"
FT   gene            complement(540828..541259)
FT                   /locus_tag="CPC231_02625"
FT                   /old_locus_tag="CpC231_0525"
FT   CDS_pept        complement(540828..541259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02625"
FT                   /old_locus_tag="CpC231_0525"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10012"
FT                   /db_xref="UniProtKB/TrEMBL:D9QET9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300520.1"
FT                   /protein_id="ADL10012.2"
FT                   /translation="MLVPIPGLSYLKTFTADATPQSSSSSYAPTDFKRLQLPDYVYKES
FT                   KSLVFMALNAAFGIRSITPLCHEQFGDQVHRLIAARRRSMPAVRGRIVMEALHLRPRGQ
FT                   LIDALGSANINNKHIGYLAQFLPLDETTRRLRMRSLRVI"
FT   gene            541416..541826
FT                   /locus_tag="CPC231_02630"
FT                   /old_locus_tag="CpC231_0526"
FT   CDS_pept        541416..541826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02630"
FT                   /old_locus_tag="CpC231_0526"
FT                   /product="HAD-IA family hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10013"
FT                   /db_xref="GOA:D9QEU0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEU0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599989.1"
FT                   /protein_id="ADL10013.1"
FT                   /translation="MRGLIVDYVGVLDGPVEDQRRWRNLLSAARANGIGTAVLSNDPGG
FT                   PGADPIRVLQTQGIVDAVILSGEIGAEKPEEAAFQAAADAIGLPMRDCVMVDDSILNVR
FT                   AAVECGLVGVFYQQFDRTVVELSGLFGLSGDF"
FT   gene            541826..542332
FT                   /locus_tag="CPC231_02635"
FT                   /old_locus_tag="CpC231_0527"
FT   CDS_pept        541826..542332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02635"
FT                   /old_locus_tag="CpC231_0527"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10014"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEU1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800129.1"
FT                   /protein_id="ADL10014.1"
FT                   /translation="MRVYVPATFSLLKELSEQGEISARSGYGFAVTPALREFYTSGDED
FT                   EIAHSAFEDAALASIRLLAVGDEEKFPYRRVVISADIADESVSLEPELGESVVKLSPSS
FT                   VSLDSVAAIHVDVQSSEDATAKAIEAIDEADLGVEDAELIVGDALDNFLAWYDPSELGA
FT                   LVELL"
FT   gene            542521..543579
FT                   /locus_tag="CPC231_02640"
FT                   /old_locus_tag="CpC231_0528"
FT   CDS_pept        542521..543579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02640"
FT                   /old_locus_tag="CpC231_0528"
FT                   /product="2Fe-2S iron-sulfur cluster binding
FT                   domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10015"
FT                   /db_xref="GOA:D9QEU2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEU2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910961.1"
FT                   /protein_id="ADL10015.1"
FT                   /translation="MARDRLASLRGVLKRFTTPLLPDDYSVLVNPLWSTRELRGQIQEV
FT                   HRDRDVVHLSIVPGWGVETDFHAGQYIGIGVEIDGRFVWRSYSLTNAPDPHARTLKITV
FT                   RAVEKGKLSNHLVGSVRPGTTIRLLAPAGDFHLSEPVPSKLAFLAAGTGITPIISMLRT
FT                   MAERKQLERCHAVLVYCVHDSTQLLFDQELTRLEQENPQLEVIRRITAREGRLTPQDYE
FT                   QVVPDITSRAIFACGPSRMLDQAHAWAEERGITITSERFTIDRASDAQGGMITFGDRGN
FT                   IQADGATTLLEAGEKSGVNLPFGCRMGVCHTCVRPLLEGHAQNLVTGETHEPGSRVRTC
FT                   VCVAAGDLTIGV"
FT   gene            543596..544870
FT                   /locus_tag="CPC231_02645"
FT                   /old_locus_tag="CpC231_0529"
FT   CDS_pept        543596..544870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02645"
FT                   /old_locus_tag="CpC231_0529"
FT                   /product="acyl-CoA desaturase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10016"
FT                   /db_xref="GOA:D9QEU3"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEU3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014836083.1"
FT                   /protein_id="ADL10016.1"
FT                   /translation="MAIDNIQAYSHLSDEDIAEIGKRLDAIKLEVTESLGERDVAYIRR
FT                   LIRAQRALEVAGRISLIFAGNKKCWWAGTAFLSIAKILENLEIGHNVLHGQWDWMNDPE
FT                   IHSTTWEWDIVCPSSQWMHSHNYVHHTYTNVLGMDHDVGYGVLRVTRDRKWTPLHAFQP
FT                   VINPVLATMFQWAVGYYDVELGKFFSQRTTWEGTKEKFWETTSKAVRQVSRDYILYPAL
FT                   AGRNYPRAVAANALANFTRSVWAYAVIFCGHFPDETETFTKEQFKNEDRNQWYLRQMLG
FT                   SANFHGGKLLTLMSGNLNYQIEHHLFPDMPSNRLAEVGKKVRALCAEYDLPYNIDSFPV
FT                   QLFKVQKTLLKLALPNKYLVASPDNAPEVRSNRAFTENPSIERQLGVDSSGKRVGLKTG
FT                   LRLLKQVRPGIRDVIRAYSGRSTRK"
FT   gene            complement(544881..545897)
FT                   /gene="rsgA"
FT                   /locus_tag="CPC231_02650"
FT                   /old_locus_tag="CpC231_0530"
FT   CDS_pept        complement(544881..545897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsgA"
FT                   /locus_tag="CPC231_02650"
FT                   /old_locus_tag="CpC231_0530"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10017"
FT                   /db_xref="GOA:D9QEU4"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEU4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910963.1"
FT                   /protein_id="ADL10017.1"
FT                   /translation="MARRSSAHRWDESDVRVRPSKGSRPRTKDRPRHDDALFGMVVTKD
FT                   RGRWGVVLDSADPAADPIVCMRAREMGRTAVEVGDRVGVVGDTSGRPGSLARIVKLEER
FT                   TSVLRRTADDTDPYERIVVANAHRLLIVCAVADPPPRAGFVERALVAAFVGNLQPILCL
FT                   TKSDLADPTQFAEEFSSLNVPVVVCGIDDPIAPVQELVTNSVTATIGHSGVGKSTLVNR
FT                   LVPDAFRETGTVSGVGKGRHTSTQAVALRLPGGGWIVDTPGIRSFGLAHVDADAVVGVF
FT                   EDLSAATENCPRGCTHAGPPADPECALDQFDADSPTGRRVIAVRKLLASLRTNTEWD"
FT   gene            complement(545897..547171)
FT                   /gene="aroA"
FT                   /locus_tag="CPC231_02655"
FT                   /old_locus_tag="CpC231_0531"
FT   CDS_pept        complement(545897..547171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="CPC231_02655"
FT                   /old_locus_tag="CpC231_0531"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10018"
FT                   /db_xref="GOA:D9QEU5"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEU5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014732912.1"
FT                   /protein_id="ADL10018.2"
FT                   /translation="MCVLWDAPTVTAPVSAVVTVPGSKSMTNRALVLSALADSPSHIKG
FT                   ALHSRDTDLMTRALQALGTDVRSHDSSSLVVNPVPLHGGTVDCGLAGTVMRFVPPVAAL
FT                   AQGTTEFDGDPQARTRPMNQILDALRGIGVQVHGDALPFSISSSETPHGGSIDIDASSS
FT                   SQFVSGLLLAAPCYRDGLTVRHIGGKLPSIPHIEMTVDMLRSAGVQVDDSSENQWTVHP
FT                   GGISGRTWEIEPDLSNATPFLAAAAVTGGTVTIPGWPQRTTQAGDSIRSILSSMGCDVS
FT                   FITYNGSNALQVTGPSDGLNGICLDMSDIGELTPTVAALAALAATPSELSGIAHLRGHE
FT                   TDRLKALSDEINRIGGHCEELADGLRITPRPLRAGTWHSYADHRMATAGAIVGLVVPGI
FT                   RVENIATTAKTLPDFENIWSAMVSD"
FT   gene            547192..547860
FT                   /locus_tag="CPC231_02660"
FT                   /old_locus_tag="CpC231_0532"
FT   CDS_pept        547192..547860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02660"
FT                   /old_locus_tag="CpC231_0532"
FT                   /product="SOS response-associated peptidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10019"
FT                   /db_xref="GOA:D9QEU6"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEU6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523108.1"
FT                   /protein_id="ADL10019.2"
FT                   /translation="MRYMCGRFVLCTTDEQLLQVPGFAAVHAPMGLPAPRYNIAPTQKI
FT                   AVLRAGSTPHEAVIEPARWGLLPSWKQDDSGPPLFNARAETVTEKPSFRAAFASRRCLI
FT                   PLDGYYEWHNKQPYWITTGSVVWVAGLWDSGAQQLSATMITTDSRPPLDRVHHRMPRFL
FT                   SEDEFTMWLQGSPDQAASLLIPGDASAFSLTPADKAVGNIRNDYPELIGLNVDKLPIDE
FT                   "
FT   gene            complement(547819..548322)
FT                   /gene="ybaK"
FT                   /locus_tag="CPC231_02665"
FT                   /old_locus_tag="CpC231_0533"
FT   CDS_pept        complement(547819..548322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="CPC231_02665"
FT                   /old_locus_tag="CpC231_0533"
FT                   /product="Cys-tRNA(Pro) deacylase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10020"
FT                   /db_xref="GOA:D9QEU7"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEU7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300523.1"
FT                   /protein_id="ADL10020.1"
FT                   /translation="MSKKKHSAATPALAVLASSDVDYKVSSFEGGTEHFGDHAAAALGV
FT                   EPERIFKTLVVDLTAGKGPKRQLAVACVPVTSQLSLKKVAAALGASKATMADPHDASKS
FT                   SGYIPGGISPLGQKTVLPTVIDETAILFDTIFVSAGRRGLDVELSAESLASLVDGKLVD
FT                   VQAD"
FT   gene            548370..549041
FT                   /locus_tag="CPC231_02670"
FT                   /old_locus_tag="CpC231_0534"
FT   CDS_pept        548370..549041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02670"
FT                   /old_locus_tag="CpC231_0534"
FT                   /product="sigma-70 family RNA polymerase sigma factor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10021"
FT                   /db_xref="GOA:D9QEU8"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014293"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEU8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241389.1"
FT                   /protein_id="ADL10021.1"
FT                   /translation="MATKTTELGKRFEAEALPLLDQLYGGALRMTRNPADAEDLVQETY
FT                   IKAFQAFASFKEGTNLKAWLYRIMTNTYINSYRKKKRQPVQSSAEDVTDYQLLATASHD
FT                   STGLESAEVEALKNLPNQRIAQAMNELSEDYRMVVYYADVEGLAYKEIADIMETPLGTV
FT                   MSRLHRGRKQLREALKDVAHDHGIGVSETASSENEASAASHSSETMDIAAGNHKVGKAK
FT                   A"
FT   gene            549041..549322
FT                   /gene="rsrA"
FT                   /locus_tag="CPC231_02675"
FT                   /old_locus_tag="CpC231_0535"
FT   CDS_pept        549041..549322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsrA"
FT                   /locus_tag="CPC231_02675"
FT                   /old_locus_tag="CpC231_0535"
FT                   /product="mycothiol system anti-sigma-R factor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10022"
FT                   /db_xref="InterPro:IPR014295"
FT                   /db_xref="InterPro:IPR024020"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEU9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241390.1"
FT                   /protein_id="ADL10022.1"
FT                   /translation="MSEKGSLDCGCNCEDLHVHMYALLDRELTEVECARLNAHIAQCPE
FT                   CAEMIAAEESLRRLLKKCCCGPAPASLREKISYSIQIERTTIITQREF"
FT   gene            complement(549561..549821)
FT                   /locus_tag="CPC231_02680"
FT                   /old_locus_tag="CpC231_0536"
FT   CDS_pept        complement(549561..549821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02680"
FT                   /old_locus_tag="CpC231_0536"
FT                   /product="WhiB family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10023"
FT                   /db_xref="GOA:D9QEV0"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEV0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599996.1"
FT                   /protein_id="ADL10023.1"
FT                   /translation="MDWRHEAICRDEDPELFFPVGNSGPALAQVAAAKVVCNRCPVTSQ
FT                   CLAWALETGQDAGVWGGMSEDERRALKRRKNRGRGRARISL"
FT   gene            550436..550858
FT                   /locus_tag="CPC231_02685"
FT                   /old_locus_tag="CpC231_0537"
FT   CDS_pept        550436..550858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02685"
FT                   /old_locus_tag="CpC231_0537"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10024"
FT                   /db_xref="GOA:D9QEV1"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEV1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366625.1"
FT                   /protein_id="ADL10024.1"
FT                   /translation="MNKNIQFPPRPVLYGGWIAAIQSLIGIAYAVLLIVREAAGYNDAS
FT                   IVYESDGANTWVGYGTAVFFIIVFGAVLAGAIMMNRGKRWGRGPVIMLQILLLPIAYYM
FT                   FSGGAFVFSVITALTAIAALALLFSPRAVDWAARNY"
FT   gene            complement(550925..551782)
FT                   /locus_tag="CPC231_02690"
FT                   /old_locus_tag="CpC231_0538"
FT   CDS_pept        complement(550925..551782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02690"
FT                   /old_locus_tag="CpC231_0538"
FT                   /product="hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10025"
FT                   /db_xref="GOA:D9QEV2"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEV2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241393.1"
FT                   /protein_id="ADL10025.2"
FT                   /translation="MRHRLFKAGAAILAFIATLPAAVTPAYAHASTHNAVIFGDSVVAN
FT                   PELIRYVATWLKIPTTTPPTERGECPTSPHNFGVLAAQRLGLRADNYACAGAVGVGDKS
FT                   LLSASRRSVSLQIDQAAAQRTLNRNTKRVFISLGFNDTYSQLARGRTDHQIRHDFAAKM
FT                   TREVARIRKLAPHARIQFIGYPRITENNSVCLFHVGNNLHDYTFAPEVAHLERLAQEME
FT                   QDAAAASGAEFVNLKGATKNNHMCAPDNQRMWSGIIDGTAGHTNLPFHLNDRGHKYVAD
FT                   FLAK"
FT   gene            complement(551887..553092)
FT                   /locus_tag="CPC231_02695"
FT                   /old_locus_tag="CpC231_0539"
FT   CDS_pept        complement(551887..553092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02695"
FT                   /old_locus_tag="CpC231_0539"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10026"
FT                   /db_xref="GOA:D9QEV3"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEV3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241394.1"
FT                   /protein_id="ADL10026.1"
FT                   /translation="MTKSLRKTRKDLIAATIIAGISITGVSIVWATAPVNNVTYSPAAQ
FT                   PLVVSETPPVPVHSLTPQWETPADQLTTKPIIAAGLVMSYDGHSVNAIDPATGAPVWSY
FT                   ARTEKLCSLGQAWSSVVLTFHTGRGCGDVVSLDAASGTYKATRSASASDVVVPISSNDA
FT                   VGTVSSERVELWRSDLVRTVEYGDVPIKQEANQQPHEDCEISSALSRKTLLGVTEKCEE
FT                   AWWLRLQKTVPEDSRVPEITRDIHISGENARIVAIGQEAAAVFVESPHPRIDSFNANGE
FT                   LTASIQVPLADASAWDHGPSVADLPHHITWFDGHRLYLFNPSSLHVEHIIDNVLGTGVA
FT                   INNKLYVPVFNGIAVINWETGVAESVLEVDRGTYNGLVSLGLAGNHVVEKRGDHLVGLA
FT                   LS"
FT   gene            complement(553089..554414)
FT                   /locus_tag="CPC231_02700"
FT                   /old_locus_tag="CpC231_0540"
FT   CDS_pept        complement(553089..554414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02700"
FT                   /old_locus_tag="CpC231_0540"
FT                   /product="DEAD/DEAH box helicase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10027"
FT                   /db_xref="GOA:D9QEV4"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEV4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241395.1"
FT                   /protein_id="ADL10027.1"
FT                   /translation="MSVSTHKPTFAELGVAAEIVDALSEQGITHTFAIQELTLPIALDG
FT                   RDIIGRARTGMGKTLGFGVPLLDRVFDAADVAELDGTPRALVVVPTRELAQQVGEDLER
FT                   AARRTPVRVTTVYGGRPYEEQIQVLTAGVDVVVGTPGRLIDLHQQGNLTLDHVAILVLD
FT                   EADEMLDLGFFPDIEKLLGALKHQHQTLLFSATMPGPVLTLARTFMSRPIHIRAEEVNA
FT                   SHTHASIEQVVFQAHRMDKTAITARALQAKERGKTIIFTRTKRTAAELAEDLAGRGFRV
FT                   AGVHGDLGQAARELSLGMFRNGRVDILVATDVAARGLDIDDVTHVINYQTPDAPMTYVH
FT                   RIGRTGRAGHTGTAITLVGYDELIKWKLISDELGLDTPAPPQWFSTSPELFDALSIPET
FT                   AGETVGQPLKVAGSSRSTIKSRRTGNQRSTDAKPTTRRHRRR"
FT   gene            554697..554924
FT                   /locus_tag="CPC231_02705"
FT                   /old_locus_tag="CpC231_0541"
FT   CDS_pept        554697..554924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02705"
FT                   /old_locus_tag="CpC231_0541"
FT                   /product="DUF3107 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10028"
FT                   /db_xref="InterPro:IPR021456"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEV5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241396.1"
FT                   /protein_id="ADL10028.1"
FT                   /translation="MDIKIGFSDSPRELVVSSRETQDEVVARVSEALANDSGLLTLTDE
FT                   NGNRYLVRNSQISYVEVGNSNTRTVGFSGA"
FT   gene            554927..555817
FT                   /locus_tag="CPC231_02710"
FT                   /old_locus_tag="CpC231_0542"
FT   CDS_pept        554927..555817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02710"
FT                   /old_locus_tag="CpC231_0542"
FT                   /product="DUF3152 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10029"
FT                   /db_xref="GOA:D9QEV6"
FT                   /db_xref="InterPro:IPR022603"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEV6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241397.1"
FT                   /protein_id="ADL10029.1"
FT                   /translation="MKTPHEESFFVRFARDYGWRAYAIPVLAVITVWVLVDVFVARPSD
FT                   QKPTEKPVSESTEQVSETRQPPLKGPNPADQEQPKIAATELPPGADFTQKGEGTYRVVG
FT                   APGAKAGQGKEKKFTYVIEIENGIKSEVFGGDDAFAAVIDATLTNPKSWAHDEKFAFEH
FT                   IANSPDADPDLRIQLSSVDTTHGLCGHNISMETSCFYSDGNRVVINESRWIRGAIPFQG
FT                   DLGAYRQYLINHEVGHGIGYASHEPCGGNGELAPIMMQQTLSLSNTELSKIDATEAYKD
FT                   DGAVCAANPWPYPFG"
FT   gene            555886..556725
FT                   /locus_tag="CPC231_02715"
FT                   /old_locus_tag="CpC231_0543"
FT   CDS_pept        555886..556725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02715"
FT                   /old_locus_tag="CpC231_0543"
FT                   /product="TIGR02569 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10030"
FT                   /db_xref="InterPro:IPR013402"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEV7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366630.1"
FT                   /protein_id="ADL10030.1"
FT                   /translation="MDFTALPPHVRNVFHAPDEPARAMGAAWDYGWKVGSVVFSQVAHP
FT                   VRAAWSSRIREKLQPEGVRIVRPIKSTDGRFINAGWRASSFAPGILTRRVDETVAAALR
FT                   LDLALSTVEVPASFKDVDDTDVFSIADHIAWHASPTSAIDLQDSVPRHLTAINIMPKVE
FT                   LLLREIDAPNQVVHADMFATTLYAGVQAPTVTDVMGVARPYGYTAAISIIDALCVGAVD
FT                   EGIIGRFSHVPHLDQLLLRALAYRTAVHALHPDATSNTGTNLEWVAKTVMSKVSVTL"
FT   gene            556729..559917
FT                   /locus_tag="CPC231_02720"
FT                   /old_locus_tag="CpC231_0544"
FT   CDS_pept        556729..559917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02720"
FT                   /old_locus_tag="CpC231_0544"
FT                   /product="UvrD-helicase domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10031"
FT                   /db_xref="GOA:D9QEV8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEV8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655153.1"
FT                   /protein_id="ADL10031.1"
FT                   /translation="MNLSATSETPLTKDVHKVPGQEPTPAVGYLDSQRAAFKQPPTPQV
FT                   RIVSADHHVETHNWENDLFKSQTGIWRLIGSAGSGVSTLIMDTVAERLRRGEDPSNILV
FT                   IAASKEGATRLRTGIAARLSGESYTAAATMVRSVHSLAFALLRSLSGEDLRLITGAEQD
FT                   AVIRELLQGHNEDSEAAQIWPQETRDALGFVGFARGLRDFLLRAVERGLSPEDLERLGN
FT                   TYHRPMWKAAGAFLREYEQTMALGGAKSLSASELVSTVLEYHIPDQGWRTVIVDDAQHL
FT                   DPKSAQLIGELLRYAEFGIIGGDPEQSVFHFRGASPEFLTKYPAEHQLMLKTTRRLPET
FT                   TARIVENQGQHFEYVADKIRRAHLIDGVPWDDIAVIVRSTGLIAPIRRALLAAGVPVQV
FT                   DPTDIILSEQRIVASMILAVRAIHGELNNRELEDLLLGPIGGADSVTLRRLYRGLRKVE
FT                   MSRGGSRRAIELLKILISPRPSEEQNDLIGEAEEVLSERELQILERTRRVLLRGAQPGS
FT                   VEEVLWAIWHETGLANHLQAVSLRGGAAGSQADRDLDAAMALFDAAGDWVERRPTAGIV
FT                   SFMRHIAEQELPTGVRDRRQIRTQAVQLLTAHAALGQQWHTVIVAGVQEGSWPSLGETG
FT                   TLFGQEELTDLIDSGIEPNTIVMRSKDRLDEERRLFHVAKSRATHRLYITAVEDPASND
FT                   VAEPSRFIEELDPSFFQQQSQENEASYADLSVPLAPKDTGLEDYIRLLSVPAMVAELRR
FT                   EVRNSDSPQRRRDQAARQLARLASAGVPGAHPEEWWGEGGPSTDQPLQQRSISPSLIEQ
FT                   GLTCPLRARLDAVIEGEETPFQMLKGSLAHAYAEAIARGVESETAKELTTEAFLRLLNA
FT                   PAWQQETEKAAWIRMIERLEEWITVSAARYELVGVETSVNTKIAEGITIRGRIDRIERT
FT                   QDGAYRIIDYKTGTRGLSAKEVADHKQLMAYQLALSKGKLSDTGDVISGNDEESLIVDQ
FT                   AVLVYPGSTTKKIKTCEQATKTPEELQEFADLLPPLIQNLTGPSLMAVVNDGCSNCSII
FT                   NICPAQPEGRMTPA"
FT   gene            559914..563138
FT                   /locus_tag="CPC231_02725"
FT                   /old_locus_tag="CpC231_0545"
FT   CDS_pept        559914..563138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02725"
FT                   /old_locus_tag="CpC231_0545"
FT                   /product="UvrD-helicase domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10032"
FT                   /db_xref="GOA:D9QEV9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEV9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800136.1"
FT                   /protein_id="ADL10032.1"
FT                   /translation="MIDPIELSRLLKQKFPPTPQQAAVIGAELEPMLVVAGAGAGKTET
FT                   MAARVVWLVANNIANPDRILGLTFTRKAAQQLSQRIRGRLEQLAGMDALRDIDPSGELS
FT                   YKLEAIAPTVSTYDSYAGSLIREYGLLLPVEPTSRLITETELFQIAYDIVINYSGSLDT
FT                   QTQPVNATEKLLSLVSEIDNHIVSPQDIVEETDAFLSVLDDVEAASKRGLNQILIGWKQ
FT                   RQIIRKQMLPMVAMLKQHLAYNNLMTFGEQMSLAARLAEENPQVGASQRDRYSVVLLDE
FT                   YQDTGHAQRVLLRSLFSGAAVTAVGDPMQSIYGWRGATSANLERFREDFALGEEPAQKR
FT                   ELTVSFRNPPEVLQLANEVSREVLGAPDNPRRTVQPLSSREGAPHGEVTLGFFPSAEKE
FT                   REFVADQLAEAYKNRGESFTAAVLVRKKRHSAPIALELQSRGVPVEIVGLSGLIDIPEV
FT                   ADLIAIAAMLIRPQDTKSALRILAGPHVGLGAADILALADRAANLAGRGKAEREEKKTD
FT                   PLERLEQIIAETLPKAPESVVGLAEAVADLDVPREEGAATRYSDEGLRRLQLLASELRY
FT                   LRTHSLGHSLPDLFADIERVFGIRTEVLQREDPHSDGAPGTVHLDRFAEVVSDFARVPN
FT                   ATLSQFLDYLELSRSQGDGLEPGEVQVRSDRVQILTVHKAKGLEWQIVSVMHADSSTYK
FT                   TTTSTWLSNESAVPSALRGDAREDDSLVGAPVWYIDSAESPADLKKQGEAHIAEFRAVE
FT                   EEENARLFYVALTRAEERVLVTASTDITKASPPGPYAHLDMLRTKFPDCVVEWFDGESD
FT                   DALEPPLPEIGVFPQELRPEGADAVKAAMVDLPELIEDGELFERWEQEVTALIEEHHQL
FT                   STPVVPVELGLELTASDIVNLSQDPQAFARRRRRPVPFKPNSYAKRGTAFHQWLENRFG
FT                   ATALLDADELPGIDDALDGTELETLKARFLDSEWADRTPEYVEHPFEVSIGEHIVRGRM
FT                   DAVFRDADGRWIVVDWKTGQPPTEAAERRSVSLQLAVYRLAWARLQGVEPSEVQALFHY
FT                   VGRNFSYRPSELPDEASLARMLALNV"
FT   gene            563175..564254
FT                   /locus_tag="CPC231_02730"
FT                   /old_locus_tag="CpC231_0546"
FT   CDS_pept        563175..564254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02730"
FT                   /old_locus_tag="CpC231_0546"
FT                   /product="Ion channel protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10033"
FT                   /db_xref="GOA:D9QEW0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEW0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366633.1"
FT                   /protein_id="ADL10033.1"
FT                   /translation="MPLTNRDAGRYLGDEGLTELPEHTLLNVIRIPGNPLISPVRLIAR
FT                   RFGYALVLILLVALIVYFDKGGYSEHLTFIDALYYSAVSLSTTGYGDITPVTQGARLLN
FT                   IIIITPLRLTFVILLVGTTLSVLTEESRRAWKIQRWRKRMRNHTVVIGYGTKGRSAVSA
FT                   LLADGVSPKEIVVVDTDPVALETANTVGLVTVNGSATKSEVLKLAGVPKAKAVVVAPNI
FT                   DDTAVLVTLSVRELAPSAWVVASVRESENQHLLEQSGADSVVISSETAGRMLGLATVTP
FT                   SVVEMMEDLLSPDEGFSVAERPVGEDEVGANPRHLADIVLGVVRSGELYRIDSPEAETV
FT                   EPSDRLLYIRRVFSEDVSD"
FT   gene            564310..564969
FT                   /locus_tag="CPC231_02735"
FT                   /old_locus_tag="CpC231_0547"
FT   CDS_pept        564310..564969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02735"
FT                   /old_locus_tag="CpC231_0547"
FT                   /product="NUDIX domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10034"
FT                   /db_xref="GOA:D9QEW1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEW1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014401039.1"
FT                   /protein_id="ADL10034.1"
FT                   /translation="MLSSQWPGAPAFNVTDQLLVQRVDPEVVDSVTGTATRLYTSWVTR
FT                   AIAVLRNREVMVYDPTSGERLEYNAPTIGQTLGGKEVFPRIDPAVIGLITSESDEYVLV
FT                   GENSHRCGYFSLIAGYLGMGETFEQALTREVWEETGRRISHISYVKSQSWPYSGAIMVG
FT                   MTAQTTDMDAVVQPDGELKEIRWITRKEIIQGTIQLPAPGSIAHDMMWDWVKKHDD"
FT   gene            564962..567013
FT                   /locus_tag="CPC231_02740"
FT                   /old_locus_tag="CpC231_0548"
FT   CDS_pept        564962..567013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02740"
FT                   /old_locus_tag="CpC231_0548"
FT                   /product="UvrD-helicase domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10035"
FT                   /db_xref="GOA:D9QEW2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEW2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241403.1"
FT                   /protein_id="ADL10035.1"
FT                   /translation="MIDLNELDSDQRAAASAPRGPVAILAGAGTGKTRTITYRIANLID
FT                   RGMASPNRVLAVTFTRRAAGEMRHRLGVMGVGGVQAQTFHSAAMRQLSYFWPQVAGNLP
FT                   WKLLDNKFPLVGKAARSVGIETTTENVRDLLGEIEWAKATLITPDRYVEHVKDRKIPAA
FT                   ADKIAQVYRRYEQAKTTSEGMLLDFDDLLLHTAGAIENSTAIAEEFREQYRTFVVDEYQ
FT                   DVTPLQQRVLDAWLGERDDITVVGDANQTIYSFTGATPNYLLGFSRKYPHATVVKLQRD
FT                   YRSTPQVTDLANTVIGKARGRVAGTRLQLEGMRPPGPDPEFCTFDDEPAEARAVASRIK
FT                   ELLDKGVAASEIAVLYRINAQSAVFEQALADAGIVYQVRGGGEFFQRAEIRQAMSQLVR
FT                   VAQRTGTESIRGSALETLVRSSLAPLGLTPEEPEGTQARERWQSLDALAELTVELTQAT
FT                   PDLDIQGLLEQLNQRASAKHPPTMQGVTLASLHAAKGLEWDAVFLVGLVDGTLPITHAL
FT                   KGGEPHIEEERRLFYVGVTRAREHLVCSWAKARQEGGRATRKRSRFFDGIVEEPIHAAV
FT                   PPRTKRSRRCRVCGSPLSTSAENVMGRCVDCPSGVGEEVFETLKAWRLDMAKEGGVPAY
FT                   IVFTDATLHAIAEACPTTTDELLKISGIGQMKAEKYGSSLLEVLAQFH"
FT   gene            complement(567007..567858)
FT                   /locus_tag="CPC231_02745"
FT                   /old_locus_tag="CpC231_0549"
FT   CDS_pept        complement(567007..567858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02745"
FT                   /old_locus_tag="CpC231_0549"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10036"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEW3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523828.1"
FT                   /protein_id="ADL10036.1"
FT                   /translation="MNTGGNVVLSPSNQVLARTEGIQFGLDSAHAGIFPAPRELIDALV
FT                   PILRSLREPRAKVQVISELTSAGLHPVAARGLMEDLLAHGVLRQQSTPYASAVIGDDPL
FT                   ANAISNLLKGAGVSVLRSTHFPISEDFMEHVHRRTLVIVCNPKESCVEDRINTHGFLLP
FT                   VALIDAHGMIGPVRIAGSGPCLACSDLYRTDADPEWPALRTQSLLSSHSFSAEPHLITA
FT                   TAAHAIFVIQSLLSEQNNVYSAASQSVIPGDSFKISAFEVERLPRLSTHPRCPFCWDLQ
FT                   RQ"
FT   gene            567893..568408
FT                   /locus_tag="CPC231_02750"
FT                   /old_locus_tag="CpC231_0550"
FT   CDS_pept        567893..568408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02750"
FT                   /old_locus_tag="CpC231_0550"
FT                   /product="DUF45 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10037"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEW4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523113.1"
FT                   /protein_id="ADL10037.2"
FT                   /translation="MPRKNTPELPVEVIRSKRRVRTVSARLIDGRVQIRIPESMSKNDE
FT                   QRVIAEMSAKVKRKTQSTADSNEQLFQRAQYLNRRYLDGKANLGSIKWVTNQRRRWGSC
FT                   SQSTGEIRISHRLKEVPDYVLDSVIIHELVHTFIHSGHSKEFWEWADRAPYAERAKGFL
FT                   EAMQRVSG"
FT   gene            complement(568476..569864)
FT                   /locus_tag="CPC231_02755"
FT                   /old_locus_tag="CpC231_0551"
FT   CDS_pept        complement(568476..569864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02755"
FT                   /old_locus_tag="CpC231_0551"
FT                   /product="hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10038"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEW5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241406.1"
FT                   /protein_id="ADL10038.1"
FT                   /translation="MNTNGFGFSFNFGGNGDDDNNGRNNNPFGAGGLGDMLNQFGQMLS
FT                   GMGSTMNSPEGQGAVNYALAERIARQQIGSSTAVSDNDTAAVEEAVRLVEIWLDDATIL
FT                   PASGNTVAAWDASLWLEQTLPMWKRLVTPVAENMAQAQVDSLPEEAREMVGPMMQIMNQ
FT                   MSGMNFGMQLGHALGDLATQTIAGTDFGLPIAPTGVTALLPANLRKETSGLKIEDREVI
FT                   VYLSAREAARQRLFKHVPWLRERLVSSVEEYAAGLVIDTSHIEEAMRDLNLESGDPAAI
FT                   QNAMEQLQGLDMSPRITSRNSHAASRLETLLALIEGWVEIVVTEAMGNRIPSTAALNEA
FT                   WRRRRATGGSAEQAFAKVVGIEFAAPKVAEARELWRRVGVAVGTELRDHVWDHPDFLPT
FT                   AEDLESSAEFIDALLDDSSGSDFDPIAEITKLEEMLASEGENPESKENPKPEDDTDDQD
FT                   PKKS"
FT   gene            569946..571001
FT                   /locus_tag="CPC231_02760"
FT                   /old_locus_tag="CpC231_0552"
FT   CDS_pept        569946..571001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02760"
FT                   /old_locus_tag="CpC231_0552"
FT                   /product="PDZ domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10039"
FT                   /db_xref="GOA:D9QEW6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEW6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241407.1"
FT                   /protein_id="ADL10039.1"
FT                   /translation="MKRRLSTLTLGALPIVVLGTLVTIDHVPGTDIDLTVPYAAEGPGP
FT                   TFNTLGQIDGQDIVEIDGAEIDKTRGNLNMTTVSIRSGMTLAQAFSRWLFTDDTLIPLE
FT                   RVYPKNKTPDQVNQENQLAFSTSEASATIAAMNHLGRPVETEVAGIVEESAAQGILHEG
FT                   DVIVEIDGTAVGGPKQVREAVRKKNVDDTVTITYQRDGKKHDATVKLGKNPSDPKIPFL
FT                   GVSMAAKPADGITVDYHLKDIGGPSAGLIFSLAVVDKLSGGELNGGKFVAGTGTIDDDG
FT                   TVGPIGGIAHKVQAAKDAGAELFLAPAKNCSEAVSRNHDGMTIVSVDSLEDAIKQMDAY
FT                   NSGGEYTTCKE"
FT   gene            complement(571018..571722)
FT                   /locus_tag="CPC231_02765"
FT                   /old_locus_tag="CpC231_0553"
FT   CDS_pept        complement(571018..571722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02765"
FT                   /old_locus_tag="CpC231_0553"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10040"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEW7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523115.1"
FT                   /protein_id="ADL10040.1"
FT                   /translation="MLSLTALRMPLNIRVFRRSACALALCGLLGVTACGNDRDDPAQAA
FT                   TETSSESAAETTTPTASSARETSQSVGTGTVDAGTAETSSEKTKKNPNLEKARKQFAAL
FT                   APKDFFDQFDSCDANGVQNSMACSGEKIGQFQFFKSDSKAASTTQLLTELRSSRVVEDT
FT                   GRRVVGWSTLGSTAVITVVDNDEGLVMQQMVSTDEKDPAEQIYALGLAQRPQAESSAME
FT                   TPTHTEPAKAKS"
FT   gene            complement(571767..572270)
FT                   /locus_tag="CPC231_02770"
FT                   /old_locus_tag="CpC231_0554"
FT   CDS_pept        complement(571767..572270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02770"
FT                   /old_locus_tag="CpC231_0554"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10041"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEW8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910986.1"
FT                   /protein_id="ADL10041.1"
FT                   /translation="MSTPDYPIQALNKAMLEAVDFIHAEGWDASPTLFALVPAELVGSA
FT                   LPEEDDSPLALVVQDNLPEHIQPGSEELGDYISRVSWPSQVIGAVLAQEIIFRDSSDPA
FT                   AGPRPARLFSGVLQGDHELTLLQMRPSEEELEARGPFAADEIELRGGPGVAPGVIAALR
FT                   MTLD"
FT   gene            572412..575378
FT                   /locus_tag="CPC231_02775"
FT                   /old_locus_tag="CpC231_0555"
FT   CDS_pept        572412..575378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02775"
FT                   /old_locus_tag="CpC231_0555"
FT                   /product="membrane protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10042"
FT                   /db_xref="GOA:D9QEW9"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEW9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523830.1"
FT                   /protein_id="ADL10042.2"
FT                   /translation="MANGLTPPSPSIGRPPKLFTRIVVLLVILGALVPTAIGLYTNWLW
FT                   FGEVDFRGVFNKVILTRIVLFVVFALVAGIITWIAGWLTYRGRPDELDVLDLEGPIPQY
FT                   RAVVERSVKRFLTIIPIVIALVAGFLGQQNWQTVQLFLNRQSFGVSDPQFGMDYGFYAF
FT                   MLPALRLGLGTVSILVAVAFLLSLIGHYLLGSIRIGNQAAGVRGSISSYARVQLSVTAG
FT                   LWMLLKVASYWLDRYDLLNNRHETFTGGSYTDINAVLPAKIVLLVIAAVVALCFFLVVV
FT                   LKDLRIPAAATVLMVVSAVSIGSIWPLMVERFSVSPNRAEKESEFISRNIQATRFAYGI
FT                   TDDQVTYLNNWGAQGPNSDKVASDSATVSNIRLLDPEIISPTFTQQQQLRNFYGFPKSL
FT                   AMDRYVIDGELRDFVVAARELDPNALQENQRDWINRHTVYTHGNGIVAAQANQVDEVAR
FT                   DVGSARGGYPVYTVSDLQSTDAEAKELGIVVKEPRTYYGPVIASARDGADYAVVGSDQG
FT                   NPVEYDTDSSTYTYKGKGGVNIGNLFNRLAFAVRYQELNLVLSDRVNKNSKLLFNRDPR
FT                   ERVHNVAPWLTTDSTTYPAVIDGRIKWIVDGYTTLSSLPYSERTSMTEATTDTTAQVGN
FT                   SAQRIVTDNVGYIRNSVKAVVDAYDGSVDLYEFDEQDPVLKAWKGIFPGSVKPKSEISE
FT                   SLMNHLRYPEDIFKVQRKMLARYHVDDARDFFTNDRFWSVPSDPSASEGQQNIAQPPYY
FT                   VVAADPHTKKPSFQLITPFRGLQREYLAAHMSVSSDPDNYGKITVRVLPTDTLTQGPKQ
FT                   AQDTMMSSDQIASDRTLWRDTNDLFNGNLLTLPVGDGEILYVEPLYSQRKDQASAFPKL
FT                   LRVLVSYQGKVGYAPTISEALSQVGIDPKAAQDLGEARNLGKVPKKDDANKDQSNQKES
FT                   PKPSAPATGTGAAGEAIQKINDALKALETAKGKSNEEYGRAIDQLDKAVQDYRHTIGG"
FT   gene            575505..575581
FT                   /locus_tag="CPC231_02780"
FT                   /old_locus_tag="CpC231_t17"
FT   tRNA            575505..575581
FT                   /locus_tag="CPC231_02780"
FT                   /old_locus_tag="CpC231_t17"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:575539..575541,aa:Met,seq:cat)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            complement(575589..575798)
FT                   /locus_tag="CPC231_02785"
FT                   /old_locus_tag="CpC231_0556"
FT   CDS_pept        complement(575589..575798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02785"
FT                   /old_locus_tag="CpC231_0556"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10043"
FT                   /db_xref="InterPro:IPR013975"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEX0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_002551115.1"
FT                   /protein_id="ADL10043.2"
FT                   /translation="MVNRVIKKQLGEVLGISGATAGRKVRGEISWSLAELFSVAELLDI
FT                   SVHDLIPHQAKAPEKHESPLRRGG"
FT   gene            575797..576618
FT                   /locus_tag="CPC231_02790"
FT                   /old_locus_tag="CpC231_0557"
FT   CDS_pept        575797..576618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02790"
FT                   /old_locus_tag="CpC231_0557"
FT                   /product="Abi family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10044"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEX1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014401043.1"
FT                   /protein_id="ADL10044.2"
FT                   /translation="MSKKMTTRQHARQLTRQALAQKVAHQSGLEPMKFHYFLGYARNFR
FT                   ELYFDGKLPGRKTPDRVFRLIDVDAKVSEVLYSGIRNAEWLLRHYLVQEYCERFESRGS
FT                   FLDFENYLNLGDDYTNDHLARGLMNDILDYSETYVVEQLAEVAKALKCPPPKRCDVSNW
FT                   EHCKNLSEDLALWSVVDSFSLGRLVKLIQRCDSTADDKQRIWRKIAADMDIPAGRFGVG
FT                   MESLRSLRNLVSHQSRLWLRPTTNTVSKKGQFHKKIGRCHRNPYPFGVPIG"
FT   gene            576775..577761
FT                   /locus_tag="CPC231_02795"
FT                   /old_locus_tag="CpC231_0558"
FT   CDS_pept        576775..577761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02795"
FT                   /old_locus_tag="CpC231_0558"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10045"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEX2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522366.1"
FT                   /protein_id="ADL10045.1"
FT                   /translation="MPLKRLNRTVQFWRIVDARDNQPLEKDYDWAAIFGDLYGKTSPLL
FT                   FEADLEGRKFLGQVVTLGDKITELLHHELTDVFGSKGSCQHFGVILAGDKDYVPNQQNK
FT                   QSGVQQPVGLNEGWDAVDNSFVWHLAFGNMFAILLESQSSGRANRYAAWLTRFLRQSGI
FT                   ISDQQVSYEAIPVIDGDVVDRARKAKGIKAVSLRTSLGRASSANNPVNRIFASHSNYHD
FT                   VDIEIKITTRPGRSRQEDEQENLEWFRENLGDLTEFSKAVVKTVDSKGTIDELNLLKER
FT                   LSRKQNITLDTSKSAADAINKDSVFPAIVEAFVKNYRDLQGLKDDGR"
FT   gene            577781..578239
FT                   /locus_tag="CPC231_02800"
FT                   /old_locus_tag="CpC231_0558a"
FT   CDS_pept        577781..578239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02800"
FT                   /old_locus_tag="CpC231_0558a"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0558a"
FT                   /db_xref="EnsemblGenomes-Tr:AEK49240"
FT                   /db_xref="GOA:F9Y342"
FT                   /db_xref="UniProtKB/TrEMBL:F9Y342"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300535.1"
FT                   /protein_id="AEK49240.2"
FT                   /translation="MSSVTKHVGLSCLFFGVVCLALGIAINSAKAEVLASALTNLAVVS
FT                   GIASGLSFAALSIFTLNGTYQEKVLKYVGNTVRGTLFYMLFVVMLVSVFSGISVIWADS
FT                   SWIRIVFPILVFLVVEPFYITFRITYTAYEWESEPTRPDPMDSKYIKK"
FT   gene            complement(578537..583483)
FT                   /locus_tag="CPC231_02805"
FT                   /old_locus_tag="CpC231_0559"
FT   CDS_pept        complement(578537..583483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02805"
FT                   /old_locus_tag="CpC231_0559"
FT                   /product="DEAD/DEAH box helicase family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10046"
FT                   /db_xref="GOA:D9QEX3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039442"
FT                   /db_xref="InterPro:IPR041635"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEX3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522367.1"
FT                   /protein_id="ADL10046.1"
FT                   /translation="MASFEQVLDQLRDNQPQGKYGIAFEKLMVNFFRMAPTLAEQFDEV
FT                   SRWGDWRYNGGKPDTGIDIVAKRKEDGSWVAIQAKFYQESTSIQKRHIDSFFEASGQSF
FT                   ETEQGREHFSHRYIISTTDKWSKNAEEALANQMIPTSRIGRADISGAPVDWDVVFPGSE
FT                   IEVKLTRKEPFKPRKHQAEAIEKALEGFNAHDRGKLIMACGTGKTFTSLRLAEQFAHKN
FT                   GGRARVLFLVPSIALLSQTLREWTAQATVSMRSFAVCSDTKAGRQAEDIASYDVEIPVS
FT                   TDGKTLAEAFETGKRSKGLHVVFSTYQSLPAVHEAQQQGLADFDLVICDEAHRTTGVTL
FT                   AGQDASNFVKVHDPAYIKAEKRLYMTATPRLFDDTVKGKAADHFAELASMDDEAIYGPE
FT                   FHRLGFGEAVERGLLTDYKVLVMTVDESVAAEALAHSPSELLNLTTASAIIGAWNALAK
FT                   RSGTLQGKKGGFGADDQPMRRTVAFAKDIKHSRQIAESFPALIAAHQELLHQNAVNVEP
FT                   SLVDATLHHVDLSVTAQHVDGTMNALERSGKITWLEADFPSDESRVLTNARCLSEGVDV
FT                   PGLDSVIFFNPRNSMVDVVQSVGRVMRKAEGKDYGYIILPVAVSPGVSPAQALNDNARF
FT                   KVVWQILNALRAHDDRFNAKVNSLALNEGSTEELPIVVDHLENPKDKLDKDDTRPAEDQ
FT                   PGEDPTHDPAQQIALFSLEKWQEAIYTKLVDKVGTRTYWEDWADDVATIAQSHIVRISK
FT                   LIDGADPQLAAEFEAFVAGLRANLNDSITKDEAISMLSQHLITAPVFDALFEGHSFSEH
FT                   NPVAQVMQRMTDALEAAHLDTETESLEKFYDSVRVRASEVSSASGKQQVIKELYERFFQ
FT                   KAFKKQADSLGIVYTPVEIVDFILRAADDVSRRHFGRGLSDEGVCILDPFAGTSTFTVR
FT                   LLQSGLIRPEDLARKYANEIFVTEIMLLAYYVSAVNIETTYNALRAEAAQRGGEPEPEY
FT                   VPFKNIALADTFQIHEDGDIPDLNIFRENNDTIERQKAAPINVVIGNPPYSAGQKSAND
FT                   LNANLKYPSLDARIAETYAAKSTATNKNSLYDSYLRAFRWATDRIGDQGVVAFVSNGGW
FT                   IDGNTGDGVRLSMAEDFTDLYVFNLRGNMRNSDWRSEGGQIFGAGSQTTIAIFVAVKDS
FT                   SRKGFRLSYAQTPDAAPREEKLELISTSTVGTLEWRVIEPNVHGDWLNQRSEDFATWPV
FT                   IGEKKGTSTTFFRTFSAGLQTNRDAWVYSFTSTELDLKVKQIEQNYAEALDKIQDGQSA
FT                   PQLFATEPSLVDPKKSKWSSSLQSQLERRQPLRKSGSVMNSLYRPFCAQHVYFDEQLNH
FT                   RRYQLPTMFPTPAHRNVGFYIPAASSAARGFNAIATELVPDLCLSGSGSGQFFPRFTWD
FT                   PTEDNGGLFGRGGVDKQSFEESAYGEIGEVVEGYRRVDNITVEIKMLYREALGGDITGD
FT                   DIFHFMYGKLHDPAYRNAYATDLKKMLPHIETPATREEFDRFVRAGAELLTLHIGYETV
FT                   EPWPLDVKVKGDEDARETWRVAKMRWAKRKDPETGKNVNDVTSLIYNRQITISGIPEQA
FT                   DEYMLGSRSAVAWLIDRYQVKTDKASGIVNDPNDWADEVGNPLYIVELIGRVVRVAMET
FT                   VRIVEGLDEG"
FT   gene            584237..584533
FT                   /locus_tag="CPC231_02810"
FT                   /old_locus_tag="CpC231_0561"
FT   CDS_pept        584237..584533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02810"
FT                   /old_locus_tag="CpC231_0561"
FT                   /product="DUF2249 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10048"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEX5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800145.1"
FT                   /protein_id="ADL10048.1"
FT                   /translation="MKSQLSLNETSTQPHAGACGCHFQQAELPTLDARAIVPRLRHAAI
FT                   FGALESLTPGEAMGFIAPHNPVPLLQQIGDKYGDGVEVSYLSEDPWTLKFTRV"
FT   gene            584602..585654
FT                   /locus_tag="CPC231_02815"
FT                   /old_locus_tag="CpC231_0562"
FT   CDS_pept        584602..585654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02815"
FT                   /old_locus_tag="CpC231_0562"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10049"
FT                   /db_xref="GOA:D9QEX6"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEX6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014401045.1"
FT                   /protein_id="ADL10049.1"
FT                   /translation="MGLNAALLLLGVPAPVESETLSNNHGLIMTLGFMGTVIALERAQA
FT                   LHQPWAYLAPGLLGSGGLALGFGASWLGHTLLLEGTLALLLVYALLFKRAPLPLVAVQG
FT                   LSAVWAFIAAALALTLPTADLIVPLAAFIVLTIAAERAELAQLAMGPKAIPTLVLLSAL
FT                   LSAGVAAHLLWAYKGAHLYGVAQAIIAMWLLRDDVVRIFIRARGLRRYNASALLSGYTW
FT                   LTLAGLIWAAGGGHIGTASYDAVIHCTFLGFGVSMIMAHAPIIFPTVIGRPLPYTPWFY
FT                   LPLAALHGGMVLRIAGDFSGQGIAWQIGGSITVIAMLIFVILAAMTVLFNRRDQQQPQT
FT                   PQTCEKKVQQ"
FT   gene            585651..588299
FT                   /locus_tag="CPC231_02820"
FT                   /old_locus_tag="CpC231_0563"
FT   CDS_pept        585651..588299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02820"
FT                   /old_locus_tag="CpC231_0563"
FT                   /product="multicopper oxidase domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10050"
FT                   /db_xref="GOA:D9QEX7"
FT                   /db_xref="InterPro:IPR001287"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEX7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800147.1"
FT                   /protein_id="ADL10050.2"
FT                   /translation="MNQPKMPPNRSGRRSSLRDFVVIGWLVALFAVIFVHRWVPEAMWL
FT                   MIHLVLLGALTHSAMVWSEYFAHTLLRTGQGAQEKKNQNRRILILVAGTLMVFIGVPAG
FT                   QWWLVVAGGVLIASAVIWHGAYLYRQLKKALPARFQIVVHYYVAASFMLPIGVFLGVLM
FT                   ARNPEEPWYGQFLMAHIAVNFLGWIGLTVVGTLVTLWPTMLRARMDERAEKLATRALPV
FT                   LLLGIAVIVGATLLGAMKMALAGLVVYFAGLVIWGIALGKPLRAKGLREFAPASVLAAM
FT                   FWAVVGLVWVGIILATSTNWAQVTAALPLIGGVFAAGFAIQLLFGALTYLMPSVMGGGT
FT                   RVVHAGQSALHKWTTFRILVPNVALALWLVVSASWVKVALSVVGVLVLAMFVPLLVIAG
FT                   KRCAAMLRDKSTGAALPEFDVPATWSWNGVVAAVAVIVLSVTAGVAVDPGAAGFQPHGG
FT                   TNSSGTGVMATGQDTRVEVTIEGMHFVPSRIEVPTGNRLIVEFKNTGSDVHNLVVGDAR
FT                   TPRLAPGESHTLEAGVISHDVEAFCSVAGHRQMGMVLDVVAVGALAGNSMTGGDHAGHT
FT                   PMSTGQIQNVPGAKLQDHIDPKLPKLGSERVHKHRFEATEVPNEVAPGLWQTRWTFNGK
FT                   SVGPTLHGRVGDVFEITLVNNGSMGHSIDFHAGALAPDLPMRTIAPGEELVYRFKATRA
FT                   GIWMYHCGTMPMTSHIAMGMHGAVVIKPEGLPEVDHEYVLTQSEIYLANKARSAGEAQE
FT                   LDSKKLAEERPDRVVFNGIANQYDQQPFRVKVGQRVRFWVLDAGPNRALSFHVVGGQFD
FT                   TSWTEGYYTLNRGVSADGATDGGAQVLPLLPAQGGFVELTFPEAGHYAVVNHVMIDAER
FT                   GAHGIVEVTDR"
FT   gene            588592..589266
FT                   /locus_tag="CPC231_02825"
FT                   /old_locus_tag="CpC231_0564"
FT   CDS_pept        588592..589266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02825"
FT                   /old_locus_tag="CpC231_0564"
FT                   /product="trypsin-like serine protease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10051"
FT                   /db_xref="GOA:D9QEX8"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEX8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523833.1"
FT                   /protein_id="ADL10051.1"
FT                   /translation="MYPSLKERSSVKMKMHTRVAIALFGSFIAASTLAGTATADESNGP
FT                   IKNGSFIEVFNGDTRIGSCSATVIEKGSLLTAGHCGHVGAKVRIRDKEIGFVDSSGLRQ
FT                   GYDIIHVTLNPGIKVVPMKADLGYTPKTGDRVSKDGWRSLHTEGTVKDPEIKEVKSRES
FT                   INAPVDGQTFTVSTWTADLVSLQGDSGGAVTHNGKVVGLVKGGPNDEVTTYSLGGCPSV
FT                   FA"
FT   gene            complement(589604..590260)
FT                   /locus_tag="CPC231_02830"
FT                   /old_locus_tag="CpC231_0565"
FT   CDS_pept        complement(589604..590260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02830"
FT                   /old_locus_tag="CpC231_0565"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10052"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEX9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655164.1"
FT                   /protein_id="ADL10052.1"
FT                   /translation="MVNKKDLPEPPSVSSEAPQPPEALPEQQIFLYPNDKEVKITPLGT
FT                   TLKFGETANVVTEDSEGRYLVWAVTAHDGVPLPLEKVSLLNTNESNEVSHFMCYAYDVE
FT                   FLGAVSKGSDDPLALSGLADAEHAAVIAPTLVPATASGDNALHLNGGADKACGIPDSSR
FT                   IPTSESLLKVNRVYARGNIGVITKNQDSANNKHAQSVRFDWDQSGEKSRDSLYWN"
FT   gene            complement(590469..591836)
FT                   /locus_tag="CPC231_02835"
FT                   /old_locus_tag="CpC231_0566"
FT   CDS_pept        complement(590469..591836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPC231_02835"
FT                   /old_locus_tag="CpC231_0566"
FT                   /product="DUF1624 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:CpC231_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADL10053"
FT                   /db_xref="GOA:D9QEY0"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:D9QEY0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655165.1"
FT                   /protein_id="ADL10053.1"
FT                   /translation="MTSQISTQHHTSDAITRPQPGPACVRPIWNGEAEVLPQPYSPPPE
FT                   PEIRPSRWNKELAFGSSADPRRIIGIDSARGFALIGMIAVHVLPAYNKYTDQPTLIWQL
FT                   FGGNSSALFALLAGVTIALLTGGNMPHSGRELRRDQISLAVRAVIVFALGLALDEIRLP
FT                   VSNILAYYGLLFLLSIALVSLRIRTLFILSGVFIIAGPLAIFAVNSWGHYTTTLNPSFS
FT                   SLINLPVDTIITLFVGGTYPVVTWMAYICVGIALGRMNLHWLITQTRLIAIGAVAAIMG
FT                   FLLSTFLIDYVGGFSQLYYHTDNYDVEDILRVIDFGPEIHLPTDTWWWLAINGPHVNTP
FT                   FSLLTSLGTAILALGSFLVITRMIKNLFIPLIAAGSMTLTLYVSHILLMATFKESTEAL
FT                   PTLWFMVHVLGALLFGTAWQLARGRGPLEEVVSKISKRVSRAFLPAQPKTVSDTEN"
FT   gen