(data stored in ACNUC7421 zone)

EMBL: CP001846

ID   CP001846; SV 1; circular; genomic DNA; STD; PRO; 5386352 BP.
XX
AC   CP001846;
XX
PR   Project:PRJNA42729;
XX
DT   09-MAR-2010 (Rel. 104, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Escherichia coli O55:H7 str. CB9615, complete genome.
XX
KW   .
XX
OS   Escherichia coli O55:H7 str. CB9615
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-5386352
RX   DOI; 10.1371/journal.pone.0008700.
RX   PUBMED; 20090843.
RA   Zhou Z., Li X., Liu B., Beutin L., Xu J., Ren Y., Feng L., Lan R.,
RA   Reeves P.R., Wang L.;
RT   "Derivation of Escherichia coli O157:H7 from its O55:H7 precursor";
RL   PLoS One 5(1):E8700-E8700(2010).
XX
RN   [2]
RP   1-5386352
RA   Wang L., Zhou Z., Li X., Liu B., Beutin L., Xu J., Ren Y., Feng L., Lan R.,
RA   Reeves P.R.;
RT   ;
RL   Submitted (22-DEC-2009) to the INSDC.
RL   TEDA School of Biological Sciences and Biotechnology, Nankai University,
RL   No. 23, Hongda Street, TEDA, Tianjin, Tianjin 300457, The People's Republic
RL   of China
XX
DR   MD5; e7960add1aa9e4700770ab17ab95ebc6.
DR   BioSample; SAMN02603636.
DR   EnsemblGenomes-Gn; EBG00001228443.
DR   EnsemblGenomes-Gn; EBG00001228444.
DR   EnsemblGenomes-Gn; EBG00001228445.
DR   EnsemblGenomes-Gn; EBG00001228446.
DR   EnsemblGenomes-Gn; EBG00001228447.
DR   EnsemblGenomes-Gn; EBG00001228448.
DR   EnsemblGenomes-Gn; EBG00001228449.
DR   EnsemblGenomes-Gn; EBG00001228450.
DR   EnsemblGenomes-Gn; EBG00001228451.
DR   EnsemblGenomes-Gn; EBG00001228452.
DR   EnsemblGenomes-Gn; EBG00001228453.
DR   EnsemblGenomes-Gn; EBG00001228454.
DR   EnsemblGenomes-Gn; EBG00001228455.
DR   EnsemblGenomes-Gn; EBG00001228456.
DR   EnsemblGenomes-Gn; EBG00001228457.
DR   EnsemblGenomes-Gn; EBG00001228458.
DR   EnsemblGenomes-Gn; EBG00001228459.
DR   EnsemblGenomes-Gn; EBG00001228460.
DR   EnsemblGenomes-Gn; EBG00001228461.
DR   EnsemblGenomes-Gn; EBG00001228462.
DR   EnsemblGenomes-Gn; EBG00001228463.
DR   EnsemblGenomes-Gn; EBG00001228464.
DR   EnsemblGenomes-Gn; EBG00001228465.
DR   EnsemblGenomes-Gn; EBG00001228466.
DR   EnsemblGenomes-Gn; EBG00001228467.
DR   EnsemblGenomes-Gn; EBG00001228468.
DR   EnsemblGenomes-Gn; EBG00001228469.
DR   EnsemblGenomes-Gn; EBG00001228470.
DR   EnsemblGenomes-Gn; EBG00001228471.
DR   EnsemblGenomes-Gn; EBG00001228472.
DR   EnsemblGenomes-Gn; EBG00001228473.
DR   EnsemblGenomes-Gn; EBG00001228474.
DR   EnsemblGenomes-Gn; EBG00001228475.
DR   EnsemblGenomes-Gn; EBG00001228476.
DR   EnsemblGenomes-Gn; EBG00001228477.
DR   EnsemblGenomes-Gn; EBG00001228478.
DR   EnsemblGenomes-Gn; EBG00001228479.
DR   EnsemblGenomes-Gn; EBG00001228480.
DR   EnsemblGenomes-Gn; EBG00001228481.
DR   EnsemblGenomes-Gn; EBG00001228482.
DR   EnsemblGenomes-Gn; EBG00001228483.
DR   EnsemblGenomes-Gn; EBG00001228484.
DR   EnsemblGenomes-Gn; EBG00001228485.
DR   EnsemblGenomes-Gn; EBG00001228486.
DR   EnsemblGenomes-Gn; EBG00001228487.
DR   EnsemblGenomes-Gn; EBG00001228488.
DR   EnsemblGenomes-Gn; EBG00001228489.
DR   EnsemblGenomes-Gn; EBG00001228490.
DR   EnsemblGenomes-Gn; EBG00001228491.
DR   EnsemblGenomes-Gn; EBG00001228492.
DR   EnsemblGenomes-Gn; EBG00001228493.
DR   EnsemblGenomes-Gn; EBG00001228494.
DR   EnsemblGenomes-Gn; EBG00001228495.
DR   EnsemblGenomes-Gn; EBG00001228496.
DR   EnsemblGenomes-Gn; EBG00001228497.
DR   EnsemblGenomes-Gn; EBG00001228498.
DR   EnsemblGenomes-Gn; EBG00001228499.
DR   EnsemblGenomes-Gn; EBG00001228500.
DR   EnsemblGenomes-Gn; EBG00001228501.
DR   EnsemblGenomes-Gn; EBG00001228502.
DR   EnsemblGenomes-Gn; EBG00001228503.
DR   EnsemblGenomes-Gn; EBG00001228504.
DR   EnsemblGenomes-Gn; EBG00001228505.
DR   EnsemblGenomes-Gn; EBG00001228506.
DR   EnsemblGenomes-Gn; EBG00001228507.
DR   EnsemblGenomes-Gn; EBG00001228508.
DR   EnsemblGenomes-Gn; EBG00001228509.
DR   EnsemblGenomes-Gn; EBG00001228510.
DR   EnsemblGenomes-Gn; EBG00001228511.
DR   EnsemblGenomes-Gn; EBG00001228512.
DR   EnsemblGenomes-Gn; EBG00001228513.
DR   EnsemblGenomes-Gn; EBG00001228514.
DR   EnsemblGenomes-Gn; EBG00001228515.
DR   EnsemblGenomes-Gn; EBG00001228516.
DR   EnsemblGenomes-Gn; EBG00001228517.
DR   EnsemblGenomes-Gn; EBG00001228518.
DR   EnsemblGenomes-Gn; EBG00001228519.
DR   EnsemblGenomes-Gn; EBG00001228520.
DR   EnsemblGenomes-Gn; EBG00001228521.
DR   EnsemblGenomes-Gn; EBG00001228522.
DR   EnsemblGenomes-Gn; EBG00001228523.
DR   EnsemblGenomes-Gn; EBG00001228524.
DR   EnsemblGenomes-Gn; EBG00001228525.
DR   EnsemblGenomes-Gn; EBG00001228526.
DR   EnsemblGenomes-Gn; EBG00001228527.
DR   EnsemblGenomes-Gn; EBG00001228528.
DR   EnsemblGenomes-Gn; EBG00001228529.
DR   EnsemblGenomes-Gn; EBG00001228530.
DR   EnsemblGenomes-Gn; EBG00001228531.
DR   EnsemblGenomes-Gn; EBG00001228532.
DR   EnsemblGenomes-Gn; EBG00001228533.
DR   EnsemblGenomes-Gn; EBG00001228534.
DR   EnsemblGenomes-Gn; EBG00001228535.
DR   EnsemblGenomes-Gn; EBG00001228536.
DR   EnsemblGenomes-Gn; EBG00001228537.
DR   EnsemblGenomes-Gn; EBG00001228538.
DR   EnsemblGenomes-Gn; EBG00001228539.
DR   EnsemblGenomes-Gn; EBG00001228540.
DR   EnsemblGenomes-Gn; EBG00001228541.
DR   EnsemblGenomes-Gn; EBG00001228542.
DR   EnsemblGenomes-Gn; EBG00001228543.
DR   EnsemblGenomes-Gn; EBG00001228544.
DR   EnsemblGenomes-Gn; EBG00001228545.
DR   EnsemblGenomes-Gn; EBG00001228546.
DR   EnsemblGenomes-Gn; EBG00001228547.
DR   EnsemblGenomes-Gn; EBG00001228548.
DR   EnsemblGenomes-Gn; EBG00001228549.
DR   EnsemblGenomes-Gn; EBG00001228550.
DR   EnsemblGenomes-Gn; EBG00001228551.
DR   EnsemblGenomes-Gn; EBG00001228552.
DR   EnsemblGenomes-Gn; EBG00001228553.
DR   EnsemblGenomes-Gn; EBG00001228554.
DR   EnsemblGenomes-Gn; EBG00001228555.
DR   EnsemblGenomes-Gn; EBG00001228556.
DR   EnsemblGenomes-Gn; EBG00001228557.
DR   EnsemblGenomes-Gn; EBG00001228558.
DR   EnsemblGenomes-Gn; EBG00001228559.
DR   EnsemblGenomes-Gn; EBG00001228560.
DR   EnsemblGenomes-Gn; EBG00001228561.
DR   EnsemblGenomes-Gn; EBG00001228562.
DR   EnsemblGenomes-Gn; EBG00001228563.
DR   EnsemblGenomes-Gn; EBG00001228564.
DR   EnsemblGenomes-Gn; EBG00001228565.
DR   EnsemblGenomes-Gn; EBG00001228566.
DR   EnsemblGenomes-Gn; EBG00001228567.
DR   EnsemblGenomes-Gn; EBG00001228568.
DR   EnsemblGenomes-Gn; EBG00001228569.
DR   EnsemblGenomes-Gn; EBG00001228570.
DR   EnsemblGenomes-Gn; EBG00001228571.
DR   EnsemblGenomes-Gn; EBG00001228572.
DR   EnsemblGenomes-Gn; EBG00001228573.
DR   EnsemblGenomes-Gn; EBG00001228574.
DR   EnsemblGenomes-Gn; EBG00001228575.
DR   EnsemblGenomes-Gn; EBG00001228576.
DR   EnsemblGenomes-Gn; EBG00001228577.
DR   EnsemblGenomes-Gn; EBG00001228578.
DR   EnsemblGenomes-Gn; EBG00001228579.
DR   EnsemblGenomes-Gn; EBG00001228580.
DR   EnsemblGenomes-Gn; EBG00001228581.
DR   EnsemblGenomes-Gn; EBG00001228582.
DR   EnsemblGenomes-Gn; EBG00001228583.
DR   EnsemblGenomes-Gn; EBG00001228584.
DR   EnsemblGenomes-Gn; EBG00001228585.
DR   EnsemblGenomes-Gn; EBG00001228586.
DR   EnsemblGenomes-Gn; EBG00001228587.
DR   EnsemblGenomes-Gn; EBG00001228588.
DR   EnsemblGenomes-Gn; EBG00001228589.
DR   EnsemblGenomes-Gn; EBG00001228590.
DR   EnsemblGenomes-Gn; EBG00001228591.
DR   EnsemblGenomes-Gn; EBG00001228592.
DR   EnsemblGenomes-Gn; EBG00001228593.
DR   EnsemblGenomes-Gn; EBG00001228594.
DR   EnsemblGenomes-Gn; EBG00001228595.
DR   EnsemblGenomes-Gn; EBG00001228596.
DR   EnsemblGenomes-Gn; EBG00001228597.
DR   EnsemblGenomes-Gn; EBG00001228598.
DR   EnsemblGenomes-Gn; EBG00001228599.
DR   EnsemblGenomes-Gn; EBG00001228600.
DR   EnsemblGenomes-Gn; EBG00001228601.
DR   EnsemblGenomes-Gn; EBG00001228602.
DR   EnsemblGenomes-Gn; EBG00001228603.
DR   EnsemblGenomes-Gn; EBG00001228604.
DR   EnsemblGenomes-Gn; EBG00001228605.
DR   EnsemblGenomes-Gn; EBG00001228606.
DR   EnsemblGenomes-Gn; EBG00001228607.
DR   EnsemblGenomes-Gn; EBG00001228608.
DR   EnsemblGenomes-Gn; EBG00001228609.
DR   EnsemblGenomes-Gn; EBG00001228610.
DR   EnsemblGenomes-Gn; EBG00001228611.
DR   EnsemblGenomes-Gn; EBG00001228612.
DR   EnsemblGenomes-Gn; EBG00001228613.
DR   EnsemblGenomes-Gn; EBG00001228614.
DR   EnsemblGenomes-Gn; EBG00001228615.
DR   EnsemblGenomes-Gn; EBG00001228616.
DR   EnsemblGenomes-Gn; EBG00001228617.
DR   EnsemblGenomes-Gn; EBG00001228618.
DR   EnsemblGenomes-Gn; EBG00001228619.
DR   EnsemblGenomes-Gn; EBG00001228620.
DR   EnsemblGenomes-Gn; EBG00001228621.
DR   EnsemblGenomes-Gn; EBG00001228622.
DR   EnsemblGenomes-Gn; EBG00001228623.
DR   EnsemblGenomes-Gn; EBG00001228624.
DR   EnsemblGenomes-Gn; EBG00001228625.
DR   EnsemblGenomes-Gn; EBG00001228626.
DR   EnsemblGenomes-Gn; EBG00001228627.
DR   EnsemblGenomes-Gn; EBG00001228628.
DR   EnsemblGenomes-Gn; EBG00001228629.
DR   EnsemblGenomes-Gn; EBG00001228630.
DR   EnsemblGenomes-Gn; EBG00001228631.
DR   EnsemblGenomes-Gn; EBG00001228632.
DR   EnsemblGenomes-Gn; EBG00001228633.
DR   EnsemblGenomes-Gn; EBG00001228634.
DR   EnsemblGenomes-Gn; EBG00001228635.
DR   EnsemblGenomes-Gn; EBG00001228636.
DR   EnsemblGenomes-Gn; EBG00001228637.
DR   EnsemblGenomes-Gn; EBG00001228638.
DR   EnsemblGenomes-Gn; EBG00001228639.
DR   EnsemblGenomes-Gn; EBG00001228640.
DR   EnsemblGenomes-Gn; EBG00001228641.
DR   EnsemblGenomes-Gn; EBG00001228642.
DR   EnsemblGenomes-Gn; EBG00001228643.
DR   EnsemblGenomes-Gn; EBG00001228644.
DR   EnsemblGenomes-Gn; EBG00001228645.
DR   EnsemblGenomes-Gn; EBG00001228646.
DR   EnsemblGenomes-Gn; EBG00001228647.
DR   EnsemblGenomes-Gn; EBG00001228648.
DR   EnsemblGenomes-Gn; EBG00001228649.
DR   EnsemblGenomes-Gn; EBG00001228650.
DR   EnsemblGenomes-Gn; EBG00001228651.
DR   EnsemblGenomes-Gn; EBG00001228652.
DR   EnsemblGenomes-Gn; EBG00001228653.
DR   EnsemblGenomes-Gn; EBG00001228654.
DR   EnsemblGenomes-Gn; EBG00001228655.
DR   EnsemblGenomes-Gn; EBG00001228656.
DR   EnsemblGenomes-Gn; EBG00001228657.
DR   EnsemblGenomes-Gn; EBG00001228658.
DR   EnsemblGenomes-Gn; EBG00001228659.
DR   EnsemblGenomes-Gn; EBG00001228660.
DR   EnsemblGenomes-Gn; EBG00001228661.
DR   EnsemblGenomes-Gn; EBG00001228662.
DR   EnsemblGenomes-Gn; EBG00001228663.
DR   EnsemblGenomes-Gn; EBG00001228664.
DR   EnsemblGenomes-Gn; EBG00001228665.
DR   EnsemblGenomes-Gn; EBG00001228666.
DR   EnsemblGenomes-Gn; EBG00001228667.
DR   EnsemblGenomes-Gn; EBG00001228668.
DR   EnsemblGenomes-Gn; EBG00001228669.
DR   EnsemblGenomes-Gn; EBG00001228670.
DR   EnsemblGenomes-Gn; EBG00001228671.
DR   EnsemblGenomes-Gn; EBG00001228672.
DR   EnsemblGenomes-Gn; EBG00001228673.
DR   EnsemblGenomes-Gn; EBG00001228674.
DR   EnsemblGenomes-Gn; EBG00001228675.
DR   EnsemblGenomes-Gn; EBG00001228676.
DR   EnsemblGenomes-Gn; EBG00001228677.
DR   EnsemblGenomes-Gn; EBG00001228678.
DR   EnsemblGenomes-Gn; EBG00001228679.
DR   EnsemblGenomes-Gn; EBG00001228680.
DR   EnsemblGenomes-Gn; EBG00001228681.
DR   EnsemblGenomes-Gn; EBG00001228682.
DR   EnsemblGenomes-Gn; EBG00001228683.
DR   EnsemblGenomes-Gn; EBG00001228684.
DR   EnsemblGenomes-Gn; EBG00001228685.
DR   EnsemblGenomes-Gn; EBG00001228686.
DR   EnsemblGenomes-Gn; EBG00001228687.
DR   EnsemblGenomes-Gn; EBG00001228688.
DR   EnsemblGenomes-Gn; EBG00001228689.
DR   EnsemblGenomes-Gn; EBG00001228690.
DR   EnsemblGenomes-Gn; EBG00001228691.
DR   EnsemblGenomes-Gn; EBG00001228692.
DR   EnsemblGenomes-Gn; EBG00001228693.
DR   EnsemblGenomes-Gn; EBG00001228694.
DR   EnsemblGenomes-Gn; G2583_0074.
DR   EnsemblGenomes-Gn; G2583_0171.
DR   EnsemblGenomes-Gn; G2583_0205.
DR   EnsemblGenomes-Gn; G2583_0206.
DR   EnsemblGenomes-Gn; G2583_0207.
DR   EnsemblGenomes-Gn; G2583_0208.
DR   EnsemblGenomes-Gn; G2583_0209.
DR   EnsemblGenomes-Gn; G2583_0210.
DR   EnsemblGenomes-Gn; G2583_0220.
DR   EnsemblGenomes-Gn; G2583_0280.
DR   EnsemblGenomes-Gn; G2583_0437.
DR   EnsemblGenomes-Gn; G2583_0567.
DR   EnsemblGenomes-Gn; G2583_0594.
DR   EnsemblGenomes-Gn; G2583_0656.
DR   EnsemblGenomes-Gn; G2583_0818.
DR   EnsemblGenomes-Gn; G2583_0827.
DR   EnsemblGenomes-Gn; G2583_0828.
DR   EnsemblGenomes-Gn; G2583_0829.
DR   EnsemblGenomes-Gn; G2583_0831.
DR   EnsemblGenomes-Gn; G2583_0832.
DR   EnsemblGenomes-Gn; G2583_0833.
DR   EnsemblGenomes-Gn; G2583_0834.
DR   EnsemblGenomes-Gn; G2583_0910.
DR   EnsemblGenomes-Gn; G2583_0911.
DR   EnsemblGenomes-Gn; G2583_0912.
DR   EnsemblGenomes-Gn; G2583_0913.
DR   EnsemblGenomes-Gn; G2583_0914.
DR   EnsemblGenomes-Gn; G2583_0915.
DR   EnsemblGenomes-Gn; G2583_1077.
DR   EnsemblGenomes-Gn; G2583_1120.
DR   EnsemblGenomes-Gn; G2583_1206.
DR   EnsemblGenomes-Gn; G2583_1290.
DR   EnsemblGenomes-Gn; G2583_1347.
DR   EnsemblGenomes-Gn; G2583_1443.
DR   EnsemblGenomes-Gn; G2583_1502.
DR   EnsemblGenomes-Gn; G2583_1503.
DR   EnsemblGenomes-Gn; G2583_1504.
DR   EnsemblGenomes-Gn; G2583_1505.
DR   EnsemblGenomes-Gn; G2583_1535.
DR   EnsemblGenomes-Gn; G2583_1688.
DR   EnsemblGenomes-Gn; G2583_1692.
DR   EnsemblGenomes-Gn; G2583_1753.
DR   EnsemblGenomes-Gn; G2583_1780.
DR   EnsemblGenomes-Gn; G2583_2060.
DR   EnsemblGenomes-Gn; G2583_2061.
DR   EnsemblGenomes-Gn; G2583_2080.
DR   EnsemblGenomes-Gn; G2583_2085.
DR   EnsemblGenomes-Gn; G2583_2252.
DR   EnsemblGenomes-Gn; G2583_2289.
DR   EnsemblGenomes-Gn; G2583_2290.
DR   EnsemblGenomes-Gn; G2583_2339.
DR   EnsemblGenomes-Gn; G2583_2360.
DR   EnsemblGenomes-Gn; G2583_2361.
DR   EnsemblGenomes-Gn; G2583_2362.
DR   EnsemblGenomes-Gn; G2583_2405.
DR   EnsemblGenomes-Gn; G2583_2484.
DR   EnsemblGenomes-Gn; G2583_2486.
DR   EnsemblGenomes-Gn; G2583_2493.
DR   EnsemblGenomes-Gn; G2583_2496.
DR   EnsemblGenomes-Gn; G2583_2499.
DR   EnsemblGenomes-Gn; G2583_2598.
DR   EnsemblGenomes-Gn; G2583_2599.
DR   EnsemblGenomes-Gn; G2583_2610.
DR   EnsemblGenomes-Gn; G2583_2732.
DR   EnsemblGenomes-Gn; G2583_2757.
DR   EnsemblGenomes-Gn; G2583_2884.
DR   EnsemblGenomes-Gn; G2583_2928.
DR   EnsemblGenomes-Gn; G2583_2929.
DR   EnsemblGenomes-Gn; G2583_2935.
DR   EnsemblGenomes-Gn; G2583_2936.
DR   EnsemblGenomes-Gn; G2583_2937.
DR   EnsemblGenomes-Gn; G2583_2938.
DR   EnsemblGenomes-Gn; G2583_3039.
DR   EnsemblGenomes-Gn; G2583_3051.
DR   EnsemblGenomes-Gn; G2583_3087.
DR   EnsemblGenomes-Gn; G2583_3171.
DR   EnsemblGenomes-Gn; G2583_3172.
DR   EnsemblGenomes-Gn; G2583_3173.
DR   EnsemblGenomes-Gn; G2583_3174.
DR   EnsemblGenomes-Gn; G2583_3202.
DR   EnsemblGenomes-Gn; G2583_3303.
DR   EnsemblGenomes-Gn; G2583_3335.
DR   EnsemblGenomes-Gn; G2583_3339.
DR   EnsemblGenomes-Gn; G2583_3340.
DR   EnsemblGenomes-Gn; G2583_3341.
DR   EnsemblGenomes-Gn; G2583_3342.
DR   EnsemblGenomes-Gn; G2583_3343.
DR   EnsemblGenomes-Gn; G2583_3411.
DR   EnsemblGenomes-Gn; G2583_3445.
DR   EnsemblGenomes-Gn; G2583_3462.
DR   EnsemblGenomes-Gn; G2583_3468.
DR   EnsemblGenomes-Gn; G2583_3469.
DR   EnsemblGenomes-Gn; G2583_3470.
DR   EnsemblGenomes-Gn; G2583_3492.
DR   EnsemblGenomes-Gn; G2583_3493.
DR   EnsemblGenomes-Gn; G2583_3518.
DR   EnsemblGenomes-Gn; G2583_3563.
DR   EnsemblGenomes-Gn; G2583_3565.
DR   EnsemblGenomes-Gn; G2583_3567.
DR   EnsemblGenomes-Gn; G2583_3626.
DR   EnsemblGenomes-Gn; G2583_3773.
DR   EnsemblGenomes-Gn; G2583_3775.
DR   EnsemblGenomes-Gn; G2583_3793.
DR   EnsemblGenomes-Gn; G2583_3845.
DR   EnsemblGenomes-Gn; G2583_3889.
DR   EnsemblGenomes-Gn; G2583_3896.
DR   EnsemblGenomes-Gn; G2583_3899.
DR   EnsemblGenomes-Gn; G2583_3935.
DR   EnsemblGenomes-Gn; G2583_3991.
DR   EnsemblGenomes-Gn; G2583_3992.
DR   EnsemblGenomes-Gn; G2583_3993.
DR   EnsemblGenomes-Gn; G2583_3994.
DR   EnsemblGenomes-Gn; G2583_3995.
DR   EnsemblGenomes-Gn; G2583_3996.
DR   EnsemblGenomes-Gn; G2583_3997.
DR   EnsemblGenomes-Gn; G2583_4143.
DR   EnsemblGenomes-Gn; G2583_4251.
DR   EnsemblGenomes-Gn; G2583_4282.
DR   EnsemblGenomes-Gn; G2583_4395.
DR   EnsemblGenomes-Gn; G2583_4552.
DR   EnsemblGenomes-Gn; G2583_4553.
DR   EnsemblGenomes-Gn; G2583_4554.
DR   EnsemblGenomes-Gn; G2583_4555.
DR   EnsemblGenomes-Gn; G2583_4556.
DR   EnsemblGenomes-Gn; G2583_4557.
DR   EnsemblGenomes-Gn; G2583_4591.
DR   EnsemblGenomes-Gn; G2583_4592.
DR   EnsemblGenomes-Gn; G2583_4593.
DR   EnsemblGenomes-Gn; G2583_4594.
DR   EnsemblGenomes-Gn; G2583_4597.
DR   EnsemblGenomes-Gn; G2583_4649.
DR   EnsemblGenomes-Gn; G2583_4650.
DR   EnsemblGenomes-Gn; G2583_4651.
DR   EnsemblGenomes-Gn; G2583_4652.
DR   EnsemblGenomes-Gn; G2583_4653.
DR   EnsemblGenomes-Gn; G2583_4663.
DR   EnsemblGenomes-Gn; G2583_4665.
DR   EnsemblGenomes-Gn; G2583_4773.
DR   EnsemblGenomes-Gn; G2583_4783.
DR   EnsemblGenomes-Gn; G2583_4784.
DR   EnsemblGenomes-Gn; G2583_4785.
DR   EnsemblGenomes-Gn; G2583_4786.
DR   EnsemblGenomes-Gn; G2583_4791.
DR   EnsemblGenomes-Gn; G2583_4792.
DR   EnsemblGenomes-Gn; G2583_4793.
DR   EnsemblGenomes-Gn; G2583_4794.
DR   EnsemblGenomes-Gn; G2583_4802.
DR   EnsemblGenomes-Gn; G2583_4806.
DR   EnsemblGenomes-Gn; G2583_4825.
DR   EnsemblGenomes-Gn; G2583_4826.
DR   EnsemblGenomes-Gn; G2583_4827.
DR   EnsemblGenomes-Gn; G2583_4828.
DR   EnsemblGenomes-Gn; G2583_4961.
DR   EnsemblGenomes-Gn; G2583_4990.
DR   EnsemblGenomes-Gn; G2583_4991.
DR   EnsemblGenomes-Gn; G2583_4992.
DR   EnsemblGenomes-Gn; G2583_5095.
DR   EnsemblGenomes-Gn; G2583_5171.
DR   EnsemblGenomes-Gn; G2583_5263.
DR   EnsemblGenomes-Gn; G2583_5264.
DR   EnsemblGenomes-Gn; G2583_5265.
DR   EnsemblGenomes-Gn; G2583_5266.
DR   EnsemblGenomes-Gn; G2583_5267.
DR   EnsemblGenomes-Gn; G2583_5268.
DR   EnsemblGenomes-Gn; G2583_5269.
DR   EnsemblGenomes-Gn; G2583_5270.
DR   EnsemblGenomes-Gn; G2583_5271.
DR   EnsemblGenomes-Gn; G2583_5272.
DR   EnsemblGenomes-Gn; G2583_5273.
DR   EnsemblGenomes-Gn; G2583_5274.
DR   EnsemblGenomes-Gn; G2583_5275.
DR   EnsemblGenomes-Gn; G2583_5276.
DR   EnsemblGenomes-Gn; G2583_5277.
DR   EnsemblGenomes-Gn; G2583_5278.
DR   EnsemblGenomes-Tr; EBT00001797216.
DR   EnsemblGenomes-Tr; EBT00001797217.
DR   EnsemblGenomes-Tr; EBT00001797218.
DR   EnsemblGenomes-Tr; EBT00001797219.
DR   EnsemblGenomes-Tr; EBT00001797220.
DR   EnsemblGenomes-Tr; EBT00001797221.
DR   EnsemblGenomes-Tr; EBT00001797222.
DR   EnsemblGenomes-Tr; EBT00001797223.
DR   EnsemblGenomes-Tr; EBT00001797224.
DR   EnsemblGenomes-Tr; EBT00001797225.
DR   EnsemblGenomes-Tr; EBT00001797226.
DR   EnsemblGenomes-Tr; EBT00001797227.
DR   EnsemblGenomes-Tr; EBT00001797228.
DR   EnsemblGenomes-Tr; EBT00001797229.
DR   EnsemblGenomes-Tr; EBT00001797230.
DR   EnsemblGenomes-Tr; EBT00001797231.
DR   EnsemblGenomes-Tr; EBT00001797232.
DR   EnsemblGenomes-Tr; EBT00001797233.
DR   EnsemblGenomes-Tr; EBT00001797234.
DR   EnsemblGenomes-Tr; EBT00001797235.
DR   EnsemblGenomes-Tr; EBT00001797236.
DR   EnsemblGenomes-Tr; EBT00001797237.
DR   EnsemblGenomes-Tr; EBT00001797238.
DR   EnsemblGenomes-Tr; EBT00001797239.
DR   EnsemblGenomes-Tr; EBT00001797240.
DR   EnsemblGenomes-Tr; EBT00001797241.
DR   EnsemblGenomes-Tr; EBT00001797242.
DR   EnsemblGenomes-Tr; EBT00001797243.
DR   EnsemblGenomes-Tr; EBT00001797244.
DR   EnsemblGenomes-Tr; EBT00001797245.
DR   EnsemblGenomes-Tr; EBT00001797246.
DR   EnsemblGenomes-Tr; EBT00001797247.
DR   EnsemblGenomes-Tr; EBT00001797248.
DR   EnsemblGenomes-Tr; EBT00001797249.
DR   EnsemblGenomes-Tr; EBT00001797250.
DR   EnsemblGenomes-Tr; EBT00001797251.
DR   EnsemblGenomes-Tr; EBT00001797252.
DR   EnsemblGenomes-Tr; EBT00001797253.
DR   EnsemblGenomes-Tr; EBT00001797254.
DR   EnsemblGenomes-Tr; EBT00001797255.
DR   EnsemblGenomes-Tr; EBT00001797256.
DR   EnsemblGenomes-Tr; EBT00001797257.
DR   EnsemblGenomes-Tr; EBT00001797258.
DR   EnsemblGenomes-Tr; EBT00001797259.
DR   EnsemblGenomes-Tr; EBT00001797260.
DR   EnsemblGenomes-Tr; EBT00001797261.
DR   EnsemblGenomes-Tr; EBT00001797262.
DR   EnsemblGenomes-Tr; EBT00001797263.
DR   EnsemblGenomes-Tr; EBT00001797264.
DR   EnsemblGenomes-Tr; EBT00001797265.
DR   EnsemblGenomes-Tr; EBT00001797266.
DR   EnsemblGenomes-Tr; EBT00001797267.
DR   EnsemblGenomes-Tr; EBT00001797268.
DR   EnsemblGenomes-Tr; EBT00001797269.
DR   EnsemblGenomes-Tr; EBT00001797270.
DR   EnsemblGenomes-Tr; EBT00001797271.
DR   EnsemblGenomes-Tr; EBT00001797272.
DR   EnsemblGenomes-Tr; EBT00001797273.
DR   EnsemblGenomes-Tr; EBT00001797274.
DR   EnsemblGenomes-Tr; EBT00001797275.
DR   EnsemblGenomes-Tr; EBT00001797276.
DR   EnsemblGenomes-Tr; EBT00001797277.
DR   EnsemblGenomes-Tr; EBT00001797278.
DR   EnsemblGenomes-Tr; EBT00001797279.
DR   EnsemblGenomes-Tr; EBT00001797280.
DR   EnsemblGenomes-Tr; EBT00001797281.
DR   EnsemblGenomes-Tr; EBT00001797282.
DR   EnsemblGenomes-Tr; EBT00001797283.
DR   EnsemblGenomes-Tr; EBT00001797284.
DR   EnsemblGenomes-Tr; EBT00001797285.
DR   EnsemblGenomes-Tr; EBT00001797286.
DR   EnsemblGenomes-Tr; EBT00001797287.
DR   EnsemblGenomes-Tr; EBT00001797288.
DR   EnsemblGenomes-Tr; EBT00001797289.
DR   EnsemblGenomes-Tr; EBT00001797290.
DR   EnsemblGenomes-Tr; EBT00001797291.
DR   EnsemblGenomes-Tr; EBT00001797292.
DR   EnsemblGenomes-Tr; EBT00001797293.
DR   EnsemblGenomes-Tr; EBT00001797294.
DR   EnsemblGenomes-Tr; EBT00001797295.
DR   EnsemblGenomes-Tr; EBT00001797296.
DR   EnsemblGenomes-Tr; EBT00001797297.
DR   EnsemblGenomes-Tr; EBT00001797298.
DR   EnsemblGenomes-Tr; EBT00001797299.
DR   EnsemblGenomes-Tr; EBT00001797300.
DR   EnsemblGenomes-Tr; EBT00001797301.
DR   EnsemblGenomes-Tr; EBT00001797302.
DR   EnsemblGenomes-Tr; EBT00001797303.
DR   EnsemblGenomes-Tr; EBT00001797304.
DR   EnsemblGenomes-Tr; EBT00001797305.
DR   EnsemblGenomes-Tr; EBT00001797306.
DR   EnsemblGenomes-Tr; EBT00001797307.
DR   EnsemblGenomes-Tr; EBT00001797308.
DR   EnsemblGenomes-Tr; EBT00001797309.
DR   EnsemblGenomes-Tr; EBT00001797310.
DR   EnsemblGenomes-Tr; EBT00001797311.
DR   EnsemblGenomes-Tr; EBT00001797312.
DR   EnsemblGenomes-Tr; EBT00001797313.
DR   EnsemblGenomes-Tr; EBT00001797314.
DR   EnsemblGenomes-Tr; EBT00001797315.
DR   EnsemblGenomes-Tr; EBT00001797316.
DR   EnsemblGenomes-Tr; EBT00001797317.
DR   EnsemblGenomes-Tr; EBT00001797318.
DR   EnsemblGenomes-Tr; EBT00001797319.
DR   EnsemblGenomes-Tr; EBT00001797320.
DR   EnsemblGenomes-Tr; EBT00001797321.
DR   EnsemblGenomes-Tr; EBT00001797322.
DR   EnsemblGenomes-Tr; EBT00001797323.
DR   EnsemblGenomes-Tr; EBT00001797324.
DR   EnsemblGenomes-Tr; EBT00001797325.
DR   EnsemblGenomes-Tr; EBT00001797326.
DR   EnsemblGenomes-Tr; EBT00001797327.
DR   EnsemblGenomes-Tr; EBT00001797328.
DR   EnsemblGenomes-Tr; EBT00001797329.
DR   EnsemblGenomes-Tr; EBT00001797330.
DR   EnsemblGenomes-Tr; EBT00001797331.
DR   EnsemblGenomes-Tr; EBT00001797332.
DR   EnsemblGenomes-Tr; EBT00001797333.
DR   EnsemblGenomes-Tr; EBT00001797334.
DR   EnsemblGenomes-Tr; EBT00001797335.
DR   EnsemblGenomes-Tr; EBT00001797336.
DR   EnsemblGenomes-Tr; EBT00001797337.
DR   EnsemblGenomes-Tr; EBT00001797338.
DR   EnsemblGenomes-Tr; EBT00001797339.
DR   EnsemblGenomes-Tr; EBT00001797340.
DR   EnsemblGenomes-Tr; EBT00001797341.
DR   EnsemblGenomes-Tr; EBT00001797342.
DR   EnsemblGenomes-Tr; EBT00001797343.
DR   EnsemblGenomes-Tr; EBT00001797344.
DR   EnsemblGenomes-Tr; EBT00001797345.
DR   EnsemblGenomes-Tr; EBT00001797346.
DR   EnsemblGenomes-Tr; EBT00001797347.
DR   EnsemblGenomes-Tr; EBT00001797348.
DR   EnsemblGenomes-Tr; EBT00001797349.
DR   EnsemblGenomes-Tr; EBT00001797350.
DR   EnsemblGenomes-Tr; EBT00001797351.
DR   EnsemblGenomes-Tr; EBT00001797352.
DR   EnsemblGenomes-Tr; EBT00001797353.
DR   EnsemblGenomes-Tr; EBT00001797354.
DR   EnsemblGenomes-Tr; EBT00001797355.
DR   EnsemblGenomes-Tr; EBT00001797356.
DR   EnsemblGenomes-Tr; EBT00001797357.
DR   EnsemblGenomes-Tr; EBT00001797358.
DR   EnsemblGenomes-Tr; EBT00001797359.
DR   EnsemblGenomes-Tr; EBT00001797360.
DR   EnsemblGenomes-Tr; EBT00001797361.
DR   EnsemblGenomes-Tr; EBT00001797362.
DR   EnsemblGenomes-Tr; EBT00001797363.
DR   EnsemblGenomes-Tr; EBT00001797364.
DR   EnsemblGenomes-Tr; EBT00001797365.
DR   EnsemblGenomes-Tr; EBT00001797366.
DR   EnsemblGenomes-Tr; EBT00001797367.
DR   EnsemblGenomes-Tr; EBT00001797368.
DR   EnsemblGenomes-Tr; EBT00001797369.
DR   EnsemblGenomes-Tr; EBT00001797370.
DR   EnsemblGenomes-Tr; EBT00001797371.
DR   EnsemblGenomes-Tr; EBT00001797372.
DR   EnsemblGenomes-Tr; EBT00001797373.
DR   EnsemblGenomes-Tr; EBT00001797374.
DR   EnsemblGenomes-Tr; EBT00001797375.
DR   EnsemblGenomes-Tr; EBT00001797376.
DR   EnsemblGenomes-Tr; EBT00001797377.
DR   EnsemblGenomes-Tr; EBT00001797378.
DR   EnsemblGenomes-Tr; EBT00001797379.
DR   EnsemblGenomes-Tr; EBT00001797380.
DR   EnsemblGenomes-Tr; EBT00001797381.
DR   EnsemblGenomes-Tr; EBT00001797382.
DR   EnsemblGenomes-Tr; EBT00001797383.
DR   EnsemblGenomes-Tr; EBT00001797384.
DR   EnsemblGenomes-Tr; EBT00001797385.
DR   EnsemblGenomes-Tr; EBT00001797386.
DR   EnsemblGenomes-Tr; EBT00001797387.
DR   EnsemblGenomes-Tr; EBT00001797388.
DR   EnsemblGenomes-Tr; EBT00001797389.
DR   EnsemblGenomes-Tr; EBT00001797390.
DR   EnsemblGenomes-Tr; EBT00001797391.
DR   EnsemblGenomes-Tr; EBT00001797392.
DR   EnsemblGenomes-Tr; EBT00001797393.
DR   EnsemblGenomes-Tr; EBT00001797394.
DR   EnsemblGenomes-Tr; EBT00001797395.
DR   EnsemblGenomes-Tr; EBT00001797396.
DR   EnsemblGenomes-Tr; EBT00001797397.
DR   EnsemblGenomes-Tr; EBT00001797398.
DR   EnsemblGenomes-Tr; EBT00001797399.
DR   EnsemblGenomes-Tr; EBT00001797400.
DR   EnsemblGenomes-Tr; EBT00001797401.
DR   EnsemblGenomes-Tr; EBT00001797402.
DR   EnsemblGenomes-Tr; EBT00001797404.
DR   EnsemblGenomes-Tr; EBT00001797406.
DR   EnsemblGenomes-Tr; EBT00001797408.
DR   EnsemblGenomes-Tr; EBT00001797410.
DR   EnsemblGenomes-Tr; EBT00001797412.
DR   EnsemblGenomes-Tr; EBT00001797413.
DR   EnsemblGenomes-Tr; EBT00001797415.
DR   EnsemblGenomes-Tr; EBT00001797418.
DR   EnsemblGenomes-Tr; EBT00001797424.
DR   EnsemblGenomes-Tr; EBT00001797427.
DR   EnsemblGenomes-Tr; EBT00001797429.
DR   EnsemblGenomes-Tr; EBT00001797431.
DR   EnsemblGenomes-Tr; EBT00001797433.
DR   EnsemblGenomes-Tr; EBT00001797435.
DR   EnsemblGenomes-Tr; EBT00001797437.
DR   EnsemblGenomes-Tr; EBT00001797439.
DR   EnsemblGenomes-Tr; EBT00001797441.
DR   EnsemblGenomes-Tr; EBT00001797443.
DR   EnsemblGenomes-Tr; EBT00001797445.
DR   EnsemblGenomes-Tr; EBT00001797447.
DR   EnsemblGenomes-Tr; EBT00001797449.
DR   EnsemblGenomes-Tr; EBT00001797451.
DR   EnsemblGenomes-Tr; EBT00001797453.
DR   EnsemblGenomes-Tr; EBT00001797455.
DR   EnsemblGenomes-Tr; EBT00001797457.
DR   EnsemblGenomes-Tr; EBT00001797459.
DR   EnsemblGenomes-Tr; EBT00001797461.
DR   EnsemblGenomes-Tr; EBT00001797462.
DR   EnsemblGenomes-Tr; EBT00001797463.
DR   EnsemblGenomes-Tr; EBT00001797464.
DR   EnsemblGenomes-Tr; EBT00001797466.
DR   EnsemblGenomes-Tr; EBT00001797469.
DR   EnsemblGenomes-Tr; EBT00001797474.
DR   EnsemblGenomes-Tr; EBT00001797476.
DR   EnsemblGenomes-Tr; EBT00001797477.
DR   EnsemblGenomes-Tr; EBT00001797479.
DR   EnsemblGenomes-Tr; EBT00001797481.
DR   EnsemblGenomes-Tr; EBT00001797484.
DR   EnsemblGenomes-Tr; EBT00001797485.
DR   EnsemblGenomes-Tr; EBT00001797488.
DR   EnsemblGenomes-Tr; EBT00001797489.
DR   EnsemblGenomes-Tr; EBT00001797491.
DR   EnsemblGenomes-Tr; EBT00001797493.
DR   EnsemblGenomes-Tr; EBT00001797495.
DR   EnsemblGenomes-Tr; EBT00001797497.
DR   EnsemblGenomes-Tr; EBT00001797499.
DR   EnsemblGenomes-Tr; EBT00001797501.
DR   EnsemblGenomes-Tr; EBT00001797502.
DR   EnsemblGenomes-Tr; EBT00001797504.
DR   EnsemblGenomes-Tr; EBT00001797506.
DR   EnsemblGenomes-Tr; EBT00001797508.
DR   EnsemblGenomes-Tr; EBT00001797511.
DR   EnsemblGenomes-Tr; EBT00001797512.
DR   EnsemblGenomes-Tr; EBT00001797514.
DR   EnsemblGenomes-Tr; EBT00001797516.
DR   EnsemblGenomes-Tr; EBT00001797518.
DR   EnsemblGenomes-Tr; EBT00001797520.
DR   EnsemblGenomes-Tr; EBT00001797522.
DR   EnsemblGenomes-Tr; EBT00001797524.
DR   EnsemblGenomes-Tr; EBT00001797525.
DR   EnsemblGenomes-Tr; EBT00001797527.
DR   EnsemblGenomes-Tr; EBT00001797529.
DR   EnsemblGenomes-Tr; EBT00001797531.
DR   EnsemblGenomes-Tr; EBT00001797534.
DR   EnsemblGenomes-Tr; EBT00001797536.
DR   EnsemblGenomes-Tr; G2583_0074-1.
DR   EnsemblGenomes-Tr; G2583_0171-1.
DR   EnsemblGenomes-Tr; G2583_0205-1.
DR   EnsemblGenomes-Tr; G2583_0206-1.
DR   EnsemblGenomes-Tr; G2583_0207-1.
DR   EnsemblGenomes-Tr; G2583_0208-1.
DR   EnsemblGenomes-Tr; G2583_0209-1.
DR   EnsemblGenomes-Tr; G2583_0210-1.
DR   EnsemblGenomes-Tr; G2583_0220-1.
DR   EnsemblGenomes-Tr; G2583_0280-1.
DR   EnsemblGenomes-Tr; G2583_0437-1.
DR   EnsemblGenomes-Tr; G2583_0567-1.
DR   EnsemblGenomes-Tr; G2583_0594-1.
DR   EnsemblGenomes-Tr; G2583_0656-1.
DR   EnsemblGenomes-Tr; G2583_0818-1.
DR   EnsemblGenomes-Tr; G2583_0827-1.
DR   EnsemblGenomes-Tr; G2583_0828-1.
DR   EnsemblGenomes-Tr; G2583_0829-1.
DR   EnsemblGenomes-Tr; G2583_0831-1.
DR   EnsemblGenomes-Tr; G2583_0832-1.
DR   EnsemblGenomes-Tr; G2583_0833-1.
DR   EnsemblGenomes-Tr; G2583_0834-1.
DR   EnsemblGenomes-Tr; G2583_0910-1.
DR   EnsemblGenomes-Tr; G2583_0911-1.
DR   EnsemblGenomes-Tr; G2583_0912-1.
DR   EnsemblGenomes-Tr; G2583_0913-1.
DR   EnsemblGenomes-Tr; G2583_0914-1.
DR   EnsemblGenomes-Tr; G2583_0915-1.
DR   EnsemblGenomes-Tr; G2583_1077-1.
DR   EnsemblGenomes-Tr; G2583_1120-1.
DR   EnsemblGenomes-Tr; G2583_1206-1.
DR   EnsemblGenomes-Tr; G2583_1290-1.
DR   EnsemblGenomes-Tr; G2583_1347-1.
DR   EnsemblGenomes-Tr; G2583_1443-1.
DR   EnsemblGenomes-Tr; G2583_1502-1.
DR   EnsemblGenomes-Tr; G2583_1503-1.
DR   EnsemblGenomes-Tr; G2583_1504-1.
DR   EnsemblGenomes-Tr; G2583_1505-1.
DR   EnsemblGenomes-Tr; G2583_1535-1.
DR   EnsemblGenomes-Tr; G2583_1688-1.
DR   EnsemblGenomes-Tr; G2583_1692-1.
DR   EnsemblGenomes-Tr; G2583_1753-1.
DR   EnsemblGenomes-Tr; G2583_1780-1.
DR   EnsemblGenomes-Tr; G2583_2060-1.
DR   EnsemblGenomes-Tr; G2583_2061-1.
DR   EnsemblGenomes-Tr; G2583_2080-1.
DR   EnsemblGenomes-Tr; G2583_2085-1.
DR   EnsemblGenomes-Tr; G2583_2252-1.
DR   EnsemblGenomes-Tr; G2583_2289-1.
DR   EnsemblGenomes-Tr; G2583_2290-1.
DR   EnsemblGenomes-Tr; G2583_2339-1.
DR   EnsemblGenomes-Tr; G2583_2360-1.
DR   EnsemblGenomes-Tr; G2583_2361-1.
DR   EnsemblGenomes-Tr; G2583_2362-1.
DR   EnsemblGenomes-Tr; G2583_2405-1.
DR   EnsemblGenomes-Tr; G2583_2484-1.
DR   EnsemblGenomes-Tr; G2583_2486-1.
DR   EnsemblGenomes-Tr; G2583_2493-1.
DR   EnsemblGenomes-Tr; G2583_2496-1.
DR   EnsemblGenomes-Tr; G2583_2499-1.
DR   EnsemblGenomes-Tr; G2583_2598-1.
DR   EnsemblGenomes-Tr; G2583_2599-1.
DR   EnsemblGenomes-Tr; G2583_2610-1.
DR   EnsemblGenomes-Tr; G2583_2732-1.
DR   EnsemblGenomes-Tr; G2583_2757-1.
DR   EnsemblGenomes-Tr; G2583_2884-1.
DR   EnsemblGenomes-Tr; G2583_2928-1.
DR   EnsemblGenomes-Tr; G2583_2929-1.
DR   EnsemblGenomes-Tr; G2583_2935-1.
DR   EnsemblGenomes-Tr; G2583_2936-1.
DR   EnsemblGenomes-Tr; G2583_2937-1.
DR   EnsemblGenomes-Tr; G2583_2938-1.
DR   EnsemblGenomes-Tr; G2583_3039-1.
DR   EnsemblGenomes-Tr; G2583_3051-1.
DR   EnsemblGenomes-Tr; G2583_3087-1.
DR   EnsemblGenomes-Tr; G2583_3171-1.
DR   EnsemblGenomes-Tr; G2583_3172-1.
DR   EnsemblGenomes-Tr; G2583_3173-1.
DR   EnsemblGenomes-Tr; G2583_3174-1.
DR   EnsemblGenomes-Tr; G2583_3202-1.
DR   EnsemblGenomes-Tr; G2583_3303-1.
DR   EnsemblGenomes-Tr; G2583_3335-1.
DR   EnsemblGenomes-Tr; G2583_3339-1.
DR   EnsemblGenomes-Tr; G2583_3340-1.
DR   EnsemblGenomes-Tr; G2583_3341-1.
DR   EnsemblGenomes-Tr; G2583_3342-1.
DR   EnsemblGenomes-Tr; G2583_3343-1.
DR   EnsemblGenomes-Tr; G2583_3411-1.
DR   EnsemblGenomes-Tr; G2583_3445-1.
DR   EnsemblGenomes-Tr; G2583_3462-1.
DR   EnsemblGenomes-Tr; G2583_3468-1.
DR   EnsemblGenomes-Tr; G2583_3469-1.
DR   EnsemblGenomes-Tr; G2583_3470-1.
DR   EnsemblGenomes-Tr; G2583_3492-1.
DR   EnsemblGenomes-Tr; G2583_3493-1.
DR   EnsemblGenomes-Tr; G2583_3518-1.
DR   EnsemblGenomes-Tr; G2583_3563-1.
DR   EnsemblGenomes-Tr; G2583_3565-1.
DR   EnsemblGenomes-Tr; G2583_3567-1.
DR   EnsemblGenomes-Tr; G2583_3626-1.
DR   EnsemblGenomes-Tr; G2583_3773-1.
DR   EnsemblGenomes-Tr; G2583_3775-1.
DR   EnsemblGenomes-Tr; G2583_3793-1.
DR   EnsemblGenomes-Tr; G2583_3845-1.
DR   EnsemblGenomes-Tr; G2583_3889-1.
DR   EnsemblGenomes-Tr; G2583_3896-1.
DR   EnsemblGenomes-Tr; G2583_3899-1.
DR   EnsemblGenomes-Tr; G2583_3935-1.
DR   EnsemblGenomes-Tr; G2583_3991-1.
DR   EnsemblGenomes-Tr; G2583_3992-1.
DR   EnsemblGenomes-Tr; G2583_3993-1.
DR   EnsemblGenomes-Tr; G2583_3994-1.
DR   EnsemblGenomes-Tr; G2583_3995-1.
DR   EnsemblGenomes-Tr; G2583_3996-1.
DR   EnsemblGenomes-Tr; G2583_3997-1.
DR   EnsemblGenomes-Tr; G2583_4143-1.
DR   EnsemblGenomes-Tr; G2583_4251-1.
DR   EnsemblGenomes-Tr; G2583_4282-1.
DR   EnsemblGenomes-Tr; G2583_4395-1.
DR   EnsemblGenomes-Tr; G2583_4552-1.
DR   EnsemblGenomes-Tr; G2583_4553-1.
DR   EnsemblGenomes-Tr; G2583_4554-1.
DR   EnsemblGenomes-Tr; G2583_4555-1.
DR   EnsemblGenomes-Tr; G2583_4556-1.
DR   EnsemblGenomes-Tr; G2583_4557-1.
DR   EnsemblGenomes-Tr; G2583_4591-1.
DR   EnsemblGenomes-Tr; G2583_4592-1.
DR   EnsemblGenomes-Tr; G2583_4593-1.
DR   EnsemblGenomes-Tr; G2583_4594-1.
DR   EnsemblGenomes-Tr; G2583_4597-1.
DR   EnsemblGenomes-Tr; G2583_4649-1.
DR   EnsemblGenomes-Tr; G2583_4650-1.
DR   EnsemblGenomes-Tr; G2583_4651-1.
DR   EnsemblGenomes-Tr; G2583_4652-1.
DR   EnsemblGenomes-Tr; G2583_4653-1.
DR   EnsemblGenomes-Tr; G2583_4663-1.
DR   EnsemblGenomes-Tr; G2583_4665-1.
DR   EnsemblGenomes-Tr; G2583_4773-1.
DR   EnsemblGenomes-Tr; G2583_4783-1.
DR   EnsemblGenomes-Tr; G2583_4784-1.
DR   EnsemblGenomes-Tr; G2583_4785-1.
DR   EnsemblGenomes-Tr; G2583_4786-1.
DR   EnsemblGenomes-Tr; G2583_4791-1.
DR   EnsemblGenomes-Tr; G2583_4792-1.
DR   EnsemblGenomes-Tr; G2583_4793-1.
DR   EnsemblGenomes-Tr; G2583_4794-1.
DR   EnsemblGenomes-Tr; G2583_4802-1.
DR   EnsemblGenomes-Tr; G2583_4806-1.
DR   EnsemblGenomes-Tr; G2583_4825-1.
DR   EnsemblGenomes-Tr; G2583_4826-1.
DR   EnsemblGenomes-Tr; G2583_4827-1.
DR   EnsemblGenomes-Tr; G2583_4828-1.
DR   EnsemblGenomes-Tr; G2583_4961-1.
DR   EnsemblGenomes-Tr; G2583_4990-1.
DR   EnsemblGenomes-Tr; G2583_4991-1.
DR   EnsemblGenomes-Tr; G2583_4992-1.
DR   EnsemblGenomes-Tr; G2583_5095-1.
DR   EnsemblGenomes-Tr; G2583_5171-1.
DR   EnsemblGenomes-Tr; G2583_5263-1.
DR   EnsemblGenomes-Tr; G2583_5264-1.
DR   EnsemblGenomes-Tr; G2583_5265-1.
DR   EnsemblGenomes-Tr; G2583_5266-1.
DR   EnsemblGenomes-Tr; G2583_5267-1.
DR   EnsemblGenomes-Tr; G2583_5268-1.
DR   EnsemblGenomes-Tr; G2583_5269-1.
DR   EnsemblGenomes-Tr; G2583_5270-1.
DR   EnsemblGenomes-Tr; G2583_5271-1.
DR   EnsemblGenomes-Tr; G2583_5272-1.
DR   EnsemblGenomes-Tr; G2583_5273-1.
DR   EnsemblGenomes-Tr; G2583_5274-1.
DR   EnsemblGenomes-Tr; G2583_5275-1.
DR   EnsemblGenomes-Tr; G2583_5276-1.
DR   EnsemblGenomes-Tr; G2583_5277-1.
DR   EnsemblGenomes-Tr; G2583_5278-1.
DR   EuropePMC; PMC3080977; 21467222.
DR   EuropePMC; PMC3147399; 21622790.
DR   EuropePMC; PMC3163573; 21824423.
DR   EuropePMC; PMC3273018; 22179243.
DR   EuropePMC; PMC3641635; 23493634.
DR   EuropePMC; PMC3681947; 23785398.
DR   EuropePMC; PMC3811523; 24014531.
DR   EuropePMC; PMC3900561; 24466152.
DR   EuropePMC; PMC4399054; 25667270.
DR   EuropePMC; PMC5039186; 27733849.
DR   EuropePMC; PMC5382810; 28663823.
DR   EuropePMC; PMC5685211; 28920571.
DR   EuropePMC; PMC6033998; 30008706.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00014; DsrA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00035; OxyS.
DR   RFAM; RF00039; DicF.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00084; CsrC.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00113; QUAD.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00115; IS061.
DR   RFAM; RF00116; C0465.
DR   RFAM; RF00117; C0719.
DR   RFAM; RF00118; rydB.
DR   RFAM; RF00119; C0299.
DR   RFAM; RF00121; MicC.
DR   RFAM; RF00122; GadY.
DR   RFAM; RF00124; IS102.
DR   RFAM; RF00126; ryfA.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00370; sroD.
DR   RFAM; RF00371; sroE.
DR   RFAM; RF00372; sroH.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00505; RydC.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01387; isrC.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01400; istR.
DR   RFAM; RF01401; rseX.
DR   RFAM; RF01407; STnc560.
DR   RFAM; RF01408; sraL.
DR   RFAM; RF01517; iscRS.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01804; Lambda_thermo.
DR   RFAM; RF01809; symR.
DR   RFAM; RF01813; rdlD.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01832; ROSE_2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02051; STnc450.
DR   RFAM; RF02052; STnc630.
DR   RFAM; RF02053; STnc430.
DR   RFAM; RF02057; STnc40.
DR   RFAM; RF02060; STnc410.
DR   RFAM; RF02064; STnc370.
DR   RFAM; RF02068; STnc480.
DR   RFAM; RF02069; STnc70.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02076; STnc100.
DR   RFAM; RF02079; STnc180.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02082; STnc540.
DR   RFAM; RF02083; OrzO-P.
DR   RFAM; RF02084; STnc130.
DR   RFAM; RF02111; IS009.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP001846.
DR   SILVA-SSU; CP001846.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5386352
FT                   /organism="Escherichia coli O55:H7 str. CB9615"
FT                   /host="Homo sapiens"
FT                   /strain="CB9615"
FT                   /serotype="O55:H7"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /isolation_source="infant with diarrhea"
FT                   /note="ST11"
FT                   /db_xref="taxon:701177"
FT   gene            190..255
FT                   /pseudo
FT                   /gene="thrL"
FT                   /locus_tag="G2583_0001"
FT                   /note="thr operon leader peptide"
FT   gene            336..2798
FT                   /gene="thrA"
FT                   /locus_tag="G2583_0002"
FT   CDS_pept        336..2798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="G2583_0002"
FT                   /product="ThrA"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54659"
FT                   /db_xref="GOA:D3QUG7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:D3QUG7"
FT                   /protein_id="ADD54659.1"
FT                   /translation="MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITN
FT                   HLVAMIEKTISGQDALPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHV
FT                   LHGISLLGQCPDSINAALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLES
FT                   TVDIAESTRRIAASRIPADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADC
FT                   CEIWTDVDGVYTCDPRQVPDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCL
FT                   IKNTGNPQAPGTLIGASRDEDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMS
FT                   RARISVVLITQSSSEYSISFCVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAII
FT                   SVVGDGMRTLRGISAKFFAALARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQM
FT                   LFNTDQVIEVFVIGVGGVGGALLEQLKRQQSWLKNKHIDLRVCGVANSKALLTNVHGLN
FT                   LENWQEELAQAKEPFNLGRLIRLVKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVVT
FT                   PNKKANTSSMDYYHLLRHAAEKSRRKFLYDTNVGAGLPVIENLQNLLNAGDELMKFSGI
FT                   LSGSLSYIFGKLDEGMSFSEATTLAREMGYTEPDPRDDLSGMDVARKLLILARETGREL
FT                   ELADIEIEPVLPAEFNAEGDVAAFMANLSQLDDLFAARVAKARDEGKVLRYVGNIDEDG
FT                   VCRVKIAEVDGNDPLFKVKNGENALAFYSHYYQPLPLVLRGYGAGNDVTAAGVFADLLR
FT                   TLSWKLGV"
FT   gene            2800..3732
FT                   /gene="thrB"
FT                   /locus_tag="G2583_0003"
FT   CDS_pept        2800..3732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="G2583_0003"
FT                   /product="Homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54660"
FT                   /db_xref="GOA:D3QUG8"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D3QUG8"
FT                   /protein_id="ADD54660.1"
FT                   /translation="MVKVYAPASSANMSVGFDVLGAAVTPVDGALLGDVVTVESAETFS
FT                   LNNLGRFADKLPSEPRENIVYQCWERFCQELGKQIPVAMTLEKNMPIGSGLGSSACSVV
FT                   AALMAMNEHCGKPLNDPRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENDIISQ
FT                   QVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPELA
FT                   AKLMKDVIAEPYRERLLPGFRQARQAVAEIGAVASGISGSGPTLFALCDKPDTAQRVAD
FT                   WLGKNYLQNQEGFVHICRLDTAGARVLEN"
FT   gene            3733..5019
FT                   /gene="thrC"
FT                   /locus_tag="G2583_0004"
FT   CDS_pept        3733..5019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="G2583_0004"
FT                   /product="Threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54661"
FT                   /db_xref="GOA:D3QUG9"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:D3QUG9"
FT                   /protein_id="ADD54661.1"
FT                   /translation="MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDE
FT                   MLKLDFVTRSAKILSAFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTL
FT                   AFKDFGGRFMAQMLTHIAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKIS
FT                   PLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQ
FT                   ICYYFEAVAQLPQEARNQLVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPR
FT                   FLHDGQWSPKATQATLSNAMDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTM
FT                   RELKELGYTSEPHAAVAYRALRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKE
FT                   LAERADLPLLSHNLPADFAALRKLMMNHQ"
FT   gene            5233..5529
FT                   /gene="yaaX"
FT                   /locus_tag="G2583_0005"
FT   CDS_pept        5233..5529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaX"
FT                   /locus_tag="G2583_0005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54662"
FT                   /db_xref="InterPro:IPR019638"
FT                   /db_xref="UniProtKB/TrEMBL:D3QUH0"
FT                   /protein_id="ADD54662.1"
FT                   /translation="MKKMQSIVLALSLVLVAPMATQAAEITLVPSVKLQIGDRDNRGYY
FT                   WDGGHWRDHGWWKQHYEWRGNRWHPHGPPPPPRHHKKAHHDHHGGHGPGKHHR"
FT   gene            complement(5682..6458)
FT                   /gene="yaaA"
FT                   /locus_tag="G2583_0006"
FT   CDS_pept        complement(5682..6458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="G2583_0006"
FT                   /product="UPF0246 protein yaaA"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54663"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/TrEMBL:D3QUH1"
FT                   /protein_id="ADD54663.1"
FT                   /translation="MLILISPAKTLDYQSPLTTTRYTLPELLDNSQQLIHEARKLTPPQ
FT                   ISTLMRISDKLAGINAARFHDWQPDFTPENARQAILAFKGDVYTGLQAETFSEDDFDFA
FT                   QQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENARGKDLYQFWGDIITNKLNEALAAQG
FT                   DNVVINLASDEYFKSVKPKKLNAEIIKPVFLDEKNGKFKIISFYAKKARGLMSRFIIEN
FT                   RLTKPEQLTGFNSEGYFFDEASSSNGELVFKRYEQR"
FT   gene            complement(6528..7958)
FT                   /gene="yaaJ"
FT                   /locus_tag="G2583_0007"
FT   CDS_pept        complement(6528..7958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaJ"
FT                   /locus_tag="G2583_0007"
FT                   /product="inner membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54664"
FT                   /db_xref="GOA:D3QV91"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D3QV91"
FT                   /protein_id="ADD54664.1"
FT                   /translation="MPDFFSFINSVLWGSVMIYLLFGAGCWFTFRTGFVQFRYIRQFGK
FT                   SLKNSIHPQPGGLTSFQSLCTSLAARVGSGNLAGVALAITAGGPGAVFWMWVAAFIGMA
FT                   TSFAECSLAQLYKERDVNGQFRGGPAWYMARGLGMRWMGVLFAVFLLIAYGIIFSGVQA
FT                   NAVARALSFSFDFPPLVTGIILAVFALLAIIRGLHGVARLMQGFVPLMAIIWVLTSLVI
FT                   CVINIGQLPHVIWSIFESAFGWQEAAGGAAGYTLSQAITNGFQRSMFSNEAGMGSTPNA
FT                   AAAAASWPPHPAAQGIVQMIGIFIDTLVICTASAMLILLAGNGTTYMPLEGIQLIQKAM
FT                   RVLMGSWGAEFVTLVVILFAFSSIVANYIYAENNLFFLRLNNPKAIWCLRICTFATVIG
FT                   GTLLSLPLMWQLADIIMACMAITNLTAILLLSPVVHTIASDYLRQRKLGVRPVFDPLRY
FT                   PDIGRQLSRDAWDDVSQE"
FT   gene            8237..9190
FT                   /gene="talB"
FT                   /locus_tag="G2583_0008"
FT   CDS_pept        8237..9190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="talB"
FT                   /locus_tag="G2583_0008"
FT                   /product="Transaldolase 1"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54665"
FT                   /db_xref="GOA:D3QV92"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:D3QV92"
FT                   /protein_id="ADD54665.1"
FT                   /translation="MTDKLTSLRQYTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQI
FT                   PEYRKLIDDAVAWAKQQSNDRAQQIVDATDKLAVNIGLEILKLVPGRISTEVDARLSYD
FT                   TEASIAKAKRLIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVFLISPFVGRILDWYKANTDKKEYAPAEDPGVVSVSEIYQYYKEHGYETVV
FT                   MGASFRNIGEILELAGCDRLTIAPALLKELAESEGAIERKLSYTGEVKARPARITESEF
FT                   LWQHNQDPMAVDKLAEGIRKFAIDQEKLEKMIGDLL"
FT   gene            9305..9892
FT                   /gene="mog"
FT                   /locus_tag="G2583_0009"
FT   CDS_pept        9305..9892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mog"
FT                   /locus_tag="G2583_0009"
FT                   /product="Molybdopterin biosynthesis mog protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54666"
FT                   /db_xref="GOA:D3QV93"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:D3QV93"
FT                   /protein_id="ADD54666.1"
FT                   /translation="MNTLRIGLVSISDRASSGVYQDKGIPALEEWLTSALTTPFELETR
FT                   LIPDEQAIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAVADREMPGFGEQMR
FT                   QISLHFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKDAEGNVVVHGIFASVP
FT                   YCIQLLEGPYVETAPEVVAAFRPKSARRDVSE"
FT   gene            complement(9927..10493)
FT                   /gene="yaaH"
FT                   /locus_tag="G2583_0010"
FT   CDS_pept        complement(9927..10493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaH"
FT                   /locus_tag="G2583_0010"
FT                   /product="membrane protein, GPR1/FUN34/yaaH family"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54667"
FT                   /db_xref="GOA:D3QV94"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:D3QV94"
FT                   /protein_id="ADD54667.1"
FT                   /translation="MGNTKLANPAPLGLMGFGMTTILLNLHNVGYFALDGIILAMGIFY
FT                   GGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKLGLTDAPNAQFLGVYLG
FT                   LWGVFTLFMFFGTLKGARVLQFVFFSLTVLFALLAIGNIAGNAAIIHFAGWIGLICGAS
FT                   AIYLAMGEVLNEQFGRTVLPIGESH"
FT   gene            10820..11344
FT                   /gene="htgA"
FT                   /locus_tag="G2583_0012"
FT   CDS_pept        10820..11344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htgA"
FT                   /locus_tag="G2583_0012"
FT                   /product="Positive regulator for sigma 32 heat shock
FT                   promoters"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54668"
FT                   /db_xref="UniProtKB/TrEMBL:D3QV95"
FT                   /protein_id="ADD54668.1"
FT                   /translation="MRKMRVSWLESRCDTPFANNLSFISSGSSSSSSFTLASTACRNSC
FT                   LCSSSIFFQVLRRNCSSNCCSISNVDISLSAFSFNRFETSSKMARYNLPCPRSLLAILS
FT                   PPKCCNSPAISCQLRRCCSGCPSIDLNSSLRISTLERRVLPFSLWVSSRAKFANCSSLQ
FT                   CWRKSRSESFR"
FT   gene            complement(11381..11785)
FT                   /gene="yaaI"
FT                   /locus_tag="G2583_0013"
FT   CDS_pept        complement(11381..11785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="G2583_0013"
FT                   /product="UPF0412 protein yaaI precursor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54669"
FT                   /db_xref="InterPro:IPR020240"
FT                   /db_xref="UniProtKB/TrEMBL:D3QV96"
FT                   /protein_id="ADD54669.1"
FT                   /translation="MKSVFTISASLAISLMLCCTAQANDHKLLGVIAMPRNETNDLALK
FT                   LPVCRIVKRIQLSADHGDLQLSGASVYFKAARSASQSLNIPSEIKEGQTTDWININSDN
FT                   DNKRCVSKITFSGHTVNSSDMATLKIIGDD"
FT   gene            12162..14078
FT                   /gene="dnaK"
FT                   /locus_tag="G2583_0014"
FT   CDS_pept        12162..14078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="G2583_0014"
FT                   /product="Chaperone protein dnaK"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54670"
FT                   /db_xref="GOA:D3QV97"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D3QV97"
FT                   /protein_id="ADD54670.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQD
FT                   GETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVE
FT                   VKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATN
FT                   GDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILV
FT                   GGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFN
FT                   LDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVR
FT                   DAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETAL
FT                   KGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVK
FT                   DKK"
FT   gene            14167..15297
FT                   /gene="dnaJ"
FT                   /locus_tag="G2583_0015"
FT   CDS_pept        14167..15297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="G2583_0015"
FT                   /product="Chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54671"
FT                   /db_xref="GOA:D3QV98"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D3QV98"
FT                   /protein_id="ADD54671.1"
FT                   /translation="MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEA
FT                   KFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGGMGGGGFGGGADFSDIFGDVFGDIFGG
FT                   GRGRQRAARGADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPT
FT                   CHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDT
FT                   GDRIRLAGEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIE
FT                   VPTLDGRVKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQL
FT                   LQELQESFGGPTGEHNSPRSKSFFDGVKKFFDDLTR"
FT   gene            complement(15401..15610)
FT                   /gene="mokC"
FT                   /locus_tag="G2583_0016"
FT   CDS_pept        complement(15401..15610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mokC"
FT                   /locus_tag="G2583_0016"
FT                   /product="Gef protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54672"
FT                   /db_xref="GOA:D3QV99"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="InterPro:IPR018084"
FT                   /db_xref="UniProtKB/TrEMBL:D3QV99"
FT                   /protein_id="ADD54672.1"
FT                   /translation="MLNTCSVPLTDRKVKEKRAMKQHKVMIVALIVICITAVVAALVTR
FT                   KDLCEVHIRTGQTEVAVFTAYESE"
FT   gene            16139..17305
FT                   /gene="nhaA"
FT                   /locus_tag="G2583_0017"
FT   CDS_pept        16139..17305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="G2583_0017"
FT                   /product="Sodium/proton antiporter nhaA"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54673"
FT                   /db_xref="GOA:D3QVA0"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVA0"
FT                   /protein_id="ADD54673.1"
FT                   /translation="MKHLHRFFSSDASGGIILIIAAILAMMMANSGATSGWYHDFLETP
FT                   VQLRVGSLEINKNMLLWINDALMAVFFLLVGLEVKRELMQGSLASLRQAAFPVIAAIGG
FT                   MIVPALLYLAFNYADPITREGWAIPAATDIAFALGVLTLLGSRVPLALKIFLMALAIID
FT                   DLGAIIIIALFYTNDLSMASLGVAAVAIAVLAVLNLCGVRRTGVYILVGVVLWTAVLKS
FT                   GVHATLAGVIVGFFIPLKEKHGRSPAKRLEHVLHPWVAYLILPLFAFANAGVSLQGVTL
FT                   DGLTSILPLGIIAGLLIGKPLGISLFCWLALRLKLAHLPEGTTYQQIMAVGILCGIGFT
FT                   MSIFIASLAFGSVDPELINWAKLGILVGSISSAVIGYSWLRVRLRPSV"
FT   gene            17365..18270
FT                   /gene="nhaR"
FT                   /locus_tag="G2583_0018"
FT   CDS_pept        17365..18270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaR"
FT                   /locus_tag="G2583_0018"
FT                   /product="DNA-binding transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54674"
FT                   /db_xref="GOA:D3QVA1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVA1"
FT                   /protein_id="ADD54674.1"
FT                   /translation="MSMSHINYNHLYYFWHVYKEGSVVGAAEALYLTPQTITGQIRALE
FT                   ERLQGKLFKRKGRGLEPSELGELVYRYADKMFTLSQEMLDIVNYRKESNLLFDVGVADA
FT                   LSKRLVSSVLNAAVVEGEPIHLRCFESTHEMLLEQLSQHKLDMIISDCPIDSTQQEGLF
FT                   SVRIGECGVSFWCTNPPPEKPFPACLEERRLLIPGRRSMLGRKLLNWFNSQGLNVEILG
FT                   EFDDAALMKAFGAMHNAIFVAPTLYAYDFYADKTVVEIGRVENVMEEYHAIFAERMIQH
FT                   PAVQRICNTDYSALFSPAVR"
FT   gene            complement(18308..19267)
FT                   /locus_tag="G2583_0019"
FT   CDS_pept        complement(18308..19267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54675"
FT                   /db_xref="GOA:D3QVA2"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVA2"
FT                   /protein_id="ADD54675.1"
FT                   /translation="MKWLLLITLSLYSFIVQSAPCGLTNVGEQRGTYILKPLSMKGNLT
FT                   AEKIENTGNIIECADLQETTNAIKVHFLTQNALRFKVGSRHYIINFPFESDGKKIALPG
FT                   KSSYNLEEMLSAINFTIPYSIASVSDSSNTADIFPGTPFPLLFEIEVSSCTGNNTNCNS
FT                   VRFNFNLNTILQVNLMTCGFEDQSIDTGRFVLSRINNENYQFHHIRFDCIQGEQGELVF
FT                   EPSDVEYYFEPVTIQESGTSILKNELENSEDGAGQIGFQLSNDGTNEIQYGKSNYYSFQ
FT                   HPHEGSNQIPLFIRPRTYGNNVSSGQIMSRVKIVVMYN"
FT   gene            complement(19280..21730)
FT                   /gene="yehB"
FT                   /locus_tag="G2583_0020"
FT   CDS_pept        complement(19280..21730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yehB"
FT                   /locus_tag="G2583_0020"
FT                   /product="Putative usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54676"
FT                   /db_xref="GOA:D3QVA3"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVA3"
FT                   /protein_id="ADD54676.1"
FT                   /translation="MLRTTRWVAAIIFLYSFPGYAEETFDTHFMIGGMKGEKVSEYHFD
FT                   NKQPLPGNYELDFYVNNQWRGKQDITIPESPVKPCLPKVLLTKLGVKTGNLNTEDNCIL
FT                   LDKAVHGGQYQWDISEHRLNLTVPQAYINELERGYVPPESWDRGIDAFYTSYNLSQYRS
FT                   YDSNNNSNTASYGRFNSGLNLFSWQLHSDASYSKPDDMKGTWQSNTLYLEHGWSQILST
FT                   VQIGENYTSSLIFDSLRFSGIRLFRDMQMLPDSMQSFTPLVQGVAQSNALITVSQNGYI
FT                   IYQKEVPPGPFTIADLQLSGSGSDLDVSIKEADGSVRSFLVPYSSVPNMLQPGISNFDF
FT                   IAGRSKIYGVKNQEDFLEANYIYGLNNLLTLYGGTILSDNYNAITLGNGWNTPLGAISF
FT                   DATRSSSKLNNDITHEGTSYQVAYNKYLVQTATRFSVAAWRYASQDYRTFSDHLYENDK
FT                   INHQSDYDDFYDIGRKNSLSANIMQPLSNNLGNVSLSALWRNYWGRSGNAKDYQFSYSN
FT                   SWQRISYTFSASQSYDENDKEEERFNLFISIPFYWGDDIAKTRHQINLSNSTSFSKDGY
FT                   SSNNTGITGIAGEHDQLNYGIYVNQQQQNNDTSLGTNLSWRTPIATIDGSYSHSKNAWQ
FT                   SGGSISSGLVVWPGGINITNQLSDTFAILDAPGLEGAHINGQKYNRTNSKGQVVYDLMI
FT                   PHRENHLVLDTANSESETELQGNRQIIAPYRGAVSYVQFTTDQRKPWYIQALRPDGSPL
FT                   TFGYDVLDLQENNIGVVGQGSRLFIRVDEIPTGIKVALNDEQNLFCTITFQHVIDENKT
FT                   YICQ"
FT   gene            complement(21743..22426)
FT                   /gene="yehC"
FT                   /locus_tag="G2583_0021"
FT   CDS_pept        complement(21743..22426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yehC"
FT                   /locus_tag="G2583_0021"
FT                   /product="Gram-negative pilus assembly chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54677"
FT                   /db_xref="GOA:D3QVA4"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVA4"
FT                   /protein_id="ADD54677.1"
FT                   /translation="MRIITALLMSFFILPVHAGVVIYGTRIIYPEKNREVLVQLMNQSK
FT                   NASLIQAWIDDGNTTIAPEKIQVTFILTPPVSRVAGGSGQQLKIRKMPNNLPHNKESLF
FT                   YLNVLDIPPNNPQNAGKNKIKLALQNRIKLLWRPSGIAPVDKKSLSQLNIKKKNNAISI
FT                   NNETANWITVTTIKAQNVKVNNESILLPPFSHNDITLKNNHASEYELTVVDDYGNNIHS
FT                   KIAAR"
FT   gene            complement(22476..23009)
FT                   /gene="stcA"
FT                   /locus_tag="G2583_0022"
FT   CDS_pept        complement(22476..23009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stcA"
FT                   /locus_tag="G2583_0022"
FT                   /product="Putative type-1 fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54678"
FT                   /db_xref="GOA:D3QVA5"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVA5"
FT                   /protein_id="ADD54678.1"
FT                   /translation="MKKYIIPFVATTLMFSATTFAKDVDQGTLTIRGEVVDTTCYFVNG
FT                   DSTTDIVVEDVVTSAMNQLINNEIYTLKTGSTSHDLEIQCDGNTAPSIEVLASEFDANN
FT                   FTLNKGTAENIGFAIFLDDGTLTRMRPGLKTPLKDNGSGQYFLNLNAQYARTSGNPVTK
FT                   GSVESTVTIKISAD"
FT   gene            complement(23311..24732)
FT                   /locus_tag="G2583_0023"
FT   CDS_pept        complement(23311..24732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54679"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVA6"
FT                   /protein_id="ADD54679.1"
FT                   /translation="MTDGISTSPHCLYKSNIVDDVIINKTRQNELVKVFCEYKTEFLIL
FT                   FDDFFRSQDLPKPSPVLHHFFQYTHLRDAHFYRCKLIEHTVQFSFFKHKGITLLRLDVF
FT                   DDRTSECLSEEIKIYQECHEKFIKFLKANFNQEIYPELYTPEIFYEACRNLQSFYDHQE
FT                   TSQNAKYSATVKKKSYFNKEIRNLIKKNIYPELYNEQCNKIPASSTDDNQKITWQNFKT
FT                   SNAAYSQLCEKLSLLKSSPSRLIEKSAYCSNENMITDKFDVVFSYCGDNVKEFILLLPY
FT                   NKSLEMHELNEQNIQYLTALNINIHKLLLSNITIEKSNLSYGYYFGCVLSNISCFESDL
FT                   SNTIFSNGEINNLFIKKSNIFGTSFTNTMIKNLRCEDIMPGRWTTQLVNKHLGYRYTGV
FT                   FKTLASIDDKPSRFEILIPLVQTLVRDNVKLNNDVYKELKKFMHDYDKTSPEMRKYLQS
FT                   INESMFLMKKISHQD"
FT   gene            complement(25202..25465)
FT                   /gene="rpsT"
FT                   /locus_tag="G2583_0024"
FT   CDS_pept        complement(25202..25465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="G2583_0024"
FT                   /product="30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54680"
FT                   /db_xref="GOA:D3QVA7"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVA7"
FT                   /protein_id="ADD54680.1"
FT                   /translation="MANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKA
FT                   AAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA"
FT   gene            25568..25792
FT                   /gene="yaaY"
FT                   /locus_tag="G2583_0025"
FT   CDS_pept        25568..25792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaY"
FT                   /locus_tag="G2583_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54681"
FT                   /db_xref="InterPro:IPR020105"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVA8"
FT                   /protein_id="ADD54681.1"
FT                   /translation="MCRHSLRSDGAGFYQLAGCEYSFSAIKIAAGSQFLPVICAMTMTM
FT                   KSHFFLISVLNRRLTLTAVQGILGRFSLF"
FT   gene            25800..26741
FT                   /gene="ribF"
FT                   /locus_tag="G2583_0026"
FT   CDS_pept        25800..26741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="G2583_0026"
FT                   /product="Riboflavin biosynthesis protein ribF [Includes:
FT                   Riboflavin kinase (Flavokinase)]"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54682"
FT                   /db_xref="GOA:D3QVA9"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVA9"
FT                   /protein_id="ADD54682.1"
FT                   /translation="MKLIRGIHNLSQAPQEGCVLTIGNFDGVHRGHRALLQGLQEEGRK
FT                   RNLPVMVMLFEPQPLELFATDKAPARLTRLREKLRYLAECGVDYVLCVRFDRRFAALTA
FT                   QNFISDLLVKHLRVKFLAVGDDFRFGAGREGDFLLLQKAGMEYGFDITSTQTFCEGGVR
FT                   ISSTAVRQALADDNLALAESLLGHPFAISGRVVHGDELGRTIGFPTANVPLRRQVSPVK
FT                   GVYAVEVLGLGEKPLPGVANIGTRPTVAGIRQQLEVHLLDVAMDLYGRHIQVVLRKKIR
FT                   NEQRFASLDELKAQIARDELTAREFFGLTKPA"
FT   gene            26784..29600
FT                   /gene="ileS"
FT                   /locus_tag="G2583_0027"
FT   CDS_pept        26784..29600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="G2583_0027"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54683"
FT                   /db_xref="GOA:D3QVB0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVB0"
FT                   /protein_id="ADD54683.1"
FT                   /translation="MSDYKSTLNLPETGFPMRGDLAKREPGMLARWTDDDLYGIIRAAK
FT                   KGKKTFILHDGPPYANGSIHIGHSVNKILKDIIVKSKGLSGYDSPYVPGWDCHGLPIEL
FT                   KVEQEYGKPGEKFTAAEFRAKCREYAATQVDGQRKDFIRLGVLGDWSHPYLTMDFKTEA
FT                   NIIRALGKIIGNGHLHKGAKPVHWCVDCRSALAEAEVEYYDKTSPSIDVAFQAVDQDAL
FT                   KAKFGVSNVNGPISLVIWTTTPWTLPANRAISIAPDFDYALVQIDGQAVILAKDLVESV
FT                   MQRIGVTDYTILGTVKGAELELLRFAHPFMGFDVPAILGDHVTLDAGTGAVHTAPGHGP
FT                   DDYVIGQKYGLETANPVGPDGTYLPGTYPTLDGVNVFKANDIVVALLQEKGALLHVEKM
FT                   QHSYPCCWRHKTPIIFRATPQWFVSMDQKGLRAQSLKEIKGVQWIPDWGQARIESMVAN
FT                   RPDWCISRQRTWGVPMSLFVHKDTEELHPRTLELMEEVAKRVEVDGIQAWWDLDAKEIL
FT                   GDEADQYVKVPDTLDVWFDSGSTHSSVVDVRPEFAGHAADMYLEGSDQHRGWFMSSLMI
FT                   STAMKGKAPYRQVLTHGFTVDGQGRKMSKSIGNTVSPQDVMNKLGADILRLWVASTDYT
FT                   GEMAVSDEILKRAADSYRRIRNTARFLLANLNGFDPAKDMVKPEEMVVLDRWAVGCAKA
FT                   AQEDILKAYEAYDFHEVVQRLMRFCSVEMGSFYLDIIKDRQYTAKADSVARRSCQTALY
FT                   HIAEALVRWMAPILSFTADEVWGYLPGEREKYVFTGEWYEGLFGLADSEAMNDAFWDEL
FT                   LKVRGEVNKVIEQARADKKVGGSLEAAVTLYTEPELAAKLTALGDELRFVLLTSGATVA
FT                   DYNDAPADAQQSEVLKGLKVALSKAEGEKCPRCWHYTQDVGKVAEHAEICGRCVSNVAG
FT                   DGEKRKFA"
FT   gene            29600..30094
FT                   /gene="lspA"
FT                   /locus_tag="G2583_0028"
FT   CDS_pept        29600..30094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="G2583_0028"
FT                   /product="Lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54684"
FT                   /db_xref="GOA:D3QVB1"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVB1"
FT                   /protein_id="ADD54684.1"
FT                   /translation="MSQSICSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVPLFPS
FT                   LNLHYARNYGAAFSFLADSGGWQRWFFAGIAIGISVTLVVMMYRSKATQKLNNIAYALI
FT                   IGGALGNLFDRLWHGFVVDMIDFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKK
FT                   Q"
FT   gene            30182..30631
FT                   /gene="fkpB"
FT                   /locus_tag="G2583_0029"
FT   CDS_pept        30182..30631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fkpB"
FT                   /locus_tag="G2583_0029"
FT                   /product="FKBP-type 16 kDa peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54685"
FT                   /db_xref="GOA:D3QVB2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVB2"
FT                   /protein_id="ADD54685.1"
FT                   /translation="MSESVQSNSAVLVHFTLKLDDGTTAESTRNNGKPALFRLGDASLS
FT                   EGLEQHLLGLKVGDKTTFSLEPDAAFGVPSPDLIQYFSRREFMDAGEPEIGAIMLFTAM
FT                   DGSEMPGVIREINGDSITVDFNHPLAGQTVHFDIEVLEIDPALEA"
FT   gene            30633..31583
FT                   /gene="ispH"
FT                   /locus_tag="G2583_0030"
FT   CDS_pept        30633..31583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="G2583_0030"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54686"
FT                   /db_xref="GOA:D3QVB3"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVB3"
FT                   /protein_id="ADD54686.1"
FT                   /translation="MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYV
FT                   VDSLRERGAIFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHM
FT                   EVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPDDVWKLTVKNEEKLSF
FT                   MTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGS
FT                   KNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR
FT                   LQQLGGGEAIPLEGREENIVFEVPKELRVDIREVD"
FT   gene            31649..32563
FT                   /gene="rihC"
FT                   /locus_tag="G2583_0031"
FT   CDS_pept        31649..32563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rihC"
FT                   /locus_tag="G2583_0031"
FT                   /product="Non-specific ribonucleoside hydrolase rihC"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54687"
FT                   /db_xref="GOA:D3QVB4"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR022976"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVB4"
FT                   /protein_id="ADD54687.1"
FT                   /translation="MRLPIFLDTDPGIDDAVAIAAAIFAPELDLQLMTTVAGNVSVEKT
FT                   TRNALQLLHFWNAEIPLAQGAAVPLVRAPRDAASVHGESGMAGYDFVEHNRKPLGIPAF
FT                   LAIRDALMRAPEPVTLVAIGPLTNIALLLSQCPECKPYIRRLVIMGGSAGRGNCTPNAE
FT                   FNIAADPEAAACVFRSGIEIVMCGLDVTNQAILTPDYLSTLPQLNRTGKMLHALFSHYR
FT                   SGSMQSGLRMHDLCAIAWLVRPDLFTLKPCFVAVETQGEFTSGTTVVDIDGCLGKPANV
FT                   QVALDLNVKGFQQWVAEVLALVP"
FT   gene            32730..33551
FT                   /gene="dapB"
FT                   /locus_tag="G2583_0032"
FT   CDS_pept        32730..33551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="G2583_0032"
FT                   /product="Dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54688"
FT                   /db_xref="GOA:D3QVB5"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVB5"
FT                   /protein_id="ADD54688.1"
FT                   /translation="MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLL
FT                   GSDAGELAGAGKTGVTVQSSLDAIKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTT
FT                   GFDEAGKQAIRDAAADIAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHK
FT                   VDAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTA
FT                   MFADIGERLEITHKASSRMTFANGAVRSALWLSGKENGLFDMRDVLDLNNL"
FT   gene            34007..35155
FT                   /gene="carA"
FT                   /locus_tag="G2583_0033"
FT   CDS_pept        34007..35155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="G2583_0033"
FT                   /product="Carbamoylphosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54689"
FT                   /db_xref="GOA:D3QVB6"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVB6"
FT                   /protein_id="ADD54689.1"
FT                   /translation="MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTD
FT                   PSYSRQIVTLTYPHIGNVGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKR
FT                   HNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVT
FT                   TAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQ
FT                   TSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGA
FT                   KTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGI
FT                   HRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRKTAK"
FT   gene            35173..38394
FT                   /gene="carB"
FT                   /locus_tag="G2583_0034"
FT   CDS_pept        35173..38394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="G2583_0034"
FT                   /product="Carbamoyl-phosphate synthase large chain"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54690"
FT                   /db_xref="GOA:D3QVB7"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVB7"
FT                   /protein_id="ADD54690.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLEEFGVTMIGATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEALAVAADVG
FT                   FPCIIRPSFTMGGSGGGIAYNREEFEEICARGLDLSPTKELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGATGFDPKVSLDDPEALTKIRRELKDAGAERIWYIADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEKVAEVGITGLNAEFLRQLKRKGFADARLAKLAGVREAEIRKLR
FT                   DQYDLHPVYKRVDTCAAEFATDTAYMYSTYEEECEANPSTDREKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKP
FT                   KGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAVDRLKLKQPANAT
FT                   VTAIEMAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLD
FT                   HFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQ
FT                   VQKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAG
FT                   KSLAEQGVTKEVIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAK
FT                   AQLGSNSTMKKHGRALLSVREGDKERVVDLAAKLLKQGFELDATHGTAIVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIINTTSGRRAIEDSRVIRRSALQYKVHYDTTLNGGF
FT                   ATAMALNADATEKVISVQEMHAQIK"
FT   gene            complement(38402..38620)
FT                   /locus_tag="G2583_0035"
FT   CDS_pept        complement(38402..38620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54691"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVB8"
FT                   /protein_id="ADD54691.1"
FT                   /translation="MTRFEAIKQGHIKIVDISIVCNFTVDKCELNPAYVIKNIDSPKDL
FT                   LNGQKKRSSSENRISYSIKLADEKYPP"
FT   gene            38655..39050
FT                   /gene="caiF"
FT                   /locus_tag="G2583_0036"
FT   CDS_pept        38655..39050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiF"
FT                   /locus_tag="G2583_0036"
FT                   /product="DNA-binding transcriptional activator CaiF"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54692"
FT                   /db_xref="GOA:D3QVB9"
FT                   /db_xref="InterPro:IPR020357"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVB9"
FT                   /protein_id="ADD54692.1"
FT                   /translation="MCEGYVEKPLYLLIAEWMMAENRWVIAREISIHFDIEHSKAVNTL
FT                   TYILSEVTEISCEVKMIPNKLEGRGCQCQRLVKVVDIDEQIYARLRNNSREKLVGVRKT
FT                   PRIPAVPLTELNREQKWQMMLSKSMRR"
FT   gene            complement(39169..39780)
FT                   /gene="caiE"
FT                   /locus_tag="G2583_0037"
FT   CDS_pept        complement(39169..39780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiE"
FT                   /locus_tag="G2583_0037"
FT                   /product="Carnitine operon protein caiE"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54693"
FT                   /db_xref="GOA:D3QVC0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023446"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVC0"
FT                   /protein_id="ADD54693.1"
FT                   /translation="MERTLTTVSYYAFEGLIPVVHPTAFVHPSAVLIGDVIVGAGVYIG
FT                   PLASLRGDYGRLIVQAGANIQDGCIMHGYTDTDTIVGENGHIGHGAILHGCVIGRDALV
FT                   GMNSVIMDGAVIGEESIVAAMSFVKAGFHGEKRQLLMGTPARAVRSVSDDELHWKRLNT
FT                   KEYQDLVGRCHASLHETQPLRQMEENRPRLQGTTDVTPKR"
FT   gene            complement(39765..40658)
FT                   /gene="caiD"
FT                   /locus_tag="G2583_0038"
FT   CDS_pept        complement(39765..40658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiD"
FT                   /locus_tag="G2583_0038"
FT                   /product="Crotonobetainyl CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54694"
FT                   /db_xref="GOA:D3QVC1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR022852"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVC1"
FT                   /protein_id="ADD54694.1"
FT                   /translation="MKRQGTTLPANNHALKQYAFFAGMLSSLKKQKWRKGMSESLHLTR
FT                   NGSILEITLDRPKANAIDAKTSFEMGEVFLNFRDDPQLRVAIITGAGEKFFSAGWDLKA
FT                   AAEGEAPDADFGPGGFAGLTEIFNLDKPVIAAVNGYAFGGGFELALAADFIVCADNASF
FT                   ALPEAKLGIVPDSGGVLRLPKILPPAIVNEMVMTGRRMGAEEALRWGIVNRVVSQAELM
FT                   DNARELAQQLVNSAPLAIAALKEIYRTTSEMPVEESYRYIRSGVLKHYPSVLHSEDAIE
FT                   GPLAFAEKRDPVWKGR"
FT   gene            complement(40659..42227)
FT                   /gene="caiC"
FT                   /locus_tag="G2583_0039"
FT   CDS_pept        complement(40659..42227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiC"
FT                   /locus_tag="G2583_0039"
FT                   /product="Putative crotonobetaine/carnitine-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54695"
FT                   /db_xref="GOA:D3QVC2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023456"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVC2"
FT                   /protein_id="ADD54695.1"
FT                   /translation="MDRGAMDIIGGQHLRQMWDDLADVYGHKTALICESSGGVVNRYSY
FT                   LELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARLLRE
FT                   ESAWILQNSQACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSSFTQLKN
FT                   QQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQCALRDDDVY
FT                   LTVMPAFHIDCQCTAAMAAFSAGATFVLVEKYSARAFWGQVQKYRATITECIPMMIRTL
FT                   MVQPPSANDRQHRLREVMFYLNLSEQEKDTFCERFGVRLLTSYGMTETIVGIIGDRPGD
FT                   KRRWPSIGRAGFCYEAEIRDDHNRPLPAGEIGEICIKGVPGKTIFKEYFLNPKATAKVL
FT                   EADGWLHTGDTGYRDEEGFFYFIDRRCNMIKRGGENVSCVELENIIATHPKIQDIVVVG
FT                   IKDSIRDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPSYLEIRKDLPRNCSGKII
FT                   RKNLK"
FT   gene            complement(42286..43503)
FT                   /gene="caiB"
FT                   /locus_tag="G2583_0040"
FT   CDS_pept        complement(42286..43503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiB"
FT                   /locus_tag="G2583_0040"
FT                   /product="Crotonobetainyl-CoA:carnitine CoA-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54696"
FT                   /db_xref="GOA:D3QVC3"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023452"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVC3"
FT                   /protein_id="ADD54696.1"
FT                   /translation="MDHLPMPKFGPLAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIEN
FT                   VAWADTIRVQPNYPQLSRRNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARR
FT                   GITDEVLWQHNPKLVIAHLSGFGQYGTEEYTNLPAYNTIAQAFSGYLIQNGDVDQPMPA
FT                   FPYTADYFSGLTATTAALAALHKARETGKGESIDIAMYEVMLRMGQYFMMDYFNGGEMC
FT                   PRMSKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLGTPEIPEGTQLI
FT                   HRIECPYGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESI
FT                   TQWQTMDGRTCKGPNIMPKFKNNPGQIWRGMPSHGMDTAAILKNIGYSENDIQELVSKG
FT                   LAKVED"
FT   gene            complement(43632..44774)
FT                   /gene="caiA"
FT                   /locus_tag="G2583_0041"
FT   CDS_pept        complement(43632..44774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiA"
FT                   /locus_tag="G2583_0041"
FT                   /product="Crotonobetainyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54697"
FT                   /db_xref="GOA:D3QVC4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023450"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVC4"
FT                   /protein_id="ADD54697.1"
FT                   /translation="MDFNLNDEQELFVAGIRELMASENWEAYFAECDRDSVYPERFVKA
FT                   LADMGIDSLLIPEEHGGLDAGFVTLAAVWMELGRLGAPTYVLYQLPGGFNTFLREGTQE
FT                   QIDKIMAFRGTGKQMWNSAITEPGAGSDVGSLKTTYTRRNGKIYLNGSKCFITSSAYTP
FT                   YIVVMARDGASPDKPVYTEWFVDMSKPGIKVTKLEKLGLRMDSCCEITFDDVELDEKDM
FT                   FGREGNGFNRVKEEFDHERFLVALTNYGTAMCAFEDAARYANQRVQFGEAIGRFQLIQE
FT                   KFAHMAIKLNSMKNMLYEAAWKADNGTITSGDAAMCKYFCANAAFEVVDSAMQVLGGVG
FT                   IAGNHRISRFWRDLRVDRVSGGSDEMQILTLGRAVLKQYR"
FT   gene            complement(44805..46319)
FT                   /gene="caiT"
FT                   /locus_tag="G2583_0042"
FT   CDS_pept        complement(44805..46319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiT"
FT                   /locus_tag="G2583_0042"
FT                   /product="L-carnitine/gamma-butyrobetaine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54698"
FT                   /db_xref="GOA:D3QVC5"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="InterPro:IPR023449"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVC5"
FT                   /protein_id="ADD54698.1"
FT                   /translation="MKNEKRKTGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFS
FT                   YVTNVWGWAFEWYMVVMLFGWFWLVFGPYAKKRLGNEPPEFSTASWIFMMFASCTSAAV
FT                   LFWGSIEIYYYISTPPFGLEPNSTGAKELGLAYSLFHWGPLPWATYSFLSVAFAYFFFV
FT                   RKMEVIRPSSTLVPLVGEKHAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWL
FT                   FGIPHTLQLDAIIITCWIILNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIVSGASF
FT                   IMNYFTDSVGMLLMYLPRMLFYTDPIAKGGFPQGWTVFYWAWWVIYAIQMSIFLARISR
FT                   GRTVRELCFGMVMGLTASTWILWTVLGSNTLLLIDKNIINIPNLIEQYGVARAIIETWA
FT                   ALPLSTATMWGFFILCFIATVTLVNACSYTLAMSTCREVRDGEEPPLLVRIGWSILVGI
FT                   IGIVLLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKQNWKD"
FT   gene            46730..47563
FT                   /gene="fixA"
FT                   /locus_tag="G2583_0043"
FT   CDS_pept        46730..47563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="G2583_0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54699"
FT                   /db_xref="GOA:D3QVC6"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR023463"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVC6"
FT                   /protein_id="ADD54699.1"
FT                   /translation="MISVINTTDMNDVSFMISGDAMKIITCYKCVPDEQDIAVNNADGS
FT                   LDFSKADAKISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTNAKGRKDVLSRGPDE
FT                   LIVVIDDQFEQALPQQTASALAAAAQKAGFDLILCGDGSSDLYAQQVGLLVGEILNIPA
FT                   VNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKK
FT                   PVQVWSAADIGFNAEAAWSEQQVAAPKQRERQRIVIEGDGEEQIAAFAENLRKVI"
FT   gene            47578..48519
FT                   /gene="fixB"
FT                   /locus_tag="G2583_0044"
FT   CDS_pept        47578..48519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixB"
FT                   /locus_tag="G2583_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54700"
FT                   /db_xref="GOA:D3QVC7"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR023461"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVC7"
FT                   /protein_id="ADD54700.1"
FT                   /translation="MNTFSQVWVFSDTPSRLPELMNGAQALANQINAFVLNDADGAQAI
FT                   QLGANHVWKLNGKPDDRMIEDYASVMADTIRQHGADGLVLLPNTRRGKLLAAKLGYRLK
FT                   AAVSNDASTVSVQDGKATVKHMVYGGLAIGEERIATPYAVLTISSGTFDAAQPDASRTG
FT                   ETHTVEWQAPAVAITRTATQARQSNSVDLDKARLVVSVGRGIGSKENIALAEQLCKAIG
FT                   AELACSRPVAENEKWMEHERYVGISNLMLKPELYLAVGISGQIQHMVGANASQTIFAIN
FT                   KDKNAPIFQYADYGIVGDAVKILPALTAALAR"
FT   gene            48570..49856
FT                   /gene="fixC"
FT                   /locus_tag="G2583_0045"
FT   CDS_pept        48570..49856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixC"
FT                   /locus_tag="G2583_0045"
FT                   /product="PAPS (adenosine 3-phosphate 5-phosphosulfate)
FT                   3(2),5-bisphosphate nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54701"
FT                   /db_xref="GOA:D3QVC8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVC8"
FT                   /protein_id="ADD54701.1"
FT                   /translation="MSEDIFDAIIVGAGLAGSVAALVLAREGAQVLVIERGNSAGAKNV
FT                   TGGRLYAHSLEHIIPGFAESAPVERLITHEKLAFMTEKSAMTMDYCNGDETSPSQRSYS
FT                   VLRSKFDAWLMEQAEEAGAQLITGIRVDNLVQRDGKVVGVEADGDVIEAKTVILADGVN
FT                   SILAEKLGMAKRVKPTDVAVGVKELIELPKSVIEDRFQLQGNQGAACLFAGSPTDGLMG
FT                   GGFLYTNENTLSLGLVCGLHHLHDAKKSVPQMLEDFKQHPAVAPLIAGGKLVEYSAHVV
FT                   PEAGINMLPELVGDGVLIAGDAAGMCMNLGFTIRGMDLAIAAGEAAAKTVLSAMKSDDF
FT                   SKQKLAEYRQHLESGPLRDMRMYQKLPAFLDNPRMFSGYPELAVGVARDLFTIDGSAPE
FT                   LMRKKILRHGKKVGFINLIKDGMKGVTVL"
FT   gene            49853..50140
FT                   /gene="fixX"
FT                   /locus_tag="G2583_0046"
FT   CDS_pept        49853..50140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixX"
FT                   /locus_tag="G2583_0046"
FT                   /product="Ferredoxin-like protein fixX"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54702"
FT                   /db_xref="GOA:D3QVC9"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVC9"
FT                   /protein_id="ADD54702.1"
FT                   /translation="MTSPVNVDVKLGVNKFNVDEEHPHIVVKADADKQALELLVKACPA
FT                   GLYKKQDDGSVRFDYAGCLECGTCRILGLGSALEQWEYPRGTFGVEFRYG"
FT   gene            50198..51529
FT                   /gene="yaaU"
FT                   /locus_tag="G2583_0047"
FT   CDS_pept        50198..51529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaU"
FT                   /locus_tag="G2583_0047"
FT                   /product="Major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54703"
FT                   /db_xref="GOA:D3QVD0"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVD0"
FT                   /protein_id="ADD54703.1"
FT                   /translation="MQPSRNFDDLKFSSIHRRILLWGSGGPFLDGYILVMIGVALEQLT
FT                   PALKLDADWIGLLGAGTLAGLFVGTSLFGYISDKVGRRKMFLIDIIAIGVISVATMFVS
FT                   SPVELLVMRVLIGIVIGADYPIATSMITEFSSTRQRAFSISFIAAMWYVGATCADLVGY
FT                   WLYDVEGGWRWMLGSAAIPCLLILIGRFELPESPRWLLRKGRVKECEEMMIKLFGEPVA
FT                   FDEEQPQQTRFRDLFNRRHFPFVLFVAAIWTCQVIPMFAIYTFGPQIVGLLGLGVGKNA
FT                   ALGNVVISLFFMLGCIPPMLWLNTAGRRPLLIGSFAMMTLALAVLGLIPDMGIWLVVMA
FT                   FAVYAFFSGGPGNLQWLYPNELFPTDIRASAVGVIMSLSRIGTIVSTWALPIFINNYGI
FT                   SNTMLMGAGISLFGLLISVAFAPETRGMSLAQTSNMTIRGQRMG"
FT   gene            51637..52167
FT                   /gene="kefF"
FT                   /locus_tag="G2583_0048"
FT   CDS_pept        51637..52167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefF"
FT                   /locus_tag="G2583_0048"
FT                   /product="Glutathione-regulated potassium-efflux system
FT                   ancillary protein kefF"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54704"
FT                   /db_xref="GOA:D3QVD1"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023948"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVD1"
FT                   /protein_id="ADD54704.1"
FT                   /translation="MILIIYAHPYPHHSHANKRMLEQARTLEGVEIRSLYQLYPDFNID
FT                   IAAEQEALSRADLIVWQHPMQWYSIPPLLKLWIDKVFSHGWAYGHGGTALHGKHLLWAV
FT                   TTGGGESHFEIGAHPGFDVLSQPLQATAIYCGLNWLPPFAMHCTFICDDETLEGQARHY
FT                   KQRLLEWQEAHHG"
FT   gene            52160..54022
FT                   /gene="kefC"
FT                   /locus_tag="G2583_0049"
FT   CDS_pept        52160..54022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefC"
FT                   /locus_tag="G2583_0049"
FT                   /product="Glutathione-regulated potassium-efflux system
FT                   protein kefC (K(+)/H(+) antiporter)"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54705"
FT                   /db_xref="GOA:D3QVD2"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR023941"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVD2"
FT                   /protein_id="ADD54705.1"
FT                   /translation="MDSHTLVQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPWG
FT                   LRLVTDAESILHFAEIGVVLMLFIIGLELDPQRLWKLRAAVFGGGALQMVICGGLLGLF
FT                   CMLLGLRWQVAELIGMTLALSSTAIAMQAMNERNLMVTQMGRSAFAVLLFQDIAAIPLV
FT                   AMIPLLAASSASTTMGAFALSALKVAGALVLVVLLGRYVTRPALRFVARSGLREVFSAV
FT                   ALFLVFGFGLLLEEVGLSMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVG
FT                   MSIDFGTLIENPLRIVILLLGFLIIKIAMLWLIARPLQVPNKQRRWFAVLLGQGSEFAF
FT                   VVFGAAQMANVLEPEWAKSLTLAVALSMAATPILLVILNRLEQSSTEEAREADEIDEEQ
FT                   PRVIIAGFGRFGQITGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLES
FT                   AGAAKAEVLINAIDDPQTNLQLTEMVKEHFPHLQIIARARDVDHYIRLRQAGVEKPERE
FT                   TFEGALKTGRLALESLGLGPYEARERADVFRRFNIQMVEEMAMVENDTKARAAVYKRTS
FT                   AMLSEIITEDREHLSLIQRHGWQGTEEGKHTGNMADEPETKPSS"
FT   gene            54103..54693
FT                   /gene="folA"
FT                   /locus_tag="G2583_0050"
FT   CDS_pept        54103..54693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="G2583_0050"
FT                   /product="Dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54706"
FT                   /db_xref="GOA:D3QVD3"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVD3"
FT                   /protein_id="ADD54706.1"
FT                   /translation="MDSPAEYKIFLNIILAPVDDGLRFTYSGDNFFYREISMISLIAAL
FT                   AVDRVIGMENAMPWNLPADLAWFKRNTLNKPVIMGRHTWESIGRPLPGRKNIILSSQPG
FT                   TDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFP
FT                   DYEPDDWESVFSEFHDADAQNSHSYCFEILERR"
FT   gene            54779..55012
FT                   /locus_tag="G2583_0051"
FT   CDS_pept        54779..55012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0051"
FT                   /product="putative antitoxin of gyrase inhibiting
FT                   toxin-antitoxin system"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54707"
FT                   /db_xref="InterPro:IPR009956"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVD4"
FT                   /protein_id="ADD54707.1"
FT                   /translation="MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHA
FT                   ATRWREENAEAIAALNQLADETGCFSDEYRSF"
FT   gene            55015..55329
FT                   /gene="ccdB"
FT                   /locus_tag="G2583_0052"
FT   CDS_pept        55015..55329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdB"
FT                   /locus_tag="G2583_0052"
FT                   /product="CcdB protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54708"
FT                   /db_xref="GOA:D3QVD5"
FT                   /db_xref="InterPro:IPR002712"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVD5"
FT                   /protein_id="ADD54708.1"
FT                   /translation="MQFTVYRSRSRNAAFPFVIDVTSDIIGVINRRIVIPLTPIERFSR
FT                   IRPPERLNPILLLVDGKEYVLMTHETATVPVNALGTKFCDASAHRTLIKGALDFMLDGI
FT                   "
FT   gene            complement(55326..56174)
FT                   /gene="apaH"
FT                   /locus_tag="G2583_0053"
FT   CDS_pept        complement(55326..56174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="G2583_0053"
FT                   /product="Bis(5-nucleosyl)-tetraphosphatase, symmetrical"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54709"
FT                   /db_xref="GOA:D3QVD6"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVD6"
FT                   /protein_id="ADD54709.1"
FT                   /translation="MATYLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGS
FT                   LDVLRYVKSLGDSVRLVLGNHDLHLLAVFAGISRNKPKDRLTPLLEAPDADELLNWLRR
FT                   QPLLQIDEEKKLVMAHAGITPQWDLQTAKECARDVEAVLSSDSYPFFLDAMYGDMPNNW
FT                   SPELRGLGRLRFITNAFTRMRFCFPNGQLDMYSKESPEEAPAPLKPWFAIPGPVAEEYS
FT                   IAFGHWASLEGKGTPEGIYALDTGCCWGGSLTCLRWEDKQYFVQPSNRHKDLGEGEAVA
FT                   S"
FT   gene            complement(56181..56558)
FT                   /gene="apaG"
FT                   /locus_tag="G2583_0054"
FT   CDS_pept        complement(56181..56558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="G2583_0054"
FT                   /product="ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54710"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVD7"
FT                   /protein_id="ADD54710.1"
FT                   /translation="MINSPRVCIQVQSVYIEAQSSPDNERYVFAYTVTIRNLGRAPVQL
FT                   LGRYWLITNGNGRETEVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMIDE
FT                   NGVPFSIDIPVFRLAVPTLIH"
FT   gene            complement(56561..57382)
FT                   /gene="ksgA"
FT                   /locus_tag="G2583_0055"
FT   CDS_pept        complement(56561..57382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="G2583_0055"
FT                   /product="Dimethyladenosine transferase
FT                   (S-adenosylmethionine-6-N, N-adenosyl(rRNA)
FT                   dimethyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54711"
FT                   /db_xref="GOA:D3QVD8"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVD8"
FT                   /protein_id="ADD54711.1"
FT                   /translation="MNNRVHQGHLARKRFGQNFLNDQFVIDSIVSAINPQKGQAMVEIG
FT                   PGLAALTEPVGERLDQLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTFNFGELAEKM
FT                   GQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVM
FT                   AQYYCNVIPVLEVPPSAFTPPPKVDSAVVRLVPHATMPHPVKDVRVLSRITTEAFNQRR
FT                   KTIRNSLGNLFSVEVLTGMGIDPAMRAENISVAQYCQMANYLAENAPFQES"
FT   gene            complement(57379..58368)
FT                   /gene="pdxA"
FT                   /locus_tag="G2583_0056"
FT   CDS_pept        complement(57379..58368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="G2583_0056"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase
FT                   (4-(phosphohydroxy)-L-threonine dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54712"
FT                   /db_xref="GOA:D3QVD9"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVD9"
FT                   /protein_id="ADD54712.1"
FT                   /translation="MVKTQRVVITPGEPAGIGPDLVVQLAQREWPVELVVCADATLLTD
FT                   RAAMLGLPLTLRPYSPNSPAQPQTTGTLTLLPVALRESVTAGQLAIENGHYVVETLARA
FT                   CDGCLNGEFAALITGPVHKGVINDAGIPFTGHTEFFEERSQAKKVVMMLATEELRVALA
FT                   TTHLPLRDIADAITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHMGTEE
FT                   IDTIIPVLDELRAQGMKLNGPLPADTLFQPKYLDNADAVLAMYHDQGLPVLKYQGFGRG
FT                   VNITLGLPFIRTSVDHGTALELAGRGEADVGSFITALNLAIKMIVNTQ"
FT   gene            complement(58368..59654)
FT                   /gene="surA"
FT                   /locus_tag="G2583_0057"
FT   CDS_pept        complement(58368..59654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="G2583_0057"
FT                   /product="Chaperone surA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54713"
FT                   /db_xref="GOA:D3QVE0"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVE0"
FT                   /protein_id="ADD54713.1"
FT                   /translation="MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGL
FT                   MQSVKLNAAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIANIA
FT                   KQNNMTLDQMRSRLAYDGLNYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESLAQQ
FT                   VGNQNDASTELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSAD
FT                   QQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGESKNIS
FT                   VTEVHARHILLKPSPIMTDEQARVKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGD
FT                   LGWATPDIFDPAFRDALTRLNKGQMSAPVHSSFGWHLIELLDTRNVDKTDAAQKDRAYR
FT                   MLMNRKFSEEAASWMQEQRASAYVKILSN"
FT   gene            complement(59707..62055)
FT                   /gene="imp"
FT                   /locus_tag="G2583_0058"
FT   CDS_pept        complement(59707..62055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="G2583_0058"
FT                   /product="LPS-assembly protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54714"
FT                   /db_xref="GOA:D3QVE1"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVE1"
FT                   /protein_id="ADD54714.1"
FT                   /translation="MKKRIPTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQG
FT                   DTNDLPVTINADHAKGDYPDDAVFTGSVDIMQGNSRLQADEVQLHQAPGQPEPVRTVDA
FT                   LGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTIL
FT                   DNGSFTSCLPGSDTWSVVGSEIIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGDKR
FT                   RSGFLIPNAKYTTTNYFEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLSQAG
FT                   AGLMELDYLPSDKVYEDEHPNDDSSRRWLFYWNHSGVMDQVWRFNVDYTKVSDPSYFND
FT                   FDNKYGSSTDGYATQKFSVGYAVQNFNATVSTKQFQVFSEQNTSSYSAEPQLDVNYYQN
FT                   DVGPFDTRIYGQAVHFVNTRDDMPEATRVHLEPTINLPLSNNWGSINTEAKLLATHYQQ
FT                   TNLDWYNSRNTTKLDESVNRVMPQFKVDGKMVFERDMEMLAPGYTQTLEPRAQYLYVPY
FT                   RDQSDIYNYDSSLLQSDYSGLFRDRTYGGLDRIASANQVTTGVTSRIYDDAAVERFNIS
FT                   VGQIYYFTESRTGDDNITWENDDKTGSLVWAGDTYWRISERWGLRGGIQYDTRLDNVAT
FT                   SNSSIEYRRDEDRLVQLNYRYASPEYIQATLPKYYSTAEQYKNGISQVGAVASWPIADR
FT                   WSIVGAYYYDTNANKQADSMLGVQYSSCCYAIRVGYERKLNGWDNDKQHAVYDNAIGFN
FT                   IELRGLSSNYGLGTQEMLRSNILPYQNTL"
FT   gene            62310..63125
FT                   /gene="djlA"
FT                   /locus_tag="G2583_0059"
FT   CDS_pept        62310..63125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="G2583_0059"
FT                   /product="putative oxidoreductase Fe-S binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54715"
FT                   /db_xref="GOA:D3QVE2"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVE2"
FT                   /protein_id="ADD54715.1"
FT                   /translation="MQYWGKIIGVAVALLMGGGFWGVVLGLLIGHMFDKARSRKMEWFA
FT                   NQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGASRTAAQNAFRVG
FT                   KSDNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNERAVLYVIAEELGI
FT                   SRAQFDQFLRMMQGGAQFGGGYQQQSGGGNWQQAQRGPTLEDACNVLGVKPTDDATTIK
FT                   RAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELIKQQKGFK"
FT   gene            63420..64157
FT                   /gene="yabP"
FT                   /locus_tag="G2583_0060"
FT   CDS_pept        63420..64157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabP"
FT                   /locus_tag="G2583_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54716"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVE3"
FT                   /protein_id="ADD54716.1"
FT                   /translation="MKVSVPGMPATLLNMSNNDIYKMVSGDKMDMKMNIFQRLWETLRH
FT                   LFWSDKQTEAYKLLFNFVNKKAGNINASKYFTGAVNENEKEKFIHSLELFNELKTCAKN
FT                   PDEMVAKGNMSWVAQTFGDIELSVTFFIENKEICTQTLQLHKGPGNLGVDLREAYLPGV
FT                   DMRDCYLGLKTMKGHNKVLYLEPGWNANLDGATLDGAILDGATHLYDEVIIINKITPKK
FT                   IDTEEVATKQSTAEQITDNAIIE"
FT   gene            complement(64575..65234)
FT                   /gene="rluA"
FT                   /locus_tag="G2583_0061"
FT   CDS_pept        complement(64575..65234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="G2583_0061"
FT                   /product="Ribosomal large subunit pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54717"
FT                   /db_xref="GOA:D3QVE4"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVE4"
FT                   /protein_id="ADD54717.1"
FT                   /translation="MGMENYNPPQEPWLVILYQDDHIMVVNKPSGLLSVPGRLEEHKDS
FT                   VMTRIQRDYPQAESVHRLDMATSGVIVVALTKAAERELKRQFRERVPKKQYVTRVWGHP
FT                   SPAEGLVDLPLICDWPNRPKQKVCYETGKPAQTEYEVVEYAADNTARVVLKPITGRSHQ
FT                   LRVHMLALGHPILGDRFYASPEARAMAPRLLLHAEMLTITHPAYGNSMTFKAPADF"
FT   gene            complement(65246..68152)
FT                   /gene="hepA"
FT                   /locus_tag="G2583_0062"
FT   CDS_pept        complement(65246..68152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepA"
FT                   /locus_tag="G2583_0062"
FT                   /product="RNA polymerase-associated protein rapA"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54718"
FT                   /db_xref="GOA:D3QVE5"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVE5"
FT                   /protein_id="ADD54718.1"
FT                   /translation="MPFTLGQRWISDTESELGLGTVVAVDARTVTLLFPSTGENRLYAR
FT                   SDSPVTRVMFNPGDTITSHDGWQMQVEEVKEENGLLTYIGTRLDTEESGVALREVFLDS
FT                   KLVFSKPQDRLFAGQIDRMDRFALRYRARKYSSEQFRMPYSGLRGQRTSLIPHQLNIAH
FT                   DVGRRHAPRVLLADEVGLGKTIEAGMILHQQLLSGAAERVLIIVPETLQHQWLVEMLRR
FT                   FNLRFALFDDERYAEAQHDAYNPFDTEQLVICSLDFARRSKQRLEHLCEAEWDLLVVDE
FT                   AHHLVWSEDAPSREYQAIEQLAEHVPGVLLLTATPEQLGMESHFARLRLLDPNRFHDFA
FT                   QFVEEQKNYRPVADAVAMLLAGNKLSNDELNMLGEMIGEQDIEPLLQAANSDSEDAQSA
FT                   RQELVSMLMDRHGTSRVLFRNTRNGVKGFPKRELHTIKLPLPTQYQTAIKVSGIMGARK
FT                   SAEDRARDMLYPERIYQEFEGDNATWWNFDPRVEWLMGYLTSHRSQKVLVICAKAATAL
FT                   QLEQVLREREGIRAAVFHEGMSIIERDRAAAWFAEEDTGAQVLLCSEIGSEGRNFQFAS
FT                   HMVMFDLPFNPDLLEQRIGRLDRIGQAHDIQIHVPYLEKTAQSVLVRWYHEGLDAFEHT
FT                   CPTGRTIYDSVYNDLINYLASPDQTEGFDDLIKNCREQHEALKAQLEQGRDRLLEIHSN
FT                   GGEKAQALAESIEEQDDDTNLIAFAMNLFDIIGINQDDRGDNMIVLTPSDHMLVPDFPG
FT                   LSEDGITITFDREVALAREDAQFITWEHPLIRNGLDLILSGDTGSSTISLLKNKALPVG
FT                   TLLVELIYVVEAQAPKQLQLNRFLPPTPVRMLLDKNGNNLAAQVEFETFNRQLNAVNRH
FT                   TGSKLVNAVQQDVHAILQLGEAQIEKSARALIDAARNEADEKLSAELSRLEALRAVNPN
FT                   IRDDELTAIESNRQQVMESLDQAGWRLDALRLIVVTHQ"
FT   gene            complement(68316..70667)
FT                   /gene="polB"
FT                   /locus_tag="G2583_0063"
FT   CDS_pept        complement(68316..70667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polB"
FT                   /locus_tag="G2583_0063"
FT                   /product="DNA polymerase II"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54719"
FT                   /db_xref="GOA:D3QVE6"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVE6"
FT                   /protein_id="ADD54719.1"
FT                   /translation="MAQAGFILTRHWRDTPQGTEVSFWLATDNGPLQVTLAPQESVAFI
FT                   PADQVPRAQHILRGEQGFRLTPLALKDFHRQPVYGLYCRAHRQLMNYEKRLREGGVTVY
FT                   EANVRPPERYLMERFITSPVWVEGDMHNGAIVNARLKPHPDYRPPLKWVSIDIETTRHG
FT                   ELYCIGLEGCGQRIVYMLGPENGDASALDFELEYVASRPQLLEKLNAWFANYDPDVIIG
FT                   WNVVQFDLRMLQKHAERYRIPLRLGRDNSELEWREHGFKNGVFFAQAKGRLIIDGIEAL
FT                   KSAFWNFSSFSLETVAQELLGEGKSIDNPWDRMDEIDRRFAEDKPALATYNLKDCELVT
FT                   QIFHKTEIMPFLLERATVNGLPVDRHGGSVAAFGHLYFPRMHRAGYVAPNLGEVPPHAS
FT                   PGGYVMDSRPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLVEGMAQPDPEHSTEGFLDAW
FT                   FSREKHCLPEIVTNIWHGRDEAKRQGNKPLSQALKIIMNAFYGVLGTTACRFFDPRLVS
FT                   SITMRGHQIMRQTKALIEAQGYDVIYGDTDSTFVWLKGAHSEEEATKIGRALVQHVNVW
FT                   WAETLQKQQLTSALELEYETHFCRFLMPTIRGADTGSKKRYAGLIQEGDKQRMVFKGLE
FT                   TVRTDWTPLAQQFQQELYLRIFRNEPYQEYVRETIDKLMAGELDARLVYRKRLRRPLSE
FT                   YQRNVPPHVRAARLADEENQKRGRPLQYQNRGTIKYVWTTNGPEPLDYQRSPLDYEHYL
FT                   TRQLQPVAEGILPFIEDNFATLMTGQLGLF"
FT   gene            complement(70742..71437)
FT                   /gene="araD"
FT                   /locus_tag="G2583_0064"
FT   CDS_pept        complement(70742..71437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="G2583_0064"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54720"
FT                   /db_xref="GOA:D3QVE7"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004661"
FT                   /db_xref="InterPro:IPR033748"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVE7"
FT                   /protein_id="ADD54720.1"
FT                   /translation="MLEDLKRQVLEANLALPKHNLVTLTWGNVSAVDRERGVFVIKPSG
FT                   VDYSIMTADDMVVVSIETGEVVEGAKKPSSDTPTHRLLYQAFPSIGGIVHTHSRHATIW
FT                   AQAGQSIPATGTTHADYFYGTIPCTRKMTDAEINGEYEWETGNVIVETFEKQGIDAAQM
FT                   PGVLVHSHGPFAWGKNAEDAVHNAIVLEEVAYMGIFCRQLAPQLPDMQQTLLDKHYLRK
FT                   HGAKAYYGQ"
FT   gene            complement(71637..73139)
FT                   /gene="araA"
FT                   /locus_tag="G2583_0065"
FT   CDS_pept        complement(71637..73139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araA"
FT                   /locus_tag="G2583_0065"
FT                   /product="L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54721"
FT                   /db_xref="GOA:D3QVE8"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVE8"
FT                   /protein_id="ADD54721.1"
FT                   /translation="MTIFDNYEVWFVIGSQHLYGPETLRQVTQHAEHVVKALNTEAKLP
FT                   CKLVLKPLGTTPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLTMLNKPLLQFH
FT                   TQFNAALPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKQAHERIGSW
FT                   MRQAVSKQDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSIS
FT                   DGDVNALVDEYESCYTMTPATQIHGEKRQNVLEAARIELGMKRFLEQGGFHAFTTTFED
FT                   LHGLKQLPGLAVQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFE
FT                   KGNDLVLGSHMLEVCPSIAAEEKPILDVQHLGIGGKDDPARLIFNTQTGPAIVASLIDL
FT                   GDRYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALN
FT                   LNDMRQFAEMHDIEITVIDNDTRLPAFKDALRWNEVYYGFRR"
FT   gene            complement(73150..74850)
FT                   /gene="araB"
FT                   /locus_tag="G2583_0066"
FT   CDS_pept        complement(73150..74850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araB"
FT                   /locus_tag="G2583_0066"
FT                   /product="Ribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54722"
FT                   /db_xref="GOA:D3QVE9"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVE9"
FT                   /protein_id="ADD54722.1"
FT                   /translation="MAIAIGLDFGSDSVRALAVDCTTGEEIATSVEWYPRWQKGQFCDA
FT                   PNNQFRHHPRDYIESMEAALKTVLAELSVEQRAAVVGIGVDSTGSTPAPIDADGNVLAL
FT                   RPEFAENPNAMFVLWKDHTAVEEAEEITRLCHAPGNVDYSRYIGGIYSSEWFWAKILHV
FT                   TRQDSAVAQSAASWIELCDWVPALLSGTTRPQDIRRGRCSAGHKSLWHESWGGLPPASF
FT                   FDELDPILNRHLPSPLFTDTWTADIPVGTLCPEWAQRLGLPESVVISGGAFDCHMGAVG
FT                   AGAQPNALVKVIGTSTCDILIADKQSVGERAVKGICGQVDGSVVPGFIGLEAGQSAFGD
FT                   IYAWFGRVLGWPLEQLAAQHPELKEQIDASQKQLLPALTEAWAKNPSLDHLPVVLDWFN
FT                   GRRTPNANQRLKGVITDLNLATDAPLLFGGLIAATAFGARAIMECFTDQGIAVNNVMAL
FT                   GGIARKNQVIMQACCDVLNRPLQIVASDQCCALGAAIFAAVAAKVHADIPSAQQKMASA
FT                   VEKTLQPRSEQAQRFEQLYRRYQQWAMSAEQHYLPTSAPAQAAQAVPTL"
FT   gene            75138..76067
FT                   /gene="araC"
FT                   /locus_tag="G2583_0067"
FT   CDS_pept        75138..76067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC"
FT                   /locus_tag="G2583_0067"
FT                   /product="arabinose operon regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54723"
FT                   /db_xref="GOA:D3QVF0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVF0"
FT                   /protein_id="ADD54723.1"
FT                   /translation="MQYGQLVSSLNGGSMKSMAEAQNDPLLPGYSFNAHLVAGLTPIEA
FT                   NGYLDFFIDRPLGMKGYILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPE
FT                   AREWYHQWVYFRPRAYWHEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGR
FT                   YSELLAINLLEQLLLRRMEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVC
FT                   LSPSRLSHLFRQQLGISVLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRV
FT                   FKKCTGASPSEFRAGCEEKVNDVAVKLS"
FT   gene            76153..76917
FT                   /gene="yabI"
FT                   /locus_tag="G2583_0068"
FT   CDS_pept        76153..76917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabI"
FT                   /locus_tag="G2583_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54724"
FT                   /db_xref="GOA:D3QVF1"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVF1"
FT                   /protein_id="ADD54724.1"
FT                   /translation="MQALLEHFITQSTVYSLMAVVLVAFLESLALVGLILPGTVLMAGL
FT                   GALIGSGELSFWHAWLAGIVGCLLGDWISFWLGWRFKKPLHRWSFLKKNKALLDKTEHA
FT                   LHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFITPNIIGCLLWPPFYFLPGILAG
FT                   AAIDIPAGMQSGEFKWLLLATAVFLWVGGWLCWRLWRSGKATDRLSHYLSRGRLLWLTP
FT                   LISAIGVVALVVLVRHPLMPVYIDILRKVVGV"
FT   gene            complement(77004..77702)
FT                   /gene="thiQ"
FT                   /locus_tag="G2583_0069"
FT   CDS_pept        complement(77004..77702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiQ"
FT                   /locus_tag="G2583_0069"
FT                   /product="Thiamine import ATP-binding protein thiQ"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54725"
FT                   /db_xref="GOA:D3QVF2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVF2"
FT                   /protein_id="ADD54725.1"
FT                   /translation="MLKLTDITWLYHHLPMRFSLTVERGEQVAILGPSGAGKSTLLNLI
FT                   AGFLTPASGALTIDGVDHTTTPPSRRPVSMLFQENNLFSHLTVAQNIGLGLNPGLKLNA
FT                   VQQEKMHAIARQMGIDNLMARLPGELSGGQRQRVALARCLVREQPILLLDEPFSALDPA
FT                   LRQEMLTLVSTSCQQQKMTLLMVSHSVEDAARIATRSVVVADGRIAWQGMTNELLSGKA
FT                   SASALLGITG"
FT   gene            complement(77686..79296)
FT                   /gene="thiP"
FT                   /locus_tag="G2583_0070"
FT   CDS_pept        complement(77686..79296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiP"
FT                   /locus_tag="G2583_0070"
FT                   /product="Thiamine/thiamine pyrophosphate ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54726"
FT                   /db_xref="GOA:D3QVF3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVF3"
FT                   /protein_id="ADD54726.1"
FT                   /translation="MATRRQPLIPGWLIPGVSAATLVVAVALAAFLALWWNAPQGDWSA
FT                   VWQDSYLWHVVRFSFWQAFLSALLSVVPAIFLARALYRRRFPGRLALLRLCAMTLILPV
FT                   LVAVFGILSVYGRQGWLASLCQSLGLEWTFSPYGLQGILLAHVFFNLPMASRLLLQALE
FT                   NIPGEQRQLAAQLGMRGWHFFRFVEWPWLRRQIPPVTALIFMLCFASFATVLSLGGGPQ
FT                   ATTIELAIYQALSYDYDPARAAMLALIQMVCCLGLVLLSQRLSKAIAPGTTLLQGWRDP
FT                   DDRLHSRICDTMLIVLALLLLLPPLLAVIVDGVNRQLPEVLAQPVLWQALWTSLRIALA
FT                   AGVLCVVLTMMLLWSSRELRARQKMLAGQALEMSGMLILAMPGIVLATGFFLLLNNTIG
FT                   LPQSADGIVIFTNALMAIPYALKVLENPMRDITARYSMLCQSLGIEGWSRLKVVELRAL
FT                   KRPLAQALAFACVLSIGDFGVVALFGNDDFRTLPFYLYQQIGSYRSQDGAVTALILLLL
FT                   CFLLFTVIEKIPGRNVKTD"
FT   gene            complement(79272..80267)
FT                   /gene="tbpA"
FT                   /locus_tag="G2583_0071"
FT   CDS_pept        complement(79272..80267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="G2583_0071"
FT                   /product="Thiamine/thiamine pyrophosphate ABC transporter,
FT                   periplasmic thiamine/thiamine pyrophospate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54727"
FT                   /db_xref="GOA:D3QVF4"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVF4"
FT                   /protein_id="ADD54727.1"
FT                   /translation="MRCKVLKKCLPLLLLCTAPVFAKPVLTVYTYDSFAADWGPGPVVK
FT                   KAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFAKSG
FT                   VAADAVNVPGGWNNDIFVPFDYGYFAFVYDKNKLKNPPQSLKELVESDQNWRVIYQDPR
FT                   TSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTS
FT                   PAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPELAQKFLQFMVSPAFQNAIPT
FT                   GNWMYPVANVTLPAGFEKLTKPATTLEFTPAEVAAQRQAWISEWQRAVSR"
FT   gene            80627..81196
FT                   /locus_tag="G2583_0072"
FT   CDS_pept        80627..81196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54728"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVF5"
FT                   /protein_id="ADD54728.1"
FT                   /translation="MKVRNPEQISIPASNTTKDPGLTNSQIIRMANLVKKTENMNIFEE
FT                   LWETLRNLFQSDKHSQTAARQILKDAFYFQNSDDYSKYFTGAVDGKARDKLTHWLIKFN
FT                   ELKEYAKDPENMAAKASLSPEGTLCVSFFIGDEAIFTLELQLKKSTRTGGIDLSNAYFN
FT                   GVVICGIDCLEVDLSNAETNNSRWYD"
FT   gene            complement(81425..83083)
FT                   /gene="sgrR"
FT                   /locus_tag="G2583_0073"
FT   CDS_pept        complement(81425..83083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sgrR"
FT                   /locus_tag="G2583_0073"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54729"
FT                   /db_xref="GOA:D3QVF6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023767"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVF6"
FT                   /protein_id="ADD54729.1"
FT                   /translation="MPSARLQQQFIRLWQCCEGKSQDTTLNELAALLSCSRRHMRTLLN
FT                   TMQDRGWLTWEAEVGRGKRSRLTFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKATVR
FT                   QMLVSHLGRSFRQGRHILRVLYYRPLRNLLPGSALRRSETHIARQIFSSLTRINEENGE
FT                   LEADIAHHWQQISPLHWRFFLRPGVHFHHGRELEMDDVIASLKRINTLPLYSHIADIVS
FT                   PTPWTLDIHLTQPDRWLPLLLGQVPAMILPREWETLSNFASHPIGTGPYAVIRNSTNQL
FT                   KIQAFDDFFGYRALIDEVNVWVLPEIADEPAGGLMLKGPQGEEKEIESRLEEGCYYLLF
FT                   DSRTHRGANQQVRDWVSYVLSPTNLVYFAEEQYQQLWFPAYGLLPRWHHARTITSEKPA
FT                   GLESLTLTFYQDHSEHRVIAGIMQQILASHQVTLEIKEISYDQWHEGEIESDIWLNSAN
FT                   FTLPLDFSLFAHLCEVPLLQHCIPIDWQADAARWRNGEMNLANWCQQLVASKAMVPLIH
FT                   HWLIIQGQRSMRGLRMNTLGWFDFKSAWFAPPDPE"
FT   gene            83151..83376
FT                   /locus_tag="G2583_0074"
FT   ncRNA           83151..83376
FT                   /locus_tag="G2583_0074"
FT                   /note="putative non-coding RNA"
FT                   /ncRNA_class="other"
FT   gene            complement(83411..84016)
FT                   /gene="leuD"
FT                   /locus_tag="G2583_0075"
FT   CDS_pept        complement(83411..84016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="G2583_0075"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54730"
FT                   /db_xref="GOA:D3QVF7"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVF7"
FT                   /protein_id="ADD54730.1"
FT                   /translation="MAEKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDEKGQQPNPDFVLNFSQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVKLSDAEVDELFALVKANPGIHFDVDLEAQEVKAGEKTYRFT
FT                   IDAFRRHCMMNGLDSIGLTLQHDDAIAAYEAKQPAFMR"
FT   gene            complement(84027..85427)
FT                   /gene="leuC"
FT                   /locus_tag="G2583_0076"
FT   CDS_pept        complement(84027..85427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="G2583_0076"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54731"
FT                   /db_xref="GOA:D3QVF8"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVF8"
FT                   /protein_id="ADD54731.1"
FT                   /translation="MAKTLYEKLFDAHVVYEAENETPLLYIDRHLVHEVTSPQAFDGLR
FT                   AHGRPVRQPGKTFATMDHNVSTQTKDINACGEMARIQMQELIKNCKEFGVELYDLNHPY
FT                   QGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRA
FT                   KTMKIEVQGKAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNM
FT                   AIEMGAKAGLVAPDETTFNYVKGRLHAPKGKDFDDAVAYWKTLQTDEGATFDTVVTLQA
FT                   EEISPQVTWGTNPGQVISVNDNIPDPASFADPVERASAEKALAYMGLKPGILLTEVAID
FT                   KVFIGSCTNSRIEDLRAAAEIAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAG
FT                   FEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGH
FT                   FADIRNIK"
FT   gene            complement(85430..86521)
FT                   /gene="leuB"
FT                   /locus_tag="G2583_0077"
FT   CDS_pept        complement(85430..86521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="G2583_0077"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54732"
FT                   /db_xref="GOA:D3QVF9"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVF9"
FT                   /protein_id="ADD54732.1"
FT                   /translation="MSKNYHIAVLPGDGIGPEVMTQALKVLDAVRNRFAMRITTSHYDV
FT                   GGAAIDNHGQPLPPATVEGCEQADAVLFGSVGGPKWEHLPPDQQPERGALLPLRKHFKL
FT                   FSNLRPAKLYQGLEAFCPLRADIAANGFDILCVRELTGGIYFGQPKGREGSGQYEKAFD
FT                   TEVYHRFEIERIARIAFESARKRRHKVTSIDKANVLQSSILWREIVNEIATEYPDIELA
FT                   HMYIDNATMQLIKDPSQFDVLLCSNLFGDILSDECAMITGSMGMLPSASLNEQGFGLYE
FT                   PAGGSAPDIAGKNIANPIAQILSLALLLRYSLDADDAASAIERAINRALEEGIRTGDLA
FT                   RGAAAVSTDEMGDIIARYVAEGV"
FT   gene            complement(86521..88092)
FT                   /gene="leuA"
FT                   /locus_tag="G2583_0078"
FT   CDS_pept        complement(86521..88092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="G2583_0078"
FT                   /product="2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54733"
FT                   /db_xref="GOA:D3QVG0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVG0"
FT                   /protein_id="ADD54733.1"
FT                   /translation="MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDVMEV
FT                   GFPVSSPGDFESVQTIARQVKNSRVCALARCVEKDIDVAAESLKVAEAFRIHTFIATSP
FT                   MHIATKLRSTLDEVIERAIYMVKRARNYTDDVEFSCEDAGRTPIADLARVVEAAINAGA
FT                   TTINIPDTVGYTMPFEFAGIISGLYERVPNIDKAIISVHTHDDLGLAVGNSLAAVHAGA
FT                   RQVEGAMNGIGERAGNCSLEEVIMAIKVRKDILNVHTAINHQEIWRTSQLVSQICNMPI
FT                   PANKAIVGSGAFAHSSGIHQDGVLKNRENYEIMTPESIGLNQIQLNLTSRSGRAAVKHR
FT                   MDEMGYKESEYNLDNLYDAFLKLADKKGQVFDYDLEALAFIGKQQEEPEHFRLDYFSVQ
FT                   SGSNDIATAAVKLACGEEVKAEAANGNGPVDAVYQAINRITDYNVELVKYSLTAKGHGK
FT                   DALGQVDIVANYNGRRFHGVGLATDIVESSAKAMVHVLNNIWRATEVEKELQRKAQHNE
FT                   NNKETV"
FT   gene            complement(88185..88271)
FT                   /gene="leuL"
FT                   /locus_tag="G2583_0079"
FT   CDS_pept        complement(88185..88271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuL"
FT                   /locus_tag="G2583_0079"
FT                   /product="leader; Amino acid biosynthesis: Leucine"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54734"
FT                   /db_xref="GOA:D3QVG1"
FT                   /db_xref="InterPro:IPR012570"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVG1"
FT                   /protein_id="ADD54734.1"
FT                   /translation="MTHIVRFIGLLLLNASSLRGRRVSGIQH"
FT   gene            88911..89873
FT                   /gene="leuO"
FT                   /locus_tag="G2583_0080"
FT   CDS_pept        88911..89873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuO"
FT                   /locus_tag="G2583_0080"
FT                   /product="leucine transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54735"
FT                   /db_xref="GOA:D3QVG2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVG2"
FT                   /protein_id="ADD54735.1"
FT                   /translation="MTVELSMPEIQTDHPETAEFSKPQLRMVDLNLLTVFDAVMQEQNI
FT                   TRAAHVLGMSQPAVSNAVARLKVMFNDELFVRYGRGIQPTARAFQLFGSVRQALQLVQN
FT                   ELPGSGFEPASSERVFHLCVCSPLDSILTSQIYNHIEQIAPNIHVMFKSSLNQNTEHQL
FT                   RYQETEFVISYEDFHRPEFTSVPLFKDEMVLVASKNHPTIKGPLLKHDVYNEQHAAVSL
FT                   DRFASFSQPWYDTVDKQASIAYQGMAMMSVLSVVSQTHLVAIAPRWLAEEFAESLELQV
FT                   LPLPLKLNSRTCYLSWHEAAGRDKGHQWMEEQLVSICKR"
FT   gene            90191..91915
FT                   /gene="ilvI"
FT                   /locus_tag="G2583_0081"
FT   CDS_pept        90191..91915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="G2583_0081"
FT                   /product="Acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54736"
FT                   /db_xref="GOA:D3QVG3"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVG3"
FT                   /protein_id="ADD54736.1"
FT                   /translation="MEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIGH
FT                   VLVRHEQAAVHMADGLARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVA
FT                   TSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPK
FT                   DILNPANKLPYVWPESVSMRSYNPTTTGHKGQIKRALQTLVAAKKPVVYVGGGAITAGC
FT                   HQQLKETVEALNLPVVSSLMGLGAFPATHRQALGMLGMHGTYEANMTMHNADVIFAVGV
FT                   RFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVTADIPIVGDARQVLEQMLELLSQESA
FT                   HQPLDEIRDWWQQIEQWRARQCLKYDTHSEKIKPQAVIETLWRLTKGGAYVTSDVGQHQ
FT                   MFAALYYPFDKPRRWINSGGLGTMGFGLPAALGVKMALPEETVVCVTGDGSIQMNIQEL
FT                   STALQYELPVLVVNLNNRYLGMVKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGIQ
FT                   ISHPQELESKLSEALEQVRNNRLVFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT"
FT   gene            91888..92409
FT                   /gene="ilvH"
FT                   /locus_tag="G2583_0082"
FT   CDS_pept        91888..92409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="G2583_0082"
FT                   /product="Acetolactate synthase III, valine sensitive,
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54737"
FT                   /db_xref="GOA:D3QVG4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVG4"
FT                   /protein_id="ADD54737.1"
FT                   /translation="MVKQNGENLIMRRILSVLLENESGALSRVIGLFSQRGYNIESLTV
FT                   APTDDPTLSRMTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQAS
FT                   GYGRDEVKRNTEIFRGQIIDVTPSLYTVQLAGTSDKLDAFLASIRDVAKIVEVARSGVV
FT                   GLSRGDKIMR"
FT   gene            92421..92507
FT                   /gene="fruL"
FT                   /locus_tag="G2583_0083"
FT   CDS_pept        92421..92507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruL"
FT                   /locus_tag="G2583_0083"
FT                   /product="fruR leader peptide"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54738"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVG5"
FT                   /protein_id="ADD54738.1"
FT                   /translation="MRNLQPNMSRWAFFAKSVGTWNKSSCRS"
FT   gene            92589..93593
FT                   /gene="fruR"
FT                   /locus_tag="G2583_0084"
FT   CDS_pept        92589..93593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="G2583_0084"
FT                   /product="Fructose repressor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54739"
FT                   /db_xref="GOA:D3QVG6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012781"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVG6"
FT                   /protein_id="ADD54739.1"
FT                   /translation="MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREH
FT                   NYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPD
FT                   NEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGAD
FT                   QDDAEMLAEELRKFPAETVLYLGALPELSVSFLREQGFRTAWKDDPREVHFLYANSYER
FT                   EAAAQLFEKWLETHPMPQALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGDNELLDF
FT                   LQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLTRIKRNLYRRGVLSRS"
FT   gene            94195..94653
FT                   /gene="mraZ"
FT                   /locus_tag="G2583_0085"
FT   CDS_pept        94195..94653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="G2583_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54740"
FT                   /db_xref="GOA:D3QVG7"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVG7"
FT                   /protein_id="ADD54740.1"
FT                   /translation="MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIHHPCL
FT                   LLYPLPEWEIIEQKLSRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGL
FT                   TKEVMLVGQFNKFELWDETTWHQQVKEDIDAEQLATGDLSERLQDLSL"
FT   gene            94655..95596
FT                   /gene="mraW"
FT                   /locus_tag="G2583_0086"
FT   CDS_pept        94655..95596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="G2583_0086"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferase mraW"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54741"
FT                   /db_xref="GOA:D3QVG8"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVG8"
FT                   /protein_id="ADD54741.1"
FT                   /translation="MMENYKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQL
FT                   GEEGRLLAIDRDPQAIAVAKTIDDPRFSIIHGPFSALGEYVAERDLIGKIDGILLDLGV
FT                   SSPQLDDAERGFSFMRDGPLDMRMDPTRGQSAAEWLQTAEEADIAWVLKTYGEERFAKR
FT                   IARAIVERNREQPMTRTKELAEVVAAATPVKDKFKHPATRTFQAVRIWVNSELEEIEQA
FT                   LKSSLNVLAPGGRLSIISFHSLEDRIVKRFMRENSRGPQVPAGLPMTEEQLKKLGGRQL
FT                   RALGKLMPGEEEVAENPRARSSVLRIAERTNA"
FT   gene            95593..95958
FT                   /gene="ftsL"
FT                   /locus_tag="G2583_0087"
FT   CDS_pept        95593..95958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="G2583_0087"
FT                   /product="Cell division protein ftsL"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54742"
FT                   /db_xref="GOA:D3QVG9"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVG9"
FT                   /protein_id="ADD54742.1"
FT                   /translation="MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
FT   gene            95974..97740
FT                   /gene="ftsI"
FT                   /locus_tag="G2583_0088"
FT   CDS_pept        95974..97740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="G2583_0088"
FT                   /product="Peptidoglycan synthetase ftsI precursor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54743"
FT                   /db_xref="GOA:D3QVH0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVH0"
FT                   /protein_id="ADD54743.1"
FT                   /translation="MKAAAKTQKPKRQEEHANFISWRFALLCGCILLALAFLLGRVAWL
FT                   QVISPDMLVKEGDMRSLRVQQVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGI
FT                   SVGDRWKALANALNIPLDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLRE
FT                   ESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDIS
FT                   STDSQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSY
FT                   NPNNLSGTPKEAMRNRTITDVFEPGSTVKPMVVMTALQRGVVRENSVLNTIPYRINGHE
FT                   IKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSG
FT                   LYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERI
FT                   FPESIVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAG
FT                   VAPASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALTTGDKNEF
FT                   VINQGEGTGGRS"
FT   gene            97727..99214
FT                   /gene="murE"
FT                   /locus_tag="G2583_0089"
FT   CDS_pept        97727..99214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="G2583_0089"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54744"
FT                   /db_xref="GOA:D3QVH1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVH1"
FT                   /protein_id="ADD54744.1"
FT                   /translation="MADRNLRDLLAPWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQ
FT                   ADGRRYIPQAIAQGVAAIIAEAKGEATDGEIREMHGVPVIYLSQLNERLSALAGRFYHE
FT                   PSDNLRLVGVTGTNGKTTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAV
FT                   DVQHELAGLVDQDATFCAMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMEHYE
FT                   AAKWLLYSEHHCGQAIINADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKATEVNY
FT                   HDSGATIRFSSSWGDGEIESHLMGAFNVSNLLLALATLLALGYPLADLLKTAARLQPVC
FT                   GRMEVFTAPGKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMG
FT                   AIAEEFADVAVVTDDNPRTEEPRAIINDILAGMLDAGHAKVMEGRAEAVTCAVMQAKEN
FT                   DVVLVAGKGHEDYQIVGNQRLDYSDRVTVARLLGVIA"
FT   gene            99211..100569
FT                   /gene="murF"
FT                   /locus_tag="G2583_0090"
FT   CDS_pept        99211..100569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="G2583_0090"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54745"
FT                   /db_xref="GOA:D3QVH2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVH2"
FT                   /protein_id="ADD54745.1"
FT                   /translation="MISVTLSQLTDILNGELQGADITLDAVTTDTRKLTPGCLFVALKG
FT                   ERFDAHDFADQAKAGGAGALLVSRPLDIDLPQLIVKDTRLAFGELAAWVRQQVPARVVA
FT                   LTGSSGKTSVKEMTAAILSQCGNTLYTAGNLNNDIGVPMTLLRLTPEYDYAVIELGANH
FT                   QGEIVWTVSLTRPEAALVNNLAAAHLEGFGSLAGVAKAKGEIFSGLPENGIAIMNADNN
FT                   DWLNWQSVIGSRKVWRFSPNAANSDFTATNIHVTSHGTEFTLQTPTGSVDVLLPLPGRH
FT                   NIANALAAAALSMSVGATLDAIKAGLANLKAVPGRLFPIQLAENQLLLDDSYNANVGSM
FT                   TAAVQVLAEMPGYRVLVVGDMAELGAESEACHVQVGEAAKAAGIDRVLSVGKQSHAIST
FT                   ASGVGEHFAEKTALITRLKSLIAEQQVITILVKGSRSAAMEEVVRALQENGTC"
FT   gene            100563..101645
FT                   /gene="mraY"
FT                   /locus_tag="G2583_0091"
FT   CDS_pept        100563..101645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="G2583_0091"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54746"
FT                   /db_xref="GOA:D3QVH3"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVH3"
FT                   /protein_id="ADD54746.1"
FT                   /translation="MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMI
FT                   AHLQKLSFGQVVRNDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVV
FT                   LVGYGVIGFVDDYRKVVRKDTKGLIARWKYFWMSVIALGVAFALYLVGKDTPATQLVVP
FT                   FFKDVMPQLGLFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNM
FT                   NFASYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIA
FT                   VLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISLMLVLIGLATLKVR"
FT   gene            101648..102964
FT                   /gene="murD"
FT                   /locus_tag="G2583_0092"
FT   CDS_pept        101648..102964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="G2583_0092"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54747"
FT                   /db_xref="GOA:D3QVH4"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVH4"
FT                   /protein_id="ADD54747.1"
FT                   /translation="MADYQGKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRMTPPGLD
FT                   KLPEAVERHTGSLNDEWLMAADLIVASPGIALAHPSLSAAADAGIEIVGDIELFCREAQ
FT                   APIVAITGSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALMLLDDECELYVLELSSFQ
FT                   LETTSSLQAVAATILNVTEDHMDRYPFGLQQYRAAKLRIYENAKVCVVNADDALTMPIR
FT                   GADERCVSFGVNMGDYHLNHQQGETWLRVKGEKVLNVKEMKLSGQHNYTNALAALALAD
FT                   AAGLPRASSLKALTTFTGLPHRFEVVLEHNGVRWINDSKATNVGSTEAALNGLHVDGTL
FT                   HLLLGGDGKSADFSPLARYLNGDNVRLYCFGRDGVQLAALRPEVAEQTETMEQAMRLLA
FT                   PRVQPGDMVLLSPACASLDQFKNFEQRGNEFARLAKELG"
FT   gene            102964..104208
FT                   /gene="ftsW"
FT                   /locus_tag="G2583_0093"
FT   CDS_pept        102964..104208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="G2583_0093"
FT                   /product="Cell division protein ftsW"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54748"
FT                   /db_xref="GOA:D3QVH5"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVH5"
FT                   /protein_id="ADD54748.1"
FT                   /translation="MRLSLPRLKMPRLPGFSILVWISTALKGWVMGSREKDTDSLIMYD
FT                   RTLLWLTFGLAAIGFIMVTSASMPIGQRLTNDPFFFAKRDGVYLILAFILAIITLRLPM
FT                   EFWQRYSATMLLGSIILLMIVLVVGSSVKGASRWIDLGLLRIQPAELTKLSLFCYIANY
FT                   LVRKGDEVRNNLRGFLKPMGVILVLAVLLLAQPDLGTVVVLFVTTLAMLFLAGAKLWQF
FT                   IAIIGMGISAVVLLILAEPYRIRRVTAFWNPWEDPFGSGYQLTQSLMAFGRGELWGQGL
FT                   GNSVQKLEYLPEAHTDFIFAIIGEELGYVGVVLALLMVFFVAFRAMSIGRKALEIDHRF
FT                   SGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMMLLRIDY
FT                   ETRLEKAQAFVRGSR"
FT   gene            104205..105272
FT                   /gene="murG"
FT                   /locus_tag="G2583_0094"
FT   CDS_pept        104205..105272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="G2583_0094"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54749"
FT                   /db_xref="GOA:D3QVH6"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVH6"
FT                   /protein_id="ADD54749.1"
FT                   /translation="MSGQGKRLMVMAGGTGGHVFPGLAVAHHLMAQGWQVRWLGTADRM
FT                   EADLVPKHGIEIDFIRISGLRGKGIKALIAAPLRIFNAWRQARAIMKAYKPDVVLGMGG
FT                   YVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLAKIATKVMQAFPGAFPNAEVVGNPVR
FT                   TDVLALPLPQQRLAGREGPVRVLVVGGSQGARILNQTMPQVAAKLGDSVTIWHQSGKGS
FT                   QQSVEQAYAEAGQPQHKVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPALFVPF
FT                   QHKDRQQYWNALPLEKAGAAKIIEQPQLSVDAVANTLAGWSRETLLTMAERARAASIPD
FT                   ATERVANEVSRAARA"
FT   gene            105326..106801
FT                   /gene="murC"
FT                   /locus_tag="G2583_0095"
FT   CDS_pept        105326..106801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="G2583_0095"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54750"
FT                   /db_xref="GOA:D3QVH7"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVH7"
FT                   /protein_id="ADD54750.1"
FT                   /translation="MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQ
FT                   ISGSDLAPNPVTQQLMNLGATIYFNHRPENVRDASVVVVSSAISADNPEIVAAHEARIP
FT                   VIRRAEMLAELMRFRHGIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHA
FT                   RLGHGRYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYQGDFENLKQTFINFLHNLP
FT                   FYGRAVMCVDDPVIRELLPRVGRQTTTYGFSEDADVRVEDYQQIGPQGHFTLLRQDKEP
FT                   MRVTLNAPGRHNALNAAAAVAVATEEGIDDEAILRALESFQGTGRRFDFLGEFPLEPVN
FT                   GKSGTAMLVDDYGHHPTEVDATIKAARAGWPDKNLVMLFQPHRFTRTRDLYDDFANVLT
FT                   QVDTLLMLEVYPAGEAPIPGADSRSLCRTIRGRGKIDPILVPDPAQVAEMLAPVLTGND
FT                   LILVQGAGNIGKIARSLAEIKLKPQTPEEEQHD"
FT   gene            106794..107714
FT                   /gene="ddlB"
FT                   /locus_tag="G2583_0096"
FT   CDS_pept        106794..107714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlB"
FT                   /locus_tag="G2583_0096"
FT                   /product="D-alanine--D-alanine ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54751"
FT                   /db_xref="GOA:D3QVH8"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVH8"
FT                   /protein_id="ADD54751.1"
FT                   /translation="MTDKIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEV
FT                   DVTQLKSMGFQKVFIALHGRGGEDGTLQGMLELMGLPYTGSGVMASALSMDKLRSKLLW
FT                   QGAGLPVAPWVALTRVEFEKGLSDKQLAEISALGLPVIVKPSREGSSVGMSKVVAENAL
FT                   QDALRLAFQHDEEVLIEKWLSGPEFTVAILGEEILPSIRIQPSGTFYDYEAKYLSDETQ
FT                   YFCPAGLEASQEANLQALVLKAWTTLGCKGWGRIDVMLDSDGQFYLLEANTSPGMTSHS
FT                   LVPMAARQAGMSFSQLVVRILELAD"
FT   gene            107716..108546
FT                   /gene="ftsQ"
FT                   /locus_tag="G2583_0097"
FT   CDS_pept        107716..108546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="G2583_0097"
FT                   /product="Cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54752"
FT                   /db_xref="GOA:D3QVH9"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVH9"
FT                   /protein_id="ADD54752.1"
FT                   /translation="MSQAALNTRNSEEEVSSRRNNGTRLAGILFLLTVLTTVLVSGWVV
FT                   LGWMEDAQRLPLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLP
FT                   WIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPDRTSKQVLPMLYGP
FT                   EGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLAR
FT                   FVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQ"
FT   gene            108543..109805
FT                   /gene="ftsA"
FT                   /locus_tag="G2583_0098"
FT   CDS_pept        108543..109805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="G2583_0098"
FT                   /product="Cell division protein ftsA"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54753"
FT                   /db_xref="GOA:D3QVI0"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVI0"
FT                   /protein_id="ADD54753.1"
FT                   /translation="MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRG
FT                   MDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV
FT                   TQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITC
FT                   HNDMAKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYT
FT                   GGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG
FT                   GRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQ
FT                   IEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK
FT                   RVTASVGSWIKRLNSWLRKEF"
FT   gene            109866..111017
FT                   /gene="ftsZ"
FT                   /locus_tag="G2583_0099"
FT   CDS_pept        109866..111017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="G2583_0099"
FT                   /product="Cell division protein ftsZ"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54754"
FT                   /db_xref="GOA:D3QVI1"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVI1"
FT                   /protein_id="ADD54754.1"
FT                   /translation="MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTD
FT                   AQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNT
FT                   IRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQ
FT                   QHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD"
FT   gene            111118..112035
FT                   /gene="lpxC"
FT                   /locus_tag="G2583_0100"
FT   CDS_pept        111118..112035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="G2583_0100"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54755"
FT                   /db_xref="GOA:D3QVI2"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVI2"
FT                   /protein_id="ADD54755.1"
FT                   /translation="MIKQRTLKRIVQATGVGLHTGKKVTLTLRPAPANTGVIYRRTDLN
FT                   PPVDFPADAKSVRDTMLCTCLVNEHDVRISTVEHLNAALAGLGIDNIVIEVNAPEIPIM
FT                   DGSAAPFVYLLLDAGIDELNCAKKFVRIKETIRVEDGDKWAEFKPYNGFSLDFTIDFNH
FT                   PAIDSSNQRYAMNFSADAFMRQISRARTFGFMRDIEYLQSRGLCLGGSFDCAIVVDDYR
FT                   VLNEDGLRFEDEFVRHKMLDAIGDLFMCGHNIIGAFTAYKSGHALNNKLLQAVLAKQEA
FT                   WEYVTFQDDAELPLAFKAPSAVLA"
FT   gene            112094..112777
FT                   /gene="secM"
FT                   /locus_tag="G2583_0101"
FT   CDS_pept        112094..112777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secM"
FT                   /locus_tag="G2583_0101"
FT                   /product="Secretion monitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54756"
FT                   /db_xref="GOA:D3QVI3"
FT                   /db_xref="InterPro:IPR009502"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVI3"
FT                   /protein_id="ADD54756.1"
FT                   /translation="MNQSFFLNFIRAIKNGANAVFLSTFTDNLSSFVLWTSGFNDKICA
FT                   LNTFEYDRDGNNVSGILTRWRQFGKRYFWPHLLLGMVAASLGLPALSNAAEPNAPAKAT
FT                   TRNHEPSAKVNFGQLALLEANTRRPNSNYSVDYWHQHAIRTVIRHLSFAMAPQTLPVAE
FT                   ESLPLQAQHLALLDTLSALLTQEGTPSEKGYRIDYAHFTPQAKFSTPVWISQAQGIRAG
FT                   PQRLS"
FT   gene            112839..115544
FT                   /gene="secA"
FT                   /locus_tag="G2583_0102"
FT   CDS_pept        112839..115544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="G2583_0102"
FT                   /product="preprotein translocase subunit SecA"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54757"
FT                   /db_xref="GOA:D3QVI4"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVI4"
FT                   /protein_id="ADD54757.1"
FT                   /translation="MLIKLLTKVFGSRNDRTLRRMRKVVNIINAMEPEMEKLSDEELKG
FT                   KTAEFRARLEKGEVLENLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNERCIAEMRT
FT                   GEGKTLTATLPAYLNALTGKGVHVVTVNDYLAQRDAENNRPLFEFLGLTVGINLPGMPA
FT                   PAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTP
FT                   LIISGPAEDSSEMYKRVNKIIPHLIRQEKEDSETFQGEGHFSVDEKSRQVNLTERGLVL
FT                   IEELLVKEGIMDEGESLYSPANIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHT
FT                   GRTMQGRRWSDGLHQAVEAKEGVQIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAF
FT                   EFSSIYKLDTVVVPTNRPMIRKDLPDLVYMTEAEKIQAIIEDIKERTAKGQPVLVGTIS
FT                   IEKSELVSNELTKAGIKHNVLNAKFHANEAAIVAQAGYPAAVTIATNMAGRGTDIVLGG
FT                   SWQAEVAALENPTAEQIEKIKADWQVRHDAVLAAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDAGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVE
FT                   SRNFDIRKQLLEYDDVANDQRRAIYSQRNELLDVSDVSETINSIREDVFKATIDAYIPP
FT                   QSLEEMWDIPGLQERLKNDFDLDLPIAEWLDKEPELHEETLRERILAQSIEVYQRKEEV
FT                   VGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFSMFA
FT                   AMLESLKYEVISTLSKVQVRMPEEVEELEQQRRMEAERLAQMQQLSHQDDDSAAAAALA
FT                   AQTGERKVGRNDPCPCGSGKKYKQCHGRLQ"
FT   gene            115604..116002
FT                   /gene="mutT"
FT                   /locus_tag="G2583_0103"
FT   CDS_pept        115604..116002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="G2583_0103"
FT                   /product="7,8-dihydro-8-oxoguanine-triphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54758"
FT                   /db_xref="GOA:D3QVI5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVI5"
FT                   /protein_id="ADD54758.1"
FT                   /translation="MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGET
FT                   PEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVESWEGEPWGKEGQPGKW
FT                   MSLVGLNADDFPPANEPVIAKLKRVYVG"
FT   gene            complement(116008..116142)
FT                   /locus_tag="G2583_0104"
FT   CDS_pept        complement(116008..116142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54759"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVI6"
FT                   /protein_id="ADD54759.1"
FT                   /translation="MAIFPKAMTGAKSQSSDICLMPHVGLIRRGQRRIRHLVQMSDAA"
FT   gene            complement(116093..116290)
FT                   /gene="yacG"
FT                   /locus_tag="G2583_0105"
FT   CDS_pept        complement(116093..116290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacG"
FT                   /locus_tag="G2583_0105"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54760"
FT                   /db_xref="GOA:D3QVI7"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVI7"
FT                   /protein_id="ADD54760.1"
FT                   /translation="MSETITVNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEK
FT                   RIPSSGDLSESDDWSEEPKQ"
FT   gene            complement(116300..117043)
FT                   /gene="yacF"
FT                   /locus_tag="G2583_0106"
FT   CDS_pept        complement(116300..117043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacF"
FT                   /locus_tag="G2583_0106"
FT                   /product="UPF0289 protein yacF"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54761"
FT                   /db_xref="GOA:D3QVI8"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVI8"
FT                   /protein_id="ADD54761.1"
FT                   /translation="MQTQVLFEHPLNEKMRTWLRIEFLIQQLTVNLPIVDHAGALHFFR
FT                   NVSELLDVFERGEVRTELLKELDRQQRKLQTWIGVPGVDQSRIEALIQQLKAAGSVLIS
FT                   APRIGQFLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLPQAQRDCQVETWIASLNP
FT                   LTQALTMVLDLIRQSAPFRKQTSLNGFYQDNGGDADLLRLNLSLDSQLYPQISGHKSRF
FT                   AIRFMPLDTENGQVPERLDFELACC"
FT   gene            complement(117043..117663)
FT                   /gene="coaE"
FT                   /locus_tag="G2583_0107"
FT   CDS_pept        complement(117043..117663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="G2583_0107"
FT                   /product="Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54762"
FT                   /db_xref="GOA:D3QVI9"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVI9"
FT                   /protein_id="ADD54762.1"
FT                   /translation="MRYIVALTGGIGSGKSTVANAFADLGINVIDADIIARQVVEPGAP
FT                   ALHAIADHFGANMIAADGTLQRRALRERIFANPEEKNWLNALLHPLIQQETQHQIQQAT
FT                   SPYVLWVVPLLVENSLYKKANRVLVVDVSPETQLKRTMQRDDVTREHVEQILAAQATRE
FT                   ARLAVADDVIDNNGAPDAIASDVARLHAHYLQLASQFVSQEKP"
FT   gene            117888..118931
FT                   /gene="guaC"
FT                   /locus_tag="G2583_0108"
FT   CDS_pept        117888..118931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaC"
FT                   /locus_tag="G2583_0108"
FT                   /product="GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54763"
FT                   /db_xref="GOA:D3QVJ0"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVJ0"
FT                   /protein_id="ADD54763.1"
FT                   /translation="MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQFTFKHSGQSWS
FT                   GVPIIAANMDTVGTFSMASALASFDILTAVHKHYSVEEWQAFINNSSADVLKHVMVSTG
FT                   TSDADFEKTKQILDLNPALNFVCIDVANGYSEHFVQFVAKAREAWPTKTICAGNVVTGE
FT                   MCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGGMIISDGGC
FT                   TTPGDVAKAFGGGADFVMLGGMLAGHEESGGRIVEENGEKFMLFYGMSSESAMKRHVGG
FT                   VAEYRAAEGKTVKLPLRGPVENTARDILGGLRSACTYVGASRLKELTKRTTFIRVQEQE
FT                   NRIFNNL"
FT   gene            complement(118851..118958)
FT                   /locus_tag="G2583_0109"
FT   CDS_pept        complement(118851..118958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54764"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVJ1"
FT                   /protein_id="ADD54764.1"
FT                   /translation="MLLHTSVGRLQVVEDAVFLFLHTDKCGALGQFFQA"
FT   gene            complement(118966..120168)
FT                   /gene="hofC"
FT                   /locus_tag="G2583_0110"
FT   CDS_pept        complement(118966..120168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofC"
FT                   /locus_tag="G2583_0110"
FT                   /product="Type IV pilus assembly protein PilC"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54765"
FT                   /db_xref="GOA:D3QVJ2"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVJ2"
FT                   /protein_id="ADD54765.1"
FT                   /translation="MASKQLWRWHGITGDGNAQDGMLWAESRTLLLMALQQQMVTPLSL
FT                   KRIAINSAQWRGDKSAEVIHQLATLLKAGLTLSEGLALLAEQHPSKQWQALLQSLAHDL
FT                   EQGIAFSNALLPWSEVFPPLYQAMIRTGELTGKLDECCFELARQQRAQRQLTDKVKSAL
FT                   RYPIIILAMAIMVVVAMLHFVLPEFAAIYKTFNTPLPALTQGIMTLADFSGEWGWLLVL
FT                   FGIMLTIANKLLMRRPTWLIARQKLLLRIPIMGSLMRGQKLTQIFTILALTQSAGITFL
FT                   QGVESVRETMRCPYWVQLLTQIQHDISNGHPIWLALKNAGEFSPLCLQLVRTGEASGSL
FT                   DLMLDNIAHHHRDNTMALADNLAALLEPALLIITGGIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
FT   gene            complement(120158..121543)
FT                   /pseudo
FT                   /gene="hofB"
FT                   /locus_tag="G2583_0111"
FT                   /note="GspE family protein HofB"
FT   gene            complement(121553..121993)
FT                   /gene="ppdD"
FT                   /locus_tag="G2583_0112"
FT   CDS_pept        complement(121553..121993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdD"
FT                   /locus_tag="G2583_0112"
FT                   /product="Prelipin peptidase dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54766"
FT                   /db_xref="GOA:D3QVJ3"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVJ3"
FT                   /protein_id="ADD54766.1"
FT                   /translation="MDKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQT
FT                   FVPYRTAVELCALEHGGLDTCDGGSNGIPSPTTTRYVSAMSVAKGVVSLTGQESLNGLS
FT                   VVMTPGWDNANGVTGWARNCNIQSDSALQQACEDVFRFDDAN"
FT   gene            complement(122196..123089)
FT                   /gene="nadC"
FT                   /locus_tag="G2583_0113"
FT   CDS_pept        complement(122196..123089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="G2583_0113"
FT                   /product="Nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54767"
FT                   /db_xref="GOA:D3QVJ4"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVJ4"
FT                   /protein_id="ADD54767.1"
FT                   /translation="MPPRRYNPDTRRDELLERINLDIPGAVAQALREDLGGTVDANNDI
FT                   TAKLLPENSRSHATVITRENGVFCGKRWVEEVFIQLAGDDVTIIWHVDDGDVINANQPL
FT                   FELEGPSRVLLTGERTALNFVQTLSGVASKVRHYVELLEGTNTQLLDTRKTLPGLRSAL
FT                   KYAVLCGGGANHRLGLSDAFLIKENHIIASGSVRQAVEKASWLHPDAPVEVEVENLEEL
FT                   DEALKAGADIIMLDNFETEQMREAVKRTNGKALLEVSGNVTDKTLREFAETGVDFISVG
FT                   ALTKHVQALDLSMRFR"
FT   gene            123177..123728
FT                   /gene="ampD"
FT                   /locus_tag="G2583_0114"
FT   CDS_pept        123177..123728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="G2583_0114"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54768"
FT                   /db_xref="GOA:D3QVJ5"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVJ5"
FT                   /protein_id="ADD54768.1"
FT                   /translation="MLLEQGWLVGARRVPSPHYDCRPDDETPTLLVVHNISLPPGEFGG
FT                   PWIDALFTGTIDPQAHPFFAEIAHLRVSAHCLIRRDGEIVQYVPFDKRAWHAGVSQYQG
FT                   RERCNDFSIGIELEGTDTLAYTDAQYQQLAAVTRALIDCYPDIANNMTGHCDIAPDRKT
FT                   DPGPAFDWARFRALVSKETT"
FT   gene            123725..124579
FT                   /gene="ampE"
FT                   /locus_tag="G2583_0115"
FT   CDS_pept        123725..124579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="G2583_0115"
FT                   /product="regulatory protein AmpE"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54769"
FT                   /db_xref="GOA:D3QVJ6"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVJ6"
FT                   /protein_id="ADD54769.1"
FT                   /translation="MTLFTTLLVLIFERLFKLGEHWQLDHRLEAFFRRVKHFSLGRTLG
FT                   MTIIAMGVTFLLLRALQGVLFNVPTLLVWLLIGLLCIGAGKVRLHYHAYLTAASRNDSH
FT                   ARATMAGELTMIHGVPAGCDEREYLRELQNALLWINFRFHLAPLFWLIVGGTWGPVTLM
FT                   GYAFLRAWQYWLARYQTPHHRLQSGIDAVLHVLDWVPVRLAGVVYALIGHGEKALPAWF
FT                   ASLGDFRTSQYQVLTRLAQFSLAREPHVDKVETPKAAVSMAKKTSFVVVVVIALLTIYG
FT                   ALV"
FT   gene            complement(124622..125995)
FT                   /gene="aroP"
FT                   /locus_tag="G2583_0116"
FT   CDS_pept        complement(124622..125995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="G2583_0116"
FT                   /product="Aromatic amino acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54770"
FT                   /db_xref="GOA:D3QVJ7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVJ7"
FT                   /protein_id="ADD54770.1"
FT                   /translation="MMEGQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAG
FT                   PGIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGSFAGFASGWNYWVLYV
FT                   LVAMAELTAVGKYIQFWYPEIPTWVSAAVFFVVINAINLTNVKVFGEMEFWFAIIKVIA
FT                   VVAMIIFGGWLLFSGNGGPQASVSNLWDQGGFLPHGFTGLVMMMAIIMFSFGGLELVGI
FT                   TAAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLMPWTRVTADTSPFVLIFHELGD
FT                   TFVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVS
FT                   ALVTALCVLINYLAPESAFGLLMALVVSALVINWAMISLAHMKFRRAKQEQGVVTRFPA
FT                   LLYPLGNWICLLFMAVVLVIMLMTPGMAISVYLIPVWLVVLGIGYLFKEKTAKAVKAH"
FT   gene            126536..127300
FT                   /gene="pdhR"
FT                   /locus_tag="G2583_0117"
FT   CDS_pept        126536..127300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhR"
FT                   /locus_tag="G2583_0117"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54771"
FT                   /db_xref="GOA:D3QVJ8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVJ8"
FT                   /protein_id="ADD54771.1"
FT                   /translation="MAYSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFD
FT                   VSRPSLREAIQRLEAKGLLLRRQGGGTFVQSSLWQSFSDPLVELLSDHPESQYDLLETR
FT                   HALEGIAAYYAALRSTDEDKERIRELHHAIELAQQSGDLDAESNAVLQYQIAVTEAAHN
FT                   VVLLHLLRCMEPMLAQNVRQNFELLYSRREMLPLVSSHRTRIFEAIMAGKPEEAREASH
FT                   RHLAFIEEILLDRSREESRRERSLRRLEQRKN"
FT   gene            127461..130124
FT                   /gene="aceE"
FT                   /locus_tag="G2583_0118"
FT   CDS_pept        127461..130124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="G2583_0118"
FT                   /product="Pyruvate dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54772"
FT                   /db_xref="GOA:D3QVJ9"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVJ9"
FT                   /protein_id="ADD54772.1"
FT                   /translation="MSERFPNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLAEAR
FT                   KGGVNVAAGTGISNYINTIPVEEQPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLEL
FT                   GGHMASFQSSATIYDVCFNHFFRARNEQDGGDLVYFQGHISPGVYARAFLEGRLTQEQL
FT                   DNFRQEVHGNGLSSYPHPKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSK
FT                   QTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIINELEG
FT                   IFEGAGWNVIKVMWGSRWDELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFG
FT                   KYPETAALVADWTDEQIWALNRGGHDPKKIYAAFKKAQETKGKATVILAHTIKGYGMGD
FT                   AAEGKNIAHQVKKMNMDGVRHIRDRFNVPVSDADIEKLPYITFPEGSEEHTYLHAQRQK
FT                   LHGYLPSRQPNFTEKLELPSLQDFGALLEEQSKEISTTIAFVRALNVMLKNKSIKDRLV
FT                   PIIADEARTFGMEGLFRQIGIYSPNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAG
FT                   CSWLAAATSYSTNNLPMIPFYIYYSMFGFQRIGDLCWAAGDQQARGFLIGGTSGRTTLN
FT                   GEGLQHEDGHSHIQSLTIPNCISYDPAYAYEVAVIMHDGLERMYGEKQENVYYYITTLN
FT                   ENYHMPAMPEGAEEGIRKGIYKLETIEGSKGKVQLLGSGSILRHVREAAEILAKDYGVG
FT                   SDVYSVTSFTELARDGQDCERWNMLHPLETPRVPYIAQVMNDAPAVASTDYMKLFAEQV
FT                   RTYVPADDYRVLGTDGFGRSDSRENLRHHFEVDASYVVVAALGELAKRGEIDKKVVADA
FT                   IAKFNIDADKVNPRLA"
FT   gene            130139..132031
FT                   /gene="aceF"
FT                   /locus_tag="G2583_0119"
FT   CDS_pept        130139..132031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="G2583_0119"
FT                   /product="Dihydrolipoyllysine-residue acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54773"
FT                   /db_xref="GOA:D3QVK0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVK0"
FT                   /protein_id="ADD54773.1"
FT                   /translation="MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASME
FT                   VPSPQAGIVKEIKVSVGDKTQTGALIMIFDSADGAADAAPAQAEEKKEAAPAAAPAAAA
FT                   AKDVNVPDIGSDEVEVTEILVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVN
FT                   TGDKVSTGSLIMVFEVAGEAGAAAPAAKQEAAPAAAPAPAAGVKEVNVPDIGGDEVEVT
FT                   EVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVE
FT                   GAAPAAAPAKQEAAAPAPAAKAEAPAAAPAAKAEGKSEFAENDAYVHATPLIRRLAREF
FT                   GVNLAKVKGTGRKGRILREDVQAYVKEAIKRAEAAPAATGGGIPGMLPWPKVDFSKFGE
FT                   IEEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITELEAFRKQQNEEAAKRKLDVKIT
FT                   PVVFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKK
FT                   GIIELSRELMTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVS
FT                   KSAMEPVWNGKEFVPRLMLPISLSFDHRVIDGADGARFITIINNTLSDIRRLVM"
FT   gene            132176..133663
FT                   /gene="lpd"
FT                   /locus_tag="G2583_0120"
FT   CDS_pept        132176..133663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpd"
FT                   /locus_tag="G2583_0120"
FT                   /product="Pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dihydrolipoamide dehydrogenase (E3) component, and related
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54774"
FT                   /db_xref="GOA:D3QVK1"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVK1"
FT                   /protein_id="ADD54774.1"
FT                   /translation="MDNGRHKKNVRPAGDKYIEVMMSTEIKTQVVVLGAGPAGYSAAFR
FT                   CADLGLETVIVERYNTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPKTDI
FT                   DKIRTWKEKVINQLTGGLAGMAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAI
FT                   IAAGSRPIQLPFIPHEDPRIWDSTDALELKEVPERLLVMGGGIIGLEMGTVYHALGSQI
FT                   DVVEMFDQVIPAADKDIVKVFTKRISKKFNLMLETKVTAVEAKEDGIYVTMEGKKAPAE
FT                   PQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPM
FT                   LAHKGVHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETAT
FT                   FPWAASGRAIASDCADGMTKLIFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAED
FT                   IALTIHAHPTLHESVGLAAEVFEGSITDLPNPKAKKK"
FT   gene            complement(133735..135588)
FT                   /gene="yacH"
FT                   /locus_tag="G2583_0121"
FT   CDS_pept        complement(133735..135588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacH"
FT                   /locus_tag="G2583_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54775"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVK2"
FT                   /protein_id="ADD54775.1"
FT                   /translation="MKMTLPFKPHVLALICSAGLCAASAGLYIKSRTVEAPVETQSTQL
FT                   AVSDAAAVTLPATVSAPPVTPAVVKSAFSTAQIDQWVAPVALYPDALLSQVLMASTYPT
FT                   NVAQAVQWSHDNPLKQGDAAIQAVSDQPWDASVKSLVAFPQLMALMGENPQWVQNLGDA
FT                   FLAQPQDVMDSVQRLRQLAQQTGSLKSSTEQKVITTTKKTVPVTQTVTAPVIPSNTVST
FT                   ANPVITEPATTVISIEPGNPDVVYIPNYNPTVVYGNWANTAYPPVYLPPPAGEPFVDSF
FT                   VRGFGYSMGVATTYALFSSIDWDDDDHDHHHHDDDNYHHHDGGHRDGNGWQHNGDNINI
FT                   DVNNFNRITGEHLTDKNMAWRHNPNYRNGVPYHDQDMAKRFHQTDVNGGMSATQLPAPT
FT                   RDSQRQAAASQFQQRTHAAPVITRDTQRQAAAQRFNEAEHYGSYDDFRDFSRRQPLTQQ
FT                   QKDAARQRYQSASPEQRQAVHEKMQTNPQNQQRREAARERIQPASPEQRQAVREKMQTN
FT                   PQIQQRRDAARERIQSASPEQRQVFKEKVQQRPLNQQQRDNARQRVQSASPEQRQVFRE
FT                   KVQESRPQRLNDSNHTARLNNEQRSAVRERLSERGARRLER"
FT   gene            135943..138540
FT                   /gene="acnB"
FT                   /locus_tag="G2583_0122"
FT   CDS_pept        135943..138540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="G2583_0122"
FT                   /product="Aconitate hydratase 2"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54776"
FT                   /db_xref="GOA:D3QVK3"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVK3"
FT                   /protein_id="ADD54776.1"
FT                   /translation="MLEEYRKHVAERAAEGIAPKPLDANQMAALVELLKNPPAGEEEFL
FT                   LDLLTNRVPPGVDEAAYVKAGFLAAVAKGEAKSPLLTPEKAIELLGTMQGGYNIHPLID
FT                   ALDDAKLAPIAAKALSHTLLMFDNFYDVEEKAKAGNEYAKQVMQSWADAEWFLNRPALA
FT                   EKLTVTVFKVTGETNTDDLSPAPDAWSRPDIPLHALAMLKNAREGIEPDQPGVVGPIKQ
FT                   IEALQQKGFPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPHVPNKRGGGLCLGGKIAPI
FT                   FFNTMEDAGALPIEVDVSNLNMGDVIDVYPYKGEVRNHETGELLATFELKTDVLIDEVR
FT                   AGGRIPLIIGRGLTTKAREALGLPHSDVFRQAKDVAESDRGFSLAQKMVGRACGVKGIR
FT                   PGAYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTAAYPKPVDVNTHH
FT                   TLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAF
FT                   AAATGVMPLDMPESVLVRFKGKMQPGITLRDLVHAIPLYAIKQGLLTVEKKGKKNIFSG
FT                   RILEIEGLPDLKVEQAFELTDASAERSAAGCTIKLNKEPIIEYLNSNIVLLKWIIAEGY
FT                   GDRRTLERRIQGMEKWLANPELLEADADAEYAAVIDIDLADIKEPILCAPNDPDDARPL
FT                   SAVQGEKIDEVFIGSCMTNIGHFRAAGKLLDAHKGQLPTRLWVAPPTRMDAAQLTEEGY
FT                   YSVFGKSGARIEIPGCSLCMGNQARVADGATVVSTSTRNFPNRLGTGANVFLASAELAA
FT                   VAALIGKLPTPEEYQTYVAQVDKTAVDTYRYLNFNQLSQYTEKADGVIFQTAV"
FT   gene            138716..139078
FT                   /gene="yacL"
FT                   /locus_tag="G2583_0123"
FT   CDS_pept        138716..139078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="G2583_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54777"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVK4"
FT                   /protein_id="ADD54777.1"
FT                   /translation="MDYEFLRDITGVVKVRMSMGHEVVGHWFNEEVKENLALLDEVEQA
FT                   AHALKGSERSWQRAGHEYTLWMDGEEVMVRANQLEFAGDEMEEGMNYYDEESLSLCGVE
FT                   DFLQVVAAYRNFVQQK"
FT   gene            complement(139116..139910)
FT                   /gene="speD"
FT                   /locus_tag="G2583_0124"
FT   CDS_pept        complement(139116..139910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="G2583_0124"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme
FT                   (AdoMetDC) (SamDC) [Contains: S-adenosylmethionine
FT                   decarboxylase beta chain]"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54778"
FT                   /db_xref="GOA:D3QVK5"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVK5"
FT                   /protein_id="ADD54778.1"
FT                   /translation="MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNA
FT                   NRLTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVDPKLIDKTEHPGPLPET
FT                   VVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDIVTI
FT                   DYRVRGFTRDINGMKHFIDHEINSIQNFMSDDMKALYDMVDVNVYQENIFHTKMLLKEF
FT                   DLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV"
FT   gene            complement(139926..140792)
FT                   /gene="speE"
FT                   /locus_tag="G2583_0125"
FT   CDS_pept        complement(139926..140792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="G2583_0125"
FT                   /product="Spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54779"
FT                   /db_xref="GOA:D3QVK6"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVK6"
FT                   /protein_id="ADD54779.1"
FT                   /translation="MAEKKQWHETLHDQFGQYFAVDNALYHEKTDHQDLIIFENAAFGR
FT                   VMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVESI
FT                   TMVEIDAGVVSFCRQYLPNHNAGSYDDPRFKLVIDDGVNFVNQTSQTFDVIISDCTDPI
FT                   GPGESLFTSAFYEGCKRCLNPGGIFVAQNGVCFLQQEEAIDSHRKLSHYFSDVGFYQAA
FT                   IPTYYGGIMTFAWATDNDALRHLSTEIIQARFLASGLKCRYYNPAVHTAAFALPQYLQD
FT                   ALASQPS"
FT   gene            complement(140898..141416)
FT                   /gene="yacC"
FT                   /locus_tag="G2583_0126"
FT   CDS_pept        complement(140898..141416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacC"
FT                   /locus_tag="G2583_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54781"
FT                   /db_xref="InterPro:IPR019114"
FT                   /db_xref="InterPro:IPR038432"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVK7"
FT                   /protein_id="ADD54781.1"
FT                   /translation="MHSYFLILKQAKQNQTLSIVLPLTGRSSRRHNLIDNNGRRLARSV
FT                   LTFIFFKPLVEAMKTFFRTVLFGSLMAVCANSYALSESEAEDMADLTAVFVFLKNDCGY
FT                   QNLPNGQIRRALVFFAQQNQWDLSNYDTFDMKALGEDSYRDLSGIGIPVAKKCKALARD
FT                   SLSLLAYVK"
FT   gene            141411..142961
FT                   /gene="cueO"
FT                   /locus_tag="G2583_0127"
FT   CDS_pept        141411..142961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueO"
FT                   /locus_tag="G2583_0127"
FT                   /product="Copper oxidase CueO"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54780"
FT                   /db_xref="GOA:D3QVK8"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVK8"
FT                   /protein_id="ADD54780.1"
FT                   /translation="MQRRDFLKYSVALGVASALPLWSRAVFAAERPTLPIPDLLTTDAR
FT                   NRIQLTIGAGQSTFGEKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHG
FT                   LEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIE
FT                   DDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYP
FT                   QHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVNELPVLMGERF
FT                   EVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPAL
FT                   PSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHSQMMGHMGHGNMNHMNHG
FT                   GKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSEN
FT                   GKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV"
FT   gene            complement(143163..145553)
FT                   /gene="gcd"
FT                   /locus_tag="G2583_0128"
FT   CDS_pept        complement(143163..145553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcd"
FT                   /locus_tag="G2583_0128"
FT                   /product="Quinoprotein glucose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54782"
FT                   /db_xref="GOA:D3QVK9"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVK9"
FT                   /protein_id="ADD54782.1"
FT                   /translation="MAINNTGSRRLLVTLTALFAALCGLYLLIGGGWLVAIGGSWYYPI
FT                   AGLVMLGVAWMLWRSKRAALWLYAALLLGTMIWGVWEVGFDFWALTPRSDILVFFGIWL
FT                   ILPFVWRRLVIPASGAVAALVVALLISGSILTWAGFNDPQEINGTLSADATPAEAISPV
FT                   ADQDWPAYGRNQEGQRFSPLKQINADNVHNLKEAWVFRTGDVKQPNDPGEITNEVTPIK
FT                   VGDTLYLCTAHQRLFALDAASGKEKWHYDPELKTNESFQHVTCRGVSYHEAKAETASPE
FT                   VMADCPRRIILPVNDGRLIAINAENGKLCETFANKGVLNLQSNMPDTKPGLYEPTSPPI
FT                   ITDKTIVMAGSVTDNFSTRETSGVIRGFDVNTGELLWAFDPGAKDPNAIPSDEHTFTFN
FT                   SPNSWAPAAYDAKLDLVYLPMGVTTPDIWGGNRTPEQERYASSILALNATTGKLAWSYQ
FT                   TVHHDLWDMDLPAQPTLADITVNGQKVPVIYAPAKTGNIFVLDRRNGELVVPAPEKPVP
FT                   QGAAKGDYVTPTQPFSELSFRPTKDLSGADMWGATMFDQLVCRVMFHQMRYEGIFTPPS
FT                   EQGTLVFPGNLGMFEWGGISVDPNREVAIANPMALPFVSKLIPRGPGNPMEQPKDAKGT
FT                   GTESGIQPQYGVPYGVTLNPFLSPFGLPCKQPAWGYISALDLKTNEVVWKKRIGTPQDS
FT                   MPFPMPVPVPFNMGMPMLGGPISTAGNVLFIAATADNYLRAYNMSNGEKLWQGRLPAGG
FT                   QATPMTYEVNGKQYVVISAGGHGSFGTKMGDYIVAYALPDDVK"
FT   gene            145759..146295
FT                   /gene="hpt"
FT                   /locus_tag="G2583_0129"
FT   CDS_pept        145759..146295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="G2583_0129"
FT                   /product="Hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54783"
FT                   /db_xref="GOA:D3QVL0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVL0"
FT                   /protein_id="ADD54783.1"
FT                   /translation="MKHTVEVMIPEAEIKARIAELGRQITERYKDSGSDMVLVGLLRGS
FT                   FMFMADLCREVQVSHEVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVEDIIDS
FT                   GNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQR
FT                   YRHLPYIGKVILLDE"
FT   gene            complement(146336..146998)
FT                   /gene="can"
FT                   /locus_tag="G2583_0130"
FT   CDS_pept        complement(146336..146998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="can"
FT                   /locus_tag="G2583_0130"
FT                   /product="Carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54784"
FT                   /db_xref="GOA:D3QVL1"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVL1"
FT                   /protein_id="ADD54784.1"
FT                   /translation="MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDS
FT                   RVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSVVQYAVDVLEVEHIIICGHYGCGGV
FT                   QAAVENPELGLINNWLLHIRDIWFKHSSLLDEMPQERRLDTLCELNVMEQVYNLGHSTI
FT                   MQSAWKRGQKVTIHGWAYGIHDGLLRDLDVTATNRETLEQRYRHGISNLKLKHANHK"
FT   gene            147107..148033
FT                   /gene="yadG"
FT                   /locus_tag="G2583_0131"
FT   CDS_pept        147107..148033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadG"
FT                   /locus_tag="G2583_0131"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54785"
FT                   /db_xref="GOA:D3QVL2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVL2"
FT                   /protein_id="ADD54785.1"
FT                   /translation="MTIALELQQLKKNYPGGVQALRGIDLQVEAGDFYALLGPNGAGKS
FT                   TTIGIISSLVNKTSGRVSVFGYDLEKDVVNAKRQLGLVPQEFNFNPFETVQQIVVNQAG
FT                   YYGVERKEAYIRSEKYLKQLDLWGKRNERARMLSGGMKRRLMIARALMHEPKLLILDEP
FT                   TAGVDIELRRSMWGFLKDLNDKGTTIILTTHYLEEAEMLCRNIGIIQHGELVENTSMKA
FT                   LLAKLKSETFILDLAPKSPLPKLDGYQYRLVDTATLEVEVLREQGINSVFTQLSEQGIQ
FT                   VLSMRNKANRLEELFVSLVNEKQGDRA"
FT   gene            148030..148800
FT                   /gene="yadH"
FT                   /locus_tag="G2583_0132"
FT   CDS_pept        148030..148800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadH"
FT                   /locus_tag="G2583_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54786"
FT                   /db_xref="GOA:D3QVL3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVL3"
FT                   /protein_id="ADD54786.1"
FT                   /translation="MMHLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNL
FT                   IGSRIGDMHGFSYMQFIVPGLIMMSVITNAYANVASSFFGAKFQRNIEELLVAPVPTHV
FT                   IIAGYVGGGVARGLFVGILVTAISLFFVPFQVHSWVFVALTLVLTAVLFSLAGLLNGVF
FT                   AKTFDDISLVPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGIN
FT                   DVPLVTTFGVLVVFIVAFYLICWSLIQRGRGLRS"
FT   gene            148905..149345
FT                   /gene="yadI"
FT                   /locus_tag="G2583_0133"
FT   CDS_pept        148905..149345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadI"
FT                   /locus_tag="G2583_0133"
FT                   /product="PTS system IIA component domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54787"
FT                   /db_xref="GOA:D3QVL4"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVL4"
FT                   /protein_id="ADD54787.1"
FT                   /translation="MLGWVITCHDDRAQEILDVLEKKHGALLQCRAVNFWRGLSSNMLS
FT                   RMMCDALHEADSGEGVIFLTDIAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMMACR
FT                   ETMTSSEFRERIVELGAPEVSSIWHQQQKNPPFVLKHNLYEY"
FT   gene            149409..150638
FT                   /gene="yadE"
FT                   /locus_tag="G2583_0134"
FT   CDS_pept        149409..150638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadE"
FT                   /locus_tag="G2583_0134"
FT                   /product="Polysaccharide deacetylase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54788"
FT                   /db_xref="GOA:D3QVL5"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVL5"
FT                   /protein_id="ADD54788.1"
FT                   /translation="MYKQAVILLLMLFTASVSAALPARYMQTIENAAVWAQIGDKMVTV
FT                   GNIRAGQIIAVEPTAASYYAFNFGFGKGFIDKGHLEPVQGRQKVEDGLGDLNKPLSNQN
FT                   LVTWKDTPVYNAPSVGSAPFGVLADNLRYPILHKLKDRLNQTWYQIRIGDRLAYISALD
FT                   AQPDNGLPVLTYHHILRDEENTRFRHTSTTTSVRAFNNQMAWLRDRGYATLSMVQLEGY
FT                   VKNKINLPARAVVITFDDGLKSVSRYAYPVLKQYGMKATAFIVTSRIKRHPQKWEPKSL
FT                   QFMSVSELNEIRDVFDFQSHTHFLHRVDGYRRPILLSRSEHNILFDFARSRRALAPFNP
FT                   HVWYLSYPFGGFNDKAVKAANDAGFHLAVTTMKGKVKPGDNPLLLKRLYILRTDSLETM
FT                   SRLVSNQPQG"
FT   gene            complement(150642..151022)
FT                   /gene="panD"
FT                   /locus_tag="G2583_0135"
FT   CDS_pept        complement(150642..151022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="G2583_0135"
FT                   /product="Aspartate 1-decarboxylase precursor (Aspartate
FT                   alpha-decarboxylase)"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54789"
FT                   /db_xref="GOA:D3QVL6"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVL6"
FT                   /protein_id="ADD54789.1"
FT                   /translation="MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAID
FT                   IWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPN
FT                   VAYFEGDNEMKRTAKAIPVQVA"
FT   gene            151296..152192
FT                   /gene="yadD"
FT                   /locus_tag="G2583_0136"
FT   CDS_pept        151296..152192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadD"
FT                   /locus_tag="G2583_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54790"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVL7"
FT                   /protein_id="ADD54790.1"
FT                   /translation="MDAPSTTPHDAVFKQFLMHAETARDFLEIHLPVELRELCDLNTLH
FT                   LESGSFIEESLKGHSTDVLYSVQMQGNPGYLHVVIEHQSKPDKKMAFRMMRYSIAAMHR
FT                   HLEADHDKLPLVVPILFYQGEATPYPLSMCWFDMFYSPELARRVYNSPFPLVDITITPD
FT                   DEIMQHRRIAILELLQKHIRQRDLMLLLEQLVTLIDEGYTSESQLVAMQNYMLQRGHTE
FT                   QADLFYGVLRDRETGGKSMMTLAQWFEEKGIEKGIQQGRQEERQEFAQRFLSKGMSRED
FT                   VAEMTNLSLAEIDRLIN"
FT   gene            complement(152484..153335)
FT                   /gene="panC"
FT                   /locus_tag="G2583_0137"
FT   CDS_pept        complement(152484..153335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="G2583_0137"
FT                   /product="Pantothenate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54791"
FT                   /db_xref="GOA:D3QVL8"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVL8"
FT                   /protein_id="ADD54791.1"
FT                   /translation="MLIIETLPLLRQQIRRLRMEGKRVALVPTMGNLHDGHMKLVDEAK
FT                   ARADVVVVSIFVNPMQFDRPEDLARYPRTLQEDCEKLNKRKVDLVFAPSVKEIYPNGTE
FT                   THTYVDVPGLSTMLEGASRPGHFRGVSTIVSKLFNLVQPDIACFGEKDFQQLALIRKMV
FT                   ADMGFDIEIVGVPIMRAKDGLALSSRNGYLTAEQRKIAPGLYKVLSSIADKLQAGERDL
FT                   DEIIAIAGQELNEKGFRADDIQIRDADTLLEVSETSKRAVILVAAWLGDARLIDNKMVE
FT                   LA"
FT   gene            complement(153347..154141)
FT                   /gene="panB"
FT                   /locus_tag="G2583_0138"
FT   CDS_pept        complement(153347..154141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="G2583_0138"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54792"
FT                   /db_xref="GOA:D3QVL9"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVL9"
FT                   /protein_id="ADD54792.1"
FT                   /translation="MKPTTIASLQKCKQEKKRFATITAYDYSFAKLFAEEGLNVMLVGD
FT                   SLGMTVQGHESTLPVTVEDIAYHTTAVRRGAPNCLLLADLPFMAYATPEQAFENAATVM
FT                   RAGANMVKIEGGEWLVETVKMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGDEASDRL
FT                   LSDALALEAAGAQLLVLECVPVELAKRITEALAIPVIGIGAGNVTDGQILVMHDAFGIT
FT                   GGHIPKFAKNFLAETGDIRAAVRQYMAEVESGVYPGEEHSFH"
FT   gene            complement(154276..155385)
FT                   /gene="yadC"
FT                   /locus_tag="G2583_0139"
FT   CDS_pept        complement(154276..155385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadC"
FT                   /locus_tag="G2583_0139"
FT                   /product="Putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54793"
FT                   /db_xref="GOA:D3QVM0"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVM0"
FT                   /protein_id="ADD54793.1"
FT                   /translation="MQRKGNKLLIQLCSAILLFFTTSWYALANECYIERNAEGDYHMKI
FT                   SSTQLSLASQMVEVPTEIAEATWDVNIQLRGDAIGCKSLGDSKAVHFLNTADPSLISTY
FT                   TTTNGAALLKTTVPGIVYSVELLCLSCGAADELDLWLPAQSGADNFIPSTQTKWAYEYS
FT                   DQSWYLRFRLFITPEFKPKNGVSSGTTIAGKIASWYIGTNDQPWINFYIDNDSLKFFVD
FT                   EPTCATVALAQDQGNVSGNQVTLGNSYVSEVKNGLTREIPFSIRAEYCYASKITVKLKA
FT                   ANKPSDATLVGKTTGSASGVAVKVNSTYDNSKVLLKADGSNTVDYNFAAWSNNLLFLPF
FT                   TAQLVPDGSGNAVGVGTFSGNATFSFTYE"
FT   gene            complement(155397..155987)
FT                   /gene="yadK"
FT                   /locus_tag="G2583_0140"
FT   CDS_pept        complement(155397..155987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadK"
FT                   /locus_tag="G2583_0140"
FT                   /product="Putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54794"
FT                   /db_xref="GOA:D3QVM1"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVM1"
FT                   /protein_id="ADD54794.1"
FT                   /translation="MLCRHHKIVHFLGLATALITPFAYSGQDVDLTAKIVPSTCQVEVS
FT                   NNGVVDLGTVTLDYFADNVTPTTDYAGGKTFNVNVVSCDNIQTTQSQMKLDFQPQAGSL
FT                   AQVNNQIFSNEYEQQATGAKNVGIVIFSAQPNQQTFNVRGTDGSSTAIYSVAPGNAVPS
FT                   TWTFYSRMQRVNNALPPESGMVRSQVIVNVSYE"
FT   gene            complement(156008..156613)
FT                   /gene="yadL"
FT                   /locus_tag="G2583_0141"
FT   CDS_pept        complement(156008..156613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadL"
FT                   /locus_tag="G2583_0141"
FT                   /product="Putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54795"
FT                   /db_xref="GOA:D3QVM2"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVM2"
FT                   /protein_id="ADD54795.1"
FT                   /translation="MKLKVIATLIATVAVGVSFNSNFASASTTSASLTVNSNLTMGTCS
FT                   AQIMDNSNKVINEVVFGNVYISELGAKSKVQQFKIRFSNCSGLPQNSAQIVLAPNGISC
FT                   AGSQSSSAGFSNKFTDASAATRTAVEVWTTDTPESNGSTQFHCAQKIPVPVTLPADTTT
FT                   QPYDYPLSARMTVAEGRLVTDVRPGNFRSPTTFTITYQ"
FT   gene            complement(156628..157188)
FT                   /gene="yadM"
FT                   /locus_tag="G2583_0142"
FT   CDS_pept        complement(156628..157188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadM"
FT                   /locus_tag="G2583_0142"
FT                   /product="Putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54796"
FT                   /db_xref="GOA:D3QVM3"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVM3"
FT                   /protein_id="ADD54796.1"
FT                   /translation="MENSMKRILLTSALIGLGLPAVGSATDLNVDFTATVLATTCTITI
FT                   VEDGGPAVTGSNDEYSLTIPDVGLDKVATAAPEAQANFKLKASDCSNGYSKIFTTLTGT
FT                   TVSGKLIVNEATSGAAGVGMGIKRRDTADSTFFTPNNTDKFEWSADEKASGVPLTVALR
FT                   ETTAGAGRTGAFQAKATFNFTYE"
FT   gene            complement(157190..159790)
FT                   /gene="htrE"
FT                   /locus_tag="G2583_0143"
FT   CDS_pept        complement(157190..159790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrE"
FT                   /locus_tag="G2583_0143"
FT                   /product="Probable outer membrane porin protein involved in
FT                   fimbrial assembly"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54797"
FT                   /db_xref="GOA:D3QVM4"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVM4"
FT                   /protein_id="ADD54797.1"
FT                   /translation="MYQFTHQKSRIPKKTLLAACCALFYSSNGAAADTVEYDSSFLMGT
FT                   GASTIDVKRYAQGNPTPPGLYNVRVFVNGQATSSLEIPFVDIGENSAAACLTHKNLAQL
FT                   HIKQPEQPVTLLAREGEEEDCLDLAKSYEKADVRFDGSDQFLDLTIPQAYVLKSYGGYV
FT                   DPSLWESGINAATLAYTLNAYHTSSDNDNSDSVYGAFNSGINLGAWHFRARGNYNWTTD
FT                   NGSDFDFQDRYLQRDIPAIRSQIIMGDAYTTGETFDSVNVRGVRLYSDSRMLPSALASY
FT                   APTIRGVANSNAKVTVTQSGYKIYETTVPPGEFVIDDISPSGFGSELVVTIEEADGSKR
FT                   TFTQPFSSVVQMQRPGVGRWDFSAGKVIDDSLRSEPNMGQASYYYGLNNLFTGYTGIQF
FT                   TDNNYLAGLLGVGINTSIGAFAVDVTHSRAEIPDDKTYQGQSYRVTWNKLFQDTGTSFN
FT                   LAAYRYSTQDYLGLHDALVLIDDAKHLSADEDKNTMQTYSRMKNQFTVSINQPLNIAYE
FT                   DYGSLFISGSWTYYWAANNSRTEYNVGYSKSVSWGSFSVNLQRSWNEDGEKDDAMYVSV
FT                   SVPIENILGGKRKSSGFRNLNTQLNTDFDGSHQLNVNSSGNTENNLVNYSVNAGYSLDK
FT                   NAGDLASVGGYLNYESGLGGISASASATSDNSQQYSISTDGGFVLHSGGLTFTNNSFSS
FT                   NDTLVLINAPGAKGARINNSNNEIDRWGYAVTSSVSPYRENRVGLNIETLENDVELKST
FT                   SATTVPRSGSVVLTRFETDEGRSAVLNITAANGKSIPFAAEVYQGEVMIGSMGQGGQAF
FT                   VRGINDSGELIVRWYENNQTIDCKLHYQFPAQPQTLGSTNTLLLNNLTCQVANH"
FT   gene            complement(159832..160563)
FT                   /gene="ecpD"
FT                   /locus_tag="G2583_0144"
FT   CDS_pept        complement(159832..160563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpD"
FT                   /locus_tag="G2583_0144"
FT                   /product="Gram-negative pili assembly chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54798"
FT                   /db_xref="GOA:D3QVM5"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVM5"
FT                   /protein_id="ADD54798.1"
FT                   /translation="MLMFPLVKKTVSALFVSTLLASAPAFADIIISGTRIIYNADKKDV
FT                   NVRLENKGNRPLLIQNWLDTGDDNADPSQIKVPFTATPPVSRVEPKRGQTVKVMYTGAT
FT                   ALPKDRESVYWFNVLEVPPKPKDAEADKNLLQLAFRTRIKLFYRLSGLQGEPAEAPAKI
FT                   TWKLNNAQLQANNPTPYYVSFNEVKLESGGKTYNVNSSMVTPFSQASFGVTGLPGSVSS
FT                   GKVVFKAINDFGGNIDGSATF"
FT   gene            complement(160644..161249)
FT                   /gene="yadN"
FT                   /locus_tag="G2583_0145"
FT   CDS_pept        complement(160644..161249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadN"
FT                   /locus_tag="G2583_0145"
FT                   /product="Putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54799"
FT                   /db_xref="GOA:D3QVM6"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:D3QVM6"
FT                   /protein_id="ADD54799.1"
FT                   /translation="MHVMKKALLAAALVMASGSALAVDGGHIDFNGMVQSGTCKVGVVD
FT                   TGMHSVTTDGVVTLDTANVTDTFAEVSATAVGLLPKEFMISVECDPGAPKNAELTMGSA
FT                   SYANTSGPLNNNMNITVNGIAPAQNVNIAVHNMKNKAGAAEIKQVHMNNSSEVQELTLD
FT                   AEGKGQYVFNASYVKAPNSPAVTAGHVTTNALYTVAYK"
FT   gene            complement(161520..162002)
FT                   /gene="folK"
FT                   /locus_tag="G2583_0146"
FT   CDS_pept        complement(161520..162002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="G2583_0146"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54800"
FT                   /db_xref="GOA:D3QWE4"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWE4"
FT                   /protein_id="ADD54800.1"
FT                   /translation="MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPP
FT                   LGPQDQPDYLNAAVALETTLAPEELLNHTQQIELQQGRVRKAERWGPRTLDLDIMLFGN
FT                   ETINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGETLREILTSLAVLQPAIWY"
FT   gene            complement(161999..163417)
FT                   /gene="pcnB"
FT                   /locus_tag="G2583_0147"
FT   CDS_pept        complement(161999..163417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="G2583_0147"
FT                   /product="Poly(A) polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54801"
FT                   /db_xref="GOA:D3QWE5"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWE5"
FT                   /protein_id="ADD54801.1"
FT                   /translation="MTLPRCTIFTRVANFCRKVLSREESEAEQAVARPQVTVIPREQHA
FT                   ISRKDISENALKVMYRLNKAGYEAWLVGGGVRDLLLGKKPKDFDVTTNATPEQVRKLFR
FT                   NCRLVGRRFRLAHVMFGPEIIEVATFRGHHEGNVSDRTTSQRGQNGMLLRDNIFGSIEE
FT                   DAQRRDFTINSLYYSVADFTVRDYVGGMKDLKDGVIRLIGNPETRYREDPVRMLRAVRF
FT                   AAKLGMRISPETAEPIPRLATLLNDIPPARLFEESLKLLQAGYGYETYKLLCEYHLFQP
FT                   LFPTITRYFTENGDSPMERIIEQVLKNTDTRIHNDMRVNPAFLFAAMFWYPLLETAQKI
FT                   AQESGLTYHDAFALAMNDVLDEACRSLAIPKRLTTLTRDIWQLQLRMSRRQGKRAWKLL
FT                   EHPKFRAAYDLLALRAEVERNAELQRLVKWWGEFQVSAPPDQKGMLNELDEEPSPRRRT
FT                   RRPRKRAPRREGTA"
FT   gene            complement(163456..164382)
FT                   /gene="yadB"
FT                   /locus_tag="G2583_0148"
FT   CDS_pept        complement(163456..164382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadB"
FT                   /locus_tag="G2583_0148"
FT                   /product="Glutamyl-Q tRNA(Asp) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54802"
FT                   /db_xref="GOA:D3QWE6"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWE6"
FT                   /protein_id="ADD54802.1"
FT                   /translation="MLPPYFLFKEMTDTQYIGRFAPSPSGELHFGSLIAALGSYLQARA
FT                   RHGRWLVRIEDIDPPREVPGAAETILRQLEHYGLHWDGDVLWQSQRHHAYREALAWLHE
FT                   QGLSYYCTCTRARIQSIGGIYDGHCRVLHHGPDNAAVRIRQQHPVTQFTDQLRGIIHAD
FT                   EKLAREDFIIHRRDGLFAYNLAVVVDDHFQGVSEIVRGADLIEPTVRQISLYQLFGWKV
FT                   PDYIHLPLALNPQGAKLSKQNHAPALPKGDPRPVLIAALQFLGQQAEAHWQDFSVEQIL
FT                   QSAVKNWRLTAVPESAIVNSTFSNASC"
FT   gene            complement(164419..164874)
FT                   /gene="dksA"
FT                   /locus_tag="G2583_0149"
FT   CDS_pept        complement(164419..164874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="G2583_0149"
FT                   /product="RNA polymerase-binding protein DksA"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54803"
FT                   /db_xref="GOA:D3QWE7"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWE7"
FT                   /protein_id="ADD54803.1"
FT                   /translation="MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFRRILE
FT                   AWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLK
FT                   KVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
FT   gene            complement(165052..165756)
FT                   /gene="sfsA"
FT                   /locus_tag="G2583_0150"
FT   CDS_pept        complement(165052..165756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="G2583_0150"
FT                   /product="Sugar fermentation stimulation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54804"
FT                   /db_xref="GOA:D3QWE8"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWE8"
FT                   /protein_id="ADD54804.1"
FT                   /translation="MEFSPPLQRATLIQRYKRFLADVITPDGRELTLHCPNTGAMTGCA
FT                   TPGDTVWYSTSDNTKRKYPHTWELTQSQSGAFICVNTLWANRLTKEAILNESISELSGY
FT                   SSLKSEVKYGAERSRIDFMLQADSRPDCYIEVKSVTLAENEQGYFPDAVTERGQKHLRE
FT                   LMSVAAEGQRAVIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAE
FT                   GMALKKSLPVTL"
FT   gene            complement(165771..166310)
FT                   /gene="ligT"
FT                   /locus_tag="G2583_0151"
FT   CDS_pept        complement(165771..166310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligT"
FT                   /locus_tag="G2583_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54805"
FT                   /db_xref="GOA:D3QWE9"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWE9"
FT                   /protein_id="ADD54805.1"
FT                   /translation="MPHMSDPQRLFFAIDLPAEIREQIIHWRATHFPLEAGRPVAADNL
FT                   HLTLAFLGEVSAEKEKALSLLAGRIRQPGFTLTLDDAGQWLRSRVVWLGMRQPPRGLIQ
FT                   LANMLRSQAARSGCFQSNRPFHPHITLLRDASEAVTIPPPGFNWSYAVTEFTLYASSFA
FT                   RGRTRYTPLKRWALTQ"
FT   gene            166330..168804
FT                   /gene="hrpB"
FT                   /locus_tag="G2583_0152"
FT   CDS_pept        166330..168804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="G2583_0152"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54806"
FT                   /db_xref="GOA:D3QWF0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWF0"
FT                   /protein_id="ADD54806.1"
FT                   /translation="MLQCGAKNVNPLERFVSSLPVAAVLPELLTALDYAPQVLLSAPTG
FT                   AGKSTWLPLQLLAHPGINGKIILLEPRRLAARNVAQRLAELLNEKPGDTVGYRMRAQNC
FT                   VGPNTRLEVVTEGVLTRMIQRDPELSGVGLVILDEFHERSLQADLALALLLDVQQGLRD
FT                   DLKLLIMSATLDNDRLQQMLPEAPVVISEGRSFPVERRYLPLPTHQRFDDAVAVATAEM
FT                   LRQESGSLLLFLPGVGEIQRVQEQLASRIGSDVLLCPLYGALSLNDQRKAILPAPQGMR
FT                   KVVLATNIAETSLTIEGIRLVVDCAQERVARFDPRTGLTRLITQRISQASMTQRAGRAG
FT                   RLEPGICLHLIAKEQAERATAQSEPEILQSDLSGLLMELLQWGCSDPAQMSWLDQPPTV
FT                   NLLAAKRLLQMLGALDGERLSAQGQKMAALGNDPRLAAMLVSAKSDDEAATAAKIAAIL
FT                   EEPPRMGNSDLGVAFSRNQPAWQQRSQQLLKRLNVRGGEADSSLIAPLLAGAFADRIAR
FT                   RRGQDGRYQLANGMGAMLDADDALSRHEWLIAPLLLQGSASPDARILLALPVDIDELVQ
FT                   RCPQLVQQSDTVEWDDAQGTLKAWRRLQIGQLTVKVQPLAKPSEDELHQAMLNGIRDKG
FT                   LSVLNWTAEAEQLRLRLLCAGKWLPEYDWPAVDDESLLATLETWLLPHMAGVHSLRGLK
FT                   SLDIYQALRGLLDWGMQQRLDSELPAHYTVPTGSRIAIRYHEDNPPALAVRMQEMFGEA
FT                   TNPTIAQGRVPLVLELLSPAQRPLQITRDLGAFWKGAYREVQKEMKGRYPKHVWPDDPA
FT                   NTAPTRRTKKYS"
FT   gene            169000..171534
FT                   /gene="mrcB"
FT                   /locus_tag="G2583_0153"
FT   CDS_pept        169000..171534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="G2583_0153"
FT                   /product="Penicillin-binding protein 1B"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54807"
FT                   /db_xref="GOA:D3QWF1"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR032730"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWF1"
FT                   /protein_id="ADD54807.1"
FT                   /translation="MAGNDREPIGRKGKPTRPVKQKVSRRRYEDDDDYDDYDDYEDEEP
FT                   MPRKGKGKGKGRKPRGKRGWLWLLLKLAIVFAVLIAIYGVYLDQKIRSRIDGKVWQLPA
FT                   AVYGRMVNLEPDMTISKNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPD
FT                   SKEGQVRARLTFDGDHLATIVNMENNRQFGFFRLDPRLITMISSPNGEQRLFVPRSGFP
FT                   DLLVDTLLATEDRHFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSE
FT                   RSYWRKANEAYMALIMDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVE
FT                   ELSLDQQALLVGMVKGASIYNPWRNPKLALERRNLVLRLLQQQQIIDQELYDMLSARPL
FT                   GVQPRGGVISPQPAFMQLVRQELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVEGI
FT                   PALKKQRKLSDLETAIVVVDRFSGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATY
FT                   LTALSQPKIYRLNTWIADAPIALRQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVP
FT                   TVNLGMALGLPAVTDTWIKLGVPKDQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRA
FT                   PLSALRSVIAEDGKVLYQSFPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLH
FT                   LAGKTGTTNNNVDTWFAGIDGSTVTITWVGRDNNQPTKLYGASGAMSIYQRYLANQTPT
FT                   PLNLVPPEDIADMGVDYDGNFVCSGGMRVLPVWTSDPQSLCQQSEMQQQPSGNPFDQSS
FT                   QPQQQPQQQPAQQEQKDSDGVAGWIKDMFGSN"
FT   gene            171754..173997
FT                   /gene="fhuA"
FT                   /locus_tag="G2583_0154"
FT   CDS_pept        171754..173997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="G2583_0154"
FT                   /product="Ferrichrome-iron receptor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54808"
FT                   /db_xref="GOA:D3QWF2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWF2"
FT                   /protein_id="ADD54808.1"
FT                   /translation="MARSKTAQPKHSLRKIAVVVATAVSGMSVYAQAAVEPKEDTITVT
FT                   AAPAPQESAWGPAATIAARQSATGTKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALS
FT                   YTPGVSVGTRGASNTYDHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAVIDPYMLERAE
FT                   IMRGPVSVLYGKSSPGGLLNMVSKRPTTEPLKEVQFKAGTDSLFQTGFDFSDALDDDGV
FT                   YSYRLTGLARSANAQQKGSEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPETGYYGWLP
FT                   KEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKT
FT                   SQNSVYGYGVCSDPANVYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFA
FT                   TGDIDHTLLTGVDFMRMRNDINAWFGYDDSVPLLDLYNPVNTDFDFNAKDPANSGPYRI
FT                   LNKQKQTGVYVQDQAQWDKVLVTLGGRYDWADQESLNRVAGTTDKRDDKQFTWRGGVNY
FT                   LFDNGVTPYFSYSESFEPSSQVGKDGNIFAPSKGKQYEVGVKYVPEDRPIVVTGAVYNL
FT                   TKTNNLMADPEGSFFSVEGGEIRARGVEIEAKAALSASVNVVGSYTYTDAEYTTDTTYK
FT                   GNTPAQVPKHMASLWADYTFFDGPLSGLTLGTGGRYTGSSYGDPANSFKVGSYTVVDAL
FT                   VRYDLARVGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVATATFRF"
FT   gene            174048..174845
FT                   /gene="fhuC"
FT                   /locus_tag="G2583_0155"
FT   CDS_pept        174048..174845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="G2583_0155"
FT                   /product="Ferrichrome transport ATP-binding protein FhuC"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54809"
FT                   /db_xref="GOA:D3QWF3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWF3"
FT                   /protein_id="ADD54809.1"
FT                   /translation="MQEYTNHSDTTFALRNISFRVPGRTLLHPLSLTFPAGKVTGLIGH
FT                   NGSGKSTLLKMLGRHQPPSEGEILLDAQPLESWSSKAFARKVAYLPQQLPPAEGMTVRE
FT                   LVAIGRYPWHGALGRFGAADREKVEEAISLVGLKPLAHRLVDSLSGGERQRAWIAMLVA
FT                   QDSRCLLLDEPTSALDIAHQVDVLALVHRLSQERGLTVIAVLHDINMAARYCDYLVALR
FT                   GGEMIAQGTPAEIMRGETLEMIYGIPMGILPHPAGAAPVSFVY"
FT   gene            174845..175735
FT                   /gene="fhuD"
FT                   /locus_tag="G2583_0156"
FT   CDS_pept        174845..175735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="G2583_0156"
FT                   /product="Ferrichrome-binding periplasmic protein FhuD"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54810"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWF4"
FT                   /protein_id="ADD54810.1"
FT                   /translation="MSGLPLISRRRLLTAMALSPLLWQMNTAHAAAIDPNRIVALEWLP
FT                   VELLLALGIVPYGVADTINYRLWVSEPPLPESVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIR
FT                   SMNPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAV
FT                   SIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSA
FT                   MHFVRVLDNAIGGKA"
FT   gene            175732..177714
FT                   /gene="fhuB"
FT                   /locus_tag="G2583_0157"
FT   CDS_pept        175732..177714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="G2583_0157"
FT                   /product="Ferrichrome ABC transporter, permease protein
FT                   FhuB"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54811"
FT                   /db_xref="GOA:D3QWF5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWF5"
FT                   /protein_id="ADD54811.1"
FT                   /translation="MSKRIALFPALLLALLVIAATALTWMNFSQALPRSQWAQAAWSPD
FT                   IDVIEQMIFHYSLLPRLAISLLVGAGLGLVGVLFQQVLRNPLAEPTTLGVATGAQLGIT
FT                   VTTLWAIPGAMASQFAALAGACVVGLIVFGVAWGKRLSPVTLILAGLVVSLYCGAINQL
FT                   LVIFHHDQLQSMFLWSTGTLTQTDWGGVERLWPQLLGGVMLTLLLLRPLTLMGLDDGVA
FT                   RNLGLALSLARLAALSLAIVISALLVNAVGIIGFIGLFAPLLAKMLGARRLLPRLMLAS
FT                   LIGALILWLSDQIILWLTRVWMEVSTGSVTALIGAPLLLWLLPRLRSISAPDMKVNDRV
FT                   AAERQHVLAFALAGGVLLLMAVVVALSFGRDAHGWTWASGALLEDLMPWRWPRIMAALF
FT                   AGVMLAVAGCIIQRLTGNPMASPEVLGISSGAAFGVVLMLFLVPGNAFGWLLPAGSIGA
FT                   AVTLLIIMIAAGRGGFSPHRMLLAGMALSTAFTMLLMMLQASGDPRMAQVLTWISGSTY
FT                   NATDAQVWRTGIVMVILLAITPLCRRWLTILPLGGDTARAVGVALTPTRIALLLLAACL
FT                   TATATMTIGPLSFVGLMAPHIARMMGFRRTMPHIVISALVGGLLLVFADWCGRMVLFPF
FT                   QIPAGLLSTFIGAPYFIYLLRKQSR"
FT   gene            complement(177749..179029)
FT                   /gene="hemL"
FT                   /locus_tag="G2583_0158"
FT   CDS_pept        complement(177749..179029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="G2583_0158"
FT                   /product="Glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54812"
FT                   /db_xref="GOA:D3QWF6"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWF6"
FT                   /protein_id="ADD54812.1"
FT                   /translation="MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLY
FT                   DVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAQLVTELVP
FT                   TMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQP
FT                   NSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACIIVEPVAGNMNCVPPLPDFLPG
FT                   LRALCDEFGALLIIDEVMTGFRVALAGAQDYYGVEPDLTCLGKIIGGGMPVGAFGGRRD
FT                   VMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGVHETLDELTTRLAEGLLEAAE
FT                   EAGIPLVVNHVGGMFGIFFTDAESVTCYQDVMACDVERFKRFFHMMLDEGVYLAPSAFE
FT                   AGFMSVAHSMEDINNTIDAARRVFAKL"
FT   gene            179254..180675
FT                   /gene="clcA"
FT                   /locus_tag="G2583_0159"
FT   CDS_pept        179254..180675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clcA"
FT                   /locus_tag="G2583_0159"
FT                   /product="H(+)/Cl(-) exchange transporter clcA"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54813"
FT                   /db_xref="GOA:D3QWF7"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR023861"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWF7"
FT                   /protein_id="ADD54813.1"
FT                   /translation="MKTDTPSLETPQAARLRRRQLIRQLLERDKTPLAILFMAAVVGTL
FT                   VGLAAVAFDKGVAWLQNQRMGALVHTADNYPLLLTVAFLCSAVLAMFGYFLVRKYAPEA
FT                   GGSGIPEIEGALEDQRPVRWWRVLPVKFFGGLGTLGGGMVLGREGPTVQIGGNIGRMVL
FT                   DVFRLKGDEARHTLLATGAAAGLAAAFNAPLAGILFIIEEMRPQFRYTLISIKAVFIGV
FT                   IMSTIMYRIFNHEVALIDVGKLSDAPLNTLWLYLILGIIFGIFGPIFNKWVLGMQDLLH
FT                   RVHGGNITKWVLMGGAIGGLCGLLGFVAPATSGGGFNLIPIATAGNFSMGMLVFIFVAR
FT                   VITTLLCFSSGAPGGIFAPMLALGTVLGTAFGMVAVELFPQYHLEAGTFAIAGMGALLA
FT                   ASIRAPLTGIILVLEMTDNYQLILPMIITGLGATLLAQFTGGKPLYSAILARTLAKQEA
FT                   EQLARSKAASASENT"
FT   gene            180757..181101
FT                   /gene="yadR"
FT                   /locus_tag="G2583_0160"
FT   CDS_pept        180757..181101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadR"
FT                   /locus_tag="G2583_0160"
FT                   /product="Iron-sulfur cluster insertion protein erpA"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54814"
FT                   /db_xref="GOA:D3QWF8"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWF8"
FT                   /protein_id="ADD54814.1"
FT                   /translation="MSDDVALPLEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGF
FT                   QYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKS
FT                   TCGCGSSFSI"
FT   gene            complement(181148..181771)
FT                   /gene="yadS"
FT                   /locus_tag="G2583_0161"
FT   CDS_pept        complement(181148..181771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadS"
FT                   /locus_tag="G2583_0161"
FT                   /product="UPF0126 inner membrane protein yadS"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54815"
FT                   /db_xref="GOA:D3QWF9"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWF9"
FT                   /protein_id="ADD54815.1"
FT                   /translation="MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGT
FT                   IRDMALDHGPVFWVKDPTDLVVAMVTSMLTIVLVRQPRRLPKWMLPVLDAVGLAVFVGI
FT                   GVNKAFNAEAGPLIAVCMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHAT
FT                   AYYTFSVPLETASMMGMVVTLLIRLAAIRWHLKLPTFALDENGR"
FT   gene            complement(181809..182609)
FT                   /gene="btuF"
FT                   /locus_tag="G2583_0162"
FT   CDS_pept        complement(181809..182609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuF"
FT                   /locus_tag="G2583_0162"
FT                   /product="Vitamin B12-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54816"
FT                   /db_xref="GOA:D3QWG0"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR023544"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWG0"
FT                   /protein_id="ADD54816.1"
FT                   /translation="MAKSLFRALVALSFLAPLWLNAAPRVITLSPANTELAFAAGITPV
FT                   GVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKV
FT                   MWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFG
FT                   INPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIP
FT                   KIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD"
FT   gene            complement(182602..183300)
FT                   /gene="mtn"
FT                   /locus_tag="G2583_0163"
FT   CDS_pept        complement(182602..183300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtn"
FT                   /locus_tag="G2583_0163"
FT                   /product="MTA/SAH nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54817"
FT                   /db_xref="GOA:D3QWG1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWG1"
FT                   /protein_id="ADD54817.1"
FT                   /translation="MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVAL
FT                   LKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTA
FT                   FGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRH
FT                   NFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMV
FT                   ESLVQKLAHG"
FT   gene            183384..184901
FT                   /gene="dgt"
FT                   /locus_tag="G2583_0164"
FT   CDS_pept        183384..184901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="G2583_0164"
FT                   /product="Deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54818"
FT                   /db_xref="GOA:D3QWG2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR020779"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWG2"
FT                   /protein_id="ADD54818.1"
FT                   /translation="MAQIDFRKKINWHRRYRSPQGVKTEHEILRIFESDRGRIINSPAI
FT                   RRLQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKELKLLEAYGLDELTG
FT                   PFESIVEMSCLMHDIGNPPFGHFGEAAINDWFRQRLHPEDAESQPLTDDRCSVAVLRLR
FT                   DGEEPLNELRRKIRQDLCHFEGNAQGIRLVHTLMRMNLTWAQVGGILKYTRPAWWRGET
FT                   PETHHYLMKKPGYYLSEEAYIARLRKELNLALYSRFPLTWIMEAADDISYCVADLEDAV
FT                   EKRIFTVEQLYHHLHEAWGQHEKGSLFSLVVENAWEKSRSNSLSRSTEDQFFMYLRVNT
FT                   LNKLVPYAAQRFIDNLPAIFAGTFNHALLEDASECSDLLKLYKNVAVKHVFSHPDVEQL
FT                   ELQGYRVISGLLEIYRPLLSLSLSDFTELVEKERVKRSPIESRLFHKLSTRHRLAYVEA
FT                   VSKLPSDSPEFPLWEYYYRCRLLQDYISGMTDLYAWDEYRRLMAVEQ"
FT   gene            185031..186455
FT                   /gene="degP"
FT                   /locus_tag="G2583_0165"
FT   CDS_pept        185031..186455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degP"
FT                   /locus_tag="G2583_0165"
FT                   /product="Protease do precursor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54819"
FT                   /db_xref="GOA:D3QWG3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWG3"
FT                   /protein_id="ADD54819.1"
FT                   /translation="MKKTTLALSALALSLGLALSPLSATAAETSSATTAQQMPSLAPML
FT                   EKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGG
FT                   GQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIA
FT                   LIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYE
FT                   NFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMV
FT                   EYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLN
FT                   GKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEG
FT                   AEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVL
FT                   ALNIQRGDSTIYLLMQ"
FT   gene            186610..187767
FT                   /gene="cdaR"
FT                   /locus_tag="G2583_0166"
FT   CDS_pept        186610..187767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdaR"
FT                   /locus_tag="G2583_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54820"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWG4"
FT                   /protein_id="ADD54820.1"
FT                   /translation="MAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERIG
FT                   ELHEGALLVLSQGRVVDIDDAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPENLRKY
FT                   GELVCMTAEMMLEQSRLMHLLAQDSRLREELVMNLIQAEENTPALTEWAQRLGIDLNQP
FT                   RVVAIVEVDSGQLGVDSAMAELQQLQNALTTPERNNLVAIVSLTEMVVLKPALNSFGRW
FT                   DVEDHRKRVEQLITRMKEYGQLRFRVSLGNYFTGPGSIARSYRTAKTTMVVGKQRMPES
FT                   RCYFYQDLMLPVLLDSLRGDWQANELARPLARLKAMDNNGLLRRTLAAWFRHNVQPLAT
FT                   SKALFIHRNTLEYRLNRISELTGLDLGNFDDRLLLYVALQLDEER"
FT   gene            complement(187856..188242)
FT                   /gene="yaeH"
FT                   /locus_tag="G2583_0167"
FT   CDS_pept        complement(187856..188242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeH"
FT                   /locus_tag="G2583_0167"
FT                   /product="UPF0325 protein yaeH"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54821"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWG5"
FT                   /protein_id="ADD54821.1"
FT                   /translation="MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDKGEFFAKS
FT                   VKFKYPRQRKTVVADGVGQGYKEVQEISPNLRYIIDELDQICQRDRSEVDLKRKILDDL
FT                   RHLESVVTNKISEIEADLEKLTRK"
FT   gene            complement(188557..189381)
FT                   /gene="dapD"
FT                   /locus_tag="G2583_0168"
FT   CDS_pept        complement(188557..189381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="G2583_0168"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54822"
FT                   /db_xref="GOA:D3QWG6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWG6"
FT                   /protein_id="ADD54822.1"
FT                   /translation="MQQLQNIIETAFERRAEITPANADTVTREAVNQVIALLDSGALRV
FT                   AEKIDGQWVTHQWLKKAVLLSFRINDNQVIEGAESRYFDKVPMKFADYDEARFQKEGFR
FT                   VVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVG
FT                   IGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEI
FT                   HYGRVPAGSVVVSGNLPSKDGKYSLYCAVIVKKVDAKTRGKVGINELLRTID"
FT   gene            complement(189412..191907)
FT                   /gene="glnD"
FT                   /locus_tag="G2583_0169"
FT   CDS_pept        complement(189412..191907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="G2583_0169"
FT                   /product="[Protein-PII] uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54823"
FT                   /db_xref="GOA:D3QWG7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWG7"
FT                   /protein_id="ADD54823.1"
FT                   /translation="MIEARTEFIDQLLQRLWIEAGFSQIADLALVAVGGYGRGELHPLS
FT                   DIDLLILSRKKLPDDQAQKVGELLTLLWDVKLEVGHSVRTLEECMLEGLSDLTVATNLI
FT                   ESRLLIGDVALFLELQKHIFSEGFWPSDKFYAAKVEEQNQRHQRYHGTSYNLEPDIKSS
FT                   PGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTSAERAELNECLHILWRIRFALHLVVS
FT                   RYDNRLLFDRQLSVAQRLNYSGEGNEPVERMMKDYFRVTRRVSELNQMLLQLFDEAILA
FT                   LPADEKPRPIDDEFQLRGTLIDLRDETLFMRQPEAILRMFYTMVRNSAITGIYSTTLRQ
FT                   LRHARRHLQQPLCNIPQARKLFLSILRHPGAVRRGLLPMHRHSVLGAYMPQWSHIVGQM
FT                   QFDLFHAYTVDEHTIRVMLKLESFASEETRQRHPLCVNVWPRLPSTELIFIAALFHDIA
FT                   KGRGGDHSILGAQDVVHFAELHGLNSRETQLVAWLVRQHLLMSVTAQRRDIQDPEVIKQ
FT                   FAEEVQTENRLRYLVCLTVADICATNETLWNSWKQSLLRELYFATEKQLRRGMQNTPDM
FT                   RERVRHHQLQALALLRMDNIDEEVLHQIWSRCRANYFVRHSPNQLAWHARHLLQHDLSK
FT                   PLVLLSPQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQIFTTRDGMAMDTFI
FT                   VLEPDGSPLSADRHEVIRFGLEQVLTQSSWQPPQPRRQPAKLRHFTVETEVTFLPTHTD
FT                   RKSFLELIALDQPGLLARVGKIFADLGISLHGARITTIGERVEDLFIIATADRRALNNE
FT                   LQQEVHQRLTEALNPNDKG"
FT   gene            complement(192146..192940)
FT                   /gene="map"
FT                   /locus_tag="G2583_0170"
FT   CDS_pept        complement(192146..192940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="G2583_0170"
FT                   /product="Methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54824"
FT                   /db_xref="GOA:D3QWG8"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWG8"
FT                   /protein_id="ADD54824.1"
FT                   /translation="MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRIC
FT                   NDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDG
FT                   FHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFS
FT                   VVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWT
FT                   VKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE"
FT   gene            193146..193281
FT                   /locus_tag="G2583_0171"
FT   ncRNA           193146..193281
FT                   /locus_tag="G2583_0171"
FT                   /note="putative non-coding RNA"
FT                   /ncRNA_class="other"
FT   gene            193308..194033
FT                   /gene="rpsB"
FT                   /locus_tag="G2583_0172"
FT   CDS_pept        193308..194033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="G2583_0172"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54825"
FT                   /db_xref="GOA:D3QWG9"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWG9"
FT                   /protein_id="ADD54825.1"
FT                   /translation="MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEK
FT                   TVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFV
FT                   IDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVR
FT                   EGRSQDLASQAEESFVEAE"
FT   gene            194291..195142
FT                   /gene="tsf"
FT                   /locus_tag="G2583_0173"
FT   CDS_pept        194291..195142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="G2583_0173"
FT                   /product="Elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54826"
FT                   /db_xref="GOA:D3QWH0"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWH0"
FT                   /protein_id="ADD54826.1"
FT                   /translation="MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSG
FT                   AIKAAKKAGNVAADGVIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGK
FT                   ITDVEVLKAQFEEERVALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADE
FT                   ELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKK
FT                   FTGEVSLTGQPFVMEPSKTVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSK
FT                   QS"
FT   gene            195289..196014
FT                   /gene="pyrH"
FT                   /locus_tag="G2583_0174"
FT   CDS_pept        195289..196014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="G2583_0174"
FT                   /product="UMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54827"
FT                   /db_xref="GOA:D3QWH1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWH1"
FT                   /protein_id="ADD54827.1"
FT                   /translation="MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELV
FT                   ELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL
FT                   MSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLK
FT                   ATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNK
FT                   PGALRRVVMGEKEGTLITE"
FT   gene            196164..196721
FT                   /gene="frr"
FT                   /locus_tag="G2583_0175"
FT   CDS_pept        196164..196721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="G2583_0175"
FT                   /product="Ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54828"
FT                   /db_xref="GOA:D3QWH2"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWH2"
FT                   /protein_id="ADD54828.1"
FT                   /translation="MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYY
FT                   GTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPP
FT                   LTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKL
FT                   TDAAIKKIEAALADKEAELMQF"
FT   gene            196813..198009
FT                   /gene="dxr"
FT                   /locus_tag="G2583_0176"
FT   CDS_pept        196813..198009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="G2583_0176"
FT                   /product="Putative ATP-binding component of a transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54829"
FT                   /db_xref="GOA:D3QWH3"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWH3"
FT                   /protein_id="ADD54829.1"
FT                   /translation="MKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQ
FT                   CLEFSPRYAVMDDEASAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGA
FT                   AGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQP
FT                   IQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDS
FT                   ATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIA
FT                   HTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANE
FT                   ITVAAFLAQQIRFTDIAALNLSVLEKMDMREPQCVDDVLSVDASAREVARKEVMRLAS"
FT   gene            198195..198956
FT                   /gene="ispU"
FT                   /locus_tag="G2583_0177"
FT   CDS_pept        198195..198956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispU"
FT                   /locus_tag="G2583_0177"
FT                   /product="Undecaprenyl pyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54830"
FT                   /db_xref="GOA:D3QWH4"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWH4"
FT                   /protein_id="ADD54830.1"
FT                   /translation="MMLSATQPLSEKLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKA
FT                   GAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHN
FT                   VRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQ
FT                   QGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWP
FT                   DFDEQDFEGALNAFANRERRFGGTEPGDETA"
FT   gene            198969..199826
FT                   /gene="cdsA"
FT                   /locus_tag="G2583_0178"
FT   CDS_pept        198969..199826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="G2583_0178"
FT                   /product="Phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54831"
FT                   /db_xref="GOA:D3QWH5"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWH5"
FT                   /protein_id="ADD54831.1"
FT                   /translation="MLKYRLISAFVLIPVVIAALFLLPPVGFAIVTLVVCMLAAWEWGQ
FT                   LSGFTTRSQRVWLAVLCGLLLALMLFLLPEYHRNIHQPLVEISLWASLGWWIVALLLVL
FT                   FYPGSAAIWRNSKTLRLIFGVLTIVPFFWGMLALRAWHYDENHYSGAIWLLYVMILVWG
FT                   ADSGAYMFGKLFGKHKLAPKVSPGKTWQGFIGGLATAAVISWGYGMWANLDVAPVTLLI
FT                   CSIVAALASVLGDLTESMFKREAGIKDSGHLIPGHGGILDRIDSLTAAVPVFACLLLLV
FT                   FRTL"
FT   gene            199838..201190
FT                   /gene="rseP"
FT                   /locus_tag="G2583_0179"
FT   CDS_pept        199838..201190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseP"
FT                   /locus_tag="G2583_0179"
FT                   /product="Regulator of sigma E protease"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54832"
FT                   /db_xref="GOA:D3QWH6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWH6"
FT                   /protein_id="ADD54832.1"
FT                   /translation="MLSFLWDLASFIVALGVLITVHEFGHFWVARRCGVRVERFSIGFG
FT                   KALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPVVPELRHHAFNNKSVGQRAAIIAAG
FT                   PVANFIFAIFAYWLVFIIGVPGVRPVVGEIAANSIAAEAQIAPGTELKAVDGIETPDWD
FT                   AVRLQLVDKIGDESTTITVAPFGSDQRRDVKLDLRHWAFEPDKEDPVSSLGIRPRGPQI
FT                   EPVLENVQPNSAASKAGLQAGDRIVKVDGQPLTQWVTFVMLVRDNPGKSLALEIERQGS
FT                   PLSLTLIPESKPGNGKAIGFVGIEPKVIPLPDEYKVVRQYGPFNAIVEATDKTWQLMKL
FT                   TVSMLGKLITGDVKLNNLSGPISIAKGAGMTAELGVVYYLPFLALISVNLGIINLFPLP
FT                   VLDGGHLLFLAIEKIKGGPVSERVQDFCYRIGSILLVLLMGLALFNDFSRL"
FT   gene            201220..203652
FT                   /gene="yaeT"
FT                   /locus_tag="G2583_0180"
FT   CDS_pept        201220..203652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeT"
FT                   /locus_tag="G2583_0180"
FT                   /product="Outer membrane protein assembly factor yaeT
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54833"
FT                   /db_xref="GOA:D3QWH7"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWH7"
FT                   /protein_id="ADD54833.1"
FT                   /translation="MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLS
FT                   MPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKS
FT                   VKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRV
FT                   DLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGD
FT                   LETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHS
FT                   AEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVN
FT                   VDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVD
FT                   TDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGI
FT                   NGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGF
FT                   PINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGW
FT                   TYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRW
FT                   GYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQD
FT                   GAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQ
FT                   YSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW"
FT   gene            203774..204259
FT                   /gene="skp"
FT                   /locus_tag="G2583_0181"
FT   CDS_pept        203774..204259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="skp"
FT                   /locus_tag="G2583_0181"
FT                   /product="Chaperone protein skp precursor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54834"
FT                   /db_xref="GOA:D3QWH8"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWH8"
FT                   /protein_id="ADD54834.1"
FT                   /translation="MKKWLLAAGLGLALATSAQAADKIAIVNMGSLFQQVAQKTGVSNT
FT                   LENEFKGRASELQRMETDLQAKMKKLQSMKAGSDRTKLEKDVMAQRQTFAQKAQAFEQD
FT                   RARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDANAVAYNSSDVKDITADVLKQVK"
FT   gene            204263..205288
FT                   /gene="lpxD"
FT                   /locus_tag="G2583_0182"
FT   CDS_pept        204263..205288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="G2583_0182"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54835"
FT                   /db_xref="GOA:D3QWH9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWH9"
FT                   /protein_id="ADD54835.1"
FT                   /translation="MPSIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNP
FT                   KYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSA
FT                   VIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHE
FT                   IQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDD
FT                   TVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICD
FT                   KVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLERKVNQQ
FT                   D"
FT   gene            205393..205848
FT                   /gene="fabZ"
FT                   /locus_tag="G2583_0183"
FT   CDS_pept        205393..205848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="G2583_0183"
FT                   /product="(3R)-hydroxymyristoyl-(acyl carrier protein)
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54836"
FT                   /db_xref="GOA:D3QWI0"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWI0"
FT                   /protein_id="ADD54836.1"
FT                   /translation="MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVS
FT                   VNEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRP
FT                   VVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA"
FT   gene            205852..206640
FT                   /gene="lpxA"
FT                   /locus_tag="G2583_0184"
FT   CDS_pept        205852..206640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="G2583_0184"
FT                   /product="Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54837"
FT                   /db_xref="GOA:D3QWI1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWI1"
FT                   /protein_id="ADD54837.1"
FT                   /translation="MIDKSAFVHPTAIVEEGASIGANAHIGPFCIVGPHVEIGEGTVLK
FT                   SHVVVNGHTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQ
FT                   GGGLTKVGSDNLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQFC
FT                   IIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIEGLKRRGFSREAITAIRNAYKLI
FT                   YRSGKTLDEVKPEIAELAETYPEVKAFTDFFARSTRGLIR"
FT   gene            206640..207788
FT                   /gene="lpxB"
FT                   /locus_tag="G2583_0185"
FT   CDS_pept        206640..207788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="G2583_0185"
FT                   /product="Lipid-A-disaccharide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54838"
FT                   /db_xref="GOA:D3QWI2"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWI2"
FT                   /protein_id="ADD54838.1"
FT                   /translation="MTEQRPLTIALVAGETSGDILGAGLIRALKERVPNARFVGVAGPR
FT                   MQAEGCEAWYEMEELAVMGIVEVLGRLRRLLHIRADLTKRFGELKPDVFVGIDAPDFNI
FT                   TLEGNLKKQGIKTIHYVSPSVWAWRQKRVFKIGRATDLVLAFLPFEKAFYDKYNVPCRF
FT                   IGHTMADAMPLDPDKNSARDVLGIPYDAHCLALLPGSRGAEVEMLSADFLKTAQLLRQT
FT                   YPDLEIVVPLVNAKRREQFERIKAAVAPDLSVHLLDGMGREAMVASDAALLASGTAALE
FT                   CMLAKCPMVVGYRMKPFTFWLAKRLVKTDYVSLPNLLAGRELVKELLQEECEPQKLAAA
FT                   LLPLLANGKTSHAMHDTFRELHQQIRCNADEQAAQAVLELAQ"
FT   gene            207785..208381
FT                   /gene="rnhB"
FT                   /locus_tag="G2583_0186"
FT   CDS_pept        207785..208381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="G2583_0186"
FT                   /product="Ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54839"
FT                   /db_xref="GOA:D3QWI3"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWI3"
FT                   /protein_id="ADD54839.1"
FT                   /translation="MIEFVYPHTQLVAGVDEVGRGPLVGAVVTAAVILDPARPIAGLND
FT                   SKKLSEKRRLALCEEIKEKALSWSLGRAEPHEIDELNILHATMLAMQRAVAGLHIAPEY
FT                   VLIDGNRCPKLPMPAMAVVKGDSRVPEISAASILAKVTRDAEMAALDIVFPQYGFAQHK
FT                   GYPTAFHLEKLAEHGATEHHRRSFGPVKRALGLAS"
FT   gene            208418..211900
FT                   /gene="dnaE"
FT                   /locus_tag="G2583_0187"
FT   CDS_pept        208418..211900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="G2583_0187"
FT                   /product="DNA polymerase III subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54840"
FT                   /db_xref="GOA:D3QWI4"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWI4"
FT                   /protein_id="ADD54840.1"
FT                   /translation="MSEPRFVHLRVHSDYSMIDGLAKTAPLVKKAAALGMPALAITDFT
FT                   NLCGLVKFYGAGHGAGIKPIVGADFNVQCDLLGDELTHLTVLAANNTGYQNLTLLISKA
FT                   YQRGYGAAGPIIDRDWLIELNEGLILLSGGRMGDVGRSLLRGNSALVDECVAFYEEHFP
FT                   DRYFLELIRTGRPDEESYLHAAVELAEARGLPVVATNDVRFIDSSDFDAHEIRVAIHDG
FT                   FTLDDPKRPRNYSPQQYMRSEEEMCELFADIPEALANTVEIAKRCNVTVRLGEYFLPQF
FT                   PTGNMSTEDYLVKRAKEGLEERLAFLFPDEEERVKRRPEYDERLETELQVINQMGFPGY
FT                   FLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSM
FT                   PDFDVDFCMEKRDQVIEHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDR
FT                   ISKLIPPDPGMTLAKAFEAEPQLPEIYEADEEVKALIDMARKLEGVTRNAGKHAGGVVI
FT                   APTKITDFAPLYCDEEGKHPVTQFDKSDVEYAGLVKFDFLGLRTLTIINWALEMINKRR
FT                   AKNGEPPLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALV
FT                   ALFRPGPLQSGMVDNFIDRKHGREEISYPDVQWQHESLKPVLEPTYGIILYQEQVMQIA
FT                   QVLSGYTLGGADMLRRAMGKKKPEEMAKQRSVFAEGAEKNGINAELAMKIFDLVEKFAG
FT                   YGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKIL
FT                   PPDINSGLYHFHVNDDGEIVYGIGAIKGVGEGPIEAIIEARNKGGYFRELFDLCARTDT
FT                   KKLNRRVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAKAEAIGQADMFGVLAEE
FT                   PEQIEQSYASCQPWPEQVVLDGERETLGLYLTGHPINQYLKEIERYVGGVRLKDMHPTE
FT                   RGKVITAAGLVVAARVMVTKRGNRIGICTLDDRSGRLEVMLFTDALDKYQHLLEKDRIL
FT                   IVSGQVSFDDFSGGLKMTAREVMDIDEAREKYARGLAISLTDRQIDDQLLNRLRQSLEP
FT                   HRSGTIPVHLYYQRADARARLRFGATWRVSPSDRLLNDLRGLIGSEQVELEFD"
FT   gene            211913..212872
FT                   /gene="accA"
FT                   /locus_tag="G2583_0188"
FT   CDS_pept        211913..212872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="G2583_0188"
FT                   /product="Acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54841"
FT                   /db_xref="GOA:D3QWI5"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWI5"
FT                   /protein_id="ADD54841.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLRE
FT                   KSVELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGG
FT                   IARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEA
FT                   MAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA"
FT   gene            212971..215112
FT                   /gene="ldcC"
FT                   /locus_tag="G2583_0189"
FT   CDS_pept        212971..215112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldcC"
FT                   /locus_tag="G2583_0189"
FT                   /product="Lysine decarboxylase, constitutive"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54842"
FT                   /db_xref="GOA:D3QWI6"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWI6"
FT                   /protein_id="ADD54842.1"
FT                   /translation="MNIIAIMGPHGVFYKDEPIKELESALVAQGFQIIWPQNSVDLLKF
FT                   IEHNPRICGVIFDWDEYSLDLCSDINQLNEYLPLYAFINTHSTMDVSVQDMRMALCFFE
FT                   YALGQAEDIAIRMRQYTDEYLDNITPPFTKALFTYVKERKYTFCTPGHMGGTAYQKSPV
FT                   GCLFYDFFGGNTLKADVSISVTELGSLLDHTGPHLEAEEYIARTFGAEQSYIVTNGTST
FT                   SNKIVGMYAAPSGSTLLIDRNCHKSLAHLLMMNDVVPVWLKPTRNALGILGGIPRREFT
FT                   RDSIEEKVAATTQAQWPVHAVITNSTYDGLLYNTDWIKQTLDVPSIHFDSAWVPYTHFH
FT                   PIYQGKSGMSGERVAGKVIFETQSTHKMLAALSQASLIHIKGEYDEEAFNEAFMMHTTT
FT                   SPSYPIVASVETAAAMLRGNPGKRLINRSVERALHFRKEVQRLREESDGWFFDIWQPPQ
FT                   VDEAECWPVAPGEQWHGFNDADADHMFLDPVKVTILTPGMDEQGNMSEEGIPAALVAKF
FT                   LDERGIVVEKTGPYNLLFLFSIGIDKTKAMGLLRGLTEFKRSYDLNLRIKNMLPDLYAE
FT                   DPDFYRNMRIQDLAQGIHKLIRKHDLPGLMLRAFDTLPEMIMTPHQAWQRQIKGEVETI
FT                   ALEQLVGRVSANMILPYPPGVPLLMPGEMLTKESRTVLDFLLMLCSVGQHYPGFETDIH
FT                   GAKQDEDGVYRVRVLKMAG"
FT   gene            215169..215558
FT                   /gene="yaeR"
FT                   /locus_tag="G2583_0190"
FT   CDS_pept        215169..215558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeR"
FT                   /locus_tag="G2583_0190"
FT                   /product="Putative lactoylglutathione lyase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54843"
FT                   /db_xref="GOA:D3QWI7"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWI7"
FT                   /protein_id="ADD54843.1"
FT                   /translation="MLGLKQVHHIAIIATDYAVSKAFYCDILGFTLQSEVYREARDSWK
FT                   GDLALNGQYVIELFSFPFPPERPSRPEACGLRHLAFSVDDIDAAVAHLESHNVKCEAIR
FT                   VDPYTQKRFTFFNDPDGLPLELYEQ"
FT   gene            215623..216918
FT                   /gene="tilS"
FT                   /locus_tag="G2583_0191"
FT   CDS_pept        215623..216918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="G2583_0191"
FT                   /product="tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine
FT                   synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54844"
FT                   /db_xref="GOA:D3QWI8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWI8"
FT                   /protein_id="ADD54844.1"
FT                   /translation="MTLTLNRQLLTSRQILVAFSGGLDSTVLLHQLVQWRTENPGVALR
FT                   AIHVHHGLSANADAWVTHCENVCQQWQVPLVVERVQLAQEGLGIEAQARQARYQAFART
FT                   LLPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMAEVSEFAGTRLIRPLLARTRGEL
FT                   AQWALAHGLRWIEDESNQDDSYDRNFLRLRVVPLLQQRWPHFAETTARSAALCAEQESL
FT                   LDELLADDLAHCQSPQGTLQIVPMLAMSDARRAAIIRRWLAGQNAPMPSRDALVRIWQE
FT                   VALAREDASPCLRLGAFEIRRYQSQLWWIKSVTGQSENIVPWQTWLQPLELPAGLGSVQ
FT                   LNAGGDIRPPRADEAVSVRFKAPGLLHIVGRNGGRKLKKIWQELGVPPWLRDTTPLLFY
FT                   GETLIAAAGVFVTQEGVAEGENGISFVWQRNA"
FT   gene            complement(216971..217231)
FT                   /gene="rof"
FT                   /locus_tag="G2583_0192"
FT   CDS_pept        complement(216971..217231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rof"
FT                   /locus_tag="G2583_0192"
FT                   /product="Rof protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54845"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR038626"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWI9"
FT                   /protein_id="ADD54845.1"
FT                   /translation="MSMNDTYQPINCDDYDNLELACQHHLMLTLELKDGEKLQAKASDL
FT                   VSRKNVEYLVVEAAGETRELRLDKITSFSHPEIGTVVVSES"
FT   gene            complement(217218..217436)
FT                   /gene="yaeP"
FT                   /locus_tag="G2583_0193"
FT   CDS_pept        complement(217218..217436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeP"
FT                   /locus_tag="G2583_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54846"
FT                   /db_xref="InterPro:IPR009624"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWJ0"
FT                   /protein_id="ADD54846.1"
FT                   /translation="MLTGGHVEKYCELIRKRYAEIASGDLGYVPDALGCVLKVLNEMAA
FT                   DDALSEAVREKAAYAAANLLVSDYVNE"
FT   gene            217584..218129
FT                   /gene="yaeQ"
FT                   /locus_tag="G2583_0194"
FT   CDS_pept        217584..218129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeQ"
FT                   /locus_tag="G2583_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54847"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWJ1"
FT                   /protein_id="ADD54847.1"
FT                   /translation="MALKATIYKATVNVADLDRNQFLDASLTLARHPSETQVRMMLRLL
FT                   AWLKYADERLQFTRGLCADDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQAAEVAL
FT                   FTYNSRAAQIWWQQNQSKCAQFANLSVWYLDDEQLAKVSAFADRTMTLQATIQDGVIWL
FT                   SDDKNNLEVNLTAWQQPS"
FT   gene            218126..218548
FT                   /gene="yaeJ"
FT                   /locus_tag="G2583_0195"
FT   CDS_pept        218126..218548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeJ"
FT                   /locus_tag="G2583_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54848"
FT                   /db_xref="GOA:D3QWJ2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWJ2"
FT                   /protein_id="ADD54848.1"
FT                   /translation="MIVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRA
FT                   SSLPEYYKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAVIKDLTTEQKA
FT                   RRPTRPTRASKERRLASKAQKSSVKAMRGKVRSGRE"
FT   gene            218562..219272
FT                   /gene="nlpE"
FT                   /locus_tag="G2583_0196"
FT   CDS_pept        218562..219272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpE"
FT                   /locus_tag="G2583_0196"
FT                   /product="Copper homeostasis protein CutF"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54849"
FT                   /db_xref="InterPro:IPR007298"
FT                   /db_xref="InterPro:IPR033450"
FT                   /db_xref="InterPro:IPR038139"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWJ3"
FT                   /protein_id="ADD54849.1"
FT                   /translation="MVKKAIVTAMAVISLFTLMGCNNRAEVDTLSPAQAAELKPMPQSW
FT                   RGVLPCADCEGIETSLFLEKDGTWVMNERYLGAREEPSSFASYGTWARTADKLVLTDSK
FT                   GEKSYYRAKGDALEMLDREGNPIESQFNYTLEPAQSSLPMTPMTLRGMYFYMADAATFT
FT                   DCATGKRFMVANNAELERGYLAARGHSEKPVLLSVEGHFTLEANPDTGAPTKVLAPDTA
FT                   GKFYPNQDCSSLGQ"
FT   gene            complement(219472..220296)
FT                   /gene="yaeF"
FT                   /locus_tag="G2583_0197"
FT   CDS_pept        complement(219472..220296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeF"
FT                   /locus_tag="G2583_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54850"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWJ4"
FT                   /protein_id="ADD54850.1"
FT                   /translation="MDKPKAYCRLLLPCFLLLSACTVDISQPDSSATAVDAEAKTWAVK
FT                   FQHQSSFTEQSIKEITVPDLKPGDLLFSSSLGVTSFGIRVFSTSSVSHVAIYLGENNVA
FT                   EATGAGVQIVSLKKAMKHSDKLFVLRVPDLTPQQATEITAFANKIKDSGYNYRGIVEFI
FT                   PFMVTRQMCSLNPFSEDFRQQCVSGLAKAQLSSVVEGDKKSWFCSEFVTDAFAKAGHPL
FT                   TLAQSGWISPADLMHMRIGDVSAFKPETQLQYVGHLKPGIYIKAGRFVGLTR"
FT   gene            complement(220349..222067)
FT                   /gene="proS"
FT                   /locus_tag="G2583_0198"
FT   CDS_pept        complement(220349..222067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="G2583_0198"
FT                   /product="Prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54851"
FT                   /db_xref="GOA:D3QWJ5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWJ5"
FT                   /protein_id="ADD54851.1"
FT                   /translation="MRTSQYLLSTLKETPADAEVISHQLMLRAGMIRKLASGLYTWLPT
FT                   GVRVLKKVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRGERPF
FT                   VLGPTHEEVITDLIRNELSSYKQLPLNFYQIQTKFRDEVRPRFGVMRSREFLMKDAYSF
FT                   HTSQESLQETYDAMYAAYSKIFSRMGLDFRAVQADTGSIGGSASHEFQVLAQSGEDDVV
FT                   FSDTSDYAANIELAEAIAPKEPRAAATQEMTLVDTPNAKTIAELVEQFNLPIKKTVKTL
FT                   LVKAVEGSSFPLVALLVRGDHELNEVKAEKLPQVASPLTFATEEEIRAVVKAGPGSLGP
FT                   VNMPIPVVIDRTVAAMSDFTAGANIDGKHYFGINWDRDVATPEVADIRNVVAGDPSPDG
FT                   QGTLLIKRGIEVGHIFQLGTKYSEALKASVQGEDGRNQILTMGCYGIGVTRVVAAAIEQ
FT                   NYDERGIVWPDAIAPFQVAILPMNMHKSFRVQELAEKLYSELRAQGIEVLLDDRKERPG
FT                   VMFADMELIGIPHTIVLGDRNLDNDDIEYKYRRNGEKQLIKTGDIVEYLVKQIKG"
FT   gene            complement(222178..222885)
FT                   /gene="yaeB"
FT                   /locus_tag="G2583_0199"
FT   CDS_pept        complement(222178..222885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeB"
FT                   /locus_tag="G2583_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54852"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWJ6"
FT                   /protein_id="ADD54852.1"
FT                   /translation="MSSFQFEQIGVIRSPYKEKFAVPRQPGLVKSANGELHLIAPYNQA
FT                   DAVRGLEAFSHLWILFVFHQTMEGGWRPTVRPPRLGGNARMGVFATRSTFRPNPIGMSL
FT                   VELKEVVCHKDCVILKLGSLDLVDGTPVVDIKPYLPFAESLPDASASYAQSAPAAEMAV
FT                   SFTAEVEKQLLTLEKRYPQLTLFIREVLAQDPRPAYRKGEETGKTYAVWLHDFNVRWRV
FT                   TDAGFEVFALEPR"
FT   gene            complement(222882..223286)
FT                   /gene="rcsF"
FT                   /locus_tag="G2583_0200"
FT   CDS_pept        complement(222882..223286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="G2583_0200"
FT                   /product="Regulator in colanic acid synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54853"
FT                   /db_xref="GOA:D3QWJ7"
FT                   /db_xref="InterPro:IPR030852"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWJ7"
FT                   /protein_id="ADD54853.1"
FT                   /translation="MRALPICLVALMLSGCSMLSRSPVEPVQSTAPQPKAEPAKPKAPR
FT                   ATPVRIYTNAEELVGKPFRDLGEVSGDSCQASNQDSPPSIPTARKRMQINASKMKANAV
FT                   LLHSCEVTSGTPGCYRQALCIGSALNITAK"
FT   gene            complement(223404..224219)
FT                   /gene="metQ"
FT                   /locus_tag="G2583_0201"
FT   CDS_pept        complement(223404..224219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="G2583_0201"
FT                   /product="D-methionine-binding lipoprotein metQ precursor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54854"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWJ8"
FT                   /protein_id="ADD54854.1"
FT                   /translation="MAFKFKTFAAVGALIGSLALVGCGQDEKDPNHIKVGVIVGAEQQV
FT                   AEVAQKVAKDKYGLDVELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQLKDRGYKLV
FT                   AVGNTFVYPIAGYSKKIKSLDELQDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVGL
FT                   LPTVLDVVENPKNLKIVELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKNGIFVED
FT                   KDSPYVNLIVTREDNKDAENVKKFVQAYQSDEVYEAANKVFNGGAVKGW"
FT   gene            complement(224259..224912)
FT                   /gene="metI"
FT                   /locus_tag="G2583_0202"
FT   CDS_pept        complement(224259..224912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metI"
FT                   /locus_tag="G2583_0202"
FT                   /product="D-methionine transport system permease protein
FT                   metI"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54855"
FT                   /db_xref="GOA:D3QWJ9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWJ9"
FT                   /protein_id="ADD54855.1"
FT                   /translation="MSEPMMWLLVRGVWETLAMTFVSGFFGFVVGLPVGVLLYVTRPGQ
FT                   IIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFI
FT                   ARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVILVYLIQFAGDRIVRAVTRK"
FT   gene            complement(224905..225936)
FT                   /gene="metN"
FT                   /locus_tag="G2583_0203"
FT   CDS_pept        complement(224905..225936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="G2583_0203"
FT                   /product="Methionine import ATP-binding protein metN"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54856"
FT                   /db_xref="GOA:D3QWK0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWK0"
FT                   /protein_id="ADD54856.1"
FT                   /translation="MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKS
FT                   TLIRCVNLLERPTEGSVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVA
FT                   LPLELDNTPKDEIKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLL
FT                   CDEATSALDPATTRSILELLKDINRRLGSTILLITHEMDVVKRICDCVAVISNGELIEQ
FT                   DTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYQERLQAEPFTDCVPMLRLEFTGQSVDAP
FT                   LLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQQDTQAAIAWLQEHHVKVEVL
FT                   GYV"
FT   gene            226124..226699
FT                   /gene="gmhB"
FT                   /locus_tag="G2583_0204"
FT   CDS_pept        226124..226699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhB"
FT                   /locus_tag="G2583_0204"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54857"
FT                   /db_xref="GOA:D3QWK1"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWK1"
FT                   /protein_id="ADD54857.1"
FT                   /translation="MAKSVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKM
FT                   GFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFR
FT                   QVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITP
FT                   EAGNAADWVLNSLADLPQAIKKQQKPAQ"
FT   gene            227062..228603
FT                   /locus_tag="G2583_0205"
FT   rRNA            227062..228603
FT                   /locus_tag="G2583_0205"
FT                   /product="16S ribosomal RNA"
FT   gene            228672..228748
FT                   /locus_tag="G2583_0206"
FT   tRNA            228672..228748
FT                   /locus_tag="G2583_0206"
FT                   /product="tRNA-Ile"
FT   gene            228790..228867
FT                   /locus_tag="G2583_0207"
FT   tRNA            228790..228867
FT                   /locus_tag="G2583_0207"
FT                   /product="tRNA-Ala"
FT   gene            229050..231952
FT                   /locus_tag="G2583_0208"
FT   rRNA            229050..231952
FT                   /locus_tag="G2583_0208"
FT                   /product="23S ribosomal RNA"
FT   gene            232047..232162
FT                   /locus_tag="G2583_0209"
FT   rRNA            232047..232162
FT                   /locus_tag="G2583_0209"
FT                   /product="5S ribosomal RNA"
FT   gene            232216..232294
FT                   /locus_tag="G2583_0210"
FT   tRNA            232216..232294
FT                   /locus_tag="G2583_0210"
FT                   /product="tRNA-Asp"
FT   gene            232456..233259
FT                   /gene="dkgB"
FT                   /locus_tag="G2583_0211"
FT   CDS_pept        232456..233259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dkgB"
FT                   /locus_tag="G2583_0211"
FT                   /product="2,5-diketo-D-gluconic acid reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54858"
FT                   /db_xref="GOA:D3QWK2"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWK2"
FT                   /protein_id="ADD54858.1"
FT                   /translation="MAIPAFGLGTFRLKDDVVISSVKTALELGYRAIDTAQIYDNEAAV
FT                   GLAIAESGVPRHELYITTKIWIENLSKDKLIPSLKESLQKLRTDYVDLTLIHWPSPNDE
FT                   VSVEEFMQALLEAKKEGLTREIGISNFTIPLMEKAIAAVGAENIATNQIELSPYLQNRK
FT                   VVAWAKQHGIHITSYMTLAYGKALKDEVIARIAAKHNATPAQVILAWAMGEGYSVIPSS
FT                   TKRENLESNLKAQNLQLDAEDKKAIAALDCNDRLVSPEGLAPEWD"
FT   gene            complement(233256..234170)
FT                   /gene="yafC"
FT                   /locus_tag="G2583_0212"
FT   CDS_pept        complement(233256..234170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafC"
FT                   /locus_tag="G2583_0212"
FT                   /product="putative transcriptional regulator LYSR-type"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54859"
FT                   /db_xref="GOA:D3QWK3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWK3"
FT                   /protein_id="ADD54859.1"
FT                   /translation="MKATSEELAIFVSVVESGSFSRAAEQLGQANSAVSRAVKKLEMKL
FT                   GVSLLNRTTRQLSLTEEGERYFRRVQSILQEMAAAESEIMETRNTPRGLLRIDAATPVV
FT                   LHFLMPLIKPFRERYPEVTLSLVSSETIINLIERKVDVAIRAGTLTDSSLRARPLFNSY
FT                   RKIIASPDYISRYGKPETIDDLKQHVCLGFTEPASLNTWPVACSDGQLHEVKYGLSSNS
FT                   GETLKQLCLSGNGIACLSDYMIDREIARGELVELMADKVLPVEMPFSAVYYSDRAVSTR
FT                   IRAFIDFLSEHVKTAPGGAVREA"
FT   gene            234411..235211
FT                   /gene="yafD"
FT                   /locus_tag="G2583_0213"
FT   CDS_pept        234411..235211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafD"
FT                   /locus_tag="G2583_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54860"
FT                   /db_xref="GOA:D3QWK4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR022958"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWK4"
FT                   /protein_id="ADD54860.1"
FT                   /translation="MRKNTYAMRYVAGQPAERILPPGSFASIGQALPPGEPLSTEERIR
FT                   ILVWNIYKQQRAEWLSVLKNYGKDAHLVLLQEAQTTPELVQFATANYLAADQVPAFVLP
FT                   QHPSGVMTLSAAHPVYCCPLREREPILRLAKSALVTVYPLPDTRLLMVVNIHAVNFSLG
FT                   VDVYSKQLLPIGDQIAHHSGPVIMAGDFNAWSRRRMNALYRFAREMSLRQVRFTDDQRR
FT                   RAFGRPLDFVFYRGLNVSEASVLVTRASDHNPLLVEFSPGKPDK"
FT   gene            235289..236059
FT                   /gene="yafE"
FT                   /locus_tag="G2583_0214"
FT   CDS_pept        235289..236059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafE"
FT                   /locus_tag="G2583_0214"
FT                   /product="Methyltransferase, UbiE/COQ5 family"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54861"
FT                   /db_xref="GOA:D3QWK5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWK5"
FT                   /protein_id="ADD54861.1"
FT                   /translation="MTTQSHHDHVEKQFSSQASEYLTSTVHASGRDLQRLAVCLADYPD
FT                   ASVLDMGCGAGHASFVAAQNVSTVVAYDLSAQMLDVVAQAAEVRQLKNITTRQGYAESL
FT                   PFADNAFDIVISRYSAHHWHDVGAALREVNRILKPGGRLIVMDVMSPGHPVRDIWLQTV
FT                   EALCDTSHVRNYASGEWLRLINEANLIVDNLITDKLPLEFSSWVARMRTPEALVDAIRI
FT                   YQQSASTEVRTYFALQNDGSFTSDIIMVDAHKAA"
FT   gene            complement(236107..237465)
FT                   /gene="mltD"
FT                   /locus_tag="G2583_0215"
FT   CDS_pept        complement(236107..237465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltD"
FT                   /locus_tag="G2583_0215"
FT                   /product="Membrane-bound lytic murein transglycosylase D
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54862"
FT                   /db_xref="GOA:D3QWK6"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWK6"
FT                   /protein_id="ADD54862.1"
FT                   /translation="MKAKAILLASVLLVGCQSTGNVQQHAQSLSAAGQGEAAKFTSQAR
FT                   WMDDGTSIAPDGDLWAFIGDELKMGIPENDRIREQKQKYLRNKSYLHDVTLRAEPYMYW
FT                   IAGQVKKRNMPMELVLLPIVESAFDPHATSGANAAGIWQIIPSTGRNYGLKQTRNYDAR
FT                   RDVVASTTAALNMMQRLNKMFDGDWLLTVAAYNSGEGRVMKAIKTNKARGKSTDFWSLP
FT                   LPQETKQYVPKMLALSDILKNSKRYGVRLPTTDESRALARVHLSSPVEMAKVADMAGIS
FT                   VSKLKTFNAGVKGSTLGASGPQYVMVPKKHADQLRESLASGEIAAVQSTLVADNTPLNS
FT                   RVYTVRSGDTLSSIASRLGVSTKDLQQWNKLRGSKLKPGQSLTIGAGSSAQRLANNSDS
FT                   ITYRVRKGDSLSSIAKRHGVNIKDVMRWNSDTANLQPGDKLTLFVKNNSMPDS"
FT   gene            complement(237537..238292)
FT                   /gene="gloB"
FT                   /locus_tag="G2583_0216"
FT   CDS_pept        complement(237537..238292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="G2583_0216"
FT                   /product="Hydroxyacylglutathione hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54863"
FT                   /db_xref="GOA:D3QWK7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWK7"
FT                   /protein_id="ADD54863.1"
FT                   /translation="MNLNSIPAFDDNYIWVLNDEAGRCLIVDPGDAEPVLNAIAANNWQ
FT                   PEAIFLTHHHHDHVGGVKELVEKFPQIVVYGPQETQDKGTTQVVKDGETAFVLGHEFSV
FT                   IATPGHTLGHICYFSKPYLFCGDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCC
FT                   AHEYTLSNMKFALSILPHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDI
FT                   DLINVINEETLLQQPEERFAWLRSKKDRF"
FT   gene            238308..239048
FT                   /gene="yafS"
FT                   /locus_tag="G2583_0217"
FT   CDS_pept        238308..239048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafS"
FT                   /locus_tag="G2583_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54864"
FT                   /db_xref="GOA:D3QWK8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWK8"
FT                   /protein_id="ADD54864.1"
FT                   /translation="MKRKVVMKPARVPQTVVAPDRWGDLPWGELYRKALERQLNPWFTK
FT                   MYGFHLLKIGNLSAEINCEACAVSHQVNVSAQGMPVQVQADPLHLPFADKSVDVCLLAH
FT                   TLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLM
FT                   RQLDWLSLLNFEVLHASRFHVLPWNKHGGKLLNAHIPALGCLQLIVARKRTIPLTLNPM
FT                   KQSKNKPRIRQAVGATRQCRKPQA"
FT   gene            complement(239045..239512)
FT                   /gene="rnhA"
FT                   /locus_tag="G2583_0218"
FT   CDS_pept        complement(239045..239512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="G2583_0218"
FT                   /product="RNase HI"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54865"
FT                   /db_xref="GOA:D3QWK9"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWK9"
FT                   /protein_id="ADD54865.1"
FT                   /translation="MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNN
FT                   RMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLW
FT                   QRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV"
FT   gene            239577..240308
FT                   /gene="dnaQ"
FT                   /locus_tag="G2583_0219"
FT   CDS_pept        239577..240308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="G2583_0219"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54866"
FT                   /db_xref="GOA:D3QWL0"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWL0"
FT                   /protein_id="ADD54866.1"
FT                   /translation="MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTG
FT                   NNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDI
FT                   GFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHG
FT                   ALLDAQILAEVYLAMTGGQTSMAFAMEGETQQQQGEATIQRLVRQASKLRVVFATDEEL
FT                   AAHEARLDLVQKKGGSCLWRA"
FT   gene            240440..240518
FT                   /locus_tag="G2583_0220"
FT   tRNA            240440..240518
FT                   /locus_tag="G2583_0220"
FT                   /product="tRNA-Asp"
FT   gene            240845..241645
FT                   /gene="yafT"
FT                   /locus_tag="G2583_0221"
FT   CDS_pept        240845..241645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafT"
FT                   /locus_tag="G2583_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54867"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWL1"
FT                   /protein_id="ADD54867.1"
FT                   /translation="MNSKKLCCICVLFSLLAGCASESSIDEKKKKAQVTQSNINKNTPQ
FT                   QLTDKDLFGNETTLAVSEEDIQAALDGDEFRVPLNSPVILVQSGNRAPETIMQEEMRKY
FT                   YTVSTFSGIPDRQKPLTCNKNKDKNENEDVARAENMNWMQALRFVAAKGHQKAIIVYQD
FT                   MLQTGKYDSALKSTVWSDYKNEKLTDAISLRYLVRFTLVDVATGEWATWSPVNYESRVI
FT                   FPPAGITKTSNKELSNDHVTEAQLFNLKQKTYVSMVKDLVSRFQ"
FT   gene            complement(241830..242126)
FT                   /locus_tag="G2583_0222"
FT   CDS_pept        complement(241830..242126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54868"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWL2"
FT                   /protein_id="ADD54868.1"
FT                   /translation="MIIINLRLTLLFILATFTYSVQSDEFDDQTTYTQYRYFSTAIPED
FT                   IRRFMFYVDYCFVDLAFDIETDSMTAKNDIINECTPLKERNKTLKEKYKKMKR"
FT   gene            complement(242123..242578)
FT                   /locus_tag="G2583_0223"
FT   CDS_pept        complement(242123..242578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54869"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWL3"
FT                   /protein_id="ADD54869.1"
FT                   /translation="MRMRKITIILLLTFSCTKGLAFDISMSKECSGVDELEFIDCVKNS
FT                   FIMSTITLKKAEANIKEKIQKWNSDEDEAIRKEAVISLKRLESSNREFIRYRFAQCSFT
FT                   LTWGARVGRLAFSRLYPCYTELNKIRAMQLNNAYISDFQNPDEISSK"
FT   gene            complement(242575..243471)
FT                   /locus_tag="G2583_0224"
FT   CDS_pept        complement(242575..243471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54870"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWL4"
FT                   /protein_id="ADD54870.1"
FT                   /translation="MANNILHSSTSDSESKNTSTDSTLFNEKFPFQLRQDFASRITEDE
FT                   SDFFKWKKIRELAFVSNHKEWNKYDLLILKSVNEINIHLSSTPYFQPLDWYIIKAMLWT
FT                   ENDAENTSQWNGYPLQIGRFRKDKAMPALISGEKSTALVTPPQWRNKAFNGLKDPERNY
FT                   WAKEQITGSPEENIKAAITYLMMKLSNTKEESTIDQYDSTLYSAIVQKGDLADNIRKER
FT                   KTTIPNLTKNNPGKNLDKIHPGDILYYQKASMKVIITGWKPITIKNVAMNHNGGGDPKY
FT                   AIKLQFVYTLLTKNRVL"
FT   gene            complement(243492..243971)
FT                   /gene="yhhZ"
FT                   /locus_tag="G2583_0225"
FT   CDS_pept        complement(243492..243971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhhZ"
FT                   /locus_tag="G2583_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54871"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWL5"
FT                   /protein_id="ADD54871.1"
FT                   /translation="MANLIYLTLNGDNQGLISSGCSSQPSIGNKAQTAHIDQIMIYEFM
FT                   HGLNRDQNVNHHHLTIKKPIDKASPLLGKAICDNELLTCDFSFYRTNKFGINELYYKIK
FT                   LTGAKISDIHVSISHIVVDNSVQPEESVSFSYESIIWEHCSAGTSAYSLWEDRLF"
FT   gene            complement(243937..245436)
FT                   /gene="impA"
FT                   /locus_tag="G2583_0226"
FT   CDS_pept        complement(243937..245436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impA"
FT                   /locus_tag="G2583_0226"
FT                   /product="ImpA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54872"
FT                   /db_xref="GOA:D3QWL6"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR021069"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWL6"
FT                   /protein_id="ADD54872.1"
FT                   /translation="MCIPTRKITRSAVGCSASLVCQTHCTEEAGMNSNVLTQTIVTGSD
FT                   PRGLPEFSAIREEINKASHPSQPELNWKLVESLALAIFKANGVDLHTATYYTLARTRTQ
FT                   GLAGFCEGAELLAAMVSHDWDKFWPQGGPARTEMLDWFNSRTGNILRQQISFAESDLPL
FT                   IYRTERALQLICDKLQQVELKRVPRVENLLYFMQNTRKRLEPQLKSNTENAAQTTVRTL
FT                   IYAPETQASSTPEAVVPPLPGLPEMKVEVRSLTENPPQASVIKQGSTVRGFIAGIACSV
FT                   AVASALWWWQVYPVQQQLLQVNDTAQGAATVWMASPELENYERRLQQLLDTSPVQPLET
FT                   GMQMMRVADSRWPESLQQQQASTQWNEALKTRAQSSPQLRGWLQTRQDLHAFADLVMQR
FT                   EKEGLTLSYIKNVIWQAERGLGQETPVESLLTQYQDARAQKQNTDALEKQINERLEGVL
FT                   SRWLLLKNNTIPTIKKALNFNNIHEYKGVLNGEFNLFNTKW"
FT   gene            complement(245357..248821)
FT                   /locus_tag="G2583_0227"
FT   CDS_pept        complement(245357..248821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0227"
FT                   /product="putative macrophage toxin"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54873"
FT                   /db_xref="GOA:D3QWL7"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWL7"
FT                   /protein_id="ADD54873.1"
FT                   /translation="MPRFKVSAFWLLILAWIFLLVWIWWKGPTWTLYEEQWLKPLANRW
FT                   LATAAWGIIALVWLTVRVMKRLQLLEKQQKQQREEAIDPLSVELNAQQRYLDRWLLRLQ
FT                   RHLDNRRFLWQLPWYMVIGPAGSGKTTLLREGFPSDIIYAPEGARGTEQRLYLTPHVGK
FT                   QAVIFDIDGTLCAPADADILHRRLWEHALGWLKEKRARQPLNGIILTLDLPDLLTADKR
FT                   HREHLLQTLRSRLQDIRQHLHCQLPVYVVLTRLDLLQGFAALFQSLNRQDRDAILGVTF
FT                   TRRAHENDDWRTELNAFWQTWVDRMNLALPDLMVTQTHTRASLFSFSRQMQGSREPLVS
FT                   LLEGLLDGENMNVMLRGVYLTSSLQRGQMDDIFTQSAARQYRLGNNPLASWPLVDTAPY
FT                   FTRSLFPQALLAEPNLATESRAWLMRSRRRLTVFSATGGVAALLLITGWHHYYNGNYQS
FT                   GITVLKQAKAFMDVPPPQGEDDYGNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGR
FT                   RIGPYVEQTYLQLLEQRYLPSLFNGLVKAMNAAPPESEEKLAVLRVMRMLEDKSGRNNE
FT                   VVKQYMAKRWSEKFHGQRDIQAQLMSHLDYALAHTDWHAERQAGDGDAISRWTPYDKPV
FT                   VSAQKELSKLPVYQRVYQSLKTRALGVLPADLNLRDQVGPTFDQVFTSADDNKLVVPQF
FT                   LTRYGLQSYFVKQRDELVELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYISDYTAT
FT                   WRAGMDNLNIRNFESIGQLTGALEQVISGDQPLQRALTVLRDNTQPGVFSEKLSAKERD
FT                   EALAEPDYQLLTRLGHEFAPENITLAVQKDKESTMQAVYQQLTELHRYLLAIQNAPVPG
FT                   KSALKAVQLRLDQNSSDPIFATRQMAKTLPAPLNRWVGRLTDQAWHVVMVEAVHYMEVD
FT                   WRDSVVKPFNEQLANNYPFNPRSAQDASLDAFERFFKPDGILDTFYQQNLKLFIDNDLS
FT                   LEDGDNNVIIREDIIAQLETAQKIRDIFFSKQNGLGTSFAVETVSLSGNKRRSVLNLDG
FT                   QLVDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGNAPRSISFSGPWAQFRLFGAGQL
FT                   TGVQDGNFTVRFSVDGGAMTYRVHTDTEDNPFSGGLFSQFGLSDTLY"
FT   gene            complement(248900..250312)
FT                   /gene="impA"
FT                   /locus_tag="G2583_0228"
FT   CDS_pept        complement(248900..250312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impA"
FT                   /locus_tag="G2583_0228"
FT                   /product="ImpA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54874"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017739"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWL8"
FT                   /protein_id="ADD54874.1"
FT                   /translation="MAMDLRDPNVWISHLLENLPEEKLASALKDDNPDWEYIDGEIVKL
FT                   GSLAHAQLDIPELQRRGLQLLASESKDFRLLAHLLRTLQHAGDPLLALHLLTLYVEHYW
FT                   TVAAPQNMAHKKRFASQIIKRFETGIEGFSQNAATTQRDTLLGELAKLAQCWQSHNVPE
FT                   LAQATDDLFALYQRTFNRAAPAPVPTPAASGSSPQTTVTSESGVTQPSAPAPQIAIDSH
FT                   DDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQSITSTPQAESDGRTPLAAVSADM
FT                   VADYQSRLASADMALWQQVEKSVLLAPYWLDGHCLSAQTALRLGYKQVADTIRDEVIRF
FT                   LERLPQLTGLLFNDRTPFLSEQTKQWLAASPDGKVAPVAQIGEESQAARACFAGQGLEA
FT                   ALRYLDMLPEGDPRDQFHRQYLAAQLTEEAGLIQLAQQQYRMLLMIGSQMMVSDWEPSL
FT                   LTQLEQKFTAEQ"
FT   gene            complement(250317..251060)
FT                   /locus_tag="G2583_0229"
FT   CDS_pept        complement(250317..251060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0229"
FT                   /product="Type VI secretion-associated protein, VC_A0118
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54875"
FT                   /db_xref="InterPro:IPR017738"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWL9"
FT                   /protein_id="ADD54875.1"
FT                   /translation="MSRLRVFRQTGWFIAGLMTGLPATAAPAEASSMAGVAVAVATTTP
FT                   PDATATLQAMQSCRRESAALERLDCYDHLLAPLSPSGFDGALVKAGFVGEAWTRATEQE
FT                   KRREGNTTELLVTQVPGERPTVVITTPAIGHVPPRPVLMFSCVDNITRMQVALMHPLDV
FT                   HDIAVTLNADSRALRSHWFVRENGTLLESSRGLSGIDEIKQLFGAKTLTVDTGADNAAG
FT                   KLTFNIDGLARAIAPLRDACHWAGE"
FT   gene            complement(251057..253840)
FT                   /gene="clpB"
FT                   /locus_tag="G2583_0230"
FT   CDS_pept        complement(251057..253840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="G2583_0230"
FT                   /product="type VI secretion ATPase, ClpV1 family"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54876"
FT                   /db_xref="GOA:D3QWM0"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWM0"
FT                   /protein_id="ADD54876.1"
FT                   /translation="MIQIDLPTLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQM
FT                   LAMPRSDLRVITRQGDIGMEELRQALTVENYTTARSADSYPAFSPMLVEWLKEGWLLAS
FT                   AEMQHSELRGGVLLLALLHSPLRYIPPAAARLLTGINRDRLQQDFVQWTQESAESVVPD
FT                   ADGKGAGTLTDASDTLLARYAKNMTEDARNGRLDPVLCRDHEIDLMIDILCRRRKNNPV
FT                   VVGEAGVGKSALIEGLALRIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKGL
FT                   MAEVISSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKK
FT                   YFEKDAALSRRFQLVKVSEPNAAEATIILRGLSAVYERSHGVLIDDDALQAAATLSERY
FT                   LSGRQLPDKAIDVLDTACARVAINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRT
FT                   DTSRMTEVLVQYDETLTALDELEAAWHQQQTLVREIIALRQQLLGVAEDDAAPLPDADT
FT                   VEDTQPESESESESESEQDNTGAVPADETDREQPEETAETVSPVQRLAQLTAELDALHN
FT                   DRLLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPKWLGDTIKGQDLAIASLH
FT                   KHLLTARADLRRPGRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEK
FT                   HTVSRLIGSPPGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEM
FT                   ADGEGRLIDCKNIVFFLTSNLGYQVIVEHADDPETMQEALYPVLADFFKPALLARMEVV
FT                   PYLPLSKETLATIIAGKLARLDNVLRSRFGAEVVIEPEVTDEIMSRVTRAENGARMLES
FT                   VIDGDMLPPLSLLLLQKMAANTAIARIRLSAVDGAFTADVEDAQNDESVTKDETVL"
FT   gene            complement(253849..254610)
FT                   /locus_tag="G2583_0231"
FT   CDS_pept        complement(253849..254610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54877"
FT                   /db_xref="GOA:D3QWM1"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWM1"
FT                   /protein_id="ADD54877.1"
FT                   /translation="MDEGSLSLPPFTGYDEKSLRDYHLALRGNSLNPMIDAATPLLGMV
FT                   MRLSTMNSQTMPEHLFAQVVTDVQAVEQLLQEQGYEPGVIISFRYILCTFIDEAALGNG
FT                   WSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIREPKRYQDLLEFLWLCFSLGFRGRY
FT                   KVAVQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLISRLTVKHIFCGG
FT                   VVVLALFYLFYLLRLDSQTQDILHQLNKLLR"
FT   gene            complement(254615..255946)
FT                   /locus_tag="G2583_0232"
FT   CDS_pept        complement(254615..255946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0232"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54878"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWM2"
FT                   /protein_id="ADD54878.1"
FT                   /translation="MATTRNKVMWQEGMLMRPHHFQQQQRYNDYLDNQRFRAMNDLSWG
FT                   FTELTLNNELLAQGKIMIDSASGTLPDGTVFSIPDQDALPDPLYPQNFPDERSRNIYLA
FT                   LPVASDVRNEISDGRRIGRYRLNYADVRDLHSEEGDARTLTLGQLTPRIMSGAEDMSAY
FT                   ITLPLCRISDRHADGSLTLDDDFIPSCQNIQVSKKLRVYLKEVQGAIGGRASDLANRIG
FT                   SPAQSGIADVAEFMMLQLLNRNQTRFTHRARRSQLHPEDFYLDLAGLLGELMTFTEPSR
FT                   LPCPLDVYDHHDLTKTFKTLLPEVKRALHTVLSPRAVNLPLHLRDGIWQADVHDSELLQ
FT                   SATFVLAVAANMPVDQIQRQFIQQSKISSPEKIRNMVSVQIPGIPLRALMVAPRQLPYH
FT                   SGFSYFELDKSGQAWTEMAAAGAVALHVSGSFPDLNMQLWAIRG"
FT   gene            complement(255949..256473)
FT                   /locus_tag="G2583_0233"
FT   CDS_pept        complement(255949..256473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0233"
FT                   /product="Type VI secretion lipoprotein, VC_A0113 family"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54879"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWM3"
FT                   /protein_id="ADD54879.1"
FT                   /translation="MNRKAFLACVLMCVILTGCETAKKISEVIKNPDIQVGSLKEQPSE
FT                   ITVTLLTEPDTNTNAEGESAAVDVQLVYLTDDSKLQAADYDQIASTPLPDVLGKNYIDH
FT                   QDFNLLPDTIKTLPPIKLDEKTQFIGVVAYFSDDQATEWKQIETVEGTGHHYRLLVHVR
FT                   QSSIEMKKEDE"
FT   gene            complement(256470..257480)
FT                   /locus_tag="G2583_0234"
FT   CDS_pept        complement(256470..257480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54880"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWM4"
FT                   /protein_id="ADD54880.1"
FT                   /translation="MRQGDEIQIGRLMVRVHLNRGDIPHYDEEMATPETIVTNRDMLTD
FT                   TLLSTEGAPHYPGMTHRHQLADTVVNGFSADPLQALQSESLITTGDPLSGIAAVRPSAP
FT                   LSDPASNGGINTPFMDLPPIYASPGDHNDDISAAEMAQRHLAVPPLLRGLGGSLTVSNS
FT                   DDADDFLEEAGRTLQAAIKGLLDLQQQRNSLSDKHLRPLEDNPLRLNMDYATALDVMFA
FT                   EGKSPVHLAAPAAVSESLRNVRHHEEANRAAIVESLRVLLDAFSPQNLLRRFVQYRRSH
FT                   ELRQPLDDAGAWQMYSHYYEELASDRQQGFEMLFNEVYAQVYDRVLREKQREPEA"
FT   gene            complement(257774..258856)
FT                   /locus_tag="G2583_0235"
FT   CDS_pept        complement(257774..258856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54881"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWM5"
FT                   /protein_id="ADD54881.1"
FT                   /translation="MDGKNRAASSYLSPGNPPADKEQNDPLAQVFHNACSYNFFAMAEL
FT                   LHRLAKGEKGTPELSLRDDPAQETLRFSADASLAFPCSDISALKRDTSGAFRMTTTFMG
FT                   LQGSQSPLPGYYLDHLAWKAVHEQSPVGDFLDMFSHRLTQFVWHIWRKYRYHISFRNGG
FT                   VDAFSQRMYSLVGLGHRQLRDKLAINHSKMLAYSGILANPGRSPEIICGLVSHCFDLSE
FT                   VTLQNWQRRKVDIEPDQQNSLGSYSLKNGEKLAGRSVLGNFVLGTRVPDLSGKFQLSIT
FT                   SLTRKQFLSFLPSGENFLPLTTFVSFILRDQLAWDLHLGLAPEQVGAMRLGDNKSALLG
FT                   WTSFLGTPEERPSVTIRVRS"
FT   gene            complement(258820..260670)
FT                   /locus_tag="G2583_0236"
FT   CDS_pept        complement(258820..260670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54882"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWM6"
FT                   /protein_id="ADD54882.1"
FT                   /translation="MEFEERYFREELDYLRQLSKLLATEKPHLARFLAEKDADPDIERL
FT                   LEGVAFLTGNLRQKIEDEFPELTHGLIKMLWPNYLRPVPAMTLIEYTPDMDKSSVPVLI
FT                   PRNEQFTTNAGEIRVDEVLPSDAKKEEPPPCTFTLCRDIWLLPVRLEQIENRSTTRNGV
FT                   INITFSVAPGTDFRTLDLNKLRFWLGNDDNYTRDQLYLWFCEYLQGADLTVGEQHIRLP
FT                   EFMLKAVGFEPQDAMLPWPKNVHSGYRILQEYFCYPDAFLFFDLCGCPALPDGLQAEFF
FT                   TLQLRFSRPLPVDIRLRRDSLRLYCAPAINLFIHHAEAITLDNRRADYPLVPSRHYPQH
FT                   YDVFSVNSVVSQVQDMFRKKDLGRPVSTQAARQWPAFESFSHQMEYSRKREVVYWHHRT
FT                   KTSLFHRGFDHTLAFIHADGSYPSDESLLSNEVVSVSLTCTNRELPSQIRSGDITGTTG
FT                   KNAAVASFRNITRPTQPLWPVIDGSLHWSLLSAMNLNYLSLLDTDALKQVIANFDRHAI
FT                   HHPQTARLSQQKLDAIERLETRPVDRLFTGIPVRGLASTLYLHPEPFVCEGEMYLLGTV
FT                   LSHFLSLYASVNSFHMLTVVNTESQETWKWTERIGQHPLI"
FT   gene            complement(260674..261087)
FT                   /locus_tag="G2583_0237"
FT   CDS_pept        complement(260674..261087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54883"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWM7"
FT                   /protein_id="ADD54883.1"
FT                   /translation="MIPDRERTTGSLFERMEASSARNRQGGSIHSLRQSIRQNLRNILN
FT                   TRSGSCRGAPELGIDEPEGAENFRESMSRAIEQCIERYEPRISHAEVQAVVSSASSPLD
FT                   MTFHITAWVTFNETHEVLEFDMAPNGSQHYRVD"
FT   gene            complement(261094..262569)
FT                   /pseudo
FT                   /locus_tag="G2583_0238"
FT                   /note="hypothetical protein"
FT   gene            complement(262620..262844)
FT                   /locus_tag="G2583_0239"
FT   CDS_pept        complement(262620..262844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54884"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWM8"
FT                   /protein_id="ADD54884.1"
FT                   /translation="MTAHKNISGTYHLSVADILQVVYQVCFSPSVEINQDGVAALITTL
FT                   DRRISDLLDEIIHFCEFQQSASHWQRVLH"
FT   gene            complement(262879..263379)
FT                   /locus_tag="G2583_0240"
FT   CDS_pept        complement(262879..263379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54885"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWM9"
FT                   /protein_id="ADD54885.1"
FT                   /translation="MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNT
FT                   QETSSLDERQAVSVNKHNFGAVMAEAAIGLNFTVPATLKGSTTDDELNVALNIKSLDDF
FT                   SPDSVARQVPEVNKLLELREALTALKGPMGNLPAFRTQLQALLENEESREQLLKEIGQV
FT                   SNK"
FT   gene            263806..263949
FT                   /locus_tag="G2583_0241"
FT   CDS_pept        263806..263949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54886"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWN0"
FT                   /protein_id="ADD54886.1"
FT                   /translation="MIQLWPFYGGNTDFEQLGMVIQIYIIKLLLNKRFNDFKNSFYDNR
FT                   KF"
FT   gene            264076..264594
FT                   /locus_tag="G2583_0242"
FT   CDS_pept        264076..264594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0242"
FT                   /product="Hcp"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54887"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWN1"
FT                   /protein_id="ADD54887.1"
FT                   /translation="MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFL
FT                   HNVTVPTDPQSGQPAGQRAHKPFIFTVALNKAVPLMYNALASGEMLPTTELHWWRTSVE
FT                   GKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQLLEVSLAYRKIEWEHVKSGTSGA
FT                   DDWRAPLEA"
FT   gene            264627..264764
FT                   /locus_tag="G2583_0243"
FT   CDS_pept        264627..264764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54888"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWN2"
FT                   /protein_id="ADD54888.1"
FT                   /translation="MLFLYYAVERKVVSKGLRSREMAAAGNFGGSVPERKRSTVLSQPL
FT                   "
FT   gene            264804..266945
FT                   /gene="vgrG"
FT                   /locus_tag="G2583_0244"
FT   CDS_pept        264804..266945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vgrG"
FT                   /locus_tag="G2583_0244"
FT                   /product="VgrG"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54889"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWN3"
FT                   /protein_id="ADD54889.1"
FT                   /translation="MSTGLRFTLEVDGLPPDAFAVVSFHLNQSLSSLFSLDLSLVSQQF
FT                   LSLEFQQILDKMAYLTIWQGDDVQRRVKGVVTWFELGENDKNQKLYSMKVCPPLWRTGL
FT                   RQNFRIFQNEDIASILGTILQENGVTEWSPLFSEPHPSREFCVQYGETDYDFLCRMAAE
FT                   EGIFFYEEHAQKSTDQSLVLCDTVRYLPESFEIPWNPNTRTEVSTLCISQFRYSAQIRP
FT                   SSVVTKDYTFKRPGWAGRFDQEGQHQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGWR
FT                   NNAEVARGTSRSPEIWPGRRIVLTGHPQANLNREWQVVASELHGEQPQAVPGRRGSGTT
FT                   LDNHFAVIPADRTWRPQPLLKPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNP
FT                   SNQDSSCWIRVAQAWAGTGFGNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPG
FT                   SLPGTKTQMTIRSKTYKGSGFNELKFDDATGKEQVYIHAQKNMNTEVLNNRTTDVINNH
FT                   AEKIGNNQAITVTNNQILNIGVNQIQTVGVNQVETVGSNQIIKVGSNQVEKVGIIRALT
FT                   VGVAYQTTVGGIMNTSVALLQSSQVGLHKSLMVGMGYSVNVGNNVTFSVGKTMKENTGQ
FT                   TAVYSAGEHLELCCGKARLVLTKDGSIFLNGTHIHLEGESDVNGDAPVINWNCGATQPV
FT                   PDAPVPKDLPPGMPDMRQF"
FT   gene            267021..271253
FT                   /pseudo
FT                   /gene="rhsG1"
FT                   /locus_tag="G2583_0245"
FT                   /note="rhsG-1"
FT   gene            271514..272110
FT                   /locus_tag="G2583_0246"
FT   CDS_pept        271514..272110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0246"
FT                   /product="Ankyrin repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54890"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWN4"
FT                   /protein_id="ADD54890.1"
FT                   /translation="MGVDLDARGDLGRTALHEAVSNGYFDIVKLLVESGADLTIKDEFG
FT                   KTALELAEVHQNYKIVEWLSHYRDHNPIPDFSVLINIYGERYFGGEIIDTDARTELGEG
FT                   VLHIAVRKRRQLDVRCFIQHGADINAKANNGFDFTPLHYSIGIGDFDMMKLLLKLGADI
FT                   YLESEMGYSPMDLAILMGDKRIIFYLYGYISHVSE"
FT   gene            272292..273800
FT                   /pseudo
FT                   /gene="rhsG2"
FT                   /locus_tag="G2583_0247"
FT                   /note="RhsG-2"
FT   gene            273803..274378
FT                   /gene="yibG"
FT                   /locus_tag="G2583_0248"
FT   CDS_pept        273803..274378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yibG"
FT                   /locus_tag="G2583_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54891"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWN5"
FT                   /protein_id="ADD54891.1"
FT                   /translation="MKVFTFLLIIMVCLYNFGVRAAMDNSKHSDEAEKLLAELSARKGE
FT                   GEGEPKSTVSVFYLQPEEVNTLSHQAKRGDGEAGFRLFLYYKLSNYDEEKSSQWLKIAA
FT                   NNGHATAQYRLYVELQEQGETKEANEWLQKIKLAASNNDSSAIWFLVNCYKNQGNKKEA
FT                   LQWAYKLKASKQPLDADRLIEELTKEQK"
FT   gene            274400..274582
FT                   /locus_tag="G2583_0249"
FT   CDS_pept        274400..274582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54892"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWN6"
FT                   /protein_id="ADD54892.1"
FT                   /translation="MESRKTLPVATTPTHKITFTTTATSSSKRKLKPKLASSSPVIITM
FT                   YLADASKVAREKMKI"
FT   gene            274726..275016
FT                   /locus_tag="G2583_0250"
FT   CDS_pept        274726..275016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0250"
FT                   /product="Hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54893"
FT                   /db_xref="GOA:D3QWN7"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWN7"
FT                   /protein_id="ADD54893.1"
FT                   /translation="MKIIRLLLLACSITIHFFIVKEHVFKIFNQHAYYFLFAFYVLIAF
FT                   CFLLFFKRSFIVDLIACIIIPYISSVISFLFLSMLISPHLRERSPNAAFLY"
FT   gene            275124..276260
FT                   /gene="yhhI"
FT                   /locus_tag="G2583_0251"
FT   CDS_pept        275124..276260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhhI"
FT                   /locus_tag="G2583_0251"
FT                   /product="ISEc3, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54894"
FT                   /db_xref="GOA:D3QWN8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWN8"
FT                   /protein_id="ADD54894.1"
FT                   /translation="MELKKLMEHISIIPDYRQAWKVEHKLSDILLLTICAVISGAEGWE
FT                   DIEDFGETHLDFLRQYGDFENGIPVHDTIARVVSCISPAKFHECFINWMRDCHSSDDKD
FT                   VIAIDGKTLRHSYDKSRRRGAIHVISAFSTMHSLVIGQIKTDEKSNEITAPPELLNILD
FT                   IKGKIITTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLKELNNPEHDS
FT                   YAISEKSHGREEIRLHIVCEVPDELIDFTFEWKGLKKLCVAVSFRSIIAEQKKEPKMTV
FT                   RYYISSADLTAGKFATAIRNHWHVENKLHWRLDVVMNEDDCKIRRGNAAELFSGIRHIA
FT                   INILTNDKVFKAGLRRKMRKAAMDRNYLASVLAGSGLS"
FT   gene            276263..278023
FT                   /locus_tag="G2583_0252"
FT   CDS_pept        276263..278023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0252"
FT                   /product="unknown protein associated with Rhs element"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54895"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWN9"
FT                   /protein_id="ADD54895.1"
FT                   /translation="MPWLHRETARSFGGAGSTAGYEQVTAYTLTGQLQSRHLNLPQLDR
FT                   DYDWNDNGQLIRISGPQESREYRYSDTGRLTGVHTTAANLDIDIPYATDPAGNRLPDPE
FT                   LHPDSTLTAWPDNRIAEDAHYVYRYDEYGRLTEKTDRIPEGVIRMHDERTHHYHYDNQH
FT                   RLVFYTRIQYGEPLVESRYLYDPLGRRTGKRVWRRERDLTGWMSLSRKPEVTWYGWDGD
FT                   RLTTVQTGTTRIQTVYQPGSFTPLIRIETENGEREKAQRRSLAEKLQQEGSEDGHGVVF
FT                   PAELVRMLDRLEEEIRADRVSSESRAWLAQCGLTVEQLEKQVEPEYTPARTLHLYHCDH
FT                   RGLPLALISEDGNTAWSAEYDEWGNQLNEENPHHLHQPYRLPGQQHDEESGLYYNRHRY
FT                   YDPLQGRYITPDPIGLRGGWNMYQYPLNPIQVIDPMGLDAIENMTSGGLIYAVSGVPGL
FT                   IVANSITNSAYQFGYDMDAIVGGAHNGAADAMRYCYLMCRMTKTFGSTIADVIGKNHEA
FT                   AGDRQGQPAKERIMDLKNNTVGIACGDFSAKCSDACIEKYNIGQLFGLDGIKADNPIKA
FT                   KQGSSDASNY"
FT   gene            278007..278488
FT                   /pseudo
FT                   /gene="ydcD"
FT                   /locus_tag="G2583_0253"
FT                   /note="hypothetical protein"
FT   gene            278669..279841
FT                   /gene="yncI"
FT                   /locus_tag="G2583_0254"
FT   CDS_pept        278669..279841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yncI"
FT                   /locus_tag="G2583_0254"
FT                   /product="Putative transposase yncI"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54896"
FT                   /db_xref="GOA:D3QWP0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWP0"
FT                   /protein_id="ADD54896.1"
FT                   /translation="MSIQSLLDYISVIPDIRQQGKVKHKLSDILFLTVCAVIAGADEWQ
FT                   EIEDFGHERLEWLKKYGDFDNGIPVDDTIARVVSNIDSLAFEKIFIEWMQECHEITDGE
FT                   IIAIDGKTIRGSFDKGKRKGAIHMVSAFSNENGVVLGQVKTEAKSNEITAIPELLNLLD
FT                   LKKNLITIDAMGCQKDIASKIKDKKADYLLAVKGNQGKLHHAFEEKFPVNVFSNYKGDS
FT                   FSTQEISHGRKETRLHIVSNVTPEFCDFEFEWKGLKKLCVALSFRQKKEDKSAEGVSIR
FT                   YYISSKDMDAKEFAHAIRAHWLIEHSLHWVLDVKMNEDASRIRRGNAAEIISGIKKMAL
FT                   NLLRDCKDIKGGVKRKRKKVALNTCYIEEVLASCSELGFRTDKMKNLTQI"
FT   gene            complement(279959..280729)
FT                   /gene="yafV"
FT                   /locus_tag="G2583_0255"
FT   CDS_pept        complement(279959..280729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafV"
FT                   /locus_tag="G2583_0255"
FT                   /product="Hydrolase, carbon-nitrogen family"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54897"
FT                   /db_xref="GOA:D3QWP1"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWP1"
FT                   /protein_id="ADD54897.1"
FT                   /translation="MPGLKITLLQQPLVWMDGPANLRHFDRQLEGITGRDVIVLPEMFT
FT                   SGFAMEAAASSLAQDDVVNWMTAKAQQCNALIAGSVALQTESGSVNRFLLVEPGGTVHF
FT                   YDKRHLFRMADEHLHYKAGNARVIVEWRGWRILPLVCYDLRFPVWSRNLNDYDLAIYVA
FT                   NWPAPRSLHWQALLTARAIENQAYVAGCNRVGSDGNGCHYRGDSRVINPQGEIIATADA
FT                   HQATRIDAELSMVALREYREKFPAWRDADEFRLR"
FT   gene            280883..281356
FT                   /gene="ivy"
FT                   /locus_tag="G2583_0256"
FT   CDS_pept        280883..281356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ivy"
FT                   /locus_tag="G2583_0256"
FT                   /product="Inhibitor of vertebrate lysozyme precursor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54898"
FT                   /db_xref="GOA:D3QWP2"
FT                   /db_xref="InterPro:IPR014453"
FT                   /db_xref="InterPro:IPR036501"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWP2"
FT                   /protein_id="ADD54898.1"
FT                   /translation="MGRISSGGMMFKAITTVAALVIATSAMAQDDLTISSLAKGETTKA
FT                   AFNQMVQGHKLPAWVMKGGTYTPAQTVTLGDETYQVMSACKPHDCGSQRIAVMWSEKSN
FT                   QMTGLFSTIDEKTSQEKLTWLNVNDALSIDGKTVLFAALTGSLENHPDGFNFK"
FT   gene            complement(281399..283843)
FT                   /gene="fadE"
FT                   /locus_tag="G2583_0257"
FT   CDS_pept        complement(281399..283843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE"
FT                   /locus_tag="G2583_0257"
FT                   /product="Acyl-coenzyme A dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54899"
FT                   /db_xref="GOA:D3QWP3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR015396"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWP3"
FT                   /protein_id="ADD54899.1"
FT                   /translation="MMILSILATVVLLGALFYHRVSLFISSLILLAWTAALGVAGLWSA
FT                   WVLVPLAIILVPFNFAPMRKSMISAPVFRGFRKVMPPMSRTEKEAIDAGTTWWEGDLFQ
FT                   GKPDWKKLHNYPQPRLTAEEQAFLDGPVEEACRMANDFQITHELADLPPELWAYLKEHR
FT                   FFAMIIKKEYGGLEFSAYAQSRVLQKLSGVSGILAITVGVPNSLGPGELLQHYGTDEQK
FT                   DHYLPRLARGQEIPCFALTSPEAGSDAGAIPDTGIVCMGEWQGQQVLGMRLTWNKRYIT
FT                   LAPIATVLGLAFKLSDPEKLLGGAEDLGITCALIPTTTPGVEIGRRHFPLNVPFQNGPT
FT                   RGKDVFVPIDYIIGGPKMAGQGWRMLVECLSVGRGITLPSNSTGGVKSVALATGAYAHI
FT                   RRQFKISIGKMEGIEEPLARIAGNAYVMDAAASLITYGIMLGEKPAVLSAIVKYHCTHR
FT                   GQQSIIDAMDITGGKGIMLGQSNFLARAYQGAPIAITVEGANILTRSMMIFGQGAIRCH
FT                   PYVLEEMEAAKNNDVNVFDKLLFKHIGHVGSNKVRSFWLGLTRGLTSSTPTGDATKRYY
FT                   QHLNRLSANLALLSDVSMAVLGGSLKRRERISARLGDILSQLYLASAVLKRYDDEGRNE
FT                   ADLPLVHWGVQDALYQAEQAMDDLLQNFPNRVVAGLLNVVIFPTGRHYLAPSDKLDHKV
FT                   AKILQVPNATRSRIGRGQYLTPSEHNPVGLLEEALVDVIAADPIHQRICKELGKNLPFT
FT                   RLDELAHNALAKGLIDKDEAAILVKAEESRLRSINVDDFDPEELATKPVKLPEKVRKVE
FT                   AA"
FT   gene            284083..284661
FT                   /gene="lpcA"
FT                   /locus_tag="G2583_0258"
FT   CDS_pept        284083..284661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpcA"
FT                   /locus_tag="G2583_0258"
FT                   /product="Phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54900"
FT                   /db_xref="GOA:D3QWP4"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWP4"
FT                   /protein_id="ADD54900.1"
FT                   /translation="MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGG
FT                   KVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHISCVGNDFGFNDIFSRY
FT                   VEAVGREGDVLLGISTSGNSANVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVP
FT                   HFGYADRIQEIHIKVIHILIQLIEKEMVK"
FT   gene            284766..285533
FT                   /gene="yafJ"
FT                   /locus_tag="G2583_0259"
FT   CDS_pept        284766..285533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafJ"
FT                   /locus_tag="G2583_0259"
FT                   /product="Glutamine amidotransferase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54901"
FT                   /db_xref="GOA:D3QWP5"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWP5"
FT                   /protein_id="ADD54901.1"
FT                   /translation="MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKG
FT                   CRTFKDPQPSFNSPIAKLVQDYPIKSCSVVAHIRQANRGEVALENTHPFTRELWGRNWT
FT                   YAHNGQLTGYKSLETGNFRPVGKTDSEKAFCWLLYKLTQRYPRTPGNMAAVFKYIASLA
FT                   DELRQKGVFNMLLSDGRYVMAYCSTNLHWITRRAPFGVATLLDQDVEIDFSSQTTPNDV
FT                   VTVIATQPLTGNETWQKIMPGEWRLFCLGERVV"
FT   gene            complement(285504..286244)
FT                   /gene="yafK"
FT                   /locus_tag="G2583_0260"
FT   CDS_pept        complement(285504..286244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafK"
FT                   /locus_tag="G2583_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54902"
FT                   /db_xref="GOA:D3QWP6"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWP6"
FT                   /protein_id="ADD54902.1"
FT                   /translation="MRKIALILAMLLIPCVSFAGLLGSSSSTTPVSKEYKQQLMGSPVY
FT                   IQIFKEERTLDLYVKMGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLK
FT                   PDSRYYKAINIGFPNAYDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV
FT                   FGQPSVQVSIYPFRMTDANMKRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVVNGRYV
FT                   VSKPLSHEVVQPQLASNYTLPEAK"
FT   gene            complement(286400..286678)
FT                   /gene="yafQ"
FT                   /locus_tag="G2583_0261"
FT   CDS_pept        complement(286400..286678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafQ"
FT                   /locus_tag="G2583_0261"
FT                   /product="Addiction module toxin, RelE/StbE family"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54903"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWP7"
FT                   /protein_id="ADD54903.1"
FT                   /translation="MIQRDIEYSGQFSKDVKLAQKRHKDMNKLKYLMTLLINNTLPLPA
FT                   VYKDHPLQGSWKGYRDAHVEPDWILIYKLTDKLLRFERTGTHAALFG"
FT   gene            complement(286681..286941)
FT                   /gene="dinJ"
FT                   /locus_tag="G2583_0262"
FT   CDS_pept        complement(286681..286941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinJ"
FT                   /locus_tag="G2583_0262"
FT                   /product="Addiction module antitoxin, RelB/DinJ family"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54904"
FT                   /db_xref="GOA:D3QWP8"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWP8"
FT                   /protein_id="ADD54904.1"
FT                   /translation="MAANAFVRARIDEDLKNQAADVLAGMGLTISDLVRITLTKVAREK
FT                   ALPFDLREPNQLTIQSIKNSEAGVDVHKAKDADDLFDKLGV"
FT   gene            287091..287900
FT                   /gene="yafL"
FT                   /locus_tag="G2583_0263"
FT   CDS_pept        287091..287900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafL"
FT                   /locus_tag="G2583_0263"
FT                   /product="NlpC/P60 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54905"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWP9"
FT                   /protein_id="ADD54905.1"
FT                   /translation="MFRYGPGYTVTSMHDQPLLSMSLPSIPSFVLSGLLLICLPFSSFA
FT                   SATTSHISFSYAARQRMQNRARLLKQYQTHLKKQVSYIVEGNAESRRALRQHNREQIKQ
FT                   HPEWFPAPLKASDRRWQALAENNHFLSSDHLHNITEVAIHRLEQQLGKPYVWGGTRPDK
FT                   GFDCSGLVFYAYNKILEAKLPRTANEMYHYHRATIVANNDLRRGDLLFFHIHSREIADH
FT                   MGVYLGDGQFIESPRTGETIRVSRLAEPFWQDHFLGARRILTEETIL"
FT   gene            288076..288372
FT                   /gene="yafM"
FT                   /locus_tag="G2583_0264"
FT   CDS_pept        288076..288372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafM"
FT                   /locus_tag="G2583_0264"
FT                   /product="Putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54906"
FT                   /db_xref="GOA:D3QWQ0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWQ0"
FT                   /protein_id="ADD54906.1"
FT                   /translation="MSEYRRYYIKGGTWFFTVNLRNRRSHLLTAQFQMLRNAIINVKRD
FT                   RPFEINAWVVLPEHMHCIWTLPESDDDFSSRWREIKKQFTHACGLKNIWQPRF"
FT   gene            complement(288806..290545)
FT                   /gene="fhiA"
FT                   /locus_tag="G2583_0265"
FT   CDS_pept        complement(288806..290545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhiA"
FT                   /locus_tag="G2583_0265"
FT                   /product="Type III secretion protein, FHIPEP family"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54908"
FT                   /db_xref="GOA:D3QWQ1"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWQ1"
FT                   /protein_id="ADD54908.1"
FT                   /translation="MLSRSDLLTLLTINFIVVTKGAERISEVSARFTLDAMPGKQMAID
FT                   ADLNAGLINQAQAQTRRKDVASEADFYGAMDGASKFVRGDAIAGMMILAINLIGGVCIG
FT                   IFKYNLSADAAFQQYVLMTIGDGLVAQIPSLLLSTAAAIIVTRVSDNGDIAHDVRHQLL
FT                   ASPSVLYTATGIMFVLAVVPGMPHLPFLLFSALLGFTGWRMSKQPQAAEAEEKSLETLT
FT                   RTITETSEQQVSWETIPLIEPISLSLGYKLVALVDKAQGNPLTQRIRGVRQVISDGNGV
FT                   LLPEIRIRENFRLKPSQYAIFINGIKADEADIPADKLMALPSSETYGEIDGVLGNDPAY
FT                   GMPVTWIQPAQKAKALNMGYQVIDSASVIATHVNKIVRSYIPDLFNYDDITQLHNRLSS
FT                   MAPRLAEDLSAALNYSQLLKVYRALLTEGVSLRDIVTIATVLVASSAVTKDHILLAADV
FT                   RLALRRSITHPFVRKQELTVYTLNNELENLLTNVVNQAQQGGKVMLDSVPVDPNMLNQF
FT                   QSTMPQVKEQMKAAGKDPVLLVPPQLRPLLARYARLFAPGLHVLSYNEVPDELELKIMG
FT                   ALS"
FT   gene            290490..291275
FT                   /gene="mbhA"
FT                   /locus_tag="G2583_0266"
FT   CDS_pept        290490..291275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mbhA"
FT                   /locus_tag="G2583_0266"
FT                   /product="Putative motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54907"
FT                   /db_xref="GOA:D3QWQ2"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWQ2"
FT                   /protein_id="ADD54907.1"
FT                   /translation="MTTIKLIVNSVSKSERESIIAALHGQSIFNGGGLSPLNKISPSHP
FT                   PKPATVAVPEETEKKARDVNEKTALLKKKSATELGELATSINTIARDAHMEANLEMEIV
FT                   PQGLRVLIKDDQNRNMFERGSAQIMPFFKTLLVELAPVFDSLDNKIIITGHTDAMAYKN
FT                   NIYNNWNLSGDRALSARRVLEEAGMPEDKVMQVSAMADQMLLDAKNPQSAGNRRIEIMV
FT                   LTKSASDTLYQYFGQHGDKVVQPLVQKLDKQQVLSQRTR"
FT   gene            291346..292401
FT                   /gene="dinB"
FT                   /locus_tag="G2583_0267"
FT   CDS_pept        291346..292401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /locus_tag="G2583_0267"
FT                   /product="DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54909"
FT                   /db_xref="GOA:D3QWQ3"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWQ3"
FT                   /protein_id="ADD54909.1"
FT                   /translation="MRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTAN
FT                   YPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDE
FT                   AYLDVTDSVHCHGSATLIAQEIRQTIFSELQLTASAGVAPVKFLAKIASDMNKPNGQFV
FT                   ITPAEVSAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVILLKRFGKFGRIL
FT                   WERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDL
FT                   LIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKTWDERRGGRGVRLVGLHVTLLD
FT                   PQMERQLVLGL"
FT   gene            292453..292746
FT                   /gene="yafN"
FT                   /locus_tag="G2583_0268"
FT   CDS_pept        292453..292746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafN"
FT                   /locus_tag="G2583_0268"
FT                   /product="Prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54910"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWQ4"
FT                   /protein_id="ADD54910.1"
FT                   /translation="MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASA
FT                   FEALMDMLAEQEEKKPIKARFRPSAARLEEITRRAEKYLNDMTDDDFNDFKE"
FT   gene            292749..293147
FT                   /gene="yafO"
FT                   /locus_tag="G2583_0269"
FT   CDS_pept        292749..293147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafO"
FT                   /locus_tag="G2583_0269"
FT                   /product="putative toxin YafO"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54911"
FT                   /db_xref="InterPro:IPR020353"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWQ5"
FT                   /protein_id="ADD54911.1"
FT                   /translation="MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYD
FT                   DSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRTNDESHLVYCQGAFDEQAWLLIAIL
FT                   KPEPHKLARDNNQMHKIGKMAEAFRMRF"
FT   gene            293157..293609
FT                   /gene="yafP"
FT                   /locus_tag="G2583_0270"
FT   CDS_pept        293157..293609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafP"
FT                   /locus_tag="G2583_0270"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54912"
FT                   /db_xref="GOA:D3QWQ6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWQ6"
FT                   /protein_id="ADD54912.1"
FT                   /translation="MNNIQIRNYQPGDFQQLCAIFIRAVMMTASQHYSPQQIAAWAQID
FT                   ESRWKEKLAKSQVRVAVINAQPVGFISRIEHYIDMLFVDPEYTRRGVASALLKPWIKSE
FT                   SELTVDASITAKPFFERYGFQTVKQQRVECRGAWFTNFSMRYKPQH"
FT   gene            293916..294182
FT                   /gene="ykfJ"
FT                   /locus_tag="G2583_0271"
FT   CDS_pept        293916..294182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfJ"
FT                   /locus_tag="G2583_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54913"
FT                   /db_xref="GOA:D3QWQ7"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWQ7"
FT                   /protein_id="ADD54913.1"
FT                   /translation="MEWYMGKYIRPLSDAVFTIASDDLWIESLAIQQLHTTANLPNMQR
FT                   VVGMPDLHPGRGYPIGAAFFSVGRFYPTRRRGNGAGNRNGPLL"
FT   gene            294151..294651
FT                   /gene="prfH"
FT                   /locus_tag="G2583_0272"
FT   CDS_pept        294151..294651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfH"
FT                   /locus_tag="G2583_0272"
FT                   /product="Probable peptide chain release factor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54914"
FT                   /db_xref="GOA:D3QWQ8"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR017509"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWQ8"
FT                   /protein_id="ADD54914.1"
FT                   /translation="MLETETGRYSDTLRSALISLDGDNAWALSESWCGTIQWICLSPYR
FT                   PHHGRKNWFLGIGRFTADEQEQSDAIRYETLRPSGPGGQHVNKTDSAVRATHLATGISV
FT                   KVQSERSQHANKRLARLLIAWKLEQQQQENSAVLKSQRRMFHHQIERGNPRRTFTGMAF
FT                   IEG"
FT   gene            complement(294708..296165)
FT                   /gene="pepD"
FT                   /locus_tag="G2583_0273"
FT   CDS_pept        complement(294708..296165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="G2583_0273"
FT                   /product="Aminoacyl-histidine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54915"
FT                   /db_xref="GOA:D3QWQ9"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWQ9"
FT                   /protein_id="ADD54915.1"
FT                   /translation="MSELSQLSPQPLWDIFAKICSIPHPSYHEEQLAEYIVGWAKEKGF
FT                   HVERDQVGNILIRKPATAGMENRKPVVLQAHLDMVPQKNNDTVHDFTKDPIQPYIDGEW
FT                   VKARGTTLGADNGIGMASALAVLADENVVHGPLEVLLTMTEEAGMDGAFGLQSNWLQAD
FT                   ILINTDSEEEGEIYMGCAGGIDFTSNLHLDREAVPAGFETFKLTLKGLKGGHSGGEIHV
FT                   GLGNANKLLVRFLAGHAEELDLRLIDFNGGTLRNAIPREAFATIAVAADKVDALKSLVN
FT                   TYQEILKNELAEKEKNLALLLDSVANDKAALIAKSRDTFIRLLNATPNGVIRNSDVAKG
FT                   VVETSLNVGVVTMTDNNVEIHCLIRSLIDSGKDYVVSMLDSLGKLAGAKTEAKGAYPGW
FT                   QPDANSPVMHLVRETYQRLFNKTPNIQIIHAGLECGLFKKPYPEMDMVSIGPTITGPHS
FT                   PDEQVHIESVGHYWTLLTELLKEIPAK"
FT   gene            296426..296884
FT                   /gene="gpt"
FT                   /locus_tag="G2583_0274"
FT   CDS_pept        296426..296884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpt"
FT                   /locus_tag="G2583_0274"
FT                   /product="Xanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54916"
FT                   /db_xref="GOA:D3QWR0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWR0"
FT                   /protein_id="ADD54916.1"
FT                   /translation="MSEKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGAL
FT                   LARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMY
FT                   PKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPISGR"
FT   gene            296976..298220
FT                   /gene="frsA"
FT                   /locus_tag="G2583_0275"
FT   CDS_pept        296976..298220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frsA"
FT                   /locus_tag="G2583_0275"
FT                   /product="Esterase frsA"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54917"
FT                   /db_xref="GOA:D3QWR1"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWR1"
FT                   /protein_id="ADD54917.1"
FT                   /translation="MTQANLSETLFKPRFKHPETSTLVRRFNHGAQPPVQSALDGKTIP
FT                   HWYRMINRLMWIWRGIDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWATQ
FT                   AMVWQQKACAEEDPQLSGRHWLHAATLYNIAAYPHLKGDDLAEQAQALSNRAYEEAAQR
FT                   LPGTMRQMEFTVPGGAPITGFLHMPKGDGPFPTVLMCGGLDAMQTDYYSLYERYFAPRG
FT                   IAMLTIDMPSVGFSSKWKLTQDSSLLHQRVLKALPNVPWVDHTRVAAFGFRFGANVAVR
FT                   LAYLESPRLKAVACLGPVVHTLLSDFKCQQQVPEMYLDVLASRLGMHDASDEALRVELN
FT                   RYSLKVQGLLGRRCPTPMLSGYWKNDPFSPEEDSRLITSSSADGKLLEIPFNPVYRNFD
FT                   KGLQEITDWIEKRLC"
FT   gene            298278..298679
FT                   /gene="crl"
FT                   /locus_tag="G2583_0276"
FT   CDS_pept        298278..298679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crl"
FT                   /locus_tag="G2583_0276"
FT                   /product="Sigma factor-binding protein crl"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54918"
FT                   /db_xref="GOA:D3QWR2"
FT                   /db_xref="InterPro:IPR009986"
FT                   /db_xref="InterPro:IPR038208"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWR2"
FT                   /protein_id="ADD54918.1"
FT                   /translation="MTLPSGHPKSRLIKKFTVLGPYIREGKCEDNRFFFDCLAVCVNVK
FT                   PAPEVREFWGWWMELEAQESRFTYSYQFGLFDKAGDWKSVPVKDTEVVERLEHTLREFH
FT                   EKLRELLTTLNLKLEPADDFRDEPVKLTA"
FT   gene            complement(298718..299773)
FT                   /gene="phoE"
FT                   /locus_tag="G2583_0277"
FT   CDS_pept        complement(298718..299773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoE"
FT                   /locus_tag="G2583_0277"
FT                   /product="Outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54919"
FT                   /db_xref="GOA:D3QWR3"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWR3"
FT                   /protein_id="ADD54919.1"
FT                   /translation="MKKSTLALVVMGIVASASVQAAEIYNKDGNKLDVYGKVKAMHYMS
FT                   DNDSKDGDQSYIRFGFKGETQINDQLTGYGRWEAEFAGNKAESDTAQQKTRLAFAGLKY
FT                   KDLGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGVI
FT                   DGLNLTLQYQGKNENRDVKKQNGDGFGTSLTYDFGGSDFAISGAYTNSDRTNEQNLQSR
FT                   GTGKRAEAWATGLKYDANNIYLATFYSETRKMTPITGGFANKTQNFEAVAQYQFDFGLR
FT                   PSLGYVLSKGKDIEGIGDEDLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNKLNINND
FT                   DIVAVGMTYQF"
FT   gene            300061..301164
FT                   /gene="proB"
FT                   /locus_tag="G2583_0278"
FT   CDS_pept        300061..301164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="G2583_0278"
FT                   /product="Glutamate 5-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54920"
FT                   /db_xref="GOA:D3QWR4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWR4"
FT                   /protein_id="ADD54920.1"
FT                   /translation="MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRI
FT                   VIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLT
FT                   RADMEDRERFLNARDTLRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGAD
FT                   KLLLLTDQKGLYTADPRSNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAAD
FT                   VACRAGIDTIIAAGSKPGVIGDVMEGISVGTLFHAQATPLENRKRWIFGAPPAGEITVD
FT                   EGATAAILERGSSLLPKGIKSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAG
FT                   HHSQEIDAILGYEYGPVAVHRDDMITR"
FT   gene            301176..302429
FT                   /gene="proA"
FT                   /locus_tag="G2583_0279"
FT   CDS_pept        301176..302429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="G2583_0279"
FT                   /product="Gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54921"
FT                   /db_xref="GOA:D3QWR5"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWR5"
FT                   /protein_id="ADD54921.1"
FT                   /translation="MLEQMGIAAKQASYKLAQLSSREKNRVLEKIADELEAQSEIILNA
FT                   NAQDVADARANGLSEAMLDRLALTPARLKGIADDVRQVCNLADPVGQVIDGGVLDSGLR
FT                   LERRRVPLGVIGVIYEARPNVTVDVASLCLKTGNAVILRGGKETCRTNAATVVVIQDAL
FT                   KSCGLPAGAVQAIDNPDRALVSEMLRMDKYIDMLIPRGGAGLHKLCREQSTIPVITGGI
FT                   GVCHIYVDESAEIAEALKVIVNAKTQRPSTCNTVETLLVNKNIAYSFLPALSKQMAESG
FT                   VTLHADASALAQLQTGPAKVVAVKAEEYDDEFLSLDLNVKIVSDLDDAIAHIREHGTQH
FT                   SDAILTRDMRNAQRFINEVDSSAVYVNASTRFTDGGQFGLGAEVAVSTQKLHARGPMGL
FT                   EALTTYKWIGIGDYTIRA"
FT   gene            302544..302619
FT                   /locus_tag="G2583_0280"
FT   tRNA            302544..302619
FT                   /locus_tag="G2583_0280"
FT                   /product="tRNA-Thr"
FT   gene            complement(302634..303794)
FT                   /locus_tag="G2583_0281"
FT   CDS_pept        complement(302634..303794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0281"
FT                   /product="Site-specific recombinase, phage integrase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54922"
FT                   /db_xref="GOA:D3QWR6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWR6"
FT                   /protein_id="ADD54922.1"
FT                   /translation="MSIKLRGGTWHCDFVAQDGSRVRRSLETSDKRQAQELHDRLKAEA
FT                   WRVKNLGESPKKLFKEACIRWLREKSDKKSIDDDKSIISFWMLHFRETILSDITTEKIM
FT                   EAVDGMENRRHRLNWEMSRDRCLRLGKPVPEYKPKLASKGTKTRHLAILRAILNMAVEC
FT                   GWLDRAPKISTPRVKNGRIRWLTEEESKRLFAEIAPHFFPVVMFAITTGLRRSNVTDLE
FT                   WSQVDLDKKMAWMHPDETKAGNAIGVPLNETACQILRKQQGLHKRWVFVHTKPAYRSDG
FT                   TKTAAVRKMRTDSNKAWKGALKRAGISNFRFHDLRHTWASWLVQSGVSLLALKEMGGWE
FT                   TLEMVQRYAHLSAGHLTEHASKIDAIISRNGTNTAQEENVVYLNAR"
FT   gene            complement(304108..304452)
FT                   /locus_tag="G2583_0282"
FT   CDS_pept        complement(304108..304452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54923"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWR7"
FT                   /protein_id="ADD54923.1"
FT                   /translation="MSDLAMKVLKWQSTGDVGISSATLASIACGLKKNIYGHSFGAPHD
FT                   AADFRRCVALVEQIPEIRDSFDKVAKRVPAFKGILNEWDSLVALLKSEMKIHGNKAPET
FT                   YRRISELRKD"
FT   gene            complement(304553..305317)
FT                   /gene="eaa"
FT                   /locus_tag="G2583_0283"
FT   CDS_pept        complement(304553..305317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eaa"
FT                   /locus_tag="G2583_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54924"
FT                   /db_xref="InterPro:IPR007538"
FT                   /db_xref="UniProtKB/TrEMBL:D3QWR8"
FT                   /protein_id="ADD54924.1"
FT                   /translation="MSTFTKEWLQNTITSIESARDEMPFGLDNDQAHMLTAFKIALASL
FT                   EREQIRHEHAKWSDSTFGCVGPIGPLKHLSKEALEAAAEPDDLSEWADMQFLLWDAQRR
FT                   AGISDAEITAAMEDKLKINMERQWPEPKDGEPRLHIKEPGNSPVTPDGLSTVCAEAYQV
FT                   VGVMADALGVFGDAAVQKVLDNLSQQKLVHRDVLPFSLPVTPDGWVMVPKQVTPEISNA
FT                   INVVGQRCTCGNCSQRLWDLLLDATQQGVNRG"
FT   gene            complement(305314..305820)
FT                   /locus_tag="G2583_0284"
FT   CDS_pept        complement(305314..305820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54925"
FT                   /db_xref="InterPro:IPR025153"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXG7"
FT                   /protein_id="ADD54925.1"
FT                   /translation="MSEINSQALREAAEKATCGERSLEYGESRFDGDDALIHREVAGYI
FT                   PICRIEGAHPESGFDEDFQMEQQANAEFIAAANPATVLALLDERERNQQYIKSRDQESE
FT                   EIALTVGKLRVELEGKDRRITEVTMWIKRLSSSLKNAKPDSKLPDDAMIWLNNEGLTSI
FT                   EDILR"
FT   gene            complement(305817..306038)
FT                   /locus_tag="G2583_0285"
FT   CDS_pept        complement(305817..306038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0285"
FT                   /product="hypothetical C4-type zinc finger protein
FT                   TraR-family"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54926"
FT                   /db_xref="GOA:D3QXG8"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXG8"
FT                   /protein_id="ADD54926.1"
FT                   /translation="MADIIDSASEIEELQRNTAIKMHRLNHQAISATHCCECGDPIDEL
FT                   RRLAVQGCRTCASCQKDLELISKQRGSK"
FT   gene            complement(306137..306418)
FT                   /locus_tag="G2583_0286"
FT   CDS_pept        complement(306137..306418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54927"
FT                   /db_xref="UniProtKB/TrEMBL:D3QMW4"
FT                   /protein_id="ADD54927.1"
FT                   /translation="MHFSGSGLHILCAYACRHGTCSMTPQQENALRSIARQANSEIKKA
FT                   RQQFPDKNVDDICRSVLKKHRETVTLMGFTPTHLSLAIGMLNGVFKER"
FT   gene            complement(306429..306620)
FT                   /locus_tag="G2583_0287"
FT   CDS_pept        complement(306429..306620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0287"
FT                   /product="unknown protein encoded by prophage CP-933K"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54928"
FT                   /db_xref="InterPro:IPR009814"
FT                   /db_xref="UniProtKB/TrEMBL:D3QMW5"
FT                   /protein_id="ADD54928.1"
FT                   /translation="MHKASPVELRTSIEMAHSLAQIGVRFVPIPVETDEEFHTLATSLS
FT                   QKLEMMVAKAEADERDLV"
FT   gene            complement(306593..306781)
FT                   /locus_tag="G2583_0288"
FT   CDS_pept        complement(306593..306781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54929"
FT                   /db_xref="InterPro:IPR009750"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXH1"
FT                   /protein_id="ADD54929.1"
FT                   /translation="MAMTHPHDNIRVGTITFVYSVTKRGWVFPGLSVIRNPLKAQRLAE
FT                   EINNKREAICTKHLLLS"
FT   gene            complement(306772..307452)
FT                   /locus_tag="G2583_0289"
FT   CDS_pept        complement(306772..307452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0289"
FT                   /product="Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54930"
FT                   /db_xref="GOA:D3QMW6"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniProtKB/TrEMBL:D3QMW6"
FT                   /protein_id="ADD54930.1"
FT                   /translation="MTPDIILQRTGIDVRAVEQGDDAWHKLRLGVITASEVHNVIAKPR
FT                   SGKKWPDMKMSYFHTLLAEVCTGVAPEVNAKALAWGKQYENDARTLFEFTSGVNVTESP
FT                   IIYRDESMRTACSPDGLCSDGNGLELKCPFTSRDFMKFRLGGFEAIKSAYMAQVQYSMW
FT                   VTRKDAWYFANYDPRMKREGLHYVVVERDEKYMAGFDEMVPEFIEKMDEALAEIGFVFG
FT                   EQWR"
FT   gene            complement(307449..308234)
FT                   /gene="bet"
FT                   /locus_tag="G2583_0290"
FT   CDS_pept        complement(307449..308234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bet"
FT                   /locus_tag="G2583_0290"
FT                   /product="Bet protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54931"
FT                   /db_xref="GOA:D3QXH3"
FT                   /db_xref="InterPro:IPR010183"
FT                   /db_xref="InterPro:IPR018330"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXH3"
FT                   /protein_id="ADD54931.1"
FT                   /translation="MSTALATLAGKLAERVGMDSVDPQELITTLRQTAFKGDASDAQFI
FT                   TLLIVANQYGLNPWTKEIYAFPDKQNGIVPVVGVDGWSRIINENQQFDGMDFEQDNESC
FT                   TCRIYRKDRNHPICVTEWMDECRREPFKTREGREITGPWQSHPKRMLRHKAMIQCARLA
FT                   FGFAGIYDKDEAERIVENTAYTAERQPERDITPVNDETMQEINTLLIALDKTWDDDLLP
FT                   LCSQIFRRDIRASSELTQAEAVKALGFLKQKATEQKVAA"
FT   gene            complement(308240..308536)
FT                   /gene="gamW"
FT                   /locus_tag="G2583_0291"
FT   CDS_pept        complement(308240..308536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gamW"
FT                   /locus_tag="G2583_0291"
FT                   /product="Gam protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54932"
FT                   /db_xref="GOA:D3QMW8"
FT                   /db_xref="InterPro:IPR009274"
FT                   /db_xref="InterPro:IPR042034"
FT                   /db_xref="UniProtKB/TrEMBL:D3QMW8"
FT                   /protein_id="ADD54932.1"
FT                   /translation="MNAYYIQDRLEAQSWARHYQQIAREEKEAELADDMEKGLPQHLFE
FT                   SLCIGHLQRHGASKKAITRAFDDDVEFQERMAEHIRYMVETIAHHQVDIDSEV"
FT   gene            complement(308722..308988)
FT                   /locus_tag="G2583_0292"
FT   CDS_pept        complement(308722..308988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0292"
FT                   /product="antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54933"
FT                   /db_xref="InterPro:IPR013056"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXH5"
FT                   /protein_id="ADD54933.1"
FT                   /translation="MEIFFALQCEGFFICIPITIHSRRFSLCINKEHTMQYAIAGWPVA
FT                   GCPSESLLERITRKLRDGWKRLIDILNQPGVPKNGSNTYGYPD"
FT   gene            complement(309110..309232)
FT                   /gene="ral"
FT                   /locus_tag="G2583_0293"
FT   CDS_pept        complement(309110..309232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ral"
FT                   /locus_tag="G2583_0293"
FT                   /product="Lambda ant-restriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54934"
FT                   /db_xref="InterPro:IPR022759"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXH6"
FT                   /protein_id="ADD54934.1"
FT                   /translation="MVKPEEMFPVMEDGKYVDKWAIRTTAMIARELGKQKNKAA"
FT   gene            309577..310059
FT                   /locus_tag="G2583_0294"
FT   CDS_pept        309577..310059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0294"
FT                   /product="Superinfection exclusion protein B"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54935"
FT                   /db_xref="GOA:D3QXH7"
FT                   /db_xref="InterPro:IPR025982"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXH7"
FT                   /protein_id="ADD54935.1"
FT                   /translation="MYMIVIWVGLLLLSPDNWPEYVNERIGIPHVWHVFVFALAFSLAI
FT                   NVHRLSAIASARYKRFKLRKRIKMQNDKVRSVIQNLTEEQSMVLCAALNEGRKYVVTSK
FT                   QFPYISELIELGVLNKTFSRWNGKHILFPIEDIYWTELVASYDPYNIEIKPRPISK"
FT   gene            complement(310060..310383)
FT                   /locus_tag="G2583_0295"
FT   CDS_pept        complement(310060..310383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0295"
FT                   /product="Antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54936"
FT                   /db_xref="InterPro:IPR020952"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXH8"
FT                   /protein_id="ADD54936.1"
FT                   /translation="MDAQTRRRERRAEKQAQWKAANPLLVGVSAKPVNRPILSLNRKPK
FT                   SRVESALNPIDLTVLAEYHKQIESNLQRIERKNQRTWYSKPGERGITCSGRQKIKGKSI
FT                   PLT"
FT   gene            complement(310735..311046)
FT                   /locus_tag="G2583_0296"
FT   CDS_pept        complement(310735..311046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0296"
FT                   /product="Gene 38 protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54937"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXH9"
FT                   /protein_id="ADD54937.1"
FT                   /translation="MNGDRYGFTKDSTEDSVFHVTINGDKSSVYESVSGVYPEMKYTAL
FT                   SSNTMVGEYQSGGGITVETWSITTDKKALYSKVMNIPGMQQLTSTKSFVGDVVGTCNQ"
FT   gene            complement(311136..311768)
FT                   /gene="ymfK"
FT                   /locus_tag="G2583_0297"
FT   CDS_pept        complement(311136..311768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ymfK"
FT                   /locus_tag="G2583_0297"
FT                   /product="SOS-response transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54938"
FT                   /db_xref="GOA:D3QXI0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXI0"
FT                   /protein_id="ADD54938.1"
FT                   /translation="MSISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRF
FT                   LPELASALGVSVDWLLNGTSDSNVRFVGHVEPKGKYPLISMVRAGSWCEACEPYDIKDI
FT                   DEWYDSDVNLLGDGFWLKVEGDSMTSPVGQSIPEGHMVLVDTGREPVNGSLVVAKLTDA
FT                   NEATFKKLVIDGGQKYLKGLNPSWPMTPINGNCKIIGVVVEARVKFV"
FT   gene            311872..312087
FT                   /locus_tag="G2583_0298"
FT   CDS_pept        311872..312087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0298"
FT                   /product="gene 40 protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54939"
FT                   /db_xref="GOA:D3QXI1"
FT                   /db_xref="InterPro:IPR000655"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXI1"
FT                   /protein_id="ADD54939.1"
FT                   /translation="MQTLSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTKRPR
FT                   FLFEIAMALNCDPVWLQYGTKRGKAA"
FT   gene            312207..312500
FT                   /locus_tag="G2583_0299"
FT   CDS_pept        312207..312500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0299"
FT                   /product="Phage regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54940"
FT                   /db_xref="GOA:D3QXI2"
FT                   /db_xref="InterPro:IPR007933"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXI2"
FT                   /protein_id="ADD54940.1"
FT                   /translation="MVRANKRNEALRIESALLNKIAMLGTEKTAEAVGVDKSQISRWKR
FT                   DWIPKFSMLLAVLEWGVVDDDMARLARQVAAILTNKKRPAATERSEQIQMEF"
FT   gene            312533..313432
FT                   /locus_tag="G2583_0300"
FT   CDS_pept        312533..313432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0300"
FT                   /product="Putative replication protein O of bacteriophage"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54941"
FT                   /db_xref="GOA:D3QXI3"
FT                   /db_xref="InterPro:IPR006497"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXI3"
FT                   /protein_id="ADD54941.1"
FT                   /translation="MTNTAKILNFCRGNFAKQERNVADLDDGYARLSNMLLEAYSGADL
FT                   TKRQFKVLLAILRKTYGWNKPMDRITDSQLSEITKLPVKRCNEAKLELVRMNIIKQQGG
FT                   MFGPNKNISEWCIPQNEGKSPKTRDKTSLKLGDCYPSKQGDTKDTITKEKRKDYSSENS
FT                   GESSDQPENDLSVVKPDAAIQSGSKWGTAEDLTAAEWMFDMVKTIAPSARKPNFAGWAN
FT                   DIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAVVTA
FT                   SKPKLDLTNTDWIYGVDL"
FT   gene            313429..314130
FT                   /locus_tag="G2583_0301"
FT   CDS_pept        313429..314130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0301"
FT                   /product="putative replication protein P of bacteriophage
FT                   BP-933W"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54942"
FT                   /db_xref="GOA:D3QMX8"
FT                   /db_xref="InterPro:IPR009731"
FT                   /db_xref="UniProtKB/TrEMBL:D3QMX8"
FT                   /protein_id="ADD54942.1"
FT                   /translation="MKNIAAQMVNFDREQMRRIANNMPEQYDEKPQVQQVAQIINGVFS
FT                   QLLATFPASLANRDQNELNEIRRQWVLAFRENGITTMEQVNAGMRVARRQNRPFLPSPG
FT                   QFVAWCREEASVIAGLPNVSELVDMVYEYCRKRGLYPDAESYPWKSNAHYWLVTNLYQN
FT                   MRANALTDAELRRKAADELTCMTARINRGEAIPEPVKQLPVMGGRPLNRVQALAKIAEI
FT                   KAKFGLKGASL"
FT   gene            314127..314417
FT                   /locus_tag="G2583_0302"
FT   CDS_pept        314127..314417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0302"
FT                   /product="Ren protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54943"
FT                   /db_xref="UniProtKB/TrEMBL:D3QMX9"
FT                   /protein_id="ADD54943.1"
FT                   /translation="MTGKEAIIHYLETHKSFCAPDVAALTGATVTSINQAAAKMARAGL
FT                   LVIEGKVWRTVYYRFATREEREGKMSTNLIFKECRQSAAMKRVLAVYGVKR"
FT   gene            314491..314931
FT                   /locus_tag="G2583_0303"
FT   CDS_pept        314491..314931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0303"
FT                   /product="Unknown protein encoded within prophage"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54944"
FT                   /db_xref="InterPro:IPR008711"
FT                   /db_xref="InterPro:IPR036619"
FT                   /db_xref="UniProtKB/TrEMBL:D3QMY0"
FT                   /protein_id="ADD54944.1"
FT                   /translation="MKKLTFEIRSPAHQQNAIHAVQQILPDPTKPIVVTIQERNRSLDQ
FT                   NRKLWACLGDVSRQVEWHGRWLDAESWKCVFTAALKQQDVVPNLAGNGFVVIGQSTSRM
FT                   RVSEFAELLELIQAFGTERGVKWSDEARLALEWKARWGDRAA"
FT   gene            314928..315455
FT                   /locus_tag="G2583_0304"
FT   CDS_pept        314928..315455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0304"
FT                   /product="Putative DNA N-6-adenine-methyltransferase of
FT                   bacteriophage"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54945"
FT                   /db_xref="GOA:D3QP26"
FT                   /db_xref="InterPro:IPR008593"
FT                   /db_xref="UniProtKB/TrEMBL:D3QP26"
FT                   /protein_id="ADD54945.1"
FT                   /translation="MTIKSNTPAHDKDCWQTPLWLFDALDIEFGFWLDSAASDKNALCA
FT                   HWLTEADDALNSEWVSHGAIWNNPPYSNIRPWVEKAAEQCIQQRQTVVMLVPEDMSVGW
FT                   FSKALESVDEVRIITDGRINFIEPSTGVEKKGNSKGSMLLIWRPFISPRRMFTTVSKAA
FT                   LMAIGQGVRRAA"
FT   gene            315452..315634
FT                   /gene="ninE"
FT                   /locus_tag="G2583_0305"
FT   CDS_pept        315452..315634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ninE"
FT                   /locus_tag="G2583_0305"
FT                   /product="NinE protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54946"
FT                   /db_xref="InterPro:IPR007986"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXI8"
FT                   /protein_id="ADD54946.1"
FT                   /translation="MRRQRRSITDIICENCKYLPTKRSRNKPKPIPKESDVKTFNYTAH
FT                   LWDIRWLRHRARNTR"
FT   gene            315794..316399
FT                   /gene="ninG"
FT                   /locus_tag="G2583_0306"
FT   CDS_pept        315794..316399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ninG"
FT                   /locus_tag="G2583_0306"
FT                   /product="NinG protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54947"
FT                   /db_xref="InterPro:IPR008713"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXI9"
FT                   /protein_id="ADD54947.1"
FT                   /translation="MAKPARRKCKICKEWFHPAFSNQWWCCPEHGTQLALERRSKEREK
FT                   AEKAAEKKRRREEQKQKDKLKIRKLALKPRSYWIKQAQQAVNAFIRERDRDLPCISCGT
FT                   LTSAQWDAGHYRTTAAAPQLRFDERNIHKQCVVCNQHKSGNLVPYRVELINRIGQEAVE
FT                   EIESDHNRHRWTVEECRAIKAEYQQKLKKLRNSRSEAA"
FT   gene            316396..317067
FT                   /locus_tag="G2583_0307"
FT   CDS_pept        316396..317067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0307"
FT                   /product="Serine/threonine-protein phosphatase 1"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54948"
FT                   /db_xref="GOA:D3QXJ0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXJ0"
FT                   /protein_id="ADD54948.1"
FT                   /translation="MNIYERIDGSKYRNIWVVGDLHGCYTNLMNKLDTIGFDNKKDLLI
FT                   SVGDLVDRGTENVECLELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGWFFNL
FT                   DYDQEILVKALAYKADELPLIIELVSKDKKYVICHADYPCDEYEFGKPVDNQQVIWNRE
FT                   RISNSQDGIVKEIKGADTFILGHTPAVKPLKFANQMYIDTGAVFCGNLTLIQVQGEVAW
FT                   V"
FT   gene            317058..317576
FT                   /locus_tag="G2583_0308"
FT   CDS_pept        317058..317576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0308"
FT                   /product="putative antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54949"
FT                   /db_xref="GOA:D3QXJ1"
FT                   /db_xref="InterPro:IPR010534"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXJ1"
FT                   /protein_id="ADD54949.1"
FT                   /translation="MGIRELNLTKEQHDWLNGWLELWGAWVYSGRLEKRMSSVIAKFME
FT                   SVEPGRIMTRPMCNDDDGMLISQVVDSVMCIDKKAFGILLSYYAHGSSKRAIASYYHAT
FT                   AKPRKMCGRGGEGWRKPSLATCRNEIDDILKASLFVLYQPMQNAFKMRKRVEKVKHIAV
FT                   KSLDMQLSI"
FT   gene            317640..317714
FT                   /locus_tag="G2583_5263"
FT   tRNA            317640..317714
FT                   /locus_tag="G2583_5263"
FT                   /product="tRNA-Asn"
FT   gene            317720..317795
FT                   /locus_tag="G2583_5264"
FT   tRNA            317720..317795
FT                   /locus_tag="G2583_5264"
FT                   /product="tRNA-Thr"
FT   gene            317799..317873
FT                   /locus_tag="G2583_5265"
FT   tRNA            317799..317873
FT                   /locus_tag="G2583_5265"
FT                   /product="tRNA-Gly"
FT   gene            317979..318209
FT                   /locus_tag="G2583_0309"
FT   CDS_pept        317979..318209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0309"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54950"
FT                   /db_xref="GOA:D3QXJ2"
FT                   /db_xref="InterPro:IPR025169"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXJ2"
FT                   /protein_id="ADD54950.1"
FT                   /translation="MTLSVGWLPTGAGSAVTAGAVPVESARFGLTVIMLFLVVAVDFTG
FT                   RLMSVLADGVMKRGIVTLRWSVMKRNSLNNA"
FT   gene            318392..320347
FT                   /locus_tag="G2583_0310"
FT   CDS_pept        318392..320347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0310"
FT                   /product="YjhS"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54951"
FT                   /db_xref="InterPro:IPR005181"
FT                   /db_xref="InterPro:IPR013619"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXJ3"
FT                   /protein_id="ADD54951.1"
FT                   /translation="MAAHGAAFFYDLPLADAHPVIFFCFGLFYSIPVHGRNSMSINRYD
FT                   IVRAASPSDLADKLTQKLKEGWQPFGSPVAITPYTLMQAIAAEGDVVVSGTTEPEWYYV
FT                   VVLAGQSNAMSYGEGIPLPDSYDAPDPRIKQLARRSTVTPGGEACVFNDVIPADHCLHD
FT                   VQDMSVFSHPEADLSKGQYGCVGQGLHIAKRLLPYIPKNAGILLVPCSRGGSAFTAGAD
FT                   GTFSEATGASQNSARWGVGKPLYQDLILRTKAALAKNPENVLLAVCWMQGEFDMTNAGY
FT                   AQQPAAFQSMVQQFRSDLAGMAAQCHGGSAQKVPWICGDTTYIWKQKYATQYEAVYGAY
FT                   KGKEAQNIFFVPFMTGGSGENTPTNEPTEDPDIVAAGYYGAASRTSANWTSADRASHFS
FT                   AWARRGIIADRMASAILSQAGRSQAFIAGVKPENTPSAGGSTSPDDSSLESISLLASAG
FT                   DVASQGWSITGGSVQLSDGVLRIVKESGKSWILSHPVKNASSLLSRGGKLTCKFRLTGA
FT                   LTNNQFGLGLYLYTDAPVPDGVTITGTGDPFLMSYFTQTTDGKLNLMHHRKSGNTKLGE
FT                   FGNYSNDWQALELVFTAGSATVTPKLNGVAGPAFQVIKDSLTLGLNALTLTDVTKNAAY
FT                   GVEIESLVLEINAPAA"
FT   gene            complement(320610..320786)
FT                   /locus_tag="G2583_0311"
FT   CDS_pept        complement(320610..320786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54952"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXJ4"
FT                   /protein_id="ADD54952.1"
FT                   /translation="MSPSPPTENESKEKQKSRQCHPLTANTGSRDYGIQALLKMPDNIP
FT                   APSLIQVINDTIS"
FT   gene            320794..321000
FT                   /locus_tag="G2583_0312"
FT   CDS_pept        320794..321000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0312"
FT                   /product="Putative lysis protein S of prophage CP-933V"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54953"
FT                   /db_xref="GOA:D3QRI8"
FT                   /db_xref="InterPro:IPR007054"
FT                   /db_xref="UniProtKB/TrEMBL:D3QRI8"
FT                   /protein_id="ADD54953.1"
FT                   /translation="MEKITTGVSYTTSAVGTGYWLLQLLDKVSPSQWVAIGVLGSLLFG
FT                   LLTYLTNLYFKIKEDKRKAARGE"
FT   gene            321000..321497
FT                   /gene="ybcS"
FT                   /locus_tag="G2583_0313"
FT   CDS_pept        321000..321497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcS"
FT                   /locus_tag="G2583_0313"
FT                   /product="Phage-related lysozyme (muraminidase)"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54954"
FT                   /db_xref="GOA:D3QXJ6"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXJ6"
FT                   /protein_id="ADD54954.1"
FT                   /translation="MSPSLRKAVAAAIGGGAVAIASVLITGPGGNDGLEGVSYIPYKDI
FT                   VGVWTVCHGHTGKDIMPGKTYTEAECKALLNKDLATVARQINPYIKVDIPETTRGALYS
FT                   FVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCLWG
FT                   QQ"
FT   gene            321482..321958
FT                   /locus_tag="G2583_0314"
FT   CDS_pept        321482..321958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0314"
FT                   /product="Putative Rz endopeptidase from lambdoid prophage
FT                   DLP12"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54955"
FT                   /db_xref="GOA:D3QXJ7"
FT                   /db_xref="InterPro:IPR004929"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXJ7"
FT                   /protein_id="ADD54955.1"
FT                   /translation="MGATMSRVTVIISALVICIIACLSWAVNHYRDNAITYKAQRDKNA
FT                   RELKLANAVITDMQMRQRDVAALDAKYTKELADAKAENDALRDDVAAGRRRLHIKAVCQ
FT                   SVREATTASGVDNAASPRLADTAERDYFILRERLMTMQKQLEGAQEYIRTQCIP"
FT   gene            322041..322181
FT                   /locus_tag="G2583_0315"
FT   CDS_pept        322041..322181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0315"
FT                   /product="unknown protein encoded within prophage CP-933R"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54956"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXJ8"
FT                   /protein_id="ADD54956.1"
FT                   /translation="MAKNDFCDKYFEYYLQINEVVRMDGNITIEYEVYVRIVWAEKAKT
FT                   R"
FT   gene            322423..322737
FT                   /locus_tag="G2583_0316"
FT   CDS_pept        322423..322737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0316"
FT                   /product="Putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54957"
FT                   /db_xref="InterPro:IPR024684"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXJ9"
FT                   /protein_id="ADD54957.1"
FT                   /translation="MLHDHLAECLEKKGLYRRAAERWAKVMVQLSDDQKRKVAAQKRAE
FT                   CLRKARRTPVSPMNLTEIKQAVNRLHSELGMGFEERRVFRRYKGTGEQNTSGNARSKKC
FT                   "
FT   gene            complement(322818..323042)
FT                   /gene="ynfO"
FT                   /locus_tag="G2583_0317"
FT   CDS_pept        complement(322818..323042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ynfO"
FT                   /locus_tag="G2583_0317"
FT                   /product="unknown protein encoded within prophage CP-933R"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54958"
FT                   /db_xref="InterPro:IPR025030"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXK0"
FT                   /protein_id="ADD54958.1"
FT                   /translation="MSSKNRTRRTTTRNIRFPNQMIEQINIALDQKGSGNFSAWVIEAC
FT                   RRRLINEKYSQFLPNKDKHDQSTCSDRFT"
FT   gene            323197..323322
FT                   /locus_tag="G2583_0318"
FT   CDS_pept        323197..323322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0318"
FT                   /product="Prophage Qin DNA packaging protein NU1-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54959"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXK1"
FT                   /protein_id="ADD54959.1"
FT                   /translation="MKLLSFLWVLSGDPAGYGAATSRVFAIYENFPGSMSGFSAS"
FT   gene            323444..323953
FT                   /locus_tag="G2583_0319"
FT   CDS_pept        323444..323953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0319"
FT                   /product="Prophage Qin DNA packaging protein NU1-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54960"
FT                   /db_xref="InterPro:IPR010906"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXK2"
FT                   /protein_id="ADD54960.1"
FT                   /translation="MATQTEVARHLSLTDRQLRRLQKLPGAPISNKRGQLDLDAWRDFY
FT                   ISYLRRSKNDVPDGDSKEDYEEKLLIARWELTAEQAVTQQLKNEVSKGKLIDTGFCIFA
FT                   LSKLAMALSSTLDSIPLSMQRQFPDLTPRHLDHLKNLIAKGANQCARAGDKLPDLLDEY
FT                   IRATTE"
FT   gene            323889..325853
FT                   /locus_tag="G2583_0320"
FT   CDS_pept        323889..325853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0320"
FT                   /product="Putative terminase large subunit of prophage
FT                   CP-933O"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54961"
FT                   /db_xref="InterPro:IPR008866"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXK3"
FT                   /protein_id="ADD54961.1"
FT                   /translation="MRGQGINYRIYLMNISEQQLNNMMSAVTTALQPLIRALPVTPVEW
FT                   ADQNYYLPKESSYGEGEWKTLPFQIAIMNSMGNDQIRTVNLIKSARVGYTKMLLGVVGY
FT                   FIEHKSRNSLLFQPTDSAAEDFMKSHVEATIRDVPCLKVISPWLGRKHRDNTLTLKRFS
FT                   SGVGFWCLGGAAAKNYREKSVDVVCYDELSSFEPDVEKEGSPTLLGDKRIEGSVWPKSI
FT                   RGSTPKIKGTCQIEKAANESAHFMRFYVPCPHCGEEQYLKFGDESTPFGLKWEKDRPES
FT                   AFYLCEHHGCVIHQSELDQSNGRWICENSGMWTRDGLMFFSARGDEIPPPRSITFHIWT
FT                   AYSPFTTWVQIVYDWLDALKDPNGVKTFVNTTLGETWEEAVGEKLDHQVLMDKVVHYTA
FT                   AVPARAVYLTAGIDSQRNRFEMYVWGWAPGEEAFLVDKIIIMGRPDEEETLLRVDAAIN
FT                   KKYRHADGTEMTISRICWDIGGIDGEIVYQRSKKHGVFRVLPVKGASVYGKPVITMPKN
FT                   RNQRGVYLCEVGTDTAKEILYARMKADPTPADEATSYAIRFPDDPDIFSQTEAQQLVAE
FT                   ELVEKWEKGKMRLLWDNKKRRNEALDCLVYAYAALRVSVQRWQLDLAVLAKSREEETTR
FT                   PTLEELAAKLSGGVNGNSR"
FT   gene            325837..326043
FT                   /locus_tag="G2583_0321"
FT   CDS_pept        325837..326043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0321"
FT                   /product="Head-stabilizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54962"
FT                   /db_xref="GOA:D3QXK4"
FT                   /db_xref="InterPro:IPR004174"
FT                   /db_xref="InterPro:IPR036626"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXK4"
FT                   /protein_id="ADD54962.1"
FT                   /translation="MVTVAELQALRQARLDLLTGKRVVSVQKDGRRIEYTAASLDELNR
FT                   AINDAESVLGTTHRRRRPLGVRL"
FT   gene            326040..327632
FT                   /locus_tag="G2583_0322"
FT   CDS_pept        326040..327632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0322"
FT                   /product="Putative capsid protein of prophage"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54963"
FT                   /db_xref="GOA:D3QXK5"
FT                   /db_xref="InterPro:IPR006429"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXK5"
FT                   /protein_id="ADD54963.1"
FT                   /translation="MKRTPVLIDVNGVPLRESLSYNGGGAGFGGQMAEWLPPAQSADAA
FT                   LLPALRLGNARADDLVRNNGIAANAVALHKDHIVGHMFLISYRPNWRWLGMRETSAKSF
FT                   VDEVEAAWSEYAEGMFGEIDAEGKRTFTEFIREGVGVHAFNGEIFVQPVWDTETTQLFR
FT                   TRFKAVSPKRVDTPGHGIGNRFLRAGVEVDRYGRAVAYHICEDDFPSSGSGRWERIPRE
FT                   LLTGRPAMLHIFEPVEDGQSRGANQFYSVMERLKMLDSLQATQLQSAIVKAMYAATIES
FT                   ELDTEKAFEYIAGAPQGQQDNPLINILEKFTRWYDTNNVTLGGVKIPHLFPGDDLKLQT
FT                   AQDSDNGFSALEQALLRYIAAGLGVSYEQLSRDYSKVSYSSARASANESWRYFMGRRKF
FT                   IASRLATQMFSCWLEEALLRGIIRLPRARFDFYQARSAWSRAEWIGSGRMAIDGLKEVQ
FT                   ESVMRIEAGLSTYEKELALMGEDYQEIFRQQVRESAEREKAGLSRPVWIAQAYQQQIAE
FT                   SRRPEEETTPRET"
FT   gene            327622..329127
FT                   /locus_tag="G2583_0323"
FT   CDS_pept        327622..329127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0323"
FT                   /product="Head-tail preconnector protein GP5"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54964"
FT                   /db_xref="GOA:D3QXK6"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033855"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXK6"
FT                   /protein_id="ADD54964.1"
FT                   /translation="MRRNLSHIIAAAFNEPLLLEPAYARVFFCALGREMGAASLSVPQQ
FT                   QVQFDAPGMLAETDEYMAGGKRPARVYRVVNGIAVLPVTGTLVHRLGGMRPFSGMTGYD
FT                   GIVACLQQAMADSQVRGVLLDIDSPGGQAAGAFDCADIIYRLRQQKPVWALCNDTACSA
FT                   AMLLASACSRRLVTQTSRIGSIGVMMSHVSYAGHLAQGGVDITLIYSGAHKVDGNQFEA
FT                   LPAEVRQDMQQRIDAARRMFAEKVAMFTGLSVDAVTGTEAAVFEGQSGIEAGLADELIN
FT                   ASDAISVMATALNSNVRGGTMPQLTATEAAAQENQRVMGILTCQEAKGREQLATMLAGQ
FT                   QGMSVEQARAILAAAAPQQPVASTQSEADRIMACEEANGREQLAATLAAMPEMTVEKAR
FT                   PILAASPQADAGPSLRDQIMALDEAKGAEAQAEQLAACPGMTVESARAVLAAGSGKAEP
FT                   VSASTTAMFEHFMANHSPTAVQGGVPQTSADGDADVKMLMAMP"
FT   gene            329164..329511
FT                   /locus_tag="G2583_0324"
FT   CDS_pept        329164..329511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0324"
FT                   /product="Head decoration protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54965"
FT                   /db_xref="InterPro:IPR004195"
FT                   /db_xref="InterPro:IPR036630"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXK7"
FT                   /protein_id="ADD54965.1"
FT                   /translation="MVTKTITEQRAEVRIFAGNDPAHTATGSSGISSPTPALTPLMLDE
FT                   ATGKLVVWDGQKAGSAVGILVLPLEGTETALTYYKSGTFATEAIHWPESVDEHKKANAF
FT                   AGSALSHAALP"
FT   gene            329569..330597
FT                   /locus_tag="G2583_0325"
FT   CDS_pept        329569..330597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0325"
FT                   /product="Major head protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54966"
FT                   /db_xref="InterPro:IPR005564"
FT                   /db_xref="UniProtKB/TrEMBL:D3QMK4"
FT                   /protein_id="ADD54966.1"
FT                   /translation="MGLFTTRQLLGYTEQKVKFRALFLELFFRRTVNFHTEEVMLDKIT
FT                   GKTPVAAYVSPVVEGKVLRHRGGETRVLRPGYVKPKHEFNYQQAVERLPGEDPSQLNDP
FT                   AYRRLRIITDNLKQEEHAIVQVEEMQAVNAVLYGKYTMEGDQFEKIEVDFGRSTKNNIT
FT                   QGSGKEWSKQDRDTFDPTHDIDLYCDQASGLVNIAIMDGTVWRLLNGFKLFREKLDTRR
FT                   GSNSQLETAVKDLGAVVSFKGYYGDLAIVVAKTSYIAEDGIEKRYLPDGMLVLGNTAAD
FT                   GIRCYGAIQDAQALSEGVVASSRYPKHWLTVGDPAREFTMTQSAPLMVLPDPDEFVVVQ
FT                   VK"
FT   gene            330649..331023
FT                   /locus_tag="G2583_0326"
FT   CDS_pept        330649..331023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0326"
FT                   /product="Uncharacterized 13.5 kDa protein in GP7-GP8
FT                   intergenic region"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54967"
FT                   /db_xref="InterPro:IPR025147"
FT                   /db_xref="UniProtKB/TrEMBL:D3QMK5"
FT                   /protein_id="ADD54967.1"
FT                   /translation="MATKEQNLKRLDELALILGREPDISGSAAEIAQRVAEWEEEMQSS
FT                   GDDVQVMNMDIRERETAAHDVREETSGALTRIRVLTCLHLCGVDGETGESVELADVGRV
FT                   ILIMSSDAKTHVDGGMAVYA"
FT   gene            331016..331369
FT                   /locus_tag="G2583_0327"
FT   CDS_pept        331016..331369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0327"
FT                   /product="Putative head-tail joining protein of prophage"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54968"
FT                   /db_xref="GOA:D3QXL0"
FT                   /db_xref="InterPro:IPR008018"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXL0"
FT                   /protein_id="ADD54968.1"
FT                   /translation="MRDFQNAFDAALAGVDSTIVEVMGISAQFTSGAQRGGEVHGVFDD
FT                   PESLGFASSGIRIEGSNPSLFVLTDTVCAVRRGDTLTINGEMFWVDRVSPDDGGSCYLW
FT                   LGRGVPPAVNRRR"
FT   gene            331381..331914
FT                   /locus_tag="G2583_0328"
FT   CDS_pept        331381..331914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0328"
FT                   /product="Prophage minor tail protein Z"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54969"
FT                   /db_xref="InterPro:IPR010633"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXL1"
FT                   /protein_id="ADD54969.1"
FT                   /translation="MTIRGLEQAVENLRRISKTAVPGASAMAINRVATTAMNQSASQVA
FT                   RETKVRRKLVKERARLKKATVKNPHVKIIVNRGDLPVIKLGIRITGSRPNSTLRAGQHR
FT                   YQRAFIQRLKNGRWHVMQRVAGKNRYPIDVVKIPMAAPLTTAFKQNIEQIRRERLPKEL
FT                   EYALKQQLRIAIKR"
FT   gene            331911..332306
FT                   /locus_tag="G2583_0329"
FT   CDS_pept        331911..332306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0329"
FT                   /product="Minor tail protein U"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54970"
FT                   /db_xref="InterPro:IPR009312"
FT                   /db_xref="InterPro:IPR035934"
FT                   /db_xref="InterPro:IPR038512"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXL2"
FT                   /protein_id="ADD54970.1"
FT                   /translation="MKHTDIRAAVLDALEKHDTGATFFDGRPAVFDEADFPAVAVYLTG
FT                   AEYTGEELDCDTWQAELHIEVFLPAQVPDSELDTWMESRIYPVMSDIPALSDLITSMVA
FT                   SGYDYRRDDDVGLWSSADLTYVITYEM"
FT   gene            332284..333054
FT                   /locus_tag="G2583_0330"
FT   CDS_pept        332284..333054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0330"
FT                   /product="Putative tail component of prophage CP-933X"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54971"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR032494"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXL3"
FT                   /protein_id="ADD54971.1"
FT                   /translation="MSLPMKCEDDMPVPNPAIPVKGAGTTLWVYNGNGDPYANPLSDVD
FT                   WSRLAKVKDLTPGELTAESYDDSYLDDEDADWTATGQGQKSAGDTSFTLAWMPGEQGQQ
FT                   ALLAWFNEGDTRAYKIRFPNGTVDVFRGWVSSIGKAVTAKEVITRTVKVTNVGRPSMAE
FT                   DRSTVTAATGMTVTPASSSVVKGQGTTLTVAFQPEGATDKSFRAVSADKTKATVSVSGM
FT                   TITVKGVAAGKVNIPVVSGNGELAAVAEITVTDS"
FT   gene            333070..333492
FT                   /locus_tag="G2583_0331"
FT   CDS_pept        333070..333492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0331"
FT                   /product="Putative tail component of prophage"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54972"
FT                   /db_xref="InterPro:IPR010027"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXL4"
FT                   /protein_id="ADD54972.1"
FT                   /translation="MFLKTESFEHNGVTVTLSELSALQRIEHLALMKRQAEQAESDSNR
FT                   KFTVEDAIRTGAFVVAMSLWHNHPQKTKLPSMNEAVKQIEQEVLTTWPTEAISHAENVV
FT                   YRLSGMYEFVVNDAPEQAEDAGPAEPVSAGKCSTVS"
FT   gene            333474..333908
FT                   /locus_tag="G2583_0332"
FT   CDS_pept        333474..333908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0332"
FT                   /product="Minor tail protein T"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54973"
FT                   /db_xref="InterPro:IPR009350"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXL5"
FT                   /protein_id="ADD54973.1"
FT                   /translation="MFDGELSFALKLAREMGRPDWRAMLAGMSSTEYADWHRFYSTHYF
FT                   HDVLLDMHFSGLTYTVLSLFFSDPDMHPLDFSLLNRREADEEPEDDVLMQKAAGLAGGV
FT                   RFGPDGNEVIPTSPDVADMTEDDVMLMTVSEGIAGGVRYG"
FT   gene            333901..336450
FT                   /locus_tag="G2583_0333"
FT   CDS_pept        333901..336450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0333"
FT                   /product="Phage-related minor tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54974"
FT                   /db_xref="InterPro:IPR006431"
FT                   /db_xref="InterPro:IPR009628"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXL6"
FT                   /protein_id="ADD54974.1"
FT                   /translation="MAEPVGDLVVDLSLDAARFDEQMARVRRHFSGTESDAKKTAAVVE
FT                   QSLSRQALAAQKAGISVGQYKAAMRMLPAQFTDVATQLAGGQSPWLILLQQGGQVKDSF
FT                   GGMIPMFRGLAGAITLPMVGATSLAVATGALAYAWYQGNSTLSDFNKTLVLSGNQAGLT
FT                   ADRMLVLSRAGQAAGLTFNQTSESLSALVKAGVSGEAQIASISQSVARFSSASGVEVDK
FT                   VAEAFGKLTTDPTSGLTAMARQFHNVTAEQIAYVAQLQRSGDEAGALQAANEAATKGFD
FT                   DQTRRLKENMGTLETWADRTARAFKSMWDAVLDIGRPDTAQEMLIKAEAAFKKADDIWN
FT                   LRKDDYFVNDEARARYWDDREKARLALEAARKKAEQQSQQDKNAQQQSDTEASRLKYTE
FT                   EAQKAYERLQTPLEKYTARQEELNKALKDGKILQADYNTLMAAAKKDYEATLKKPKQSG
FT                   VKVSAGDRQEDSAHAALLTLQAELRTLEKHAGANEKISQQRRDLWKAESQFAVLEEAAQ
FT                   RRQLSAQEKSLLAHKDETLEYKRQLAALGDKVTYQERLNALAQQADKFAQQQRAKRAAI
FT                   DAKSRGLTDRQAEREATEQRLKEQYGDNPLALNNVMSEQKKTWAAEDLLRGSWMAGLRS
FT                   GWSEWKESATDSMSQVKSAATQTFDGIAQNMAAMLTGSEQNWRSFTRSVLSMMTEILLK
FT                   QAMVGIVGSIGSAIGGGASASGGTAIQAAAAKFHFAAGGFTGTGGKYEPAGIVHRGEFV
FT                   FTKEATSRIGVGNLYRLMRGYATGGYVGTPGSMADSRSQASGTFEQNNHVVINNDGTNG
FT                   QIGPQALKAVYDVARKAAMDVVTGQMRDGGLFSGGGR"
FT   gene            336447..336776
FT                   /locus_tag="G2583_0334"
FT   CDS_pept        336447..336776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0334"
FT                   /product="minor tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54975"
FT                   /db_xref="InterPro:IPR010265"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXL7"
FT                   /protein_id="ADD54975.1"
FT                   /translation="MKTFRWKVKPGMDVASAPSVRKVRFGDGYSQRAPAGLNADLKTYS
FT                   VTLSVPRWEATALESFLAEHGGWKSFLWTPPYEWRQIKVTCAKWSSRVSMLRVEFSAEF
FT                   EQVVN"
FT   gene            336776..337474
FT                   /locus_tag="G2583_0335"
FT   CDS_pept        336776..337474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0335"
FT                   /product="Phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54976"
FT                   /db_xref="InterPro:IPR006487"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXL8"
FT                   /protein_id="ADD54976.1"
FT                   /translation="MQDIRQETLNECTRAEQSASVVLWEIDLTEVGGERYFFCNEQNEK
FT                   GEPVTWQGRQYQPYPIQGSGFELNGKGTSTRPTLTVSNLYGMVTGMAEDLQSLVGGTVV
FT                   RRKVYARFLDAVNFVNGNSDADPEQEVISRWRIEQCSELSAVSASFVLSTPTETDGAVF
FT                   PGRIMLANTCTWTYRGGECGYHGPAVADEYDQPTSDITKDKCSKCLSGCKFRNNVGNFG
FT                   GFLSINKLSQ"
FT   gene            337480..338223
FT                   /locus_tag="G2583_0336"
FT   CDS_pept        337480..338223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0336"
FT                   /product="Tail assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54977"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXL9"
FT                   /protein_id="ADD54977.1"
FT                   /translation="MTKTESAILAHARRCAPAESCGFVVSTPEGERYFPGVNISGEPEA
FT                   YFRMSPEDWLQAEMQGEIVALVHSHPGGLPWLSEADRRLQVQSDLPWWLVCRGTIHKFR
FT                   CVPHLTGRRFEHGVTDCYTLFRDAYHLAGIEMPDFHRGDDWWRHGQNLYLDNLEATGLY
FT                   QVPLSSAQPGDVLLCCFGSSVPNHAAIYCGDGELLHHIPEQLSKRERYTDKWQRRTHSL
FT                   WRHRAWRASAFTGICNDLAAASTFV"
FT   gene            338121..338792
FT                   /locus_tag="G2583_0337"
FT   CDS_pept        338121..338792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0337"
FT                   /product="Tail assembly protein I"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54978"
FT                   /db_xref="GOA:D3QXM0"
FT                   /db_xref="InterPro:IPR010654"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXM0"
FT                   /protein_id="ADD54978.1"
FT                   /translation="MAATHTLPLASPGMARICLYGDLQRFGRRIDLRVKTGAEAIRALA
FT                   TQLPVFRQKLSDGWYQVRIAGRDVSTSGLTAQLHETLSDGAVIHIVPRVAGAKSGGVFQ
FT                   IVLGAAAIAGSFFTAGATLAAWGAAIGAGGMTGILFSLGASMVLGGVAQMLAPKARTPR
FT                   TQTTDNGKQNTYFSSLDNMVAQGNPLPVLYGEMRVGSRVVSQEISTADEGDGGQVVVIG
FT                   R"
FT   gene            338853..342266
FT                   /locus_tag="G2583_0338"
FT   CDS_pept        338853..342266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0338"
FT                   /product="Phage-related protein, tail component"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54979"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR015406"
FT                   /db_xref="InterPro:IPR021034"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXM1"
FT                   /protein_id="ADD54979.1"
FT                   /translation="MGKGSSKGHTPREAKDNLKSTQLLSVIDAISEGPVEGPVDGLKSV
FT                   LLNSTPVLDSEGNTNISGVTVVFRAGEQEQTPPEGFESSGSETVLGTEVKYDTPITRTI
FT                   TSANIDRLRFTFGVQALVETTSKGDRNPSEVRLLVQIQRNGGWVTEKDITIKGKTTSQY
FT                   LASVVVDNLPPRPFNIRMRRMTPDSTTDQLQNKTLWSSYTEIIDVKQCYPNTALVGVQV
FT                   DSEQFGSQQVSRNYHLRGRILQVPSNYNPQTRQYSGIWDGTFKPAYSNNMAWCLWDMLT
FT                   HPRYGMGKRLGAADVDKWALYVIGQYCDQSVPDGFGGTEPRITCNAYLTTQRKAWDVLS
FT                   DFCSAMRCMPVWNGQTLTFVQDRPSDKVWTYNRSNVVMPDDGAPFRYSFSALKDRHNAV
FT                   EVNWIDPNNGWETATELVEDTQAIARYGRNVTKMDAFGCTSRGQAHRAGLWLIKTELLE
FT                   TQTVDFSVGAEGLRHVPGDVIEICDDDYAGIRIGGRVLAVNSQTRTLTLDREITLPSSG
FT                   TTLISLVDGQGSPVSVEVQSVTDGVKVKVSRVPDGVAEYSVWGLKLPTLRQRLFRCVSI
FT                   RENDDGTYAITAVQHVPEKEAIVDNGAHFDGDQSGTVNGVTPPAVQHLTAEVTADSGEY
FT                   QVLARWDTPKVVKGVSFLLRLTVTADDGSERLVSTARTAETTYRFTQLALGNYRLTVRA
FT                   VNAWGQQGDPASVSFRIAAPAAPSRIELTPGYFQITATPHLAVYDPTVQFEFWFSEKRI
FT                   TDIRQVETTARYLGTGLYWIAASINIKPGHDYYFYVRSVNTVGKSAFVEAVGRASDDAE
FT                   GYLDFFKGKITESHLGKELLEKVDLTEDNASRLDEFSKEWKDANDKWNAMWGVKIEQTK
FT                   DGKHYVAGIGLSMEDTEEGKLSQFLVAANRIAFIDPANGNETPMFVAQGNQIFMNDVFL
FT                   KRLTAPTITSGGNPPAFSLTPDGRLTAKNADISGNVNANSGTLNNVTINQNCTIKGMLE
FT                   ATQVRGDFVKAVSKAFPKKVGTWGNTETPDGTVTVTISDDHNFDRQIIIPPIIFNGIAY
FT                   TDPGSGNNPGGTRYTGYGFEVRKNGVLIASRETKGAIPGSYSAVIDMPSGRGSVTLEFK
FT                   IYQKGNQGAGNITDCTVIVTKKAASGISIR"
FT   gene            342337..342936
FT                   /gene="lomK"
FT                   /locus_tag="G2583_0339"
FT   CDS_pept        342337..342936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lomK"
FT                   /locus_tag="G2583_0339"
FT                   /product="Enterobacterial Ail/Lom family protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54980"
FT                   /db_xref="GOA:D3QXM2"
FT                   /db_xref="InterPro:IPR000758"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXM2"
FT                   /protein_id="ADD54980.1"
FT                   /translation="MRKVCAAILSAAICLAVSGVPAWASEHQSTLSAGYLHASTDAPGS
FT                   DDLNGINVKYRYEFTDTLGLITSFSYANAEDEQKTHYSDTRWHEDYVRNRWFSVMAGPS
FT                   VRVNEWFSAYAMAGVAYSRVSTFSGDYFRVTDNKRKTHDVLTGSDDARYSNTSLAWGAG
FT                   VQFNPTESVAVDVAYEGSGSGDWRTDGFIVGVGYKF"
FT   gene            342990..344312
FT                   /locus_tag="G2583_0340"
FT   CDS_pept        342990..344312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0340"
FT                   /product="Putative tail fiber protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54981"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR009640"
FT                   /db_xref="InterPro:IPR013609"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXM3"
FT                   /protein_id="ADD54981.1"
FT                   /translation="MGMAAVQISGVLKDGAGKPIQNCTIQLKARRNSTTVVVNTVASEN
FT                   PDEAGRYSMDVEYGQYSVTLLVEGFPPSHAGTISVYEDSQPGTLNDFLGAMTEDDARPE
FT                   ALRRFEQMVEEAARHAEEAKKNAGEAETSARNAGISASKAEASAANADTSAEDASESAR
FT                   QAAESAASAKKSEEASSSSASEAAQKASESLQSATDAELSKKTAESAAGNAARDATTAT
FT                   EKARESAESAQSAEQSRIAAEDAVNRIPTVVGPPGPKGEPGPAGPQGPKGDKGERGDTG
FT                   PAGATGERGPGGDTGPAGPQGPKGDRGERGETGLTGSTGPQGPKGDTGATGPAGPQGPK
FT                   GETGAAGPVGATGPQGAKGDPGETQIRFRLGPASIIETNSYGWFPGTDGALITGLTFLD
FT                   PKDATQVQGMFQHLQVRFGDGPWQDVKGLDEVGSDTGRTGE"
FT   gene            344689..345267
FT                   /gene="nleG"
FT                   /locus_tag="G2583_0341"
FT   CDS_pept        344689..345267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nleG"
FT                   /locus_tag="G2583_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54982"
FT                   /db_xref="GOA:D3QXM4"
FT                   /db_xref="InterPro:IPR010489"
FT                   /db_xref="InterPro:IPR038436"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXM4"
FT                   /protein_id="ADD54982.1"
FT                   /translation="MVMPGLISYVSSASFVNEMMELRQQVMEGQIGGFLLGGERVRVSY
FT                   IPDTGRFLAEGEGQGRVYAELLNIAFNDGVNALRNRILSALPGMGGRNSLQAKISECTF
FT                   TVDIGKLHCPGEVLQCPITLELPEKGIFVRNSDGSDVCTLFDAAAFSRLTGEGLPHPLT
FT                   REPITASIIVKHEECIYDSARGNFVIKGN"
FT   gene            complement(345587..345904)
FT                   /locus_tag="G2583_0342"
FT   CDS_pept        complement(345587..345904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0342"
FT                   /product="PotB"
FT                   /note="trcA, ORF2, ORF3, ORF4 genes"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54983"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXM5"
FT                   /protein_id="ADD54983.1"
FT                   /translation="MPKISSVVSSCYHLFSEHQQLSNETTMTNSASRRIVHKEYGISLK
FT                   SVPVWLATAKTPLALLNGRHTRSHSFIIAGPPGMGSRSGAQYYAINSDDKRSRIDIDSL
FT                   F"
FT   gene            complement(346007..346633)
FT                   /locus_tag="G2583_0343"
FT   CDS_pept        complement(346007..346633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0343"
FT                   /product="PotB"
FT                   /note="trcA, ORF2, ORF3, ORF4 genes"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54984"
FT                   /db_xref="GOA:D3QXM6"
FT                   /db_xref="InterPro:IPR010489"
FT                   /db_xref="InterPro:IPR038436"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXM6"
FT                   /protein_id="ADD54984.1"
FT                   /translation="MPVILNFSNGSVLPENELEALRHIARSNQNDTITIGGRNMRLHYI
FT                   QFMDGFSVEPIPGGLWDHLGARESHHLADSLARQLNGGNTFLQAYSLYLEQRQAAPLVQ
FT                   ESVIKTLLDRINSNAFPVSLQDFSCTEEHLNCPITLRIPETGVFVRNARNSEICALYDQ
FT                   EALTELILRNALHPLSRDPFAPEMIISKDKCHFNITKQCFYALPI"
FT   gene            346816..347406
FT                   /locus_tag="G2583_0344"
FT   CDS_pept        346816..347406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0344"
FT                   /product="Putative chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54985"
FT                   /db_xref="GOA:D3QXM7"
FT                   /db_xref="InterPro:IPR004959"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXM7"
FT                   /protein_id="ADD54985.1"
FT                   /translation="MPMNTTGTSFSSFGISCHRENSFRNSFRGKNDEVIKCSMGERTIH
FT                   FSVRKFSGNILETVRRQSTKDIDEWIKDERIVYPSRVINQEIDNYCFQKNAKISTEERQ
FT                   RVFFLVSQENQLTLDVKAAQSSINHVIMGSASFGKKMDALCDGMSRDVKNRTSDTIANL
FT                   LADKFYQKHIESDIDIVKLRNEIPDYLRCAIRA"
FT   gene            347651..347782
FT                   /locus_tag="G2583_0345"
FT   CDS_pept        347651..347782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0345"
FT                   /product="Tail fiber assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54986"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXM8"
FT                   /protein_id="ADD54986.1"
FT                   /translation="MLQIATEEEASLLEAWKKYRVLLNRVDISIAPDIEWPAVPVME"
FT   gene            complement(348095..348235)
FT                   /gene="intR"
FT                   /locus_tag="G2583_0346"
FT   CDS_pept        complement(348095..348235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="intR"
FT                   /locus_tag="G2583_0346"
FT                   /product="Putative integrase for prophage CP-933R"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54987"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXM9"
FT                   /protein_id="ADD54987.1"
FT                   /translation="MTAGANPAFIASQMGHETAQMVYEIYGMWIDDMNDEQVAMLYARL
FT                   S"
FT   gene            348406..349386
FT                   /locus_tag="G2583_0347"
FT   CDS_pept        348406..349386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0347"
FT                   /product="NleB"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54988"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXN0"
FT                   /protein_id="ADD54988.1"
FT                   /translation="MLSPIRTICHNSADILQNSSCQTASFAGKEYELKVIDEKTPILFQ
FT                   WFEPNPERYKKDEVPIVNTKQHPYLDNVINTARIESERTIGVFVDGDFSFSQKVAFSKL
FT                   EQDFENIMIIYRENVDFSMYDRKLSDIYHDIICEQKLRSEAKRDEYLLNLLEKELSEIS
FT                   NAQDSLIYMYAEKRDHTWFDFFRNLALLKAGEIFRCTDNTKNHGISSGEGCIYLDMDMM
FT                   LTGKLGVMRAPDGIAVHVDRRNDSVNIENGAIIVNRSNHPALLEGLSFMHKKVDAHPYY
FT                   DGLGKGIKKYFNFTPLHDYNHFCDFIEFKHQNIIMNTSQYTGSSW"
FT   gene            complement(349463..349741)
FT                   /locus_tag="G2583_0348"
FT   CDS_pept        complement(349463..349741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54989"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXN1"
FT                   /protein_id="ADD54989.1"
FT                   /translation="MPFSIKNIFSGSKGHPPEISGPIHDKPVQGNCTLTSTTCTIQDYT
FT                   VCSRWSCSFDMRPPGAGDRTSNLKLTATELSWLSKTIETERNNTKES"
FT   gene            complement(349803..351164)
FT                   /pseudo
FT                   /gene="gogB"
FT                   /locus_tag="G2583_0349"
FT                   /note="conserved hypothetical protein"
FT   gene            351744..352976
FT                   /locus_tag="G2583_0351"
FT   CDS_pept        351744..352976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0351"
FT                   /product="Integrase protein for prophage CP-933I"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54990"
FT                   /db_xref="GOA:D3QXN2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXN2"
FT                   /protein_id="ADD54990.1"
FT                   /translation="MCIGLCICSCSVWIPIHMPLNDMQIRRAKPEAKAYTLGDGLGLSL
FT                   LIEPNGSKSWRFRYRYAGKPKMISLGVYPTITLADARSRRDEARKLVAEGKNPSEVRKE
FT                   QKLAMQTESENAFEKIAREWHQLKSAKWSAGYASDIMEAFKNDIFPYVGTRPVGEIKPL
FT                   ELLNVLRKIEKRGALEKMRKVRQRCSEVFRYAIATGRAEYNPAADLSSALEVHQSNHFP
FT                   FLKADEIPDFLRALEGYSGSKLVQIATKLLMITGVRTIELRAALWQEFDLDNAIWEIPA
FT                   ERMKMRRPHLVPLSSQAVDLLNELKIMTGNYRYVFPGRNDPNRPMSEASINQAIKRIGY
FT                   GGKVTGHGFRHTLSTILHEQGFESAWIEIQLAHVDKNSIRGTYNHAQYFSGRKSMMDWY
FT                   SNLIFERLKRS"
FT   gene            352980..353986
FT                   /pseudo
FT                   /locus_tag="G2583_0352"
FT                   /note="unknown protein encoded in prophage CP-933I"
FT   gene            353986..354444
FT                   /locus_tag="G2583_0354"
FT   CDS_pept        353986..354444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0354"
FT                   /product="unknown protein encoded in prophage CP-933I"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54991"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXN3"
FT                   /protein_id="ADD54991.1"
FT                   /translation="MVRIYNSSLEVACRIAKVLVAIYPSSLSLERLICFDFILVNLKDF
FT                   LPEEISLHPPIPRRDAQLALKREIVLESLALLQGYELASKIYTHRGFVYKASEKTYAFT
FT                   NSLHNEYVAQMEHNINLVVKLYSDIPDEQLQSIIKNKIGKYDMEFNYE"
FT   gene            354437..355071
FT                   /pseudo
FT                   /locus_tag="G2583_0355"
FT                   /note="hypothetical protein"
FT   gene            355101..355622
FT                   /locus_tag="G2583_0356"
FT   CDS_pept        355101..355622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0356"
FT                   /product="unknown protein encoded in prophage CP-933I"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54992"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXN4"
FT                   /protein_id="ADD54992.1"
FT                   /translation="MKAQLIYPEYDQVIVSRELEKAEQDIESSKDILKGIVDALDDKKQ
FT                   LLKELSDELYSISDREKYLSLLIERFSLLKDQYFIDLQRIDVVSQANFYLNNFADIYCE
FT                   FCNTPQKKENEISYDDCFLSCNAEKLKIKSQLKGLIESIGSNVREHELIMLRKNDVNEI
FT                   YQAEKVILRR"
FT   gene            355690..356256
FT                   /locus_tag="G2583_0357"
FT   CDS_pept        355690..356256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0357"
FT                   /product="unknown protein encoded in prophage CP-933I"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54993"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXN5"
FT                   /protein_id="ADD54993.1"
FT                   /translation="MDHTKHSILSSLQDKEDDVDELKYSAEDFDSLTVADLYDIEIAMQ
FT                   DFLNDINFENSKDNKVRFDEDTYDFNINGKRRGMFGKGTRAVMHAIFTICFAEFLSRKG
FT                   NPFIGFVVLDSPLVTHFDKDRGVSLSDVNSVSLSDSFYHALIKRDYNFQIVILENKGPT
FT                   FQIKINDANKIHNLNKNGSSGFYPV"
FT   gene            complement(356666..356938)
FT                   /gene="ogrK"
FT                   /locus_tag="G2583_0358"
FT   CDS_pept        complement(356666..356938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ogrK"
FT                   /locus_tag="G2583_0358"
FT                   /product="Putative activator encoded in prophage CP-933I"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54994"
FT                   /db_xref="InterPro:IPR007684"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXN6"
FT                   /protein_id="ADD54994.1"
FT                   /translation="MALKCPECGTTAHARTSAYEAPSVKRSWYQCQNLECSYTFTALES
FT                   VDTIIMKPRRNEQESEKAQMPEKQQQTLNRYGSASKLSSRQQIPV"
FT   gene            complement(356944..357495)
FT                   /gene="psuI"
FT                   /locus_tag="G2583_0359"
FT   CDS_pept        complement(356944..357495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psuI"
FT                   /locus_tag="G2583_0359"
FT                   /product="Putative polarity suppression protein encoded in
FT                   CP-933I"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54995"
FT                   /db_xref="InterPro:IPR010006"
FT                   /db_xref="InterPro:IPR038395"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXN7"
FT                   /protein_id="ADD54995.1"
FT                   /translation="MMARVTPDQALISFRNARILWAGHSESRKAVEQQIESLLTAMEKP
FT                   ADYARQLELQREHLDVLKWQINCAARECIYSQHQLMEACTEDALSNFMQANGAALTSAL
FT                   APFLKGRGGVDVASRILRNALVRQLAITPPEIAGDYRMILDESGVMPDPMMVRDCQSSY
FT                   TPAQQLRFQQRLDYINGMQE"
FT   gene            complement(357492..358244)
FT                   /gene="sidI"
FT                   /locus_tag="G2583_0360"
FT   CDS_pept        complement(357492..358244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sidI"
FT                   /locus_tag="G2583_0360"
FT                   /product="Putative capsid morphogenesis protein encoded in
FT                   CP-933I"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54996"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXN8"
FT                   /protein_id="ADD54996.1"
FT                   /translation="MTIPEQNNNPIVEISIPVSTQQALEKVNATKSAWLEARRQQKAAA
FT                   DNIATIRQRRAEMEATTNALNEEWRTLFRESQGVVSKEMKKLRTEIALGRETLEDFDEL
FT                   LAAQESENALLPQEAAELAGKYIHAHDTLVGIRAKQIWEDFMQSHGKALIQTLSLLKST
FT                   MGREASAVVGVVHSVNDPDTLLKDFIHKHITRPALTNDAMPEQDPVFKLAGVAPDYAAR
FT                   LDFSNKLSPAAMHKMKVRQERAEKEKAV"
FT   gene            358632..358802
FT                   /locus_tag="G2583_0361"
FT   CDS_pept        358632..358802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0361"
FT                   /product="unknown protein encoded in prophage CP-933I"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54997"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXN9"
FT                   /protein_id="ADD54997.1"
FT                   /translation="MFLPGNNIFASGHGVAFHTDFYKTRSVRFFMDSFGYILRFKVMLF
FT                   NIKVFMQAQCL"
FT   gene            359163..359423
FT                   /gene="alpA"
FT                   /locus_tag="G2583_0362"
FT   CDS_pept        359163..359423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alpA"
FT                   /locus_tag="G2583_0362"
FT                   /product="Phage DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54998"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXP0"
FT                   /protein_id="ADD54998.1"
FT                   /translation="MRNISVSAPAPAAPLFPVSNHHERFLRLPEVMHLCGLSRSTVYDL
FT                   ISRDAFPKQIPLGGKNVAWAQSEVSAWMADRISARGRGCDA"
FT   gene            359420..359977
FT                   /locus_tag="G2583_0363"
FT   CDS_pept        359420..359977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0363"
FT                   /product="putative CI repressor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADD54999"
FT                   /db_xref="InterPro:IPR018880"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXP1"
FT                   /protein_id="ADD54999.1"
FT                   /translation="MMIPAYIKYLYSGLLTVVISRYSFSAVAKSAAGIGVPYNLLATID
FT                   APCVFFYVVAQAQPFSGLWCLCLHHGSIEIMVVRAGQPSGWPVSNKAGYANPVRAATSE
FT                   IGVSGGSNNRYLLEAAIMATILTPSHPQYVFVFAAIRRADTQPRICMLRTVSCDERSAR
FT                   RLLVRDYVLSLSARLPAGEVTL"
FT   gene            359974..360195
FT                   /locus_tag="G2583_0364"
FT   CDS_pept        359974..360195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55000"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXP2"
FT                   /protein_id="ADD55000.1"
FT                   /translation="MNQFEISYDDVVRLKHLRNVGEYVTGMAALQDCYEKPAGAQCEQL
FT                   VSLIYLMTEQLDGVVQRCHDDLMNAEVA"
FT   gene            360195..360518
FT                   /locus_tag="G2583_0365"
FT   CDS_pept        360195..360518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0365"
FT                   /product="unknown protein encoded in prophage CP-933I"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55001"
FT                   /db_xref="InterPro:IPR035317"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXP3"
FT                   /protein_id="ADD55001.1"
FT                   /translation="MICCESLLALRAALYRRAVACAWLALSNHQERYSGLTLAELEDAI
FT                   ARELEGFYLRQHGQQRGLEIACALLSDLMESGPLKACPVLSLLGMTVMDELCSRHLNKP
FT                   ALH"
FT   gene            360475..362865
FT                   /locus_tag="G2583_0366"
FT   CDS_pept        360475..362865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0366"
FT                   /product="Alpha replication protein of prophage CP-933I"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55002"
FT                   /db_xref="GOA:D3QXP4"
FT                   /db_xref="InterPro:IPR004968"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013237"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXP4"
FT                   /protein_id="ADD55002.1"
FT                   /translation="MNFVPVTSTNQRCTKEGRTMSGMKVSQAEKAARGHWSRILPALGV
FT                   NVLKNRHQPCPVCAGKDRFRFDDQEGRGTWFCNQCGAGDGLALVSKVLDVGISEAADRI
FT                   NGIIGNLLPVSQGMLESGSPEKEDGRKAAAVLAARLFDKSRQTTGNAYLTSKGFPALPC
FT                   RELTAMHKVGGVAFRAGDLVVPLYADGELVNLQLINANGGKCFLKGGQVKNAFYLVEGT
FT                   AKAAKRLWIAEGYATALTINYLTGDAVMVAFSSVNFLSLASIACSEYPTHQIIIAADRD
FT                   LNGAGQTRGAAVTGACNCTMALPPVFGDWNDAFTQNGEEATRHAIHEVIKPAVASPFDT
FT                   MSEAEFTALSVSEKAQRVVDHYKNSLAVDPNGQLLSRYEAGAWKVIYYADFARDVAALF
FT                   QRLDAPFSSAKIASLVENLKLIVPQQQNPARQLIGFRNGVLDTRTGLFSPHDKKHWLRT
FT                   LCEVDYTQPVDGESLETHAPAFWRWLDRAAGFNPEKRDIILAALFMVLANRYDWQLFLE
FT                   VTGPGGSGKSILAEIATMLAGEDNATSATIEMLESPRERAALIGFSLIRLPDQEKWSGD
FT                   GAGLKAITGGDAVSVDPKYQNAYSTHIPAVILAVNNNPMRFTDRSGGVSRRRVILHFPD
FT                   QIAPEERDTQLKEKIASELAVIVRQLMQRFSDPMSARTLLQSQQNSDEALTIKRDADSA
FT                   FDFCGYLEVLPDTTGMFMGNANIVPRQPRTYLYHAYLVYMEANGYKNTLSLTMFGKGLP
FT                   LMLKEYGLQYEKRRTNQGMQTNLALREESNADWLPKCDEFAAK"
FT   gene            complement(362998..363954)
FT                   /locus_tag="G2583_0367"
FT   CDS_pept        complement(362998..363954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0367"
FT                   /product="unknown protein encoded in prophage CP-933I"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55003"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXP5"
FT                   /protein_id="ADD55003.1"
FT                   /translation="MTSYSNFSNQIKETINNKFDHEIHDWDIIKNSITTLINKNIHGAG
FT                   RNIVDFIDLGNWNFISNFSFDDSTRRLELEWHPNDKFHIYIESVVFVEFNDTIYAFLKG
FT                   YYHNQLSLNRIYNTKCSSCSFENSGSYMVDVYRTVKRVNETIQTPNINCYTTCILTRPA
FT                   NGHVTSTGFSRNLMDAINISLAEHKIASLHNEVMSIEEYDRDSLQEKGNTARRYLEYIL
FT                   MLVNIRIMHLNNVQYQEQMLGSLVSVIEALDYEPLMKNDVEITKDILNACSHHGGVRIE
FT                   KKDVIFSLEVIENLIKAIKKTDINKLQLDGMFKSIQK"
FT   gene            complement(364629..365528)
FT                   /gene="yagP"
FT                   /locus_tag="G2583_0368"
FT   CDS_pept        complement(364629..365528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagP"
FT                   /locus_tag="G2583_0368"
FT                   /product="putative LysR-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55004"
FT                   /db_xref="GOA:D3QXP6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXP6"
FT                   /protein_id="ADD55004.1"
FT                   /translation="MKIDLNLLPIFIAVAEESNFSKAAARLGVTRSAVSQGIRRLEDAF
FT                   GTMLVMRTTRSVNLTEAGERLHKSLSLPLSGIEAAFEEMVSDHVPRGLLRIAVTSIAEE
FT                   FLSGPLIASFAAANPAVTLDIVVTDEEFDIVAAGYDAGVRLGEVIEKDMIAVPLTGRQR
FT                   EMVVASPSYLAANSTPVHPRELVNHKCIGWRQSPEVAPYRWPFEENGRAFDLAIEPQIT
FT                   TNDLRLMLRLALAGGGITIATQETFRPYIESGKLVSLLDDFLPQFPGFYLYFPQRRNIA
FT                   PKLRALIDHVKEWRQQLA"
FT   gene            365627..366349
FT                   /locus_tag="G2583_0369"
FT   CDS_pept        365627..366349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0369"
FT                   /product="Clavaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55005"
FT                   /db_xref="GOA:D3QXP7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXP7"
FT                   /protein_id="ADD55005.1"
FT                   /translation="MDKVILITGASSGIGEGIARELGMTGAKVLLGARRVERIEAIATE
FT                   ICRAGGIAKARELDVTDRQSMADFVQAALDSWGRVDVLINNAGVMPLSPLAAGKQDEWA
FT                   LTIDVNIKGVLWGIGAVLPVMEAQGSGQIINLGSIGALSVVPTGAVYCASKFAVRAISD
FT                   GLRQESSKIRVTCVNPGVVESELASTITHVETMKAMDAYRSVALQPADIARAVRHIIES
FT                   PESVDTTEITIRPTASAN"
FT   gene            366515..366793
FT                   /locus_tag="G2583_0370"
FT   CDS_pept        366515..366793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55006"
FT                   /db_xref="GOA:D3QXP8"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXP8"
FT                   /protein_id="ADD55006.1"
FT                   /translation="MSLYIKLILSIVREISVNTICSLIVVVALSLLSFSSVAKTITAVG
FT                   STINSTEKEISLQAEKQGKSYKILGAFFKNRVYMIAKLTPVSKNDAS"
FT   gene            367068..367217
FT                   /locus_tag="G2583_0371"
FT   CDS_pept        367068..367217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55007"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXP9"
FT                   /protein_id="ADD55007.1"
FT                   /translation="MITNQTEMVKSSNSYLIRFLTPLNSLKRMHILNISEMNSLLPLLI
FT                   EMEG"
FT   gene            complement(367496..368398)
FT                   /locus_tag="G2583_0372"
FT   CDS_pept        complement(367496..368398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0372"
FT                   /product="LysR substrate binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55008"
FT                   /db_xref="GOA:D3QXQ0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXQ0"
FT                   /protein_id="ADD55008.1"
FT                   /translation="MKGNVSMAKRENYNELYLFMQVVREGSFTAAAKRLGLAQSGVSRS
FT                   VRELEERLGVQLLVRTTRKLSLTQAGEQLYQKTASGFEMLDLGLATLAHYRETPSGTVR
FT                   INASQHAIDKCLLPKLAVFKQRYPDIRLELINESRFVDIIEERFDAGVRLGPEVSQGMV
FT                   AVRITPDMEMAIVGTPEHFRRYGFPQTPADLKAHPCIAYQFADGSVYQWELNQDDKKIT
FT                   HQPEGQWAFSDSYMEAEAARLGLGLAYVPVELVADDLEHGKLIRVLQRYSLRMEGLFLY
FT                   YPHRNVSPALRMVIDTLKI"
FT   gene            368566..369702
FT                   /locus_tag="G2583_0373"
FT   CDS_pept        368566..369702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0373"
FT                   /product="Hydrolase of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55009"
FT                   /db_xref="GOA:D3QXQ1"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXQ1"
FT                   /protein_id="ADD55009.1"
FT                   /translation="MKSFTRTLKTAMPVMLLFASLSGVTTMSYADSTNPNAPVSMTDKW
FT                   DKTFAESQKVDHRKVSFPNRYGITLVGDLYLPKDRGDRKLAAIAVSGPFGAVKEQSSGL
FT                   YAQTLAERGFVTLAFDPSYTGESGGYPRNVASPDINTEDFSAAVDFLGLQKEVDRNRIG
FT                   LLGICGWGGMALNDAAMDTRVKAVATSVMYDMSRAMGHGVGDGEDRYSTADRRAVLQYL
FT                   NEQRWKDAQSGTFAHGGHDINVDSNGKVSAGERILPETLPANPHPVLKEFFDYYRMPRG
FT                   FHERSVNSTGAWTATMPLSFMNMPLLSYASEITIPTLIVTGEKAHSRYFAEDAYKAVGS
FT                   KDKELVVVPGANHVDLYDNVAGKIPFAKFEQFFQTKLK"
FT   gene            369778..370971
FT                   /locus_tag="G2583_0374"
FT   CDS_pept        369778..370971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0374"
FT                   /product="Purine ribonucleoside efflux pump NepI"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55010"
FT                   /db_xref="GOA:D3QXQ2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXQ2"
FT                   /protein_id="ADD55010.1"
FT                   /translation="MSTLSQTPSPHHQHAYWGGIFAMTLCVFVLIASEFMPVSLLTPIA
FT                   RDLGVTEGLAGRGIAISGALAVLTSLTLSTLAGKMNRKFLLLGMTVLMAVSGLIIALAT
FT                   SYLMYMVGRAMIGVAIGGFWSMSAATAIRLVPQHQVTRALAIFNAGNALATVVAAPLGS
FT                   YLGATVGWRGAFLCLVPMAVVAFIWQCISLPSMDANKSHTSCGAVFRLFSRRMVVVGMI
FT                   ACGLFFMGQFALFTYVRPFLESVTRVNSLGLSLILLIIGVAGFIGTLVVSTFLNRKFYP
FT                   TLMAIPGLMAVIAIGLMLTGHHVWMVSLLLGLWGMLATAAPTGWWTWIARTLLDNAEAG
FT                   GGLMVAVIQLSIALGSTAGGIVFDRLGWQSTFAMSSVLLLCAGVLTFVTARQKAGAL"
FT   gene            complement(371091..372107)
FT                   /pseudo
FT                   /gene="yagQ"
FT                   /locus_tag="G2583_0375"
FT                   /note="Putative xanthine dehydrogenase accessory factor"
FT   gene            complement(372117..374315)
FT                   /gene="yagR"
FT                   /locus_tag="G2583_0376"
FT   CDS_pept        complement(372117..374315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagR"
FT                   /locus_tag="G2583_0376"
FT                   /product="Putative xanthine dehydrogenase yagR
FT                   molybdenum-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55011"
FT                   /db_xref="GOA:D3QXQ3"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXQ3"
FT                   /protein_id="ADD55011.1"
FT                   /translation="MKFDKPAGENPIDQLKVVGRPHDRIDGPLKTTGTARYAYEWHEES
FT                   PNAAYGYIVGSAIAKGRLTALDTDAAQKAPGVLPVITASNAGALSKGDKNTARLLGGPT
FT                   IEHYHQAIALVVAETFEQARAAASLVQAHYRRNKGAYSLADEKQAVSQPPEDTPDKNVG
FT                   DFDGAFSSAAVKIDATYTTPDQSHMAMEPHASMAVWDGNKLTLWTSNQMIDWCRTDLAK
FT                   TLKVPVENVRIISPYIGGGFGGKLFLRSDALLAALAARAVKRPVKVMLPRPSIPNNTTH
FT                   RPATLQHLRIGADQSGKITAISHESWSGNLPGGTPETAVQQSELLYAGANRHTGLRLAT
FT                   LDLPEGNAMRAPGEAPGLMALEIAIDELAEKAGIDPVEFRILNDTQVDPADPTRRFSRR
FT                   QLIECLRTGADKFGWKQRNATPGQVRDGEWLVGHGVAAGFRNNLLEKSGARVHLEPNGT
FT                   VTVETDMTDIGTGSYTILAQTAAEMLGVPLEQVAVHLGDSSFPVSAGSGGQWGANTSTS
FT                   GVYAACVKLREMIASAVGFDPEQSQFADGKITNGTRSAMLHEATAGGRLTAEESIEFGT
FT                   LSKEYQQSTFAGHFVEVGVHSATGEVRVRRMLAVCAAGRILNPKTARSQVIGAMTMGMG
FT                   AALMEELAVDDRLGYFVNHDMAGYEVPVHADIPKQEVIFLDDTDPISSPMKAKGVGELG
FT                   LCGVSAAIANAVYNATGIRVRDYPITLDKLLDKLPDVV"
FT   gene            complement(374312..375268)
FT                   /gene="yagS"
FT                   /locus_tag="G2583_0377"
FT   CDS_pept        complement(374312..375268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagS"
FT                   /locus_tag="G2583_0377"
FT                   /product="FAD binding domain in molybdopterin
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55012"
FT                   /db_xref="GOA:D3QXQ4"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXQ4"
FT                   /protein_id="ADD55012.1"
FT                   /translation="MKAFTYERVNPPAEAALSAQRVPGAKFIAGGTNLLDLMKLEIETP
FT                   THLIDVNGLGLDKIEVTDAGGLRIGALVRNTDLVAHERVRRDYAVLSRALLAGASGQLR
FT                   NQATTAGNLLQRTRCPYFYDTNQPCNKRLPGSGCAALEGFSRQHAVVGVSEACIATHPS
FT                   DMAVAMRLLDAVVETITPEGKTRSITLADFYHPPGKTPHIETALLPGELIVAVTLPPPL
FT                   GGKHIYRKVRDRASYAFALVSVAAIIQPDGSGRVALGGVAHKPWRIEAADAQLSQGAQA
FT                   VYDALFASAHPTAENTFKLLLAKRTLASVLAEARAQA"
FT   gene            complement(375265..375954)
FT                   /gene="yagT"
FT                   /locus_tag="G2583_0378"
FT   CDS_pept        complement(375265..375954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagT"
FT                   /locus_tag="G2583_0378"
FT                   /product="Putative xanthine dehydrogenase yagT
FT                   iron-sulfur-binding subunit precursor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55013"
FT                   /db_xref="GOA:D3QXQ5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXQ5"
FT                   /protein_id="ADD55013.1"
FT                   /translation="MSNQGEYPEDNRVGKHEPHDLSLTRRDLIKVSAATAAAAVVYPHS
FT                   TLAASVPAATPAPEIMPLTLKVNGKTEQLEVDTRTTLLDALRENLHLIGTKKGCDHGQC
FT                   GACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTS
FT                   GQICSSVAVLKEIQDGIPSHVTVDLVSPPERTADEIRERMSGNICRCGAYANILAAIED
FT                   AAGEIKS"
FT   gene            376372..376986
FT                   /gene="yagU"
FT                   /locus_tag="G2583_0379"
FT   CDS_pept        376372..376986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagU"
FT                   /locus_tag="G2583_0379"
FT                   /product="Inner membrane protein yagU"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55014"
FT                   /db_xref="GOA:D3QXQ6"
FT                   /db_xref="InterPro:IPR009898"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXQ6"
FT                   /protein_id="ADD55014.1"
FT                   /translation="MNIFEQTPPNRRRYGLAAFIGLIAGVVSAFVKWGAEVPLPPRSPV
FT                   DMFNAACGPESLIRAAGQIDCSRNFLNPPYIFLRDWLGLTDPNAAVYTFAGHVFNWVGV
FT                   THIIFSIVFAVGYCVVAEVFPKIKLWQGLLAGALAQLFVHMISFPLMGLTPPLFDLPWY
FT                   ENVSEIFGHLVWFWSIEIIRRDLRNRITHEPDPEIPLGSNR"
FT   gene            complement(377234..377563)
FT                   /gene="ykgJ"
FT                   /locus_tag="G2583_0380"
FT   CDS_pept        complement(377234..377563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgJ"
FT                   /locus_tag="G2583_0380"
FT                   /product="putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55015"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXQ7"
FT                   /protein_id="ADD55015.1"
FT                   /translation="MSNLNPCMTCGACCAFFRVSFYWAEADDAGGTIPARLTEQISPFH
FT                   RCMSGTNQKNPRCIALAGTPGKNACCTIYKNRSSTCREFAMSGENGVVNEACNRARAKY
FT                   GLTPL"
FT   gene            complement(377876..378631)
FT                   /gene="yagV"
FT                   /locus_tag="G2583_0381"
FT   CDS_pept        complement(377876..378631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagV"
FT                   /locus_tag="G2583_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55016"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXQ8"
FT                   /protein_id="ADD55016.1"
FT                   /translation="MITAGLAKSALQEKFMFRRRGVTLTKALLTAVCMLAAPLTQAISV
FT                   GNLTFSLPSETDFVSKRVVNNNKSARIYRIAISAIDSPGSSELRTRPVDGELLFAPRQL
FT                   ALQAGESEYFKFYYHGPQDNRERYYRVSFREVPTRNLTKRSPTGGEVSTEPVVVMDTIL
FT                   VVRPRQVQFKWSFDQVTGTVSNTGNTWFKLLIKPGCDSTEEEGDAWYLRPGDVVHQPEL
FT                   RQPGNHYLVYNDKFIKISDSCPAKPPSAD"
FT   gene            complement(378555..380198)
FT                   /gene="yagW"
FT                   /locus_tag="G2583_0382"
FT   CDS_pept        complement(378555..380198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagW"
FT                   /locus_tag="G2583_0382"
FT                   /product="putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55017"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXQ9"
FT                   /protein_id="ADD55017.1"
FT                   /translation="MRVNLLIAMIIFALIWPVTALRAAVSKTTWADAPAREFVFVENNS
FT                   DDNFFVTPGGALDPRLTGANRWTGLKYNGSGTIYQQSLGYIDNGYNTGLYTNWKFDMWL
FT                   ENSPVSSPLTGLRCINWYAGCNMTTSLILPQTTDTSGFYGATVTSGGAKWMHGMLSDAF
FT                   YQYLQQMPVGSSFTMTINACQTSVNYDASSGARCKDQASGNWYVRNVTHTKAANLRLIN
FT                   THSLAEVFINSDGVPTLGEGNADCRTQTIGSRSGLSCKMVNYTLQTNGLSNTSIHIFPA
FT                   IANSSLASAVGAYDMQFSLNGSSWKPVSNTAYYYTFNEMKSADSIYVFFSSNFFKQMVN
FT                   QGISDINTKDLFNFRFQNTTSPESGWYEFSTSNTLIIKPRDFSISIISDEYTQTPSREG
FT                   YVGSGESALDFGYIVTTSGKTAADEVLIKVTGPAQVIGGRSYCVFSSDDGKAKVPFPAT
FT                   LSFITRNGATKTYDAGCDDSWRDMTDALWLTTPWTDISGEVGQMDKTTVKFSIPMDNAI
FT                   SLRTVDDNGWFGEVSASGEIHVQATWRNIN"
FT   gene            complement(380188..382713)
FT                   /gene="yagX"
FT                   /locus_tag="G2583_0383"
FT   CDS_pept        complement(380188..382713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagX"
FT                   /locus_tag="G2583_0383"
FT                   /product="putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55018"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR031917"
FT                   /db_xref="InterPro:IPR032636"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXR0"
FT                   /protein_id="ADD55018.1"
FT                   /translation="MPLRRFSPGLKAQFAFGMVFLFVQPDASAADISAQQIGGVIIPQA
FT                   FSQALQDGMSVPLYIHLAGSQGRQDDQRIGSAFIWLDDGQLRIRKIQLEESEDNASVSE
FT                   QTRQQLMALANAPFNEALTIPLTDNAQLDLSLRQLLLQLVVKREALGTVLRSRSEDIGQ
FT                   SSVNTLSSNLSYNFGIYNNQLRNGGSNTSSYLSLNNVTALREHHVVLDGSLYGIGSGQQ
FT                   DSELYKAMYERDFAGHRFAGGTLDTWNLQSLGPMTAISAGKIYGLSWGNQASSTIFDSS
FT                   QSATPVIAFLPAAGEVHLTRDGRLLSVQNFTMGNHEVDTRGLPYGIYDVEVEVIVNGRV
FT                   ISKRTQRVNKLFSRGRGVGAPLAWQVWGGSFHMDRWSENGKKTRPAKESWLAGASTSGS
FT                   LSTLSWAATGYGYDNQAVGETRLTLPLGGAINVNLQNMLASDSSWSSIGSISATLPGGF
FT                   SSLWVNQEKTRIGNQLRRSDADNRAIGGTLNLNSLWSKLGTFSISYNDDRRYNSHYYTA
FT                   DYYQNVYSGTFGSLGLRAGIQRYNNGDSNANTGKYIALDLSLPLGNWFSAGMTHQNGYT
FT                   MANLSARKQFDEGTIRTVGANLSRAISGDTGDDKTLSGGAYAQFDARYASGTLNVNSAA
FT                   DGYVNTNLTANGSVGWQGKNIAASGRTDGNAGVIFNTGLEDDGQISAKINGRIFPLNGK
FT                   RNYLPLSPYGRYEVELQNSKNSLDSYDIVSGRKSHLTLYPGNVAVIEPEVKQMVTVSGR
FT                   IRAEDGTLLANARINNHIGRTRTDENGEFVMDVDKKYPTIDFRYSGNKTCEVALELNQA
FT                   RGAVWVGDVVCSGLSSWAAVTQTGEENES"
FT   gene            complement(382739..383407)
FT                   /gene="matC"
FT                   /locus_tag="G2583_0384"
FT   CDS_pept        complement(382739..383407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="matC"
FT                   /locus_tag="G2583_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55019"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR040695"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXR1"
FT                   /protein_id="ADD55019.1"
FT                   /translation="MKKHLLLLALLLSGISPAQALDVGDISSFMNSDSSTLSKTIKNST
FT                   DSGRLINIRLERLSSPLDDGQVISMDKPDELLLTPASLLLPAQASEVIRFFYKGPADEK
FT                   ERYYRIVWFDQALSDAQRDNANRSAVATASARIGTILVVAPRQANYHFQYANGTLTNTG
FT                   NATLRILAYGPCLKAANGKECKENYYLMPGKSRRFTRVDTADNKGRVALWQGDKFIPVK
FT                   "
FT   gene            complement(383465..384052)
FT                   /gene="matB"
FT                   /locus_tag="G2583_0385"
FT   CDS_pept        complement(383465..384052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="matB"
FT                   /locus_tag="G2583_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55020"
FT                   /db_xref="GOA:D3QXR2"
FT                   /db_xref="InterPro:IPR016514"
FT                   /db_xref="InterPro:IPR038478"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXR2"
FT                   /protein_id="ADD55020.1"
FT                   /translation="MKKKVLAIALVTVFTGMGVAQAADVTAQAVATWSATAKKDTTSKL
FT                   VVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGST
FT                   LNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGT
FT                   TNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS"
FT   gene            complement(384127..384717)
FT                   /gene="matA"
FT                   /locus_tag="G2583_0386"
FT   CDS_pept        complement(384127..384717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="matA"
FT                   /locus_tag="G2583_0386"
FT                   /product="MatA"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55021"
FT                   /db_xref="GOA:D3QXR3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXR3"
FT                   /protein_id="ADD55021.1"
FT                   /translation="MTWQNDYSRDYEVENHMECQNRSDKYIWSPHDAYFYKGLSELIVD
FT                   IDRLIYLSLEKIRKDFVFINLNTDSLTEFINRDNEWLSAVKGKQVVLIAARKSEALANY
FT                   WYYNSNIRGVVYAGLSRDIRKELAYVINGRFLRKDIKKDKITDREMEIIRMTAQGMLPK
FT                   SIARIENCSVKTVYTHRRNAEAKLYSKLYKLVQ"
FT   gene            complement(385122..385346)
FT                   /locus_tag="G2583_0387"
FT   CDS_pept        complement(385122..385346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55022"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXR4"
FT                   /protein_id="ADD55022.1"
FT                   /translation="MQCPGKEAIVPVTTGSLRLTSLNLALRGLTGQMTYLHLFNFSSLI
FT                   GMNTHNHFVRHVNPLKHLTDWQIIFNYDS"
FT   gene            385493..385684
FT                   /gene="ykgL"
FT                   /locus_tag="G2583_0388"
FT   CDS_pept        385493..385684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgL"
FT                   /locus_tag="G2583_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55023"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXR5"
FT                   /protein_id="ADD55023.1"
FT                   /translation="MQAASQREETEWRVQSKRGLMPAYRGEAGQQVNINIMEYSERNVR
FT                   QLTLNEQEDTSPGKLMLV"
FT   gene            complement(385754..385894)
FT                   /gene="ykgO"
FT                   /locus_tag="G2583_0389"
FT   CDS_pept        complement(385754..385894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgO"
FT                   /locus_tag="G2583_0389"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55024"
FT                   /db_xref="GOA:D3QXR6"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXR6"
FT                   /protein_id="ADD55024.1"
FT                   /translation="MKVLNSLRTAKERHPDCQIVKRKGRLYVICKSNPRFKAVQGRKKK
FT                   R"
FT   gene            complement(385894..386160)
FT                   /gene="ykgM"
FT                   /locus_tag="G2583_0390"
FT   CDS_pept        complement(385894..386160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgM"
FT                   /locus_tag="G2583_0390"
FT                   /product="Ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55025"
FT                   /db_xref="GOA:D3QXR7"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXR7"
FT                   /protein_id="ADD55025.1"
FT                   /translation="MMKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIELDGVTYPY
FT                   VTIDVSSKSHPFYTGKLRTVASEGNVARFTQRFGRFVSTKKGA"
FT   gene            complement(387096..388238)
FT                   /locus_tag="G2583_0391"
FT   CDS_pept        complement(387096..388238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0391"
FT                   /product="Oxidoreductase, FAD/FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55026"
FT                   /db_xref="GOA:D3QXR8"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXR8"
FT                   /protein_id="ADD55026.1"
FT                   /translation="MTNKHPSLFSPFMLTEKIKLRNRIVMAPMTTWSANPDGTISEQEL
FT                   EFYKRRSQNVGLVITGCTYVTPSGIGFTHEFAAYDDRFINSLEKLAAAAKSGGAPAILQ
FT                   IFHAGNKAIPELVPNNDVISASASSVKSGDFMKRVVQSREMTENEIQETIRAFGDVTKR
FT                   AIKAGFDGIELHGAHGFLLQNFFSPLFNQRNDRWGGDLEGRMRFPLAVLQEVKNVVYEY
FT                   ATKPFAIGYRISPEESATGGLRIEDTYKLLDRLISSGISYIHTSLVSINDSYPVESPNG
FT                   PRTIELILNHIAGRVPVIAAGKIRTPSQAQEAISTGLPLVAIGKGLVINPEWVTLAESG
FT                   RGHEIQTTLNPQLVPELTIPDKLWDQIQASKGTGWFPLMD"
FT   gene            complement(388473..389393)
FT                   /gene="ycjY"
FT                   /locus_tag="G2583_0392"
FT   CDS_pept        complement(388473..389393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycjY"
FT                   /locus_tag="G2583_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55027"
FT                   /db_xref="GOA:D3QXR9"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXR9"
FT                   /protein_id="ADD55027.1"
FT                   /translation="MKTVSIKHTYWDIAADIYFPDDFNSEKKHPAIISAHPIGSCKEQT
FT                   SGSVYGAALAKAGFIVIAFDASFQGSSGGEPRYLEDPTMRVKDFSIVVDYLTSLPYVDA
FT                   GRIGVLGICGGGGYAINAAMTERRIKAIGTVTGANYGRLMREGFTAFNPIGALEAMAQQ
FT                   RTDEANGAKLRVDDLLPSSPDAALEAGLTEIDLFEATEYYRSPRGYAPNGVNRSLFSHQ
FT                   TVAVGWDAFHLAEVLLTQPIMVVVGDRVGAFGAYRDGCEIIGRAASKHKELVVVEGYSH
FT                   YDLYDKPEPVKQALDKLIPFYKTHL"
FT   gene            389487..390476
FT                   /gene="ycaN"
FT                   /locus_tag="G2583_0393"
FT   CDS_pept        389487..390476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycaN"
FT                   /locus_tag="G2583_0393"
FT                   /product="Putative LysR-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55028"
FT                   /db_xref="GOA:D3QXS0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXS0"
FT                   /protein_id="ADD55028.1"
FT                   /translation="MTCIGYHQWSNIYHSVKLRFTMMKIEPSILPSLAWFALIVRAGSF
FT                   SRAASEMGITLAALSQNLKSLEERLNTKLIYRTTRNMSLTEEGQRLYEVLVSALGQIDD
FT                   ALKDVGDTQLEPTGLLRINSSRVAARMLVEPHIGEFLTRYPKTKIELIMDDGLSNIIAD
FT                   GCDVGIRLEQGLDEHMTAVPVSPLIKLVTVASPDYLKEHGIPETPQELSNHNCLRLRHK
FT                   SSGALSAWEFSKVVGGNEEFEIEVSGKYISNDDESMIRMALNGTGIIQHLDFAIAEHIN
FT                   AGKLQPILEDWAVSFPGFYIYVSSRVRMPSKVRAFIDFMVEKRVKLEN"
FT   gene            complement(390764..391120)
FT                   /locus_tag="G2583_0394"
FT   CDS_pept        complement(390764..391120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55029"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXS1"
FT                   /protein_id="ADD55029.1"
FT                   /translation="MNKNLILAFALFSLPVFAEEDLGPGKYVCDIRISSLDTATQILSK
FT                   SATVLDNGNNFIVQMPNGDQLYSPDLENVDDGIKQKATIGGVTFIRRPTFNDRFIVEDG
FT                   NTGFFYKMRNCEKK"
FT   gene            391151..391279
FT                   /locus_tag="G2583_0395"
FT   CDS_pept        391151..391279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55030"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXS2"
FT                   /protein_id="ADD55030.1"
FT                   /translation="MLHKEHVNEKSDWLMSNAINPRMAYFSLAAVLNLIEYGQDSD"
FT   gene            complement(391313..391888)
FT                   /locus_tag="G2583_0396"
FT   CDS_pept        complement(391313..391888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0396"
FT                   /product="2,5-diketo-D-gluconic acid reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55031"
FT                   /db_xref="GOA:D3QXS3"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXS3"
FT                   /protein_id="ADD55031.1"
FT                   /translation="MQKVKLNNGIEMPLLGFGVFQMTDAAECERAVIDAINTGYRLIDT
FT                   AASYQNEPQVGNALKQSGIARNELFVTTKLWLQDTSYEGAKALFERSLNRLQLDYVDLY
FT                   LIHQPYGDVHGAWRAMEELQQAGKIRAIGVSNFHPDRLADLIAFNNVVPAVNQVEVNPF
FT                   NQQLHAVPWMQSRGIQPEAWAPFAVTGR"
FT   gene            392454..396707
FT                   /gene="eaeH"
FT                   /locus_tag="G2583_0397"
FT   CDS_pept        392454..396707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eaeH"
FT                   /locus_tag="G2583_0397"
FT                   /product="Attaching and effacing protein-like protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55032"
FT                   /db_xref="GOA:D3QXS4"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR003535"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015217"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="InterPro:IPR038177"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXS4"
FT                   /protein_id="ADD55032.1"
FT                   /translation="MSRYKTGHKQPRFRYSVLARCVAWANISVQVLFPLAVTFTPVMAA
FT                   RAQHAVQPRLSMGNTTVTADNNVEKNVASFAANAGTFLSSQPDSDATRNFITGMATAKA
FT                   NQEIQEWLGKYGTARVKLNVDKDFSLKDSSLEMLYPIYDTPTNMLFTQGAIHRTDDRTQ
FT                   SNIGFGWRHFSGNDWMAGVNTFIDHDLSRSHTRIGVGAEYWRDYLKLSANGYIRASGWK
FT                   KSPDIEDYQEHPANGWDIRAEGYLPAWPQLGASLMYEQYYGDEVGLFGKDKRQKDPHAI
FT                   SAEVTYTPVPLLTLSAGHKQGKSGENDTRFGLEVNYRIGEPLAKQLDTDSIRERRVLAG
FT                   SRYDLVERNNNIVLEYRKSEVIRIALPERIEGKGGQTLSLGLVVSKATHGLKNVQWEAP
FT                   SLLAEGGKITGQGSQWQVTLPAYRPGKDNYYAISAVAYDNKGNTSKRVQTEVVITGAGM
FT                   SADRTALTLDGQSRIQMLANGNEQKPLVLSLRDAEGQPVTGMKDQIKTELTFKPAGNIV
FT                   TRSLKATKSQAKPTLGEFTETEAGVYQSVFTTGTQSGEATITVSVDGMSKTVTAELRAT
FT                   MMDVANSTLSANEPSGDVVADGQQAYTLTLTAVDSEGNSVTGEASRLRFVPQDTNGVTV
FT                   GAISEIKPGVYSAAVSSTRAGNVVVRAFSEQYQLGTLQQTLKFVAGPLDAAHSSITLNP
FT                   DKPVVGGTVTAIWTVKDAYDNPVTSLTPEAPSLAGAAAEGSTASGWTNNGDGTWTAQIT
FT                   LGSTAGELEVMPKLNGQNAAANAAKVTVVADALSSNQSKVSVAEDHVKAGESTTVTLVA
FT                   KDAHGNAISGLALSASLTGTASEGATVSSWTEKGNGSYVATLTTGGKTGELRVMPLFNG
FT                   QPAATEAAQLTVIAGEMSSANSTLVADNKAPTVKTTTELTFTVKDAYGNPVTGLKPDAP
FT                   VFSGAASTGSERPSAGNWTEKGNGVYVSTLTLGSAAGQLSVMPRVNGQNAVAQPLVLNV
FT                   AGDASKAEIRDMTVKVNNQLANGQSANQITLTVVDTYGNPLQGQEVTLTLPQGVTSKTG
FT                   NTVTTNAAGKADIELMSTVAGEHNISASVNGAQKTVTVKFNADASTGQANLQVDAAAQK
FT                   VANGKDAFTLTANVEDKNGNPVPGSLVTFNLPRGVKPLTGDNVWVKANDEGKAELQVVS
FT                   VTAGTYEITASAGNSQPSNTQTITFVADKATATVSGIEVIGNYALADGNAKQTYKVTVT
FT                   DANNNLLKDSEVTLTASPANLVLTPNGTAKTNEQGQAIFTATTTVAAKYTLTAKVSQAD
FT                   GQESTKTAESKFVADDKNAVLTASSDVTSLVADGISTAKLEVTLMSANNPVGGNMWVDI
FT                   KTPEGVTEKDYQFLPSKNDHFVSGKITRTFSTSKPGVYTFTFNALTYGGYEMKPVTVTI
FT                   TAVDADTAKGEEAMN"
FT   gene            complement(396828..397718)
FT                   /gene="ykgA"
FT                   /locus_tag="G2583_0398"
FT   CDS_pept        complement(396828..397718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgA"
FT                   /locus_tag="G2583_0398"
FT                   /product="Putative AraC-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55033"
FT                   /db_xref="GOA:D3QXS5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXS5"
FT                   /protein_id="ADD55033.1"
FT                   /translation="MRYDKELTENVMIRQKILQQLLEWIECNLEHPISIEDIAQKSGYS
FT                   RRNIQLLFRNFMHVPLGEYIRKRRLCRAAILVRLTAKSMLDIAISLHFDSQQSFSREFK
FT                   KLFGCSPRVYRHRDYWDLANIFPSFLIRQQQKTECRLVNFPETPIFGNSFKYDIEVSNK
FT                   SPDEEVKLRRHHLARCMKNFKTDIYFVSTFEPSTKSVDLLTVETFAGTVCKQTDSEMPK
FT                   EWTINRGLYASFRYEGEWEHYPEWARNLYLMELPARGLARVNGSDIERFYYNEDFVEKD
FT                   SNDVVCEIFIPVRPV"
FT   gene            397919..398803
FT                   /locus_tag="G2583_0399"
FT   CDS_pept        397919..398803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0399"
FT                   /product="Putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55034"
FT                   /db_xref="GOA:D3QXS6"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXS6"
FT                   /protein_id="ADD55034.1"
FT                   /translation="MEGLTVEFSVLSNNLKMPMMGFGVFQVTDKNVCKQSVLNAIRTGY
FT                   RLIDTAAVYGNEDAVGEAVREAISEGLCTREELFITSKLWVQDMLNQDTAAAGIEASLK
FT                   KSGLEYFDLYLLHQAMRDYFSAWRALEDAYEEGKLKAIGVSNFYPHVLANFCETVRVKP
FT                   MVNQVELHPYFAQPEALATMKYYNVQPEAWAPLGGGRHKPFENNLLQSIADAHQKSISQ
FT                   VILRWNIQRGVVVIPKSTHQQRIEENFAIWDFSLTEKEMAQISSLDLGYVGESVKHFNP
FT                   EFVRGCLAVKIHD"
FT   gene            complement(398963..399556)
FT                   /gene="ykgB"
FT                   /locus_tag="G2583_0400"
FT   CDS_pept        complement(398963..399556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgB"
FT                   /locus_tag="G2583_0400"
FT                   /product="protein of unknown function DUF417"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55036"
FT                   /db_xref="GOA:D3QXS7"
FT                   /db_xref="InterPro:IPR007339"
FT                   /db_xref="InterPro:IPR016865"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXS7"
FT                   /protein_id="ADD55036.1"
FT                   /translation="MEKYLHLLSRGDKIGLTLIRLSIAIVFMWIGLLKFVPYEADSITP
FT                   FVANSPLMSFFYEHPEDYKQYLTHEGEYKPEARAWQSANNTYGFSNGLGVVEVIIALLV
FT                   LANPVNRWLGLLGGLMAFTTPLVTLSFLITTPEAWVPALGDAHHGFPYLSGAGRLVLKD
FT                   TLMLAGAVMIMADSARGILKQRSNESSSTLKTEY"
FT   gene            399539..399808
FT                   /locus_tag="G2583_0401"
FT   CDS_pept        399539..399808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55035"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXS8"
FT                   /protein_id="ADD55035.1"
FT                   /translation="MQVFFHCEHPYLYNTAVAVELLSIRIDVTFQDEALYFLAISAMAS
FT                   SRTVGDADTDETLICFRIILSSALVENAITPDNSVANKTGFLNI"
FT   gene            complement(399568..399819)
FT                   /gene="ykgI"
FT                   /locus_tag="G2583_0402"
FT   CDS_pept        complement(399568..399819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgI"
FT                   /locus_tag="G2583_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55037"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXS9"
FT                   /protein_id="ADD55037.1"
FT                   /translation="MMVFYMFKKPVLFATLLSGVMAFSTNADDKIILKHISVSSVSASP
FT                   TVLEDAIADIARKYNASSWKVTSMRIDNNSTATAVLYK"
FT   gene            complement(399913..401238)
FT                   /gene="ykgC"
FT                   /locus_tag="G2583_0403"
FT   CDS_pept        complement(399913..401238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgC"
FT                   /locus_tag="G2583_0403"
FT                   /product="Pyridine nucleotide-disulfide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55038"
FT                   /db_xref="GOA:D3QXT0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXT0"
FT                   /protein_id="ADD55038.1"
FT                   /translation="MNKYQAVIIGFGKAGKTLAVTLAKAGWRVALIEQSNAMYGGTCIN
FT                   IGCIPTKTLVHDAQQHTDFVRAIQRKNEVVNFLRNKNFHNLADMPNIDVINGQAEFINN
FT                   HSLRVHRPEGNLEIHGEKIFINTGAQTVVPPIPGITTTPGVYDSTGLLNLKELPGHLGI
FT                   LGGGYIGVEFASMFANFGSKVTILEAASLFLPREERDIADNIATILRDQGVDIILNAHV
FT                   ERISHHENQVQVHSEHAQLAVDALLIASGRQPATASLHPENAGIAVNERGAIVVDKRLH
FT                   TTADNIWAMGDVTGGLQFTYISLDDYRIVRDELLGEGKRSTDDRKNVPYSVFMTPPLSR
FT                   VGMTEEQARESGADIQVVTLPVAAIPRARVMNDTRGVLKAIVDNKTQRILGASLLCVDS
FT                   HEMINIVKMVMDAGLPYSILRDQIFTHPSMSESLNDLFSLVK"
FT   gene            401464..402318
FT                   /gene="ykgD"
FT                   /locus_tag="G2583_0404"
FT   CDS_pept        401464..402318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgD"
FT                   /locus_tag="G2583_0404"
FT                   /product="Hypothetical transcriptional regulator ykgD"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55039"
FT                   /db_xref="GOA:D3QXT1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXT1"
FT                   /protein_id="ADD55039.1"
FT                   /translation="MDALSRLLMLNAPQGTIDKNCVLGSDWQLPHGAGELSVIRWHALT
FT                   QGAAKLEMPTGEIFTLRPGNVVLLPQNSAHRLSHVDNESTCIVCGTLRLQHSARYFLTS
FT                   LPETLFLAPVNHSVEYNWLREAIPFLQQESRSAMPGVDALCSQICATFFTLAVREWIAQ
FT                   VNTEKNILSLLLHPRLGAVIQQMLEMPGHAWSVESLASIAHMSRASFAQLFRDVSGTTP
FT                   LAVLTKLRLQIAAQMFSREMLPVVVIAESVGYASESSFHKAFVREFGCTPGEYRERVRQ
FT                   LAP"
FT   gene            402845..403564
FT                   /gene="ykgE"
FT                   /locus_tag="G2583_0405"
FT   CDS_pept        402845..403564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgE"
FT                   /locus_tag="G2583_0405"
FT                   /product="Cysteine-rich domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55040"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXT2"
FT                   /protein_id="ADD55040.1"
FT                   /translation="MNVNFFVTCIGDALKSRMARDSVLLLEKLGCRVNFPEKQGCCGQP
FT                   AINSGYIKEAIPGMKNLIAALEDNDDPIISPAGSCTYAVKSYPTYLADEPEWASRAEKV
FT                   AARMQDLTSFIVNKLGVVDVGASLQGRAVYHPSCSLARKLGVKDEPLTLLKNVRGLELL
FT                   TFAEQDTCCGFGGTFSVKMAEISGEMVKEKVAHLMEVRPEYLIGADVSCLLNISGRLQR
FT                   EGQKVKVMHIAEVLMSR"
FT   gene            403575..405002
FT                   /gene="ykgF"
FT                   /locus_tag="G2583_0406"
FT   CDS_pept        403575..405002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgF"
FT                   /locus_tag="G2583_0406"
FT                   /product="Iron-sulfur cluster binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55041"
FT                   /db_xref="GOA:D3QXT3"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXT3"
FT                   /protein_id="ADD55041.1"
FT                   /translation="MLIKTSNTDFKTRIRQQIEDPIMRKAVANAQQRIGANRQKMVDEL
FT                   GLWEEWRDRAAQIRDHVLSNLDAYLYQLSEKVTQNGGHVYFAKTKEDATRYILQVAQRK
FT                   NARKVVKSKSMVTEEIGVNHVLQDAGIQVIETDLGEYILQLDQDPPSHVVVPAIHKDRH
FT                   QIRRVLHERLGYEGPETPEAMTLFIRQKIREDFLSAEIGITGCNFAVAETGSVCLVTNE
FT                   GNARMCTTLPKTHIAVMGMERIAPTFAEVDVLITMLARSAVGARLTGYNTWLTGPREAG
FT                   HVDGPEEFHLVIVDNGRSEVLASEFRDVLRCIRCGACMNTCPAYRHIGGHGYGSIYPGP
FT                   IGAVISPLLGGYKDFKDLPYACSLCTACDNVCPVRIPLSKLILRHRRVMAEKGITAKAE
FT                   QRAIKMFAYANSHPGLWKVGMMAGAHAASWFINGGKTPLKFGAISDWMEARDLPEADGE
FT                   SFRSWFKKHQAQEKKNG"
FT   gene            404995..405690
FT                   /gene="ykgG"
FT                   /locus_tag="G2583_0407"
FT   CDS_pept        404995..405690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgG"
FT                   /locus_tag="G2583_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55042"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXT4"
FT                   /protein_id="ADD55042.1"
FT                   /translation="MDNRGEFLNNVAQALGRPLRLEPQAEDAPLNNYANERLTQLNQQQ
FT                   RCDAFIQFASDVMLTRCELTSEAKAAEAAIRLCKELGDQSVVISGDTRLEELGISERLQ
FT                   QECNAVVWDPAKGAKNISQAEQAKVGVVYAEYGLTESGGVVLFSAAERGRSLSLLPESS
FT                   LFILRKSTILPRVAQLAERLHQKAQAGERMPSCINIISGPSSTADIELIKVVGVHGPVK
FT                   AVYLIIEDC"
FT   gene            complement(405645..405857)
FT                   /locus_tag="G2583_0408"
FT   CDS_pept        complement(405645..405857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55043"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXT5"
FT                   /protein_id="ADD55043.1"
FT                   /translation="MDACLFHCKYPGISNARIFTEEEHNHDGTGLSQVVLNAIFNLVCL
FT                   LQVYVQTSYLSQQSSIIRYTAFTGP"
FT   gene            complement(405933..406601)
FT                   /pseudo
FT                   /gene="ykgH"
FT                   /locus_tag="G2583_0409"
FT                   /note="hypothetical protein"
FT   gene            complement(406783..409080)
FT                   /locus_tag="G2583_0410"
FT   CDS_pept        complement(406783..409080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0410"
FT                   /product="Putative autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55044"
FT                   /db_xref="GOA:D3QXT6"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXT6"
FT                   /protein_id="ADD55044.1"
FT                   /translation="MKNSKAFYRSALATAIVMALSAPAFAADNAVSTDSVTLNKDKTTL
FT                   DQDVVISNTADKQITAVTINAADEDLNVAFAGHDITAESTADKKFVEGVKVSGNKNVVI
FT                   NATDSTITAQGEGTYVRTAMVIDSTGDVVVNGGNFVAKNEKGSATGISLEGAKGNNVTL
FT                   NGTTINAQGNKSSSNASTAIFAQKGSLLNSFEGDATDNITLAGSNIINGRIETIVTAGN
FT                   KTGIHTVNLNIKDGSVIGAANNKQTIYASASAQGTGSATQNLNLSVADSTIYSDVLALS
FT                   ESENSAATTTNVNMNVARSYWEGNAYTFNSGDKAGSNLDINLSDSSVWKGKVSGAGNAS
FT                   VSLQNESVWNVTGSSTVDALAVKDSTVNITKATVNTGTFASQNGTLIVDASSENTLDIS
FT                   GKASGDLRVYSAGSLDLINEQTAFISTGKDSTLKATGTTEGGLYQYDLTQGADGNFYFV
FT                   KNTHKASNASSVIQAMAAAPANVANLQADTLSARQDAVRLSENDKGGVWIQYFGGKQKH
FT                   TTAGNASYDLDVNGVMLGGDTRFMTEDGSWLAGVAMSSAKGDMTTMQSKGDTEGYSFHA
FT                   YLSRQYNNGIFIDTAAQFGHYSNTADVRLMNGGGTIKADFNTNGFGAMVKGGYTWEDGN
FT                   GLFIQPYAKLSALTLEGVDYQLNGVDVHSDSYNSVLGEAGTRVGYDFAVGNASVKPYLN
FT                   LAALNEFSDGNKVRLGDESVNASIDGAAFRVGAGVQADITKNMGAYASLDYTKGDDIEN
FT                   PLQGVVGINVTW"
FT   gene            complement(409122..409883)
FT                   /locus_tag="G2583_0411"
FT   CDS_pept        complement(409122..409883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55045"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXT7"
FT                   /protein_id="ADD55045.1"
FT                   /translation="MRFVLFCPSGIVPAQFAALSTGSVGNVTCIGTEEELRNKLRHRPQ
FT                   SVVISAGRPAECAEMWFRFYRDHSFVVVLCVAPFFLPPDVSISGVLKNLRLLKPGMSVE
FT                   HVISIANSSGGLSGLKHAENLPVMDSYSVFMKEVNNRTKTIVMSERFPEKQKKVLSLLL
FT                   AGHSWEYSAQFLKTGIRQIWLAEQSLKKRWGIPDSMSLREALLLSSNKFHGDGNALEKT
FT                   NAMTLRENGNTNRYSVVVNAGTQVLSLHKYK"
FT   gene            complement(410037..410831)
FT                   /locus_tag="G2583_0412"
FT   CDS_pept        complement(410037..410831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55046"
FT                   /db_xref="GOA:D3QXT8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXT8"
FT                   /protein_id="ADD55046.1"
FT                   /translation="MKKPLVIISACQFTRLALESLIPADRYIVRVYSNVTTEVEFVLKT
FT                   SCGYLLADIPSLPSGELVLLACLVRLRSDAGQWQVCLTGDSDWFDNAPAASLYNGFPRI
FT                   GTMLTASRYQNQIIRWLLRPLPGDMSDFWLLTARELSVLKILMQGMSFSEIARYEQRSS
FT                   KTLHAIATRALMKLGLGTLSDFRLLYTGCGDSRVKRNIRLHARYVGQHSAHRLTQYVQN
FT                   MVSGILYPEKVAVGESINSDAISGKVLPGQRKNISKKRPGLL"
FT   gene            complement(411161..411723)
FT                   /pseudo
FT                   /gene="fimX"
FT                   /locus_tag="G2583_0413"
FT                   /note="Site-specific recombinase, phage integrase family"
FT   gene            412531..412782
FT                   /locus_tag="G2583_0414"
FT   CDS_pept        412531..412782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55047"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXT9"
FT                   /protein_id="ADD55047.1"
FT                   /translation="MLTVSGSEQVTIARNTSGVILKLSGISPAVYQCIHSTFISEIERV
FT                   SLEFAGEVVTMKHESYPYVLYNDSVPIPGTVTLNLIGS"
FT   gene            complement(412784..414472)
FT                   /gene="betA"
FT                   /locus_tag="G2583_0415"
FT   CDS_pept        complement(412784..414472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betA"
FT                   /locus_tag="G2583_0415"
FT                   /product="Choline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55048"
FT                   /db_xref="GOA:D3QXU0"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXU0"
FT                   /protein_id="ADD55048.1"
FT                   /translation="MQFDYIIIGAGSAGNVLATRLTEDPNTSVLLLEAGGPDYRFDFRT
FT                   QMPAALAFPLQGKRYNWAYETEPEPFMNNRRMECGRGKGLGGSSLINGMCYIRGNAMDL
FT                   DNWAKEPGLENWSYLDCLPYYRKAETRDVGENDYHGGDGPVSVTTSKPGVNPLFEAMIE
FT                   AGVQAGYPRTDDLNGYQQEGFGPMDRTVTPQGRRASTARGYLDQAKSRPNLTIRTHAMT
FT                   DHIIFDCKRAVGVEWLEGDSTIPTRATANKEVLLCAGAIASPQILQRSGVGNAELLAEF
FT                   DIPLVHDLPGVGENLQDHLEMYLQYECKEPVSLYPALQWWNQPKIGAEWLFGGTGVGAS
FT                   NHFEAGGFIRSREEFAWPNIQYHFLPVAINYNGSNAVKEHGFQCHVGSMRSPSRGHVRI
FT                   KSRDPHQHPAILFNYMSHEQDWQEFRDAIRITREIMHQPALDQYRGREISPGTECQTDE
FT                   QLDEFVRNHAETAFHPCGTCKMGYDEMSVVDGEGRVHGLEGLRVVDASIMPQIITGNLN
FT                   ATTIMIGEKMADMIRGKEALPRSTAGYFVANGMPVRAKKMSRDLN"
FT   gene            complement(414486..415958)
FT                   /gene="betB"
FT                   /locus_tag="G2583_0416"
FT   CDS_pept        complement(414486..415958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betB"
FT                   /locus_tag="G2583_0416"
FT                   /product="Betaine aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55049"
FT                   /db_xref="GOA:D3QXU1"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXU1"
FT                   /protein_id="ADD55049.1"
FT                   /translation="MSRMAEQQLYIHGGYTSATSGRTFETINPANGNVLATVQAAGRED
FT                   VDRAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELAKLETLDAGKAYSETSTV
FT                   DIVTGADVLEYYAGLIPSLEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWKS
FT                   APALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTEHPGI
FT                   AKVSFTGGVASGKKVMANSAASSLKEVTMELGGKSPLIVFDDADLDLAADIAMMANFFS
FT                   SGQVCTNGTRVFVPAKCNAAFEQKILARVERIRAGDVFDPQTNFGPLVSFPHRDNVLRY
FT                   IAKGKEEGARVLCGGDVLKGDGLDNGAWVAPTVFTDCSDEMTIVREEIFGPVMSILTYE
FT                   SEDEVIRRANDTDYGLAAGIVTADLNRAHRVIHQLEAGICWINTWGESPAEMPVGGYKH
FT                   SGIGRENGVMTLQSYTQVKSIQVEMAKFQSIF"
FT   gene            complement(415972..416577)
FT                   /gene="betI"
FT                   /locus_tag="G2583_0417"
FT   CDS_pept        complement(415972..416577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betI"
FT                   /locus_tag="G2583_0417"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55050"
FT                   /db_xref="GOA:D3QXU2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017757"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXU2"
FT                   /protein_id="ADD55050.1"
FT                   /translation="MNGVAKMPKLGMQSIRRRQLIDATLEAINEVGMHDATIAQIARRA
FT                   GVSTGIISHYFRDKNGLLEATMRDITSQLRDAVLNRLHALPQGSAEQRLQAIVGGNFDE
FT                   TQVSSAAMKAWLAFWASSMHQPMLYRLQQVSSRRLLSNLVSEFRRELPRHQAQEAGYGL
FT                   AALIDGLWLRAALSGKPLDKPLAHSLTRHFITQHLPTD"
FT   gene            416688..418721
FT                   /gene="betT"
FT                   /locus_tag="G2583_0418"
FT   CDS_pept        416688..418721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betT"
FT                   /locus_tag="G2583_0418"
FT                   /product="High-affinity choline transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55051"
FT                   /db_xref="GOA:D3QXU3"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXU3"
FT                   /protein_id="ADD55051.1"
FT                   /translation="MTDLSHSREKDKINPVVFYTSAGLILLFSLTTILFRDFSALWIGR
FT                   TLDWVSKTFGWYYLLAATLYIVFVVCIACSRFGSVKLGPEQSKPEFSLLSWAAMLFAAG
FT                   IGIDLMFFSVAEPVTQYMQPPEGAGQTIEAARQAMVWTLFHYGLTGWSMYALMGMALGY
FT                   FSYRYNLPLTIRSALYPIFGKRINGPIGHSVDIAAVIGTIFGIATTLGIGVVQLNYGLS
FT                   VLFDIPDSMAAKAALIALSVIIATISVTSGVDKGIRVLSELNVALALGLILFVLFMGDT
FT                   SFLLNALVLNVGDYVNRFMGMTLNSFAFDRPVEWMNNWTLFFWAWWVAWSPFVGLFLAR
FT                   ISRGRTIRQFVLGTLIIPFTFTLLWLSVFGNSALYEIIHGGAAFAEEAMVHPERGFYSL
FT                   LAQYPAFTFSASVATITGLLFYVTSADSGALVLGNFTSQLKDINSDAPGWLRVFWSVAI
FT                   GLLTLGMLMTNGISALQNTTVIMGLPFSFVIFFVMAGLYKSLKVEDYRRESANRDTAPR
FT                   PLGLQDRLSWKKRLSRLMNYPGTRYTKQMMETVCYPAMEEVAQELRLRGAYVELKSLPP
FT                   EEGQQLGHLDLLVHMGEEQNFVYQIWPQQYSVPGFTYRARSGKSTYYRLETFLLEGSQG
FT                   NDLMDYSKEQVITDILDQYERHLNFIHLHREAPGHSVMFPDA"
FT   gene            419229..423278
FT                   /gene="aidA"
FT                   /locus_tag="G2583_0419"
FT   CDS_pept        419229..423278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aidA"
FT                   /locus_tag="G2583_0419"
FT                   /product="AidA-I adhesin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55052"
FT                   /db_xref="GOA:D3QXU4"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXU4"
FT                   /protein_id="ADD55052.1"
FT                   /translation="MAFNALLFMQSWFYLDVLLEIVMNKIYRLKWNRSRNCWSVCSELG
FT                   SRVKGKKSRAVLISAISLYSSLVFADDVIVNQDKTIDFGKENQSIDYRITVTDNANLVI
FT                   NATDTSRPRLTLASGGGLDITGGKVTINGPLNFLLKGTGFLNVSNAGSELYADDLYESN
FT                   SGMRHDRGYFNVSNGGKIHVKGTSRLTYLQGNVSGEGSQVNSETFFMGVYGSYGGNQYL
FT                   SVNNGGEVNARKQISLGYYDQVSDTTLAVSEGGKISAPTISLSTNSELALGAQEGSAAK
FT                   AAGIIDAEKIEFVWAKTSEKKITLNHTDKDATISADIVSGSEGLGYINALNGTTYLTGD
FT                   NSAFSGKVKIEQNGALGITQNIGTAEINNRGKLHLKADDSMTFANKISGNGTISIDSGT
FT                   VELTGNNYAFSGYIDVASGAVAVISEDKNIGRAELDVDGKLQINANKDWVFDNDLEGRG
FT                   IVEINMGNHEFSFDEFAYTDWFQGSLAFQNTTFNLEKNAEFLQKGGITAGQGSLVTVGK
FT                   GAHSISTLGFSGGTVDFGALTAGAQMTEGTVNVSKTLDLRGEGVIQVSDSDVVRSVSRD
FT                   IDSALSLTEVDDGNSTIKLVDAQGAEVLGDAGNLQLQDKNGQILSSSAQRDIQQNGQKA
FT                   AVGTYDYRLTSGVNNDGLYIGYGLTQLDLHATDSDALVLSSNGKSENAADLSAKITGSG
FT                   DLAFSSQKGQTVSLSNKDNDYTGVTDLRSGTLLLNNDNVLGNTHELRLAAETELDMNGH
FT                   SQTVGTLNGSADSLLSLNGGSLTVTNGGTSTGSLTGSGELNIQGGTLDIAGDNSNLTAN
FT                   VNIANSANVLVSHAQGLGSANVENNGTLALNNSAEKRAAASVNYALGGNLTNNGTLMTG
FT                   MSGQQAGNVLVVKGNYHGNNGQLVMNTVLNGDDSVTDKLVVEGDTSGTTAVTVNNAGGT
FT                   GAKTLNGIELIHVDGKSEGEFVQAGRIVAGAYDYTLARGQGANSGNWYLTSGSDSPELQ
FT                   PEPDPMPNPEPNPNPEPNPNPTPTPGPDLNVDNDLRPEAGSYIANLAAANTMFTTRLHE
FT                   RLGNTYYTDMVTGEQKQTTMWMRHEGGHNKWRDGSGQLKTQSNRYVLQLGGDVAQWSQN
FT                   GSDRWHVGVMAGYGNSDSKTISSRTGYRAKASVNGYSTGLYATWYADDESRNGAYLDSW
FT                   AQYSWFDNTVKGDDLQSESYKSKGFTASLEAGYKHKLAEFNGSQGTRNEWYVQPQAQVT
FT                   WMGVKADKHRESNGTLVHSNGDGNVQTRLGVKTWLKSHHKMDDGKSREFQPFVEVNWLH
FT                   NSKDFSTSMDGVSVTQDGARNIAEIKTGVEGQLNANLNVWGNVGVQVADRGYNDTSAMV
FT                   GIKWQF"
FT   gene            423411..424508
FT                   /gene="yahA"
FT                   /locus_tag="G2583_0420"
FT   CDS_pept        423411..424508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahA"
FT                   /locus_tag="G2583_0420"
FT                   /product="LuxR-family transcriptional regulator/cyclic
FT                   diguanylate phosphodiesterase (EAL) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55053"
FT                   /db_xref="GOA:D3QXU5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXU5"
FT                   /protein_id="ADD55053.1"
FT                   /translation="MCSMASHDLSVFLEEFGATVNLTLPGIVSEKERLLLKLLMEGMSV
FT                   TEISQYRNRSAKTISHQKKQLYEKLGIQSDITFWRDIFFQYHPQVISGTGNKNNFYIPD
FT                   NRCHHIVTPEAISLALENHEFKPWIQPVFCAQTGVLTGCEVLVRWEHPQTGIIPPDQFI
FT                   PLAESSGLIVIMTRQLMKQTADILMPVKHLLPDNFHIGINVSAGCFLAAGFEKECLNLV
FT                   KKLGNDKIKLVLELTERNPIPVTPEARAIFDSLHQHNITFALDDFGTGYATYRYLQAFP
FT                   VDFIKIDKSFVQMASVDEISGHIVDNIVELARKPSLSIVAEGVETQEQADLMIGKGVHF
FT                   LQGYLYSPPVPGNKFISEWVMKAGG"
FT   gene            complement(424550..425481)
FT                   /pseudo
FT                   /gene="yahB"
FT                   /locus_tag="G2583_0421"
FT                   /note="Uncharacterized HTH-type transcriptional regulator
FT                   yahB"
FT   gene            complement(425573..426090)
FT                   /pseudo
FT                   /gene="yahC"
FT                   /locus_tag="G2583_0422"
FT                   /note="Uncharacterized protein yahC"
FT   gene            426348..426953
FT                   /gene="yahD"
FT                   /locus_tag="G2583_0423"
FT   CDS_pept        426348..426953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahD"
FT                   /locus_tag="G2583_0423"
FT                   /product="Ankyrin repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55054"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D3QXU6"
FT                   /protein_id="ADD55054.1"
FT                   /translation="MSIKNLPADYLLAAQQGDIDKVKTCLALGVDINTCDRQGKTAITL
FT                   ASLYQQYACVQALIDAGADINKQDHTCLNPFLISCLNGDLTLLRIILPAKPDLNCVTRF
FT                   GGVGLTPACEKGHLSIVKELLAHTEINVNQTNHVGWTPLLEAIVLNDGGIKQQAIVQLL
FT                   LEHGASPHLTDKYGKTPLELARERGFEEIAQLLIAAGA"
FT   gene            426993..427856
FT                   /gene="yahE"
FT                   /locus_tag="G2583_0424"
FT   CDS_pept        426993..427856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahE"
FT                   /locus_tag="G2583_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55055"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJ85"
FT                   /protein_id="ADD55055.1"
FT                   /translation="MWALTADADFLAQRGQGQVEQVFARAVNIALPARQQLLTLLCEEY
FT                   DNAPNSCRLALTHFDDLFRHGDKVQFDDQGITVGQHLHIEMSRCRRWLSPTLQMTAVNF
FT                   RLIAWQQWHDIIHQHLGENETLFNYRGDNPFYQALNKELHIKRRAVIQAVIDKQNIASA
FT                   VASMMGLGIGLTPSADDYLTGLALILFISGHPAGKYKEEFYLGLQRGRNNTTLLSAITL
FT                   EAALQQRCRENIHRFIHNIIYDIPGNATQAIEKIKHIGSSSGCDMLYGMADGCALSQTY
FT                   GGNYVS"
FT   gene            427846..429393
FT                   /gene="yahF"
FT                   /locus_tag="G2583_0425"
FT   CDS_pept        427846..429393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahF"
FT                   /locus_tag="G2583_0425"
FT                   /product="Bacterial FdrA protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55056"
FT                   /db_xref="GOA:D3QJ86"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJ86"
FT                   /protein_id="ADD55056.1"
FT                   /translation="MSVKIVIKPNTYFDSVSLMSISTRANKLDGVEQAFVAMATEMNKG
FT                   VLKNLGLLTPELEQAKNGDLMIVINGKSGADNEQLLVEIEELFNTKAQSGSHEARYATI
FT                   ASAKKHIPESNLAVISVNGLFAAREARQALQNDLNVMLFSDNVSVEDELALKQLAHEKG
FT                   LLMMGPDCGTAIINGAALCFGNAVRRGNIGIVGASGTGSQELSVRIHEFGGGVSQLIGT
FT                   GGRDLSEKIGGLMMLDAIGMLENDPQTEIIALISKPPAPAVARKVLERARACRKPVVVC
FT                   FLGRGETPVDEQGLQFARGTKEAALKAVMLSGVKQEHLDLHTLNQPLIADVRARLKPQQ
FT                   KYIRGLFCGGTLCDETMFAVMEKHSDVYSNIQPDPEFRLKDINRSIKHTFLDFGDDDFT
FT                   NGKPHPMIDPTNRISRLIEEARDPEVAVIVMDFVLGFGSHEDPVGSTIEAIKEAKAIAA
FT                   AEGRELIILAYVLGTDLDTPSLEQQSQMLLDAGVILASSSTNTGLLAREFICKGEEA"
FT   gene            429393..430811
FT                   /gene="yahG"
FT                   /locus_tag="G2583_0426"
FT   CDS_pept        429393..430811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahG"
FT                   /locus_tag="G2583_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55057"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJ87"
FT                   /protein_id="ADD55057.1"
FT                   /translation="MSQSLFSQPLNVINVGIAMFSDDLKKQHVEVTQLDWTPPGQGNMQ
FT                   VVQALDNIADSPLADKIAAANQQALERIIQSHPVLIGFDQAINVVPGMTPKTILHAGPP
FT                   ITWEKMCGAMKGAVTGALVFEGLAKDLDEAAELAASGEITFSPCHEHDCVGSMAGVTSA
FT                   SMFMHIVKNKTYGNIAYTNMSEQMAKILRMGANDQSVIDRLNWMRDVQGPILRDAMKII
FT                   GEIDLRLMLAQALHMGDECHNRNNAGTTLLIQALTPGIIQAGYSVAQQREVFEFVASSD
FT                   YFSGPTWMAMCKAAMDAAHGIEYSTVVTTMARNGVEFGLRVSGLPGQWFTGPAQQVIGP
FT                   MFAGYKPEDSGLDIGDSAITETYGIGGFAMATAPAIVALVGGTVEEAIDFSRQMREITL
FT                   GENPNVTIPLLGFMGVPSAVDITRVGSSGILPVINTAIAHKDAGVGMIGAGIVHPPFAC
FT                   FEKAILGWCERYGV"
FT   gene            430830..431294
FT                   /gene="yahH"
FT                   /locus_tag="G2583_0427"
FT   CDS_pept        430830..431294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahH"
FT                   /locus_tag="G2583_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55058"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJ88"
FT                   /protein_id="ADD55058.1"
FT                   /translation="MRRERLIRPTNGARICRPDKRSASGICHHCRMRRERLIRPTSGAR
FT                   ICRPDKRSASGIYHHCRMRRERLIRPTNGARICRPDKRSASGICHHCRMRRERLIRPTN
FT                   GTRIVGLISVAHQAFVTIAGCGVNALSGLRMAREFVGLISVAHQAVWRWS"
FT   gene            431326..432276
FT                   /gene="yahI"
FT                   /locus_tag="G2583_0428"
FT   CDS_pept        431326..432276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahI"
FT                   /locus_tag="G2583_0428"
FT                   /product="Carbamate kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55059"
FT                   /db_xref="GOA:D3QJ89"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJ89"
FT                   /protein_id="ADD55059.1"
FT                   /translation="MKELVVVAIGGNSIIKDNASQSIEHQAEAVKAVADTVLEMLASDY
FT                   DIVLTHGNGPQVGLDLRRAEIAHEREGLPLTPLANCVADTQGGIGYLIQQALNNRLARH
FT                   GEKKAVTVVTQVEVDKNDPGFAHPTKPIGAFFSESQRDELQKANPDWRFVEDAGRGYRR
FT                   VVASPEPKRIVEAPAIKALIQQGFVVIGAGGGGIPVVRTDAGDYQSVDAVIDKDLSTAL
FT                   LAREIHADILVITTGVEKVCIHFGKPEKQALDRVDIATMTRYMQEGHFPPGSMLPKIIA
FT                   SLTFLEQGGKEVIITTPECLPAALRGETGTHIIKT"
FT   gene            432286..433668
FT                   /gene="yahJ"
FT                   /locus_tag="G2583_0429"
FT   CDS_pept        432286..433668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahJ"
FT                   /locus_tag="G2583_0429"
FT                   /product="Amidohydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55060"
FT                   /db_xref="GOA:D3QJ90"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJ90"
FT                   /protein_id="ADD55060.1"
FT                   /translation="MKENNSRREFLSQSGKMVTAAALFGTSVPLAHAAVSGTTNCEANN
FT                   TMKITDPHYYLDNVLLETGFDYENGVAVQTRTARQTVEIQNGKIVALRENKQHPDATLP
FT                   HYDAGDKLMLPTTRDMHIHLDKTFYGGPWRSLNRPAGTTIQDMIKLEQKMLPELQPYTQ
FT                   ERAEKLIDLLQSKGTTIARSHCNIEPVSGLKNLQNLQAVLARRQAGFECEIVAFPQHGL
FT                   LLSKSESLMREAMQAGAHYVGGLDPTSVDGAMEKSLDTMFQIALDYDKGVDIHLHETTP
FT                   SGVAAINYMVETVEKTPQLKGKLTISHAFALATLNEQQVDELAHRMAAQQISIASTVPI
FT                   GTLHMPLKQLHDKGVKVMTGTDSVIDHWSPYGLGDMLEKANLYAQLYIRPNEQNLSRSL
FT                   FLATGDVLPLNEKGERVWPKAQDDASFVLVDASCSAEAVARISPRTATFHKGQLVWGSV
FT                   AG"
FT   gene            433937..434377
FT                   /locus_tag="G2583_0430"
FT   CDS_pept        433937..434377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55061"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJ91"
FT                   /protein_id="ADD55061.1"
FT                   /translation="MFFRNRKNIAMTIKEKFSQKYPHASFCTFGDSAALADHLATLIAT
FT                   GVKTASCGSLAGCIEDNAFPMIGEYKIVENSRGEPVCVIRVIGLHLLRFSDVTAELARK
FT                   EGEGDLSLEYWRNEHRRFFQAEGSYSPEMDVIFEEYALIDVV"
FT   gene            434628..435614
FT                   /locus_tag="G2583_0431"
FT   CDS_pept        434628..435614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0431"
FT                   /product="Sugar ABC transporter, periplasmic sugar-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55062"
FT                   /db_xref="GOA:D3QJ92"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJ92"
FT                   /protein_id="ADD55062.1"
FT                   /translation="MMNKRFVINMVSSLLLGAALISAPLQAAEKVVVNISKVDGMPWFN
FT                   RMGEGVVEAGKAFGVNASQVGPSSTDAPQQVKIIEDLIARKVNAITIVPNDANVLEPVF
FT                   KKARDAGIVVLTNESPGQPSANWDIEIIDNEKFAAEYVEHMAKRMGGKGGYVIYVGSLT
FT                   VPQHNLWADLLVKYQKEHYPDMHEVTRRMPVAESVDVSRRTTLDLMKTYPDLKAVVSFG
FT                   SNGPIGAGRAVKEKRAKNKVAVYGMMIPSQAASLIKSGDITEGITYDPASAGYALAAVA
FT                   STLLKGEEIKPGLEMQNLGKAEVDMDKRIIRFHKVLLVNKDNIDSLY"
FT   gene            435663..437147
FT                   /locus_tag="G2583_0432"
FT   CDS_pept        435663..437147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0432"
FT                   /product="Sugar ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55063"
FT                   /db_xref="GOA:D3QJ93"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJ93"
FT                   /protein_id="ADD55063.1"
FT                   /translation="METFLSLRHINKTFHATRALRDVSLDFMSGEVHCLAGQNGCGKST
FT                   LIKIMSGVYRPDEGAEITLGGKNWSKLTPAASVAQGIQVIYQDLSLFPNLSVWENIAVN
FT                   HYHHGLFVNRRRLREVAQAAMTSINVTLPLDTLVSELSIARCQLVAICRALAQDARLIV
FT                   MDEPTASLTHQEVQGLLQVVHQLRERGICVVFVSHRLEEVMEVSDRISVLKDGELVGTF
FT                   PAAEMTTKQLGFLMTGQEFEYQVRELWQGKSSTPVLEVRNLSRHGEYLNINLRVEAGEV
FT                   VSIVGLLGAGRTELCLSLFGMTRPDAGEILINGQLVTLHSNQDAIRHGIGYVSEDRMSR
FT                   GLVMAQSIEDNIISTVFHKVKDRFGFLSETKVRDLVDRLIKALTIKVSDPHLPVNTLSG
FT                   GNAQRVSIAKWLAIGPRLLILDSPTVGVDIANKAGIYGIISDLAAHGIAVLMICDEIEE
FT                   AWYQSHRILVMQKGQITHSFLPDSSSQARIAEVVNG"
FT   gene            437140..438111
FT                   /locus_tag="G2583_0433"
FT   CDS_pept        437140..438111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0433"
FT                   /product="Putative permease component of transport system,
FT                   probably ribose specific"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55064"
FT                   /db_xref="GOA:D3QJ94"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJ94"
FT                   /protein_id="ADD55064.1"
FT                   /translation="MAELKKRHEFWLALLIVVLFVGLAWRSDEFLTFGNLYDLANNYAM
FT                   LTILACGLFVVLISGGIDISFPAMTIIAQYGMVLLLQKIGGNFAVAFALAGCIGILLGL
FT                   INALLVNRLRVPSIIITISTLNIFYGLLLWLSKGVWLYDFPPWFEQGVMLFKYTDADGY
FT                   DYGLGLPLIAMITVVLLTAFIMNFTSVGRKIYALGGNRESASRIGFSVLKLQLFVYGYM
FT                   GLMSGAAGVVQSWTVMTVAPDSLLGYELTVLAAVVLGGTSLLGGRGTLTGTLLGVVLLA
FT                   VMQNGLNLLGVSSYWQTLITGIIIVASISATAWSQHQNRSLL"
FT   gene            438108..439064
FT                   /locus_tag="G2583_0434"
FT   CDS_pept        438108..439064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0434"
FT                   /product="Putative permease component of transport system"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55065"
FT                   /db_xref="GOA:D3QJ95"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJ95"
FT                   /protein_id="ADD55065.1"
FT                   /translation="MKKSWRNNVEFYLIGLLVLTVAAFSITMPEIFWSISNFQSVASQM
FT                   PVLGILALAMAVTMLCGGINLSIIATANACSLVMAWVATQYPPGIATVVATLLAGAGAA
FT                   VIIGLCNGVLIAGIRVSPILATLGMMTLLKGINILVTGGSAIANYPSWVLWLNHAQWFG
FT                   IPLPMWLFAAVALGLWILLEKTPLGKAIYLIGSNERATLYSGINTRRVLIWVYVISALL
FT                   CAVAAFLMMSKLNSAKASYGESYLLVSILAAVLGGVNPDGGSGRIIGMVLALFLLQIIE
FT                   SGFNILGISPYLTMALWGTLLLCFIQARGMLGLDRVV"
FT   gene            439151..440200
FT                   /gene="yahK"
FT                   /locus_tag="G2583_0435"
FT   CDS_pept        439151..440200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahK"
FT                   /locus_tag="G2583_0435"
FT                   /product="Oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55066"
FT                   /db_xref="GOA:D3QJ96"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJ96"
FT                   /protein_id="ADD55066.1"
FT                   /translation="MKIKAVGSYSAKQPLEPMDITRREPGPNDVKIEIAYCGVCHSDLH
FT                   QVRSEWAGTVYPCVPGHEIVGRVVAVGDQVEKHAPGDLVGVGCIVDSCKHCEECEDGLE
FT                   NYCDHMTGTYNSPTPDEPGHTLGGYSQQIVVHERYVLRIRHPQEQLAAVAPLLCAGITT
FT                   YSPLRHWQAGPGKKVGVVGIGGLGHMGIKLAHAMGAHVVAFTTSEAKREAAKALGADEV
FT                   VNSRNADEMAAHLKSFDFILNTVAAPHNLDDFTTLLKRDGTMTLVGAPATPHKSPEVFN
FT                   LIMKRRAIAGSMIGGIPETQEMLDFCAEHGIVADIEMIRADQINEAYERMLRGDVKYRF
FT                   VIDNRTLTD"
FT   gene            440443..441258
FT                   /gene="yahL"
FT                   /locus_tag="G2583_0436"
FT   CDS_pept        440443..441258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahL"
FT                   /locus_tag="G2583_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55067"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJ97"
FT                   /protein_id="ADD55067.1"
FT                   /translation="MISLKAPHNNLMPYTQQSILNTVKNNQLPEDIKSSLVSCVDIFKV
FT                   LIKQYYDYPYDCRDDLVDDDKLIHLMAAVRDCEWSDDNALTINVQFNDFPGFYDWMDYP
FT                   DHPVKFVFRILENQKGTVWVYDQDDAFLDIKANVQAGRFTGLKKLVQFINSVRTDCKCI
FT                   LLEHHMPLLRLFPKGKECMHVEKWLREMSSIPETDAPIKQALAHGLLLHLKNIYPVFPE
FT                   SLVMLLLSVLDVKTYRDDARLNEWISNRVQELGDRYYPVNKHVKIRYTL"
FT   gene            441604..441684
FT                   /locus_tag="G2583_0437"
FT   tRNA            441604..441684
FT                   /locus_tag="G2583_0437"
FT                   /product="tRNA-OTHER"
FT   gene            441743..441919
FT                   /gene="yahM"
FT                   /locus_tag="G2583_0438"
FT   CDS_pept        441743..441919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahM"
FT                   /locus_tag="G2583_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55068"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJ98"
FT                   /protein_id="ADD55068.1"
FT                   /translation="MPLFGYSGRVRPMKKAHTGESGLKWEAKDSSKLIGNKDHALRGLS
FT                   SPMVGIRQIRLIT"
FT   gene            complement(441936..442607)
FT                   /gene="yahN"
FT                   /locus_tag="G2583_0439"
FT   CDS_pept        complement(441936..442607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahN"
FT                   /locus_tag="G2583_0439"
FT                   /product="Putative homoserine/threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55069"
FT                   /db_xref="GOA:D3QJ99"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJ99"
FT                   /protein_id="ADD55069.1"
FT                   /translation="MMQLVHLFMDEITMDPLHAVYLTVGLFVITFFNPGANLFVVVQTS
FT                   LASGRRAGVLTGLGVALGDAFYSGLGLFGLATLITQCEEIFSLIRIVGGAYLLWFAWCS
FT                   MRRQSTPQMSTLQQPINAPWYVFFRRRLITDLSNPQTVLFFISIFSVTLNAETPTWARL
FT                   MAWAGIVLASIIWRVFLSQAFSLPAVRRAYGRMQRVASRVIGAIIGVFALRLIYEGVTQ
FT                   R"
FT   gene            442754..443029
FT                   /gene="yahO"
FT                   /locus_tag="G2583_0440"
FT   CDS_pept        442754..443029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahO"
FT                   /locus_tag="G2583_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55070"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJA0"
FT                   /protein_id="ADD55070.1"
FT                   /translation="MKIISKMLVGALAFAVTNVYAAELMTKAEFEKVESQYEKIGDIST
FT                   SNEMSTADAKEDLIKKADEKGADVLVLTSGQTDNKIHGTADIYKKK"
FT   gene            complement(443127..444713)
FT                   /gene="prpR"
FT                   /locus_tag="G2583_0441"
FT   CDS_pept        complement(443127..444713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpR"
FT                   /locus_tag="G2583_0441"
FT                   /product="Propionate catabolism operon regulatory protein
FT                   PrpR"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55071"
FT                   /db_xref="GOA:D3QJA1"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR012704"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJA1"
FT                   /protein_id="ADD55071.1"
FT                   /translation="MAHPPRLNDDKPVIWTVSVTRLFELFRDISLEFDHLANITPIQLG
FT                   FEKAVTYIRKKLANERCDAIIAAGSNGAYLKSRLSVPVILIKPSGYDVLQALAKAGKLT
FT                   SSIGVVTYQETIPALVAFQKTFNLRLDQRSYITEEDARGQINELKANGTEAVVGAGLIT
FT                   DLAEEAGMTGIFIYSAATVRQAFSDALDMTRMSLRHNTHDATRNALRTRYVLGDMLGQS
FT                   PQMEQVRQTILLYARSSAAVLIEGETGTGKELAAQAIHREYFARHDARQGKKSHPFVAV
FT                   NCGAIAESLLEAELFGYEEGAFTGSRRGGRAGLFEIAHGGTLFLDEIGEMPLPLQTRLL
FT                   RVLEEKEVTRVGGHQPVPVDVRVISATHCNLEEDMRQGQFRRDLFYRLSILRLQLPPLR
FT                   ERVADILPLAESFLKVSLAALSAPFSAALRQGLQASETVLVHYDWPGNIRELRNMMERL
FT                   ALFLSVEPTPDLTPQFLQLLLPELARESAKIPAPRLLTPQQALEKFNGDKTAAANYLGI
FT                   SRTTFWRRLKS"
FT   gene            444952..445842
FT                   /gene="prpB"
FT                   /locus_tag="G2583_0442"
FT   CDS_pept        444952..445842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpB"
FT                   /locus_tag="G2583_0442"
FT                   /product="Methylisocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55072"
FT                   /db_xref="GOA:D3QJA2"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJA2"
FT                   /protein_id="ADD55072.1"
FT                   /translation="MSLHSPGKAFRAALTKENPLQIVGTINANHALLAQRAGYQAIYLS
FT                   GGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCSLPLLVDADIGFGSSAFNVARTVKSM
FT                   IKAGAAGLHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDAKTDPDFVIMARTDALA
FT                   VEGLDAAIERAQAYVEAGAEMLFPEAITELAMYRQFADAVQVPILANITEFGATPLFTT
FT                   DELRSAHVAMALYPLSAFRAMNRAAEHVYNVLRQEGTQKSVIDTMQTRNELYESINYYH
FT                   YEEKLDDLFVRSQAK"
FT   gene            445998..447167
FT                   /gene="prpC"
FT                   /locus_tag="G2583_0443"
FT   CDS_pept        445998..447167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpC"
FT                   /locus_tag="G2583_0443"
FT                   /product="2-methylcitrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55073"
FT                   /db_xref="GOA:D3QJA3"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJA3"
FT                   /protein_id="ADD55073.1"
FT                   /translation="MSDTTILQNSTHVIKPKKSVALSGVPAGNTALCTVGKSGNDLHYR
FT                   GYDILDLAEHCEFEEVAHLLIHGKLPTRDELAAYKTKLKALRGLPANVRTVLEALPAAS
FT                   HPMDVMRTGVSALGCTLPEKEGHTVSGARDIADKLLASLSSILLYWYHYSHNGERIQPE
FT                   TDDDSIGGHFLHLLHGEKPSQSWEKAMHISLVLYAEHEFNASTFTSRVIAGTGSDMYSA
FT                   IIGAIGALRGPKHGGANEVSLEIQQRYETPDEAEADIRKRVESKEVVIGFGHPVYTIAD
FT                   PRHQVIKRVAKQLSQEGGSLKMYNIADRLETVMWESKKMFPNLDWFSAVSYNMMGVPTE
FT                   MFTPLFVIARVTGWAAHIIEQRQDNKIIRPSANYVGPEDRQFVALDKRQ"
FT   gene            447201..448652
FT                   /gene="prpD"
FT                   /locus_tag="G2583_0444"
FT   CDS_pept        447201..448652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpD"
FT                   /locus_tag="G2583_0444"
FT                   /product="2-methylcitrate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55074"
FT                   /db_xref="GOA:D3QJA4"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR012705"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJA4"
FT                   /protein_id="ADD55074.1"
FT                   /translation="MSAQINNIRPEFDREIVDIVDYVMNYEISSKVAYDTAHYCLLDTL
FT                   GCGLEALEYPACKKLLGPIVPGTVVPNGVRVPGTQFQLDPVQAAFNIGAMIRWLDFNDT
FT                   WLAAEWGHPSDNLGGILATADWLSRNAVASGKAPLTMKQVLTGMIKAHEIQGCIALENS
FT                   FNRVGLDHVLLVKVASTAVVAEMLGLTREEILNAVSLAWVDGQSLRTYRHAPNTGTRKS
FT                   WAAGDATSRAVRLALMAKTGEMGYPSALTAPVWGFYDVSFKGESFRFQRPYGSYVMENV
FT                   LFKISFPAEFHSQTAVEAAMTLYEQMQAAGKTAADIEKVSIRTHEACIRIIDKKGPLNN
FT                   PADRDHCIQYMVAIPLLFGRLTAADYEDNVAQDKRIDALREKINCFEDPVFTADYHDPE
FT                   KRAIANAITLEFTDGTRFEEVVVEYPIGHARRRQDGIPKLVDKFKINLARQFPTRQQQR
FT                   ILEVSLDRARLEQMPVNEYLDLYVI"
FT   gene            448692..450578
FT                   /gene="prpE"
FT                   /locus_tag="G2583_0445"
FT   CDS_pept        448692..450578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpE"
FT                   /locus_tag="G2583_0445"
FT                   /product="Propionate--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55075"
FT                   /db_xref="GOA:D3QJA5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR012694"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJA5"
FT                   /protein_id="ADD55075.1"
FT                   /translation="MSFSEFYQRSINEPEQFWAEQARRIDWQTPFTQTLDHSNPPFARW
FT                   FCEGRTNLCHNAIDRWLEKQPEALALIAVSSETEEERTFTFRQLHDEVNAVASMLRSLG
FT                   VQRGDRVLVYMPMIAEAHITLLACARIGAIHSVVFGGFASHSVAARIDDAKPVLIVSAD
FT                   AGARGGKIIPYKKLLDDAISQAQHQPRHVLLVDRGLAKMARVSGRDVDFASLRHQHIGA
FT                   RVPVAWLESNETSCILYTSGTTGKPKGVQRDVGGYAVALATSMDTIFGGKAGGVFFCAS
FT                   DIGWVVGHSYIVYAPLLAGMATIVYEGLPTWPDCGVWWKIVEKYQVSRMFSAPTAIRVL
FT                   KKFPTAEIRKHDLSSLEVLYLAGEPLDEPTASWVSNTLDVPVIDNYWQTESGWPIMAIA
FT                   RGLDDRPTRLGSPGVPMYGYNVQLLNEVTGEPCGVNEKGMLVVEGPLPPGCIQTIWGDD
FT                   DRFVKTYWSLFSRPVYATFDWGIRDADGYHFILGRTDDVINVAGHRLGTREIEESISSH
FT                   PGVAEVAVVGVKDALKGQVAVAFVIPKESDSLEDRDVAHSQEKAIMALVDSQIGNFGRP
FT                   AHVWFVSQLPKTRSGKMLRRTIQAICEGRDPGDLTTIDDPASLDQIRQAMEE"
FT   gene            450583..450820
FT                   /pseudo
FT                   /gene="nrdB"
FT                   /locus_tag="G2583_0446"
FT                   /note="mannitol-1-phosphate 5-dehydrogenase"
FT   gene            451284..452543
FT                   /gene="codB"
FT                   /locus_tag="G2583_0447"
FT   CDS_pept        451284..452543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codB"
FT                   /locus_tag="G2583_0447"
FT                   /product="Cytosine permease"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55076"
FT                   /db_xref="GOA:D3QJA6"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJA6"
FT                   /protein_id="ADD55076.1"
FT                   /translation="MSQDNNFSQGPVPQSARKGVLALTFVMLGLTFFSASMWTGGTLGT
FT                   GLSYHDFFLAVLIGNLLLGIYTSFLGYIGAKTGLTTHLLARFSFGVKGSWLPSLLLGGT
FT                   QVGWFGVGVAMFAIPVGKATGLDINLLIAVSGLLMTVTVFFGISALTVLSVIAVPAIAC
FT                   LGGYSVWLAVNGMGGLDALKAVVPAQPLDFNVALALVVGSFISAGTLTADFVRFGRNAK
FT                   LAVLVAMVAFFLGNSLMFIFGAAGAAALGMADISDVMIAQGLLLPAIVVLGLNIWTTND
FT                   NALYASGLGFANITGMSSKTLSVINGIIGTVCALWLYNNFVGWLTFLSAAIPPVGGVII
FT                   ADYLMNRRRYEHFATTRMMSVNWVAILAVALGIAAGHWLPGIVPVNAVLGGALSYLILN
FT                   PILNRKTTAAMTHVEANSVE"
FT   gene            452533..453816
FT                   /gene="codA"
FT                   /locus_tag="G2583_0448"
FT   CDS_pept        452533..453816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codA"
FT                   /locus_tag="G2583_0448"
FT                   /product="Cytosine deaminase and related metal-dependent
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55077"
FT                   /db_xref="GOA:D3QJA7"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJA7"
FT                   /protein_id="ADD55077.1"
FT                   /translation="MSNNALQTIINARLPGKEGLWQIHLQDGKISAIDAQSGVMPITEN
FT                   SLDAEQGLVIPPFVEPHIHLDTTQTAGQPNWNQSGTLFEGIERWAERKALLTHDDVKQR
FT                   AWQTLKWQIANGIQHVRTHVDVSDATLTALKAMLEVKQEVAPWIDLQIVAFPQEGILSY
FT                   PNGEALLEEALRLGADVVGAIPHFEFTREYGVESLHKTFALAQKYDRLIDVHCDEIDDE
FT                   QSRFVETVAALAHREGMGARVTASHTTAMHSYNGAYTSRLFRLLKMSGINFVANPLVNI
FT                   HLQGRFDTYPKRRGITRVKEMLESGINVCFGHDDVFDPWYPLGTANMLQVLHMGLHVCQ
FT                   LMGYGQINDGLNLITHHSARTLNLQDYSIAAGNSANLIILPAENGFDALRRQVPVRYSV
FT                   RGGKVIASTQPAQTTVYLEQPEAIDYKR"
FT   gene            complement(453949..454872)
FT                   /gene="cynR"
FT                   /locus_tag="G2583_0449"
FT   CDS_pept        complement(453949..454872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynR"
FT                   /locus_tag="G2583_0449"
FT                   /product="DNA-binding transcriptional regulator CynR"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55078"
FT                   /db_xref="GOA:D3QJA8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037403"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJA8"
FT                   /protein_id="ADD55078.1"
FT                   /translation="MNLLIGWRMLSRHINYFLAVAEHGSFTRAASALHVSQPALSQQIR
FT                   QLEESLGVPLFDRSGRTIHLTDAGEVWRQYASRALQELGAGKRAIHDVADLTRGSLRIA
FT                   VTPTFTSYFIGPLMADFYARYPGITLQLQEMSQEKIEDLLCRDELDVGIAFAPVHSPEL
FT                   EAIPLLTESLALVVAQHHPLAACEQVALSRLHDEKLVLLSAEFATREQIDHYCEKAGLH
FT                   PQVVIEANSISAVLELIRRTSLSTLLPAAIATQHDGLKAIPLAPPLLERTAVLLRRKNS
FT                   WQTAAAKAFLHMALEECADVGENESR"
FT   gene            454958..455617
FT                   /gene="cynT"
FT                   /locus_tag="G2583_0450"
FT   CDS_pept        454958..455617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynT"
FT                   /locus_tag="G2583_0450"
FT                   /product="Carbonic anhydrase 1"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55079"
FT                   /db_xref="GOA:D3QJA9"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJA9"
FT                   /protein_id="ADD55079.1"
FT                   /translation="MKEIIDGFLKFQREAFPKREALFKQLATQQSPRTLFISCSDSRLV
FT                   PELVTQREPGDLFVIRNAGNIVPSYGPEPGGVSASVEYAVAALRVSDIVICGHSNCGAM
FT                   TAIASCQCMDHMPAVSHWLRYADSARVVNEARPHSDLPSKAAAMVRENVIAQLANLQTH
FT                   PSVRLALEEGRIALHGWVYDIESGSIAAFDGATRQFVPLAANPRVCAIPLRQPTAA"
FT   gene            455648..456118
FT                   /gene="cynS"
FT                   /locus_tag="G2583_0451"
FT   CDS_pept        455648..456118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynS"
FT                   /locus_tag="G2583_0451"
FT                   /product="Cyanate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55080"
FT                   /db_xref="GOA:D3QJB0"
FT                   /db_xref="InterPro:IPR003712"
FT                   /db_xref="InterPro:IPR008076"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036581"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJB0"
FT                   /protein_id="ADD55080.1"
FT                   /translation="MIQSQINRNIRLDLADAILLSKAKKDLSFAEIADGTGLAEAFVTA
FT                   ALLGQQALPADAARQVGAKLDLDEDAILLLQMIPLRGCIDDRIPTDPTMYRFYEMLQVY
FT                   GTTLKALVHEKFGDGIISAINFKLDVKKVADPEGGERAVITLDGKYLPTKPF"
FT   gene            456151..457305
FT                   /gene="cynX"
FT                   /locus_tag="G2583_0452"
FT   CDS_pept        456151..457305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynX"
FT                   /locus_tag="G2583_0452"
FT                   /product="Cyanate transport"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55081"
FT                   /db_xref="GOA:D3QJB1"
FT                   /db_xref="InterPro:IPR004747"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJB1"
FT                   /protein_id="ADD55081.1"
FT                   /translation="MLLVLVLIGLNMRPLLTSVGPLLPQLRQASGMSFSVAALLTALPV
FT                   VTMGGLALAGSWLHQHVSERRSVAISLLLIAVGALMRELYPQSALLLSSALLGGVGIGI
FT                   IQAVMPSVIKRRFQQRTPLVMGLWSAALMGGGGLGAALTPWLVQHSETWYQTLAWWALP
FT                   AVVALFAWWWQSTREVASSHKTTTIPVRVVFTPRAWTLGVYFGLINGGYASLIAWLPAF
FT                   YIEIGASAQYSGSLLALMTLGQAAGALLMPAMARHQDRRKLLMLALALQLVGFCGFIWL
FT                   PLQLPVLWAMVCGLGLGGAFPLCLLLALDHSVQPAIAGKLVAFMQGIGFIIAGLAPWFS
FT                   GVLRSISGNYLMDWAFHALCVVGLMIITLRFAPARFPQLWVKEA"
FT   gene            complement(457408..458019)
FT                   /gene="lacA"
FT                   /locus_tag="G2583_0453"
FT   CDS_pept        complement(457408..458019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacA"
FT                   /locus_tag="G2583_0453"
FT                   /product="Galactoside O-acetyltransferase LacA"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55082"
FT                   /db_xref="GOA:D3QJB2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="InterPro:IPR039369"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJB2"
FT                   /protein_id="ADD55082.1"
FT                   /translation="MNMSMTERIKAGKLFTDMCEGLPEKRLRRKTLMYEFNHSHPSEVD
FT                   KRESLIKEMFATVGENAWVEPPVYFSYGSNIHIGRNFYANFNLTIVDDYTVTIGDNVLI
FT                   APNVTLSVTGHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSI
FT                   VTKDIPPNVVAAGVPCRVIREINDRDKQYYFRDYKVESSV"
FT   gene            complement(458085..459338)
FT                   /gene="lacY"
FT                   /locus_tag="G2583_0454"
FT   CDS_pept        complement(458085..459338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacY"
FT                   /locus_tag="G2583_0454"
FT                   /product="Lactose permease"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55083"
FT                   /db_xref="GOA:D3QJB3"
FT                   /db_xref="InterPro:IPR000576"
FT                   /db_xref="InterPro:IPR018457"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJB3"
FT                   /protein_id="ADD55083.1"
FT                   /translation="MYYLKNTNFWMFGLFFFFYFFIMGAYFPFFPIWLHDINHISKSDT
FT                   GIIFAAISLFSLLFQPLFGLLSDKLGLRKYLLWIITGMLVMFAPFFIFIFGPLLQYNIL
FT                   VGSIVGGIYLGFCFNAGAPAVEAFIEKVSRRSNFEFGRARMFGCVGWALCASIVGIMFT
FT                   INNQFVFWLGSGCALILAILLFFAKTDAPSSATVANAVGANHSAFSLKLALELFRQPKL
FT                   WFLSLYVIGVSCTYDVFDQQFANFFTSFFATGEQGTRVFGYVTTMGELLNASIMFFAPL
FT                   IINRIGGKNALLLAGTIMSVRIIGSSFATSALEVVILKTLHMFEVPFLLVGCFKYITSQ
FT                   FEVRFSATIYLVCFCFFKQLAMIFMSVLAGNMYESIGFQGAYLVLGLVALGFTLISVFT
FT                   LSGPGPLSLLRRQVNEVA"
FT   gene            complement(459390..462464)
FT                   /gene="lacZ"
FT                   /locus_tag="G2583_0455"
FT   CDS_pept        complement(459390..462464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacZ"
FT                   /locus_tag="G2583_0455"
FT                   /product="Beta-D-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55084"
FT                   /db_xref="GOA:D3QJB4"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJB4"
FT                   /protein_id="ADD55084.1"
FT                   /translation="MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART
FT                   NRPSQQLRSLNGEWQFVWFPAPEAVPESWLECDLPDADTVVVPSNWQMHGYDAPIYTNV
FT                   TYPITVNPPFVPTENPTGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYG
FT                   QDSRLLSEFDLSAFLRAGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQ
FT                   ISDFHVATLFNDDFSRAVLEAEVQMYGELRDELRVTVSLWQGETQVASGTAPFGGEIID
FT                   ERGGYADRVTLGLNVENPKLWSAEIPNIYRAVVELHTADGTLIEAEACDVGFREVRIEN
FT                   GLLLLNGKPLLIRGVNRHEHHPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLW
FT                   YTLCDRYGLYVVDEANIETHGMVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPSVIIWS
FT                   LGNESGHGANHDALYRWIKSVDPSRPVQYEGGGADTSATDIICPMYARVDEDQPFPAVP
FT                   KWSIKKWLSLPGEMRPLILCEYAHAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSL
FT                   IKYDENGNPWSAYGGDFGDTPNDRQFCMNGLVFADRTPHPALTEAKHQQQFFQFRLSGR
FT                   TIEVTSEYLFRHSDNELLHWTVALDGKPLASGEVPLDVAPQGKQVIELPELPRLESTGQ
FT                   LWLTVHVVQPNATAWSEAGHISAWQQWRLAENLSVTLPSAPHAIPQLTTSETDFCIELD
FT                   NKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVERWK
FT                   AAGHYQAEAALLQCTADTLADAVLITTVHAWQHQGKTLFISRKTYRIDGSGQMAITVDV
FT                   EVASDTPHPARIGLTCQLAQVAERVNWLGLGPQENYPDRLTAACFDRWDLPLSDMYTPY
FT                   VFPSENGLRCGTRELNYGPHQWRGDFQFNISRYSQQQLMETSHRHLLHAEEGTWLNIDG
FT                   FHMGIGGDDSWSPSVSAEFQLSAGRYHYQLVWCQK"
FT   gene            complement(462587..463678)
FT                   /gene="lacI"
FT                   /locus_tag="G2583_0456"
FT   CDS_pept        complement(462587..463678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacI"
FT                   /locus_tag="G2583_0456"
FT                   /product="lac repressor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55085"
FT                   /db_xref="GOA:D3QJB5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJB5"
FT                   /protein_id="ADD55085.1"
FT                   /translation="MVNVKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAM
FT                   AELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVER
FT                   SGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACANVPALFLDVSDQTPINSII
FT                   FSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGD
FT                   WSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTED
FT                   SSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPKTQTA
FT                   SPRALADSLMQLARQVSRLESGQ"
FT   gene            complement(463706..464659)
FT                   /locus_tag="G2583_0457"
FT   CDS_pept        complement(463706..464659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0457"
FT                   /product="putative AraC-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55086"
FT                   /db_xref="GOA:D3QJB6"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJB6"
FT                   /protein_id="ADD55086.1"
FT                   /translation="MRPLTVAIIAVAGFSPFHLSVPFIVFSEKMAEKKRFHVIICAEKP
FT                   GNVDSADGFSVTATHDYTAVIQADIVIIPYWGTITQKPPQKLLEALTTARDNGAQIVGL
FT                   CLGTFVLGYAGLLKNKRAATHWEFEREFQARFPQTHLDINALYVDDDGIITSAGTAAAL
FT                   DCCLYIVRQHFGSDYANHIARRMVVPPYRTGGQAQFIEQPVPKNTHDERINLLLDYLRQ
FT                   NIAQQHDLDSLAQRVMMSRRTLTRHFMKATGSSIAEWLITERLRRSQELLGSSQLPVER
FT                   IAAEVGFLSPVTWRQHFKSHFGVSPAEWRKTFRGMA"
FT   gene            complement(464679..465467)
FT                   /locus_tag="G2583_0458"
FT   CDS_pept        complement(464679..465467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0458"
FT                   /product="Beta-lactamase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55087"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJB7"
FT                   /protein_id="ADD55087.1"
FT                   /translation="MEQIMKITQIRNATQIIQYAGKTFLIDPLLAPKGSYPGFAGTARA
FT                   EIRNPTVELPCDLTTLLNVDALIVTHLHEDHWDETASRVVPKDKLIYVQNEQDAESLNK
FT                   QGFTHLTVLTDETKFGDITLHKTTGQHGSDRTYADPAMAKRLGAACGVVFQHPTEKTLY
FT                   LAGDTLWRDDVEATMLTFQPEVVVLNAGFAHVLGHGAIIMGAEDILKTHFTLPEAQIIA
FT                   THMEAVNHCLLTRDALKEYARDNQIIEFVNVPEDGETLTF"
FT   gene            complement(465570..466517)
FT                   /gene="mhpR"
FT                   /locus_tag="G2583_0459"
FT   CDS_pept        complement(465570..466517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpR"
FT                   /locus_tag="G2583_0459"
FT                   /product="DNA-binding protein transcriptional activator,
FT                   3HPP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55088"
FT                   /db_xref="GOA:D3QJB8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJB8"
FT                   /protein_id="ADD55088.1"
FT                   /translation="MIFYCALSIERVFSATIKTCPNVHQVHNVVLTIEMSINMQNNEQT
FT                   EYKTVRGLTRGLMLLNMLNKLDGGASVGLLAELSGLHRTTVRRLLETLQEEGYVRRSPS
FT                   DDSFRLTIKVRQLSEGFRDEQWISALAAPLLGDLLREVVWPTDVSTLDVDAMVVRETTH
FT                   RFSRLSFHRAMVGRRLPLLKTASGLTWLAFCPEQERKELIEMLASRPGDDYQLAREPLK
FT                   LEAILARARKEGYGQNYRGWDQEEKIASIAVPLRSEQRVIGCLNLVYMASAMTIEQAAE
FT                   KHLPALQRVAKQIEEGVESQAILVAGRRSGVHLR"
FT   gene            466594..468258
FT                   /gene="mhpA"
FT                   /locus_tag="G2583_0460"
FT   CDS_pept        466594..468258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpA"
FT                   /locus_tag="G2583_0460"
FT                   /product="3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic
FT                   acid hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55089"
FT                   /db_xref="GOA:D3QJB9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR023786"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJB9"
FT                   /protein_id="ADD55089.1"
FT                   /translation="MAIQHPDIQPAVNHSVQVAIAGAGPVGLMMANYLGQMGIDVLVVE
FT                   KLDKLIDYPRAIGIDDEALRTMQSVGLVDNVLPHTTPWHAMRFLTPKGRCFADIQPMTD
FT                   EFGWPRRNAFIQPQVDAVMLEGVSRFPNVRCLFSRELEAFSQQDDEVTLHLKTAEGQRE
FT                   IVKAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVVDIANDPLSTPHIYLCCDPVRPY
FT                   VSAALPHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPDNVELIRQRVYTHNARL
FT                   AQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDTYQQ
FT                   ERRDHAKAMIDLSVTAGNVLAPPKRWQGTLRDGVSWLLNYLPPVKRYFLEMRFKPMPQY
FT                   YGGALVREGEAKHSPVGKMFIQPKVTLENGDVTLLDNAIGANFAVIGWGCNPLWGMSDE
FT                   QIQQWRALSTRFIQVVPEVQIHTAQDNHDGVLRVGDTQGRLRSWFAQHNASLVVMRPDR
FT                   FVAATAIPQTLGKTLNKLASVMTLTRPDADVSVEKVA"
FT   gene            468260..469204
FT                   /gene="mhpB"
FT                   /locus_tag="G2583_0461"
FT   CDS_pept        468260..469204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpB"
FT                   /locus_tag="G2583_0461"
FT                   /product="2,3-dihydroxyphenylpropionate/2,
FT                   3-dihydroxicinnamic acid 1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55090"
FT                   /db_xref="GOA:D3QJC0"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR023789"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJC0"
FT                   /protein_id="ADD55090.1"
FT                   /translation="MHAYLHCLSHSPLVGYVDPAQEVLDEVNGVIASARERIAAFSPEL
FT                   VVLFAPDHYNGFFYDVMPPFCLGVGATAIGDFGSAAGELPVPVELAEACAHAVMKSGID
FT                   LAVSYCMQVDHGFAQPLEFLLGGLDKVPVLPVFINGVATPLPGFQRTRMLGEAIGRFTS
FT                   TLNKRVLFLGSGGLSHQPPVPELAKADAHMRDRLLGSGKDLPASERELRQQRVISAAEK
FT                   FVEDQRTLHPLNPIWDNQFMTLLEQGRIQELDAVSNEELSAIAGKSTHEIKTWVAAFAA
FT                   ISAFGNWRSEGRYYRPIPEWIAGFGSLSARTEN"
FT   gene            469159..470088
FT                   /gene="mhpC"
FT                   /locus_tag="G2583_0462"
FT   CDS_pept        469159..470088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpC"
FT                   /locus_tag="G2583_0462"
FT                   /product="2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55091"
FT                   /db_xref="GOA:D3QJC1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR023791"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJC1"
FT                   /protein_id="ADD55091.1"
FT                   /translation="MDCRIWLVKRQNRELNMQEKMMSYQPQTEAATSRFLNVEEAGKTL
FT                   RIHFNDCGQGDETVVLLHGSGPGATGWANFSRNIDPLVEAGYRVILLDCPGWGKSDSIV
FT                   NSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMGGGTG
FT                   GMSLFTPMPTEGIKRLNQLYRQPTIENLKLMMDIFVFDTSDLTDALFEARLNNMLSRRD
FT                   HLENFVKSLEANPKQFPDFGPRLAEIKAQTLIVWGRNDRFVPMDAGLRLLSGIAGSELH
FT                   IFRDCGHWAQWEHADAFNQLVLNFLARA"
FT   gene            470098..470907
FT                   /gene="mhpD"
FT                   /locus_tag="G2583_0463"
FT   CDS_pept        470098..470907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpD"
FT                   /locus_tag="G2583_0463"
FT                   /product="2-keto-4-pentenoate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55092"
FT                   /db_xref="GOA:D3QJC2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR023793"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJC2"
FT                   /protein_id="ADD55092.1"
FT                   /translation="MTKHTLEQLAADLRRAAEQGEAIAPLRDLIGIDNAEAAYAIQHIN
FT                   VQYDVAQGRRVVGRKVGLTHPKVQQQLGVDQPDFGTLFADMCYGDNEIIPFSRVLQPRI
FT                   EAEIALVLNRDLPATDITFDELYNAIEWVLPALEVVGSRIRDWSIQFVDTVADNASCGV
FT                   YVIGGPAQRPAGLDLKNCAMKMTRNNEEVSSGRGSECLGHPLNAAVWLARKMASLGEPL
FT                   RAGDIILTGALGPMVAVNAGDRFEAHIEGIGSVAAAFSSAAPKGSLS"
FT   gene            470904..471854
FT                   /gene="mhpF"
FT                   /locus_tag="G2583_0464"
FT   CDS_pept        470904..471854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpF"
FT                   /locus_tag="G2583_0464"
FT                   /product="Acetaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55093"
FT                   /db_xref="GOA:D3QJC3"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR003361"
FT                   /db_xref="InterPro:IPR015426"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJC3"
FT                   /protein_id="ADD55093.1"
FT                   /translation="MSKRKVAIIGSGNIGTDLMIKILRHDQHLEMAVMVGIDPQSDGLA
FT                   RARRMGVATTHEGVIGLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTP
FT                   AAIGPYCVPVVNLEENVDQLNVNMVTCGGQATIPMVAAVSRVVRVHYAEIIASIASKSA
FT                   GLGTRANIDEFTETTSRAIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDI
FT                   EASINEMAEAVQAYVPGYRLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAH
FT                   YLPAYAGNLDIMTSSALATAEKMAQSLARKAGEAA"
FT   gene            471851..472864
FT                   /gene="mhpE"
FT                   /locus_tag="G2583_0465"
FT   CDS_pept        471851..472864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpE"
FT                   /locus_tag="G2583_0465"
FT                   /product="4-hydroxy-2-oxovalerate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55094"
FT                   /db_xref="GOA:D3QJC4"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="InterPro:IPR035685"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJC4"
FT                   /protein_id="ADD55094.1"
FT                   /translation="MNGKKLYISDVTLRDGMHAIRHQYSLVNVRQIAKALDDARVDSIE
FT                   VAHGDGLQGSSFNYGFGAHSDLEWIEAAADVVKHAKIATLLLPGIGTIHDLKNAWQAGA
FT                   RVVRVATHCTEADVSAQHIQYARELGMDTVGFLMMSHMTTPENLAKQAKLMEGYGATCI
FT                   YVVDSGGAMNMSDIRDRFRALKAVLKPETQTGMHAHHNLSLGVANSIAAVEEGCDRIDA
FT                   SLAGMGAGAGNAPLEVFIAAVDKLGWQHGADLYALMDAADDLVRPLQDRPVRVDRETLA
FT                   LGYAGVYSSFLRHCETAAARYGLSAVDILVELGKRRMVGGQEDMIVDVALDLRNNK"
FT   gene            473298..474554
FT                   /gene="mhpT"
FT                   /locus_tag="G2583_0466"
FT   CDS_pept        473298..474554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpT"
FT                   /locus_tag="G2583_0466"
FT                   /product="Putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55095"
FT                   /db_xref="GOA:D3QJC5"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJC5"
FT                   /protein_id="ADD55095.1"
FT                   /translation="MYQSRFTCTRNEVHLMSTRTPSSSSSRLMLTIGLCFLVALMEGLD
FT                   LQAAGIAAGGIAQAFALDKMQMGWIFSAGILGLLPGALVGGMLADRYGRKRILIGSVAL
FT                   FGLFSLATAIAWDFPSLVFARLMTGVGLGAALPNLIALTSEAAGPRFRGTAVSLMYCGV
FT                   PIGAALAATLGFAGANLAWQTVFWVGGVVPLILVPLLMRWLPESAVFAGEKQAAPPLRA
FT                   LFAPETATATLLLWLCYFFTLLVVYMLINWLPLLLVEQGFQPSQAAGVMFALQMGAASG
FT                   TLMLGALMDKLRPVTMSLLIYSGMLASLLALGTVSSFNGMLLAGFVAGLFATGGQSVLY
FT                   ALAPLFYSSQIRATGVGTAVAVGRLGAMSGPLLAGKMLALGTGTVGVMAASAPGILVAG
FT                   LAVFILMSRRLRMQPCADA"
FT   gene            474656..475195
FT                   /gene="yaiL"
FT                   /locus_tag="G2583_0467"
FT   CDS_pept        474656..475195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiL"
FT                   /locus_tag="G2583_0467"
FT                   /product="Nucleoprotein/polynucleotide-associated enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55096"
FT                   /db_xref="InterPro:IPR018636"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJC6"
FT                   /protein_id="ADD55096.1"
FT                   /translation="MAKLTLQEQLLKAGLVTSKKAAKVERTAKKSRVQAREARAAVEEN
FT                   KKAQLERDKQLSEQQKQAALAKEYKAQVKQLIEMNRITIANGDIGFNFTDGNLIKKIFV
FT                   DKLTQAQLINGRLAIARLLVDNNSEGEYAIIPASVADKIAQRDASSIVLHSALSAEEQD
FT                   EDDPYADFKVPDDLMW"
FT   gene            complement(475320..476153)
FT                   /gene="frmB"
FT                   /locus_tag="G2583_0468"
FT   CDS_pept        complement(475320..476153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frmB"
FT                   /locus_tag="G2583_0468"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55097"
FT                   /db_xref="GOA:D3QJC7"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJC7"
FT                   /protein_id="ADD55097.1"
FT                   /translation="MELIEKHASFGGWQNVYRHYSASLKCEMNVGVYLPPKAAGEKLPV
FT                   LYWLSGLTCNEQNFITKSGVQRYAAEHNIIVVAPDTSPRGSHVADADRYDLGQGAGFYL
FT                   NATQAPWNEHYKMYDYIRNELPDLVMNHFPATAKKSISGHSMGGLGALVLALRNPDEYV
FT                   SVSAFSPIVSPSQVPWGQQAFAAYLGENKEAWLDYDPVSLISQGQRVAEIMVDQGLSDD
FT                   FYAEQLRTQNLEKICQEMNIKTLIRYHEGYDHSYYFVSSFIGEHIAYHANKLNMR"
FT   gene            complement(476246..477355)
FT                   /gene="frmA"
FT                   /locus_tag="G2583_0469"
FT   CDS_pept        complement(476246..477355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frmA"
FT                   /locus_tag="G2583_0469"
FT                   /product="S-(hydroxymethyl)glutathione dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55098"
FT                   /db_xref="GOA:D3QJC8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJC8"
FT                   /protein_id="ADD55098.1"
FT                   /translation="MKSRAAVAFAPGKPLEIVEIDVAPPKKGEVLIKVTHTGVCHTDAF
FT                   TLSGDDPEGVFPVVLGHEGAGVVVEVGEGVTSVKPGDHVIPLYTAECGECEFCRSGKTN
FT                   LCVAVRETQGKGLMPDGTTRFSYNGQPLYHYMGCSTFSEYTVVAEVSLAKINPEANHEH
FT                   VCLLGCGVTTGIGAVHNTAKVQPGDSVAVFGLGAIGLAVVQGARQAKAGRIIAIDTNPK
FT                   KFDLARRFGATDCINPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRAALESAHRGW
FT                   GQSVIIGVAGSGQEISTRPFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPF
FT                   VTHTMSLDEINDAFDLMHEGKSIRTVIRY"
FT   gene            complement(477390..477686)
FT                   /gene="frmR"
FT                   /locus_tag="G2583_0470"
FT   CDS_pept        complement(477390..477686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frmR"
FT                   /locus_tag="G2583_0470"
FT                   /product="regulator protein FrmR"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55099"
FT                   /db_xref="GOA:D3QJC9"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJC9"
FT                   /protein_id="ADD55099.1"
FT                   /translation="MQMMRCEMPSTPEEKKKVLTRVRRIRGQIDALERSLEGDAECRAI
FT                   LQQIAAVRGAANGLMAEVLESHIRETFDRNDCYSREVSQSVDDTIELVRAYLK"
FT   gene            complement(477825..478871)
FT                   /gene="afuC"
FT                   /locus_tag="G2583_0471"
FT   CDS_pept        complement(477825..478871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuC"
FT                   /locus_tag="G2583_0471"
FT                   /product="Fe(3+) ions import ATP-binding protein fbpC"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55100"
FT                   /db_xref="GOA:D3QJD0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR015853"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJD0"
FT                   /protein_id="ADD55100.1"
FT                   /translation="MSQKNFVELRNVTKRFGSNTVIDNINLTIPQGQMVTLLGPSGCGK
FT                   TTILRLVAGLEKPSEGQIFIDGEDVTHRSIQQRDICMVFQSYALFPHMSLGENVGYGLK
FT                   MLGVSRSEVKQRVKEALAMVDLEGFEDRYVDQISGGQQQRVALARALILKPKVLLFDEP
FT                   LSNLDANLRRSMRDKIRELQKQFNITSLYVTHDQSEAFAVSDTVLVMNKGHIMQIGSPQ
FT                   DLYRQPASRFMASFMGDANLFPANFSEEYVDIYGYRLPRAAHFPVQGSGTVGVRPEAIT
FT                   LSNHGEESQRCVIRHVAYMGPQYEVTVEWHGQEILLQVNATRLQPDIGEHYYLEIHPYG
FT                   MFVLADAA"
FT   gene            complement(478883..480961)
FT                   /gene="afuB"
FT                   /locus_tag="G2583_0472"
FT   CDS_pept        complement(478883..480961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuB"
FT                   /locus_tag="G2583_0472"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55101"
FT                   /db_xref="GOA:D3QJD1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJD1"
FT                   /protein_id="ADD55101.1"
FT                   /translation="MSQTLALHPVKKRDAIFLWVLLGWLAFVLLPSWSLDYGLLESTSD
FT                   EILGAYGWSHFNISWLWYLLPSLLLVRPFRQATREQRSRHYFDAGWALLCMAFIVISAT
FT                   VAGRGLGYAAIVLFVELGAIMTLALTRLEWLGGDRFVIGSLIAIVALIGIFIVWPSIAI
FT                   FIPMFTNDAGELAPLAFMTVLSQAHIVQVIVNSIVLSIAVGIGCTFFGLVLAIYTTRIA
FT                   KRSAIIGRIFSILPIVTPPFVVGLGVTLMMGRSGYVTEFMVEWFGLTNTNWLYGFTGIW
FT                   LAQVLAFTPMAFMILDGAIKTIHPSLEEASYTLRASRWQTFNGVFVPLLKPALANAFLI
FT                   VVVQSLADFSNPLVLGGNFDVLATQIYFYITGSQLDYQAASTLGAFLLLFSLLVFCIQY
FT                   MWIGKRSYVTVSGKSYRGDVQPLPVTLVWSVVAILAIWIAFNALLYGSIFYGSFTVNWG
FT                   VDYTLTLDNFIKLFGQGMSDGAWPSLLDTLLYAGIAAPITAIFGLLIAWVVVRQQFKGK
FT                   KTIEFTTMLCFAVPGTVAGVSYILAFNSAPVYLTGTAAIVIISMVMRNVPVGIRAGIAG
FT                   LGQIDKSLDEASLSLRAGSLRTITHILLPLLRPAILSALIYSFVRAITTVSAIVFLVTP
FT                   DTRVATAYILNRVEDGEYGVAIAYGSILIVVMLAIIFLFDWLIGEARISRSKAKNQA"
FT   gene            complement(481030..482061)
FT                   /gene="afuA"
FT                   /locus_tag="G2583_0473"
FT   CDS_pept        complement(481030..482061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuA"
FT                   /locus_tag="G2583_0473"
FT                   /product="Periplasmic ferric iron-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55102"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJD2"
FT                   /protein_id="ADD55102.1"
FT                   /translation="MKMTFTSTLIASAVALATLTGAAQAKGRLVVYCSATNEMCEAETK
FT                   AFGEKYDVKTSFIRNGSGSTLAKVDAEKKNPQADVWYGGTLDPQSQAGEMGLLQAYKSP
FT                   NLEQIMEKFRDPAKVKGNLSSAVYVGILGFGVNTDRLKEKNLPVPKCWKDLTKPEYKGE
FT                   IQIADPQSSGTAYTALATFAQLWGEDQAFDYLKQLNANVSQYTKSGIAPARNAARGETA
FT                   IGIGFLHDYSLEKEQGAPLELISPCEGTGYEIGGVSILKGARNLDNAKLFVDWVLSKEA
FT                   QELAWKKGKSYQILTNTTAETSPNSLKLDDLKLINYDMDKYGSTDVRKALINKWVSEVK
FT                   MGK"
FT   gene            complement(482058..483362)
FT                   /gene="uhpC"
FT                   /locus_tag="G2583_0474"
FT   CDS_pept        complement(482058..483362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uhpC"
FT                   /locus_tag="G2583_0474"
FT                   /product="putative permease; hexosephosphate transport"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55103"
FT                   /db_xref="GOA:D3QJD3"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJD3"
FT                   /protein_id="ADD55103.1"
FT                   /translation="MHARSAREINQCYRTLRPRLLMCMIIGYAAFYLTRKSVNYVLPAL
FT                   QTDLGLDKGDIGLLGSLFYLSYGLSKFTAGLWHDSHGQRGFMGVGLFATGLLNVVFAFG
FT                   ESLTLLLVVWTLNGFFQGWGWPPCARLLTHWYSRNERGFWWGCWNMSINIGGAIIPLIS
FT                   AFAAHWWGWQAAMLTPGIISMALGIWLTLQLKGTPQEEGLPTVGHWRHDPLELRQEQQS
FT                   PPMGLWQMLRTTMLQNPLIWLLGVSYVLVYVIRIALNDWGNIWLTESHGVNLLSANATV
FT                   MLFEVGGLLGALFAGWGSDLLFSGQRAPMILLFTLGLMVSVAALWLAPVHHYALLAVCF
FT                   FTVGFFVFGPQMLIGLAAVECGHKAAAGSITGFLGLFAYLGAALAGWPLSLVIERYGWP
FT                   GMFSLLSVAAVLMGLLLMPLLMAGITTTHARRIKQ"
FT   gene            complement(483447..484988)
FT                   /locus_tag="G2583_0475"
FT   CDS_pept        complement(483447..484988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0475"
FT                   /product="Integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55104"
FT                   /db_xref="GOA:D3QJD4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJD4"
FT                   /protein_id="ADD55104.1"
FT                   /translation="MSRNLRHWVILLFIVLAWGTGWLMLWTLSFYLTNNGQQAVLFLPQ
FT                   GVYLALVILLSRRYWPALVLPPLLMMFWLHSEQLLNGYLMLATPVISLFPALLAQNFWH
FT                   RFPLYWQRLTLLLATVTAASLLNTALLSPFMSGPIMLPGLTSFTGGVLLTPFVYLIFEF
FT                   LRQQHRYQLLGLDTHNPPLRTSLIIWCSLFFIIGIGTQMVLSPEIERLLLIVVFLPNVV
FT                   MAWKFGWQGGVLSGLLGSMMITIARQIGVGFSNLVELEIFLATQALLGIGLGIAISRQQ
FT                   HLALNLHHYRQRLEAELAARRALAEKLIHTEEDTRKNLARELHDEIGQNITAIQIQSQL
FT                   VKRARDPAQIQSAASQINELARRIHLSTRQLLRQLRPPALDELTFREALLHLINEFAFS
FT                   ERGIHCQFAYQLNSTPENETVRFTLYRLLQELLNNICKHAEASEVTIILRQQGEVLHLE
FT                   VSDNGVGIASGKMAGFGIQGMRERVSALGGDLTLEKQHGTRVIVNLPTFLQQIAG"
FT   gene            complement(484988..485617)
FT                   /locus_tag="G2583_0476"
FT   CDS_pept        complement(484988..485617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0476"
FT                   /product="Putative response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55105"
FT                   /db_xref="GOA:D3QJD5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJD5"
FT                   /protein_id="ADD55105.1"
FT                   /translation="MIRVVLVDDHVVVRSGFAQLLSLEDDLEVIGQYSSAAQAWSALIR
FT                   DDVNVAVIDIAMPDENGLSLLKRLRAQKPQFRAIILSIYDAPTFVQSALDAGASGYLTK
FT                   RCGPEELVQAVRSVGLGGHYLCADAIRALRGGGQPAQALEILTPREREVFELLVKGDSV
FT                   KEIAFKLELSHKTVHVHRANVLGKLNCHSTIELVHFALDHHLLAGH"
FT   gene            485920..486882
FT                   /gene="tauA"
FT                   /locus_tag="G2583_0477"
FT   CDS_pept        485920..486882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauA"
FT                   /locus_tag="G2583_0477"
FT                   /product="Taurine transport system periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55106"
FT                   /db_xref="GOA:D3QJD6"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJD6"
FT                   /protein_id="ADD55106.1"
FT                   /translation="MAISSRNTLLAALAFIAFQAQAVNVTVAYQTSAEPAKVAQADNTF
FT                   AKESGATVDWRKFDSGASIVRALASGDVQIGNLGSSPLAVAASQQVPIEVFLLASKLGN
FT                   SEALVVKKTISKPEDLIGKRIAVPFISTTHYSLLAALKHWGIKPGQVEIVNLQPPAIIA
FT                   AWQRGDIDGAYVWAPAVNALEKDGKVLTDSEQVGQWGAPTLDVWVVRKDFAEKHPEVVK
FT                   AFAKSAIDAQQPYIANPDVWLKQPENISKLARLSGVPEGDVPGLVKGNTYLTPQQQTAE
FT                   LTGPVNKAIIDTAQFLKEQGKVPAVANDYSQYVTSRFVQ"
FT   gene            486895..487662
FT                   /gene="tauB"
FT                   /locus_tag="G2583_0478"
FT   CDS_pept        486895..487662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauB"
FT                   /locus_tag="G2583_0478"
FT                   /product="Taurine import ATP-binding protein tauB"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55107"
FT                   /db_xref="GOA:D3QJD7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJD7"
FT                   /protein_id="ADD55107.1"
FT                   /translation="MLQISHLYADYGGKPVLEDINLTLESGELLVVLGPSGCGKTTLLN
FT                   LIAGFVPYQHGSIQLAGKRIEGPGAERGVVFQNEGLLPWRNVQDNVAFGLQLAGIEKMQ
FT                   RLEIAHQMLKKVGLEGAEKRYIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDAFT
FT                   RDQMQTLLLKLWQETGKQVLLITHDIEEAVFMATELVLLSPGPGRVLERLPLNFARRFV
FT                   AGESSRSIKSDPQFIAMREYVLSRVFEQREAFS"
FT   gene            487659..488486
FT                   /gene="tauC"
FT                   /locus_tag="G2583_0479"
FT   CDS_pept        487659..488486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauC"
FT                   /locus_tag="G2583_0479"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transpo rt
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55108"
FT                   /db_xref="GOA:D3QJD8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJD8"
FT                   /protein_id="ADD55108.1"
FT                   /translation="MSVLINEKLHSRRLKWRWPLSRQVTLSIGTLAVLLTVWWTVAALQ
FT                   LISPLFLPPPQQVLAKLLTIAGPQGFMDATLWQHLAASLTRIVLALLAAVLIGIPVGIA
FT                   MGLSPTVRGILDPIIELYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSALA
FT                   GVKSAQQVRIRAAQSLGASRAQVLWFVILPGALPEILTGLRIGLGVGWSTLVAAELIAA
FT                   TRGLGFMVQSAGEFLATDVVLAGIAVIAIIAFLLELGLRALQRRLTPWHGEVQ"
FT   gene            488483..489334
FT                   /gene="tauD"
FT                   /locus_tag="G2583_0480"
FT   CDS_pept        488483..489334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauD"
FT                   /locus_tag="G2583_0480"
FT                   /product="Taurine dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55109"
FT                   /db_xref="GOA:D3QJD9"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJD9"
FT                   /protein_id="ADD55109.1"
FT                   /translation="MSERLSITPLGPYIGAQISGADLTRPLSDNQFEQLYHAVLRHQVV
FT                   FLRDQAITPQQQRALAQRFGELHIHPVYPHAEGVDEIIVLDTHNDNPPDNDNWHTDVTF
FT                   IETPPAGAILAAKELPSTGGDTLWTSGIAAYEALSVPFRQLLSGLRAEHDFRKSFPEYK
FT                   YRKTEEEHQRWREAVAKNPPLLHPVVRTHPVSGKQALFVNEGFTTRIVDVSEKESEALL
FT                   GFLFAHITKPEFQVRWRWQPNDIAIWDNRVTQHYANADYLPQRRIMHRATILGDKPFYR
FT                   AG"
FT   gene            complement(489441..490448)
FT                   /gene="hemB"
FT                   /locus_tag="G2583_0481"
FT   CDS_pept        complement(489441..490448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="G2583_0481"
FT                   /product="Delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55110"
FT                   /db_xref="GOA:D3QJE0"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJE0"
FT                   /protein_id="ADD55110.1"
FT                   /translation="MHLNSTNIRQTMTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLP
FT                   IFVEEEIDDYKAVEAMPGVMRIPEKHLAREIERIANAGIRSVMTFGISHHTDETGSDAW
FT                   REDGLVARMSRICKQTVPEMIVMSDTCFCEYTSHGHCGVLCEHGVDNDATLENLGKQAV
FT                   VAAAAGADFIAPSAAMDGQVQAIRQALDAAGFKDTAIMSYSTKFASSFYGPFREAAGSA
FT                   LKGDRKSYQMNPMNRREAIRESLLDEAQGADCLMVKPAGAYLDIVRELRERTELPIGAY
FT                   QVSGEYAMIKFAALAGAIDEEKVVLESLGSIKRAGADLIFSYFALDLAEKKILR"
FT   gene            490941..493883
FT                   /gene="yaiU"
FT                   /locus_tag="G2583_0482"
FT   CDS_pept        490941..493883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiU"
FT                   /locus_tag="G2583_0482"
FT                   /product="Putative flagellin structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55111"
FT                   /db_xref="GOA:D3QJE1"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJE1"
FT                   /protein_id="ADD55111.1"
FT                   /translation="MHSWKKKLVVSQLALACTLAITSQANAATNDISGQTYNTFHHYND
FT                   ATYADDVYYDGYVGWNNYAADSYYNGDIYPVINNATVNGVISTYYLDDGISTNTNANSL
FT                   TIKNSTIHGMITSECMTTDCADDRATGYVYDRLTLSVDNSTIDDNYEHYTYNGTYNNAA
FT                   DTHVVDVYDMGTAITLDQEVDLSITNNSHVAGITLTQGYEWEDIDDNTVSTGVNSSEVF
FT                   NNTITVKDSTVTSGSWTDEGTTGWFGHTGNASNYSNTLTADDVAIAAIANPYADNAMQT
FT                   TVTLDNSTLMGDVVFSSNFDENFFPQGADSYRDADGDVDTNGWDGTDRMDVTLNNGSKW
FT                   VGAAMSVHMVDEDGDGSYDGYAVGTEATATLLDIAANSLWPSSTVGVDNINTQYDENGH
FT                   IVGNEVYQSGLFNVTLNGGSEWDTTKSSLIDTLSINSGSQVNVADSRLISDTVSLTGGS
FT                   NLNIGEDGHVATNTLTIDNSTVKMSDDVSAGWGLEDAALYANTITVTNDGLLDINVDQF
FT                   DANPFQADTLNLTSTTDTNGNIHAGVFDIHSSDYVMDTDLVNDRTNDTTKSNYGYGLIA
FT                   MNSDGHLTINGNGDNDNTASIEAGQNEVDNNGDHVAAATGNYKVRIDNATGAGSIADYN
FT                   GNELIYVNDKNSNATFSAANKADLGAYTYQAEQRGNTVVLQQMELTDYANMALSIPSAN
FT                   TNIWNLEQDTVGTRLTNSRHGLADNGGAWVSYFGGNFNGDNGTINYDQDVNGIMVGVDT
FT                   KIDGNNAKWIVGAAAGFAKGDMNDRSGQVDQDSQTAYIYSSAHFANNVFVDGSLSYSHF
FT                   NNDLSATMSNGTYVDGSTNSDAWGFGLKAGYDFKLGDAGYVTPYGSISGLFQSGDDYQL
FT                   SNDMKVDGQSYDSMRYELGVDAGYTFTYSEDQALTPYFKLAYVYDDSNNDNDVNGDSID
FT                   NGTEGSAVRVGLGTQFSFTKNFSAYTDANYLGGGDVDQDWSANVGVKYTW"
FT   gene            493926..494594
FT                   /gene="yaiV"
FT                   /locus_tag="G2583_0483"
FT   CDS_pept        493926..494594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiV"
FT                   /locus_tag="G2583_0483"
FT                   /product="putative DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55112"
FT                   /db_xref="GOA:D3QJE2"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR034719"
FT                   /db_xref="InterPro:IPR041687"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJE2"
FT                   /protein_id="ADD55112.1"
FT                   /translation="MPVKDLTGITAKDAQMLSVVKPLQEFGKLDKCLSRYGTRFEFNNE
FT                   KQVIFSSDVNNEDTFVILEGVISLRREENVLIGITQAPYIMGLADGLMKNDIPYKLISE
FT                   GICTGYHLPAKQTITLIEQNQLWRDAFYWLAWQNRILELRDVQLIGHNSYEQIRATLLS
FT                   MIDWNEELRSRIGVMNYIHQRTRISRSVVAEVLAALRKGGYIEMNKGKLVAINRLPSEY
FT                   "
FT   gene            complement(494595..495752)
FT                   /gene="ampH"
FT                   /locus_tag="G2583_0484"
FT   CDS_pept        complement(494595..495752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="G2583_0484"
FT                   /product="Penicillin-binding protein ampH"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55113"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJE3"
FT                   /protein_id="ADD55113.1"
FT                   /translation="MKRSLLFSAVLCAASLTSVHAAQPITEPEFASDIVDRYADHIFYG
FT                   SGATGMALVVIDGNQRVFRSYGETRPGNNVRPQLDSVVRIASLTKLMTSEMLVKLLDQG
FT                   TVKLNDPLSKYAPPGARVPTYNGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQ
FT                   RWKYLSTAKLKAAPGSQAAYSNLAFDLLADALANASGKPYTQLFEEQITRPLGMKDTTY
FT                   TPSPDQCRRLMVAERGASPCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYQRSNQAD
FT                   RMQTLIYQRAQFTKVIGMDVPGKADALGLGWVYMAPKEGRPGIIQKTGGGGGFITYMAM
FT                   IPQKNIGAFVVVTRSPLTRFKNMSDGINDLVTELSGNKPLVIPAS"
FT   gene            496104..497324
FT                   /gene="sbmA"
FT                   /locus_tag="G2583_0485"
FT   CDS_pept        496104..497324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbmA"
FT                   /locus_tag="G2583_0485"
FT                   /product="Inner-membrane transport protein, Microcin 25"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55114"
FT                   /db_xref="GOA:D3QJE4"
FT                   /db_xref="InterPro:IPR009248"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJE4"
FT                   /protein_id="ADD55114.1"
FT                   /translation="MFKSFFPKPGTFFLSAFVWALIAVIFWQAGGGDWVARITGASGQI
FT                   PISAARFWSLDFLIFYAYYIVCVGLFALFWFIYSPHRWQYWSILGTALIIFVTWFLVEV
FT                   GVAVNAWYAPFYDLIQTALSSPHKVTIEQFYREVGVFLGIALIAVVISVLNNFFVSHYV
FT                   FRWRTAMNEYYMANWQQLRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLIAFLPV
FT                   LVTLSAHVPELPIIGHIPYGLVIAAIVWSLMGTGLLAVVGIKLPGLEFKNQRVEAAYRK
FT                   ELVYGEDDATRATPPTVRELFSAVRKNYFRLYFHYMYFNIARILYLQVDNVFGLFLLFP
FT                   SIVAGTITLGLMTQITNVFGQVRGAFQYLINSWTTLVELMSIYKRLRSFEHELDGDKIQ
FT                   EVTHTLS"
FT   gene            497337..498431
FT                   /gene="yaiW"
FT                   /locus_tag="G2583_0486"
FT   CDS_pept        497337..498431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiW"
FT                   /locus_tag="G2583_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55115"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJE5"
FT                   /protein_id="ADD55115.1"
FT                   /translation="MSRVNHLSSLSFLAVLVLAGCSSQAPQPLKKGEKAIDVASVVRQK
FT                   MPASVKDRDAWAKDLATTFESQGLALTLENVCSVLAVAQQESNYQADPAVPGLSKIAWQ
FT                   EIDRRAERMHIPAFLVHTALKIKSPNGKSYSERLDSVRTEKQLSGIFDDLISMVPMGQT
FT                   LFGSLNPVRTGGPMQVSIAFAEQHTKGYPWKMDGTVRQEVFSRRGGLWFGTYHLLNYPA
FT                   SYSAPIYRFADFNAGWYASRNAAFQNAVSKASGVKLALDGDLIRYDSKEPGKTELATRK
FT                   LAAKLGMSDSEIRRQLEKGDSFSFEETALYKKVYQLAEAKTGKSLPREMLPGIQLESPK
FT                   ITRNLTTAWFAKRVDERRARCMKQ"
FT   gene            complement(498490..498798)
FT                   /gene="yaiY"
FT                   /locus_tag="G2583_0487"
FT   CDS_pept        complement(498490..498798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiY"
FT                   /locus_tag="G2583_0487"
FT                   /product="Inner membrane protein yaiY"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55116"
FT                   /db_xref="GOA:D3QJE6"
FT                   /db_xref="InterPro:IPR020513"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJE6"
FT                   /protein_id="ADD55116.1"
FT                   /translation="MADFTLSKSLFSGKYRNASSTPGNIAYALFVLFCFWAGAQLLNLL
FT                   VHAPGVYERLMQVQETGRPRVEIGLGVGTIFGLIPFLVGCLIFAVVALWLHWRHRRQ"
FT   gene            498926..499270
FT                   /gene="yaiZ"
FT                   /locus_tag="G2583_0488"
FT   CDS_pept        498926..499270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiZ"
FT                   /locus_tag="G2583_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55117"
FT                   /db_xref="GOA:D3QJE7"
FT                   /db_xref="InterPro:IPR020490"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJE7"
FT                   /protein_id="ADD55117.1"
FT                   /translation="MNLRCESQNSNFKLNLLTIAKMLSTPQTVVAEYARMLFFVNGAAM
FT                   NLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGLVTWVISFWLAGLIIR
FT                   RRDEETENAQ"
FT   gene            complement(499294..500388)
FT                   /gene="ddlA"
FT                   /locus_tag="G2583_0489"
FT   CDS_pept        complement(499294..500388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="G2583_0489"
FT                   /product="D-alanine--D-alanine ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55118"
FT                   /db_xref="GOA:D3QJE8"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJE8"
FT                   /protein_id="ADD55118.1"
FT                   /translation="MEKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDK
FT                   QGQWHVSDASNYLLNADDPAHIALRPSATSLAQVPGKHEHQLIDAQNGQPLPTVDVIFP
FT                   IVHGTLGEDGSLQGMLRVANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTR
FT                   ANRHNISFAEVEAKLGLPLFVKPANQGSSVGVSKVTSEEQYAIAVDLAFEFDHKVIVEQ
FT                   GIKGREIECAVLGNDNPQASTCGEIVLTSDFYAYDTKYIDEDGAKVVVPAAIAPEINDK
FT                   IRAIAVQAYQTLGCAGMARVDVFLTPENEVVINEINTLPGFTNISMYPKLWQASGLGYT
FT                   DLITRLIELALERHAADNALKTTM"
FT   gene            500851..501111
FT                   /gene="iraP"
FT                   /locus_tag="G2583_0490"
FT   CDS_pept        500851..501111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iraP"
FT                   /locus_tag="G2583_0490"
FT                   /product="Anti-adapter protein iraP"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55119"
FT                   /db_xref="GOA:D3QJE9"
FT                   /db_xref="InterPro:IPR019732"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJE9"
FT                   /protein_id="ADD55119.1"
FT                   /translation="MKNLIAELLFKLAQKEEESKELCAQVEALEIIVTAMLRNMAQNDQ
FT                   QRLIDQVEGALYEVKPDASIPDDDTELLRDYVKKLLKHPRQ"
FT   gene            501143..502627
FT                   /gene="phoA"
FT                   /locus_tag="G2583_0491"
FT   CDS_pept        501143..502627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoA"
FT                   /locus_tag="G2583_0491"
FT                   /product="Alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55120"
FT                   /db_xref="GOA:D3QJF0"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJF0"
FT                   /protein_id="ADD55120.1"
FT                   /translation="MSRPRLIVALFLFFNVFVHGENKVKQSTIALALLPLLFTPVTKAR
FT                   TPEMPVLENRAAQGDITAPGGARRLTADQTAALRDSLSDKPAKNIILLIGDGMGDSEIT
FT                   AARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDYVTDSAASATAWSTGVKTYNG
FT                   ALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEK
FT                   CPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAGEWQGKTLREQAQARGYQL
FT                   VSDAASLNSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGNIDKPAVTCTPNPQRNDS
FT                   VPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALE
FT                   FAKKDGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHT
FT                   GSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK"
FT   gene            502728..503066
FT                   /gene="psiF"
FT                   /locus_tag="G2583_0492"
FT   CDS_pept        502728..503066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="G2583_0492"
FT                   /product="Phosphate starvation-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55121"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJF1"
FT                   /protein_id="ADD55121.1"
FT                   /translation="MKRDGAMKITLLVTLLFGLVFLTTVGAAERTLTPQQQRMTSCNQQ
FT                   ATAQALKGDARKTYMSDCLKNSKSAPGEKSLTPQQQKMRECNNQATQQSLKGDDRNKFM
FT                   SACLKKAA"
FT   gene            503168..504283
FT                   /gene="adrA"
FT                   /locus_tag="G2583_0493"
FT   CDS_pept        503168..504283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adrA"
FT                   /locus_tag="G2583_0493"
FT                   /product="MASE2 domain/diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55122"
FT                   /db_xref="GOA:D3QJF2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR007894"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJF2"
FT                   /protein_id="ADD55122.1"
FT                   /translation="MFPKIMNDENFFKKAAAHGEEPPLTPQNEHQRSGLRFARRVRLPR
FT                   AVGLAGMFLPIASTLVSHPPPGWWWLVLVGWAFVWPHLAWQIASRAVDPLSREIYNLKT
FT                   DAVLAGMWVGVMGVNVLPSTAMLMIMCLNLMGAGGPRLFVAGLVLMVVSCLVTLELTGI
FT                   TVSFNSAPLEWWLSLPIIVIYPLLFGWVSYQTATKLAEHKRRLQVMSTRDGMTGVYNRR
FT                   HWETMLRNEFDNCRRHNRDATLLIIDIDHFKSINDTWGHDVGDEAIVALTRQLQITLRG
FT                   SDVIGRFGGDEFAVIMSGTPAESAITAMLRVHEGLNTLRLPNTPQVNLRISVGVAPLNP
FT                   QMSHYREWLKSADLALYKAKKAGRNRTEVAA"
FT   gene            complement(504300..505109)
FT                   /gene="proC"
FT                   /locus_tag="G2583_0494"
FT   CDS_pept        complement(504300..505109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="G2583_0494"
FT                   /product="Pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55123"
FT                   /db_xref="GOA:D3QJF3"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJF3"
FT                   /protein_id="ADD55123.1"
FT                   /translation="MEKKIGFIGCGNMGKAILGGLIASGQVLPGQIWVYTPSPDKVAAL
FT                   HDKFGINAAESAQEVAQIADIIFAAVKPGIMIKVLSEITSSLNKDSLVVSIAAGVTLDQ
FT                   LARALGHDRKIIRAMPNTPALVNAGMTSVTPNALVTPEDTADVLNIFRCFGEAEVIAEP
FT                   MIHPVVGVSGSSPAYVFMFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLETGEHP
FT                   GALKDMVCSPGGTTIEAVRVLEEKGFRAAVIEAMTKCMEKSEKLSKS"
FT   gene            505229..505687
FT                   /gene="yaiI"
FT                   /locus_tag="G2583_0495"
FT   CDS_pept        505229..505687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiI"
FT                   /locus_tag="G2583_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55124"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJF4"
FT                   /protein_id="ADD55124.1"
FT                   /translation="MTIWVDADACPNVIKEILYRAAERMQMPLVLVANQSLRVPPSRFI
FT                   RTLRVAAGFDVADNEIVRQCEAGDLVITADIPLAAEAIEKGAAALNPRGERYTPATIRE
FT                   RLTMRDFMDTLRASGIQTGGPDSLSQRDRQAFAAELEKWWLEVQRSRG"
FT   gene            505870..506394
FT                   /gene="aroL"
FT                   /locus_tag="G2583_0496"
FT   CDS_pept        505870..506394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroL"
FT                   /locus_tag="G2583_0496"
FT                   /product="Shikimate kinase 2"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55125"
FT                   /db_xref="GOA:D3QJF5"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027544"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJF5"
FT                   /protein_id="ADD55125.1"
FT                   /translation="MTQPLFLIGPRGCGKTTVGMALADSLNRRFVDTDQWLQSQLNMTV
FT                   AEIVEREEWAGFRARETAALEAVTAPSTVIATGGGIILTEFNRHFMQNNGIVVYLCAPV
FT                   SVLVNRLQAAPEEDLRPTLTGKPLSEEVQEVLEERDALYREVAHIIIDATNEPSQVISE
FT                   IRSALAQTINC"
FT   gene            506444..506635
FT                   /gene="yaiA"
FT                   /locus_tag="G2583_0497"
FT   CDS_pept        506444..506635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiA"
FT                   /locus_tag="G2583_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55126"
FT                   /db_xref="InterPro:IPR032303"
FT                   /db_xref="InterPro:IPR038462"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJF6"
FT                   /protein_id="ADD55126.1"
FT                   /translation="MPTKPPYPREAYIVTIEKGKPGQTVTWYQLRADHPKPDSLISEHP
FT                   TAQEAMDAKKRYEDPDKE"
FT   gene            506893..507570
FT                   /gene="aroM"
FT                   /locus_tag="G2583_0498"
FT   CDS_pept        506893..507570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroM"
FT                   /locus_tag="G2583_0498"
FT                   /product="AroM protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55127"
FT                   /db_xref="InterPro:IPR010843"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJF7"
FT                   /protein_id="ADD55127.1"
FT                   /translation="MSASLAILTIGIVPMQEVLPLLTEYIDEDNISHHSLLGKLSREEV
FT                   MAEYAPEAGEDTILTLLNDNHLAHVSRRKVERDLQGVVEVLDNQGYDVIILMSTANISS
FT                   MTARNTIFLEPSRILPPLVSSIVEDHQVGVIVPVEELLTVQAQKWQILQKPPVFSLGNP
FT                   IHDSEQKIIDAGKELLAKGADVIMLDCLGFNQRHRDLLQKQLDVPVLLSNVLIARLAAE
FT                   LLV"
FT   gene            507642..507926
FT                   /gene="yaiE"
FT                   /locus_tag="G2583_0499"
FT   CDS_pept        507642..507926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiE"
FT                   /locus_tag="G2583_0499"
FT                   /product="UPF0345 protein yaiE"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55128"
FT                   /db_xref="GOA:D3QJF8"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJF8"
FT                   /protein_id="ADD55128.1"
FT                   /translation="MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGEYTFSTAEPEEM
FT                   TVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVAEPTSYLCRYL"
FT   gene            508184..510349
FT                   /gene="ydbD"
FT                   /locus_tag="G2583_0500"
FT   CDS_pept        508184..510349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbD"
FT                   /locus_tag="G2583_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55129"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024497"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJF9"
FT                   /protein_id="ADD55129.1"
FT                   /translation="MTADERNVVKAATDDSMEAAYMLKDNIRWYYHNGDLSLPANFSNK
FT                   NKLVVNGNLTISGDYDDYLSGNGHLIVLGNVIVDNFINHDFAYVKGQMTAKGLVYADYN
FT                   DHNFEVMKGISARGIIVSDKATQFEVIKAEFYINEDGSGEGYNWDENIQKAYSLVTADL
FT                   YDHTEIETDNISNAYPDYDSVADNIVQGLPLFRDKAAPEINEKLKWIETGKLDNFPANK
FT                   IKHQDPLVARFLTHTESLSPAVMLQLLQHPDDQTRESMAQSWPAQQMHWLTDELIKDEA
FT                   VARGLVKNSNISADVNKKLMSVPVESVQLEQARQDNLSPDIVASLSHSPFLSVRKTLLS
FT                   HYDYAWLVPTAVADELINNEDPELRERITGADLTAQQAVMLSKDKSLKVREALARTLTE
FT                   LKITQLSATLRTEDIERIAEQMYLDNKENKNIVKVLLIALPEMRQLSLAKEDVHNLREG
FT                   ARYLTSKDVISYLLTQHDVPTVWDELARDKLLPLEYKKQLWQRTLNLMMSKRQEDQEQA
FT                   YEVQLALIDNGVVDEEMLNNAIDLLVDLPAEYRYRMRNQLFDNKELPSGIINKLDQQYR
FT                   FNSDWALAVVSMKNSTRRQSERGLHRWNHEDSDIFAELATIKDKSDDEWWRALLQSRND
FT                   HLRQTALRNAHTPASLLTTLTESQDRSLAINNPQLAADVKTVWLKEDPSLLLFVDKPDL
FT                   SQLRDLVKTGATRKIRNEARHRLEEKQ"
FT   gene            510346..510801
FT                   /locus_tag="G2583_0501"
FT   CDS_pept        510346..510801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55130"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJG0"
FT                   /protein_id="ADD55130.1"
FT                   /translation="MTQRPWSKLQREIYDLLTPTINLQIHCTRYPMRSQNGGSTDLPRY
FT                   WITLDKNVIWDYPKDFIAGNGGVRNFHGETCWYPYLTDICSISDLLREYIDTPKAELLT
FT                   KQFTSDKWGLVNILRAADRRIGMRRLDQLRRKTHNIAALKIIARRSE"
FT   gene            complement(510879..511790)
FT                   /gene="rdgC"
FT                   /locus_tag="G2583_0502"
FT   CDS_pept        complement(510879..511790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="G2583_0502"
FT                   /product="Recombination-associated protein rdgC"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55131"
FT                   /db_xref="GOA:D3QJG1"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJG1"
FT                   /protein_id="ADD55131.1"
FT                   /translation="MLWFKNLMVYRLSREISLRAEEMEKQLASMAFTPCGSQDMAKMGW
FT                   VPPMGSHSDALTHVANGQIVICARKEEKILPSPVIKQALEAKIAKLEAEQARKLKKTEK
FT                   DSLKDEVLHSLLPRAFSRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSLGSLPV
FT                   VPLSMANPIELTLTEWVRSGSAAQGFQLLDEAELKSLLEDGGVIRAKKQDLTSEEITNH
FT                   IEAGKVVTKLALDWQQRIQFVMCDDGSLKRLKFCDELRDQNEDIDREDFAQRFDADFIL
FT                   MTGELAALIQNLIEGLGGEAQR"
FT   gene            511915..512823
FT                   /gene="mak"
FT                   /locus_tag="G2583_0503"
FT   CDS_pept        511915..512823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mak"
FT                   /locus_tag="G2583_0503"
FT                   /product="Possible NAGC-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55132"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJG2"
FT                   /protein_id="ADD55132.1"
FT                   /translation="MRIGIDLGGTKTEVIALGDAGEQLYRHRLPTPRDDYRQTIETIAT
FT                   LVDMAEQATGQRGTVGMGIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLAN
FT                   DANCLAVSEAVDGAAAGAQTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWM
FT                   DEDELRYREEVPCYCGKQGCIETFISGTGFATDYRRLSGHALKGSEIIRLVEESDPVAE
FT                   LALRRYELRLAKSLAHVVNILDPDVIVLGGGMSNVDRLYQTVPQLIKQFVFGGECETPV
FT                   RKAKHGDSSGVRGAAWLWPQE"
FT   gene            complement(512966..514234)
FT                   /gene="araJ"
FT                   /locus_tag="G2583_0504"
FT   CDS_pept        complement(512966..514234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araJ"
FT                   /locus_tag="G2583_0504"
FT                   /product="protein AraJ"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55133"
FT                   /db_xref="GOA:D3QJG3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJG3"
FT                   /protein_id="ADD55133.1"
FT                   /translation="MALLVVILQAITLLATVIGSRSGSCDGGMKKVILSLALGTFGLGM
FT                   AEFGIMGVLTELAHNVGISIPAAGHMISYYALGVVVGAPIIALFSSRYSLKHILLFLVA
FT                   LCVIGNAMFTLSSSYLMLAIGRLVSGFPHGAFFGVGAIVLSKIIKPGKVTAAVAGMVSG
FT                   MTVANLLGIPLGTYLSQEFSWRYTFLLIAVFNIAVMASVYFWVPDIRDEAKGKLREQFH
FT                   FLRSPAPWLIFAATMFGNAGVFAWFSYVKPYMMFISGFSETAMTFIMMLVGLGMVLGNM
FT                   LSGRISGRYSPLRIAAVTDFIIVLALLMLFFCGGMKTTSLIFAFICCAGLFALSAPLQI
FT                   LLLQNAKGGELLGAAGGQIAFNLGSAVGAYCGGMMLTLGLAYNYVALPAALLSFAAMSS
FT                   LLLYGRYKRQQAADSPVLAKPLG"
FT   gene            complement(514276..517419)
FT                   /gene="sbcC"
FT                   /locus_tag="G2583_0505"
FT   CDS_pept        complement(514276..517419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="G2583_0505"
FT                   /product="Nuclease SbcCD, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55134"
FT                   /db_xref="GOA:D3QJG4"
FT                   /db_xref="InterPro:IPR004592"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJG4"
FT                   /protein_id="ADD55134.1"
FT                   /translation="MKILSLRLKNLNSLKGEWKIDFTREPFASNGLFAITGPTGAGKTT
FT                   LLDAICLALYHETPRLSNVSQSQNDLMTRDTAECLAEVEFEVKGEAYRAFWSQNRARNQ
FT                   PDGNLQVPRVELARCADGKILADKVKDKLELTATLTGLDYGRFTRSMLLSQGQFAAFLN
FT                   AKPKERAELLEELTGTEIYGQISAMVFEQHKSARTELEKLQAQASCVALLTPEQVQSLT
FT                   ASLQVLTDEEKQLLTAQQQEQQSLNWLTRLDELQQEASRRQQALQQALAEEEKAQPQLA
FT                   ALSLAQPARNLRPHWERIAEHSAALAHTRQQIEEVNTRLQNTMALRASIRHHAAKQSAE
FT                   LQQQQQSLNTWLQEHDRFRQWNNELAGWRAQFSQQTSDREHLRQWQQQLTHAEQKLNAL
FT                   AAITLTLTADEVATALAQHAEQRPLRQRLVALHGQIVPQQKRLAQLMVTIQNVTLEQTQ
FT                   RNAALNEMRQRYKEKTQQLADVKTICEQEARIKTLEAQRAQLQAGQPCPLCGSTSHPAV
FT                   EAYQALEPGVNQSRLLALENEVKKLGEEGAALRGQLDALTKQLQRDENEAQSLRQDEQA
FT                   LTQQWQAVTASLNITLQPQDDIQPWLDAQDEHERQLRLLSQRHELQGQIAAHNQQIIQY
FT                   QQQIEQRQQQLLTALAGYALTLPQEDEEESWLATRQQEAQSWQQRQNELTALQNRIQQL
FT                   TPILETLPQSDDLPHSEETVALDNWRQVHEQCLALHSQQQTLQQQDVLAAQSLQKAQAQ
FT                   FDTALQASVFDDQQAFLAALMDEQTLTQLEQLKQNLENQRRQAQTLVTQTAETLAQHQQ
FT                   HRPDGLALTVTVEQIQQELAQTHQKLRENTTSQGEIRQQLKQDADNRQQQQTLLQQIAQ
FT                   MTQQVEDWGYLNSLIGSKEGDKFRKFAQGLTLDNLVHLANQQLTRLHGRYLLQRKASEA
FT                   LEVEVVDTWQADAVRDTRTLSGGESFLVSLALALALSDLVSHKTRIDSLFLDEGFGTLD
FT                   SETLDTALDALDALNASGKTIGVISHVEAMKERIPVQIKVKKINGLGYSKLESAFAVK"
FT   gene            complement(517416..518618)
FT                   /gene="sbcD"
FT                   /locus_tag="G2583_0506"
FT   CDS_pept        complement(517416..518618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcD"
FT                   /locus_tag="G2583_0506"
FT                   /product="Nuclease sbcCD subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55135"
FT                   /db_xref="GOA:D3QJG5"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJG5"
FT                   /protein_id="ADD55135.1"
FT                   /translation="MRILHTSDWHLGQNFYSKSREAEHQAFLDWLLETAQTHQVDAIIV
FT                   AGDVFDTGSPPSYARTLYNRFVVNLQQTGCHLVVLAGNHDSVATLNESRDIMAFLNTTV
FT                   VASAGHAPQILPRRDGTPGAVLCPIPFLRPRDIITSQAGLNGIEKQQHLLAAITDYYQQ
FT                   HYADACKLRGDQPLPIIATGHLTTVGASKSDAVRDIYIGTLDAFPAQNFPPADYIALGH
FT                   IHRAQIIGGMEHVRYCGSPIPLSFDECGKSKYVHLVTFSNGKLESVENLNVPVTQPMAV
FT                   LKGDLASITAQLEQWRDVSQEPPVWLDIEITTDEYLHDIQRKIQALTESLPVEILLVRR
FT                   SREQRERVLASQQRETLSELSVEEVFNRRLALEELDESQQQRLQHLFTTTLHTLAGEHE
FT                   A"
FT   gene            518808..519497
FT                   /gene="phoB"
FT                   /locus_tag="G2583_0507"
FT   CDS_pept        518808..519497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="G2583_0507"
FT                   /product="Positive response regulator for pho regulon"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55136"
FT                   /db_xref="GOA:D3QJG6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJG6"
FT                   /protein_id="ADD55136.1"
FT                   /translation="MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEP
FT                   WPDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYIT
FT                   KPFSPKELVARIKAVMRRISPMAVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLL
FT                   HFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTG
FT                   YRFSTRF"
FT   gene            519555..520850
FT                   /gene="phoR"
FT                   /locus_tag="G2583_0508"
FT   CDS_pept        519555..520850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="G2583_0508"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55137"
FT                   /db_xref="GOA:D3QJG7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJG7"
FT                   /protein_id="ADD55137.1"
FT                   /translation="MLERLSWKRLVLELLLCCLPAFILGAFFGYLPWFLLASVTGLLIW
FT                   HFWNLLRLSWWLWVDRSMTPPPGRGSWELLLYGLHQMQLRNKKRRRELGNLIKRFRSGA
FT                   ESLPDAVVLTTEEGGIFWCNGLAQQILGLRWPEDNGQNILNLLRYPEFTQYLKTRDFSR
FT                   PLNLVLNTGRHLEIRVMPYTHKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVL
FT                   QGYLEMMDEQPLEGAVREKALHTMREQTQRMEGLVKQLLTLSKIEAAPTQLLNEKVDVP
FT                   MMLRVVEREAQTLSQKKQTFTFEIDNGLKVSGNEDQLRSAISNLVYNAVNHTPEGTHIT
FT                   VRWQRVPHGAEFSVEDNGPGIAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVN
FT                   HHESRLNIESTVGKGTRFSFVIPERLIVKNSD"
FT   gene            521257..522576
FT                   /gene="brnQ"
FT                   /locus_tag="G2583_0509"
FT   CDS_pept        521257..522576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="G2583_0509"
FT                   /product="Branched-chain amino acid transport system 2
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55138"
FT                   /db_xref="GOA:D3QJG8"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJG8"
FT                   /protein_id="ADD55138.1"
FT                   /translation="MTHQLRSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTAA
FT                   FGFLITAVGLPVLTVVALAKVGGGVDSLSTPIGKVAGVLLATVCYLAVGPLFATPRTAT
FT                   VSFEVGIAPLTGDSALPLFIYSLVYFAIVILVSLYPGKLLDTVGNFLAPLKIIALVILS
FT                   VAAIVWPAGSISTATEAYQNAAFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVTEAR
FT                   LLTRYTVWAGLMAGVGLTLLYLALFRLGSDSASLVDQSANGAAILHAYVQHTFGGGGSF
FT                   LLAALIFIACLVTAVGLTCACAEFFAQYVPLSYRTLVFILGGFSMVVSNLGLSQLIQIS
FT                   VPVLTAIYPPCIALVVLSFTRSWWHNSSRVIAPPMFISLLFGILDGIKASAFSDILPSW
FT                   AQRLPLAEQGLAWLMPTVVMVVLAIIWDRAAGRQVTSSAH"
FT   gene            522652..524025
FT                   /gene="proY"
FT                   /locus_tag="G2583_0510"
FT   CDS_pept        522652..524025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proY"
FT                   /locus_tag="G2583_0510"
FT                   /product="Proline-specific permease proY"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55139"
FT                   /db_xref="GOA:D3QJG9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJG9"
FT                   /protein_id="ADD55139.1"
FT                   /translation="MESKNKLKRGLSTRHIRFMALGSAIGTGLFYGSADAIKMAGPSVL
FT                   LAYIIGGIAAYIIMRALGEMSVHNPAASSFSRYAQENLGPLAGYITGWTYCFEILIVAI
FT                   ADVTAFGIYMGVWFPTVPHWIWVLSVVLIICAVNLMSVKVFGELEFWFSFFKVATIIIM
FT                   IVAGFGIIIWGIGNGGQPTGIHNLWSNGGFFSNGWLGMVMSLQMVMFAYGGIEIIGITA
FT                   GEAKDPEKSIPRAINSVPMRILVFYVGTLFVIMSIYPWNQVGTAGSPFVLTFQHMGITF
FT                   AASILNFVVLTASLSAINSDVFGVGRMLHGMAEQGSAPKIFSKTSRRGIPWVTVLVMTT
FT                   ALLFAVYLNYIMPENVFLVIASLATFATVWVWIMILLSQIAFRRRLPPEEVKALKFKVP
FT                   GGVATTIGGLIFLLFIIGLIGYHPDTRISLYVGFAWIVVLLIGWMFKRRHDRQLAENQ"
FT   gene            524181..525998
FT                   /gene="malZ"
FT                   /locus_tag="G2583_0511"
FT   CDS_pept        524181..525998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malZ"
FT                   /locus_tag="G2583_0511"
FT                   /product="Maltodextrin glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55140"
FT                   /db_xref="GOA:D3QJH0"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017069"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJH0"
FT                   /protein_id="ADD55140.1"
FT                   /translation="MMLNAWHLPVPPFVKQSKDQLLITLWLTGEDPPQRIMLRTEHDNE
FT                   EMSVPMHKQRSQPQPGVTAWRAAIDLSSGQPRRRYSFKLLWHDRQRWFTPQGFSRMPPA
FT                   RLEQFAVDVPDIGPQWAADQIFYQIFPDRFARSLPREAEQDHVYYHHAAGQEIILRDWD
FT                   EPVTAQAGGSTFYGGDLDGISEKLPYLKKLGVTALYLNPVFKAPSVHKYDTEDYRHVDP
FT                   QFGGDGALLRLRHNTQQLGMRLVLDGVFNHSGDSHAWFDRHNRGTGGACHNPESPWRDW
FT                   YSFSDDGTALDWLGYASLPKLDYQSESLVNEIYRGEDSIVRHWLKEPWNMDGWRLDVVH
FT                   MLGEAGGARNNLQHVAGITEAAKETQPEAYIVGEHFGDARQWLQADVEDAAMNYRGFTF
FT                   PLWGFLANTDISYDPQQIDAQTCMAWMDNYRAGLSHQQQLRMFNQLDSHDTARFKTLLG
FT                   REVARLPLAVVWLFTWPGVPCIYYGDEVGLDGKNDPFCRKPFPWQVEKQDMALFALYQR
FT                   MIALRKKSQALRRGGCQVLYAEDNVVVFVRVLNQQRVLVAINRGEACEVVLPASPFLNV
FT                   VQWQRKEGHGQLTDGILALPAISATVWMN"
FT   gene            526186..527631
FT                   /locus_tag="G2583_0512"
FT   CDS_pept        526186..527631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55141"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJH1"
FT                   /protein_id="ADD55141.1"
FT                   /translation="MTISNSNLLKPFITGTELPPFKEDVFSKTEEQFKKSTYGKSLFIS
FT                   GNENLVNISAEKIDEIKNSKNFFSNIVNIIILLIKHPDKILPILHGCPVESIEVIKNAK
FT                   RTGQWSYEMTDKNGQSIEVSYIFTDTIDDKSDGKLCLKICNSCNQNDSSTHEYKIDHQQ
FT                   LKNHIRQLEEWALLEKFYDNNAYYSKRTKQLEKKIADAGFITRKVKAENFNVKEFKDDI
FT                   ASMLCEQPPMRTHQISSSGYVSADKLHKLYKTNLEDAQRDLKTTPVDIDGVSLKSITRE
FT                   KIAEEIAKKTAEIIAKQNAKSIEEKNIEKNKKQTNSEDNFVLKFSPEEINEMLLDYSDE
FT                   EQKKLRPFFTSDHIYCLFDAFSQGLHNVARNGSPRYAGLLRQIASKSAILQDFDQQLFW
FT                   RTFTGGVLHRHISVKSEPEKTDVWRFSSQFDFPHINENGELSRTVLMFEGVAESNFKDI
FT                   ANHSSECFSYRCYAAPLDANAKK"
FT   gene            complement(527652..528233)
FT                   /gene="acpH"
FT                   /locus_tag="G2583_0513"
FT   CDS_pept        complement(527652..528233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpH"
FT                   /locus_tag="G2583_0513"
FT                   /product="Acyl carrier protein phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55142"
FT                   /db_xref="GOA:D3QJH2"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="InterPro:IPR023491"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJH2"
FT                   /protein_id="ADD55142.1"
FT                   /translation="MNFLAHLHLAHLAESSLSGNLLADFVRGNPEESFPPDVVAGIHMH
FT                   RRIDVLTDNLPEVREAREWFRSETRRVAPITLDVMWDHFLSRHWSQLSPDFPLQEFVCY
FT                   AREQVMTILPDSPPRFINLNNYLWSEQWLVRYRDMDFIQNVLNGMASRRPRLDALRDSW
FT                   YDLDAHYAALETRFWQFYPRMMAQASRKAL"
FT   gene            528325..529395
FT                   /gene="queA"
FT                   /locus_tag="G2583_0514"
FT   CDS_pept        528325..529395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="G2583_0514"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55143"
FT                   /db_xref="GOA:D3QJH3"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJH3"
FT                   /protein_id="ADD55143.1"
FT                   /translation="MRVTDFSFELPESLIAHYPMPERSSCRLLSLDGPTGALTHGTFTD
FT                   LLDKLNPGDLLVFNNTRVIPARLFGRKASGGKIEVLVERMLDDKRILAHIRASKAPKPG
FT                   AELLLGDDESINATMTARHGALFEVEFNDERSVLDILNSIGHMPLPPYIDRPDEDADRE
FT                   LYQTVYSEKPGAVAAPTAGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIED
FT                   HIMHSEYAEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKNDLIEPFFDDTQ
FT                   IFIYPGFQYKVVDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYGDA
FT                   MFITYNPQAINERVGE"
FT   gene            529450..530577
FT                   /gene="tgt"
FT                   /locus_tag="G2583_0515"
FT   CDS_pept        529450..530577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="G2583_0515"
FT                   /product="Queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55144"
FT                   /db_xref="GOA:D3QJH4"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJH4"
FT                   /protein_id="ADD55144.1"
FT                   /translation="MKFELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEE
FT                   VEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIRKI
FT                   TEQGVHFRNPINGDPIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSL
FT                   RWAKRSRERFDSLGNKNALFGIIQGSVYEDLRDISVKGLVDIGFDGYAVGGLAVGEPKA
FT                   DMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTD
FT                   GVVKIRNAKYKSDTGPLDPECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQR
FT                   LMAGLRKAIEEGKLESFVTDFYQRQGREVPPLNVD"
FT   gene            530600..530932
FT                   /gene="yajC"
FT                   /locus_tag="G2583_0516"
FT   CDS_pept        530600..530932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="G2583_0516"
FT                   /product="UPF0092 membrane protein yajC"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55145"
FT                   /db_xref="GOA:D3QJH5"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJH5"
FT                   /protein_id="ADD55145.1"
FT                   /translation="MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKR
FT                   TKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPK
FT                   GTMKAL"
FT   gene            530960..532807
FT                   /gene="secD"
FT                   /locus_tag="G2583_0517"
FT   CDS_pept        530960..532807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="G2583_0517"
FT                   /product="Protein-export membrane protein secD"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55146"
FT                   /db_xref="GOA:D3QJH6"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJH6"
FT                   /protein_id="ADD55146.1"
FT                   /translation="MLNRYPLWKYVMLIVVIVIGLLYALPNLFGEDPAVQITGARGVAA
FT                   SEQTLIQVQKTLQEEKITAKSVALEEGAILARFDSTDTQLRAREALMGVMGDKYVVALN
FT                   LAPATPRWLAAIHAEPMKLGLDLRGGVHFLMEVDMDTALGKLQEQNIDSLRSDLREKGI
FT                   PYTTVRKENNYGLSITFRDAKARDEAIAYLSKRHPDLVISSQGSNQLRAVMSDARLSEA
FT                   REYAVQQNINILRNRVNQLGVAEPVVQRQGADRIVVELPGIQDTARAKEILGATATLEF
FT                   RLVNTNVDQAAAASGRVPGDSEVKQTREGQPVVLYKRVILTGDHITDSTSSQDEYNQPQ
FT                   VNISLDSAGGNIMSNFTKDNIGKPMATLFVEYKDSGKKDANGRAVLVKQEEVINIANIQ
FT                   SRLGNSFRITGINNPNEARQLSLLLRAGALIAPIQIVEERTIGPTLGMQNIEQGLEACL
FT                   AGLLVSILFMIIFYKKFGLIATSALIANLILIVGIMSLLPGATLSMPGIAGIVLTLAVA
FT                   VDANVLINERIKEELSNGRTVQQAIDEGYRGAFSSIFDANITTLIKVIILYAVGTGAIK
FT                   GFAITTGIGVATSMFTAIVGTRAIVNLLYGGKRVKKLSI"
FT   gene            532818..533789
FT                   /gene="secF"
FT                   /locus_tag="G2583_0518"
FT   CDS_pept        532818..533789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="G2583_0518"
FT                   /product="Protein-export membrane protein SecF"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55147"
FT                   /db_xref="GOA:D3QJH7"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJH7"
FT                   /protein_id="ADD55147.1"
FT                   /translation="MAQEYTVEQLNHGRKVYDFMRWDYWAFGISGLLLIAAIVIMGVRG
FT                   FNWGLDFTGGTVIEITLEKPAEIDVMRDALQKAGFEEPMLQNFGSSHDIMVRMPPAEGE
FT                   TGGQVLGSQVLKVINESTNQNAAVKRIEFVGPSVGADLAQTGAMALMAALLSILVYVGF
FT                   RFEWRLAAGVVIALAHDVIITLGILSLFHIEIDLTIVASLMSVIGYSLNDSIVVSDRIR
FT                   ENFRKIRRGTPYEIFNVSLTQTLHRTLITSGTTLMVILMLYLFGGPVLEGFSLTMLIGV
FT                   SIGTASSIYVASALALKLGMKREHMLQQKVEKEGADQPSILP"
FT   gene            533941..534183
FT                   /locus_tag="G2583_0519"
FT   CDS_pept        533941..534183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0519"
FT                   /product="UPF0156 protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55148"
FT                   /db_xref="GOA:D3QJH8"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJH8"
FT                   /protein_id="ADD55148.1"
FT                   /translation="MRKITSVSVGEQLDSFITRMVQSGRYGSASEVMRSALRLLEQQES
FT                   RDEAVRNAVIEGLESGESSMTLRDIAAERKQKHRV"
FT   gene            534176..534457
FT                   /locus_tag="G2583_0520"
FT   CDS_pept        534176..534457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0520"
FT                   /product="Plasmid stabilization system protein, RelE/ParE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55149"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJH9"
FT                   /protein_id="ADD55149.1"
FT                   /translation="MYKLSGKAVEDFRGIYDYTLGKFGDEQADRYTDSLGTFLDTLSQM
FT                   PEIGQDYDAIPEVKKIAFRFHTVYYVIRVDDILIARILHQLMEPRRHW"
FT   gene            534545..534892
FT                   /gene="yajD"
FT                   /locus_tag="G2583_0521"
FT   CDS_pept        534545..534892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajD"
FT                   /locus_tag="G2583_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55150"
FT                   /db_xref="GOA:D3QJI0"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJI0"
FT                   /protein_id="ADD55150.1"
FT                   /translation="MAIIPKNYARLESGYREKALKIYPWVCGRCSREFVYSNLRELTVH
FT                   HIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGTTVIAGEDAQKDVGEAKYNPF
FT                   ADLKAMMNKKK"
FT   gene            complement(535069..535953)
FT                   /gene="tsx"
FT                   /locus_tag="G2583_0522"
FT   CDS_pept        complement(535069..535953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsx"
FT                   /locus_tag="G2583_0522"
FT                   /product="Nucleoside-specific channel-forming protein, Tsx"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55151"
FT                   /db_xref="GOA:D3QJI1"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJI1"
FT                   /protein_id="ADD55151.1"
FT                   /translation="MKKTLLAAGAVLALSSSFTVNAAENDKPQYLSDWWHQSVNVVGSY
FT                   HTRFGPQIRNDTYLEYEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEP
FT                   RFSIDKLTNTDLSFGPFKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSM
FT                   NVYAKYQWQNYGAANENEWDGYRFKIKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSG
FT                   NAINGIKTRTNNSIASSHILALNYDHWHYSVVARYWHDGGQWNDDAELNFGNGNFNVRS
FT                   TGWGGYLVVGYNF"
FT   gene            complement(536252..536791)
FT                   /gene="yajI"
FT                   /locus_tag="G2583_0523"
FT   CDS_pept        complement(536252..536791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajI"
FT                   /locus_tag="G2583_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55152"
FT                   /db_xref="InterPro:IPR021658"
FT                   /db_xref="InterPro:IPR037125"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJI2"
FT                   /protein_id="ADD55152.1"
FT                   /translation="MNINVFRLILLGSLFSLSACVQQSEVRQMKHSVSTLNQEMTQLNQ
FT                   ETVKITQQNRLNAKSSSGVYLLPGAKTPARLESQIGTLRMSLVNITPDTDGTTLTLRIQ
FT                   GESNDPLPAFSGTVEYGQIQGTIDNFQEINVQNQLINAPASVLAPSDVDIPLQLKGISV
FT                   DQLGFVRIHDIQPVMQ"
FT   gene            536942..537391
FT                   /gene="nrdR"
FT                   /locus_tag="G2583_0524"
FT   CDS_pept        536942..537391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdR"
FT                   /locus_tag="G2583_0524"
FT                   /product="ATP-cone domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55153"
FT                   /db_xref="GOA:D3QJI3"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJI3"
FT                   /protein_id="ADD55153.1"
FT                   /translation="MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAE
FT                   LVMPRVVKSNDVREPFNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATGEREVP
FT                   SKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKEFGEEIARLED"
FT   gene            537395..538498
FT                   /gene="ribD"
FT                   /locus_tag="G2583_0525"
FT   CDS_pept        537395..538498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="G2583_0525"
FT                   /product="Bifunctional deaminase-reductase,
FT                   C-terminal:Riboflavin biosynthesis protein RibD"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55154"
FT                   /db_xref="GOA:D3QJI4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJI4"
FT                   /protein_id="ADD55154.1"
FT                   /translation="MQDEYYMARALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQR
FT                   AGEPHAEVHALRMAGEKAKGATAYVTLEPCSHHGRTPPCCDALIAAGVARVVAAMQDPN
FT                   PQVAGRGLYRLQQAGIDVSHGLMMSEAEQLNKGFLKRMRTGFPYIQLKLGASLDGRTAM
FT                   ASGESQWITSPQARRDVQRLRAQSHAILTSSATVLADDPALTVRWSELDVQTQALYPQH
FT                   HLRQPVRIVIDSQNRVTPEHHIVQQPGETWFARTQEDSREWPETVRTLLIPEHKGHLDL
FT                   VVLMMQLGKQQINSIWVEAGPTLAGALLQAGLVDELIVYIAPKLLGSDARGLCTLPGLE
FT                   KLADAPQFKFKEIRHVGPDVCLHLVGA"
FT   gene            538587..539057
FT                   /gene="ribE"
FT                   /locus_tag="G2583_0526"
FT   CDS_pept        538587..539057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="G2583_0526"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55155"
FT                   /db_xref="GOA:D3QJI5"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJI5"
FT                   /protein_id="ADD55155.1"
FT                   /translation="MNIIEANVATPDARVAITIARFNNFINDSLLEGAIDALKRIGQVK
FT                   DENITVVWVPGAYELPLAAGALAKTGKYDAVIALGTVIRGGTAHFEYVAGGASNGLAHV
FT                   AQDSEIPVAFGVLTTESIEQAIERAGTKAGNKGAEAALTALEMINVLKAIKA"
FT   gene            539077..539496
FT                   /gene="nusB"
FT                   /locus_tag="G2583_0527"
FT   CDS_pept        539077..539496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="G2583_0527"
FT                   /product="N utilization substance protein B-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55156"
FT                   /db_xref="GOA:D3QJI6"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJI6"
FT                   /protein_id="ADD55156.1"
FT                   /translation="MKPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDV
FT                   LYFRELLAGVATNTAYLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVAI
FT                   NEAIELAKSFGAEDSHKFVNGVLDKAAPVIRPNKK"
FT   gene            539574..540551
FT                   /gene="thiL"
FT                   /locus_tag="G2583_0528"
FT   CDS_pept        539574..540551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="G2583_0528"
FT                   /product="Thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55157"
FT                   /db_xref="GOA:D3QJI7"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJI7"
FT                   /protein_id="ADD55157.1"
FT                   /translation="MACGEFSLIARYFDRVRSSRLDVELGIGDDCALLNIPEKQTLAIS
FT                   TDTLVAGNHFLPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPDVDEAWLESFS
FT                   DSLFDLLNYYDMQLIGGDTTRGPLSMTLGIHGFVPMGRALTRSGAKPGDWIYVTGTPGD
FT                   SAAGLAILQNRLQVADAKDADYLIKRHLRPSPRILQGQALRDLASSAIDLSDGLISDLG
FT                   HIVKASDCGARIDLALLPFSDALSRHVVPEQALRWALSGGEDYELCFTVPELNRGALDV
FT                   ALGHLGVPFTCIGQMTADIEGLCFIRDGEPVTLDWKGYDHFATP"
FT   gene            540529..541044
FT                   /gene="pgpA"
FT                   /locus_tag="G2583_0529"
FT   CDS_pept        540529..541044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="G2583_0529"
FT                   /product="Phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55158"
FT                   /db_xref="GOA:D3QJI8"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJI8"
FT                   /protein_id="ADD55158.1"
FT                   /translation="MTILPRHKDVAKSRLKMSNPWHLLAVGFGSGLSPIVPGTMGSLAA
FT                   IPFWYLMTFLPWQLYSLVVMLGICIGVYLCHQTAKDMGVHDHGSIVWDEFIGMWITLMA
FT                   LPTNDWQWVAAGFVIFRILDMWKPWPIRWFDRNVHGGMGIMIDDIVAGVISAGILYFIG
FT                   HHWPLGIL"
FT   gene            complement(541222..542793)
FT                   /locus_tag="G2583_0530"
FT   CDS_pept        complement(541222..542793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55159"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJI9"
FT                   /protein_id="ADD55159.1"
FT                   /translation="MMKTITKQPILFTDVPVADLRNSMKQDLNQNLIERLWNKIRDFFL
FT                   DSDKQKAFKSIHKYINTLSVLNYNSALTPDPNFNIDATSDLDSYLKLDFDRLSPKQKQT
FT                   TLCCFWNKIASSLPEPYNSTIKHNIIFYKDGENLMIRGTISIVNEVVKTYSLPIEKDDN
FT                   GYYDFSGLYLAHSNISGKDPNKDPDIDFGIDMGNCNCSNVNFEHTYFYGVKFTNANCTN
FT                   ANFNNCRFKKCDLTNMNCTGAILDNAMIYGKEKEPEMQYPEADQIIQRITYQKSDGNET
FT                   KGMILTNCSCVKTTFNWADLSESDCQNVDFSEANLSNTILPDIVRMKGTKLYRTDLFNP
FT                   ILKTEAESTEEKDISPLAKIILDYIESDKNPESLNFEEKSTVIKIKQDIDNFIFYNQHL
FT                   KKIFNRAMNLQGKISRKKYNEFFKYIQAEAKQYFKDQYKLTKNDYLKKVPLTAQLIAKY
FT                   KMDDQLDQLLVTREIQDEIKSKIQDKIDELSKNLFNTMTETIENNFDDIFRQQSENMSN
FT                   YYEFVD"
FT   gene            complement(543024..543998)
FT                   /gene="yajO"
FT                   /locus_tag="G2583_0531"
FT   CDS_pept        complement(543024..543998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajO"
FT                   /locus_tag="G2583_0531"
FT                   /product="Oxidoreductase, aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55160"
FT                   /db_xref="GOA:D3QJJ0"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJJ0"
FT                   /protein_id="ADD55160.1"
FT                   /translation="MQYNPLGKTDLRVSRLCLGCMTFGEPDRGNHAWTLPEESSRPIIK
FT                   RALEGGINFFDTANSYSDGSSEEIVGRALRDFSRREDVVVATKVFHRVGDLPEGLSRAQ
FT                   ILRSIDDSLRRLGMDYVDILQIHRWDYNTPIEETLEALNDVVKAGKARYIGASSMHASQ
FT                   FAQALELQKQHGWAQFVSMQDHYNLIYREEEREMLPLCYQEGVAVIPWSPLARGRLTRP
FT                   WGETTARLVSDEVGKNLYKESDENDAQIAERLTGVSEELGATRAQVALAWLLSKPGIAA
FT                   PIIGTSREEQLDELLNAVDITLKPEQIAELETPYKPHPVVGFK"
FT   gene            complement(544053..545915)
FT                   /gene="dxs"
FT                   /locus_tag="G2583_0532"
FT   CDS_pept        complement(544053..545915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="G2583_0532"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55161"
FT                   /db_xref="GOA:D3QJJ1"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJJ1"
FT                   /protein_id="ADD55161.1"
FT                   /translation="MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSR
FT                   SSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGL
FT                   HPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEA
FT                   MNHAGDIRPDMLVVLNDNEMSISENVGALNNHLAQLLSGKLYSSLREGGKKVFSGVPPI
FT                   KELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLKGPQFLHIM
FT                   TKKGRGYEPAEKDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLM
FT                   AITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRA
FT                   YDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECR
FT                   QMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGIVKRRGEKLAILNFGTLMPE
FT                   AAKVAESLNATLVDMRFVKPLDETLILEMAASHEALVTVEENAIMGGAGSGVNEVLMAH
FT                   RKPVPVLNIGLPDFFIPQGTQEEMRAELGLDAAGMEAKIKAWLA"
FT   gene            complement(545940..546839)
FT                   /gene="ispA"
FT                   /locus_tag="G2583_0533"
FT   CDS_pept        complement(545940..546839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="G2583_0533"
FT                   /product="Geranyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55162"
FT                   /db_xref="GOA:D3QJJ2"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJJ2"
FT                   /protein_id="ADD55162.1"
FT                   /translation="MDFPQQLEACVKQANQALSRFIAPLPFQNTPVVETMQYGALLGGK
FT                   RLRPFLVYATGHMFGVSTNTLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVK
FT                   FGEANAILAGDALQTLAFSILSDADMPEVSDRDRISMISELASASGIAGMCGGQALDLD
FT                   AEGKHVPLDALERIHRHKTGALIRAAVRLGALSAGDKGRRALPVLDKYAESIGLAFQVQ
FT                   DDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARKKAQDLIDDARQSLKQLAEQS
FT                   IDTSALEALADYIIQRNK"
FT   gene            complement(546839..547081)
FT                   /gene="xseB"
FT                   /locus_tag="G2583_0534"
FT   CDS_pept        complement(546839..547081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="G2583_0534"
FT                   /product="Exodeoxyribonuclease 7 small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55163"
FT                   /db_xref="GOA:D3QJJ3"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJJ3"
FT                   /protein_id="ADD55163.1"
FT                   /translation="MPKKNEAPASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQL
FT                   ARQGQAKLQQAEQRVQILLSDNEDASLTPFTPDNE"
FT   gene            547287..548735
FT                   /gene="thiI"
FT                   /locus_tag="G2583_0535"
FT   CDS_pept        547287..548735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiI"
FT                   /locus_tag="G2583_0535"
FT                   /product="Thiamine biosynthesis protein thiI"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55164"
FT                   /db_xref="GOA:D3QJJ4"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR026340"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJJ4"
FT                   /protein_id="ADD55164.1"
FT                   /translation="MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVVR
FT                   HWDNIEVRAKDENQRLTIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALVQYRDQLDG
FT                   KTFCVRVKRRGKHDFSSIDVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLLIK
FT                   GRYEGIGGFPIGTQEDVLSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVRQ
FT                   VAHYLWNRFGSSHRVRFVAINFEPVVGEILEKIDDGQMGVILKRMMVRAASKVAERYGV
FT                   QALVTGEALGQVSSQTLTNLRLIDNVSDTLILRPLISYDKEHIINLARQIGTEDFARTM
FT                   PEYCGVISKSPTVKAVKSKIEAEEEKFDFSILDKVVEEANNVDIREIAQQTEQEVVEVE
FT                   TVNDFGPNDVILDIRSVDEQEDKPLKVEGIDVVSLPFYKLSTKFGDLDQNRTWLLWCER
FT                   GVMSRLQALYLREQGFKNVKVYRP"
FT   gene            complement(548789..549385)
FT                   /gene="yajL"
FT                   /locus_tag="G2583_0536"
FT   CDS_pept        complement(548789..549385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajL"
FT                   /locus_tag="G2583_0536"
FT                   /product="4-methyl-5(Beta-hydroxyethyl)-thiazole
FT                   monophosphate synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55165"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJJ5"
FT                   /protein_id="ADD55165.1"
FT                   /translation="MNMSASALVCLAPGSEETEAVTTIDLLIRGGIKVTTASVASDGNL
FT                   AITCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECFRDSTLLVETVKQFHRSGRIV
FT                   AAICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWQDKRVVWDARVKLLTSQGPGTA
FT                   IDFGLKIIDLLVGREKAHEVASQLVMAAGIYNYYE"
FT   gene            complement(549342..550253)
FT                   /gene="panE"
FT                   /locus_tag="G2583_0537"
FT   CDS_pept        complement(549342..550253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panE"
FT                   /locus_tag="G2583_0537"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55166"
FT                   /db_xref="GOA:D3QJJ6"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJJ6"
FT                   /protein_id="ADD55166.1"
FT                   /translation="MKITVLGCGALGQLWLTALCKQGHEVQGWLRVPQPYCSVNLVETD
FT                   GSIFNESLTANDPDFLATSDLLLVTLKAWQVSDAVKSLASTLPVTTPILLIHNGMGTIE
FT                   ELQNIQQPLLMGTTTHAACRDGNVIIHVANGITHIGPARQQDGDYSYLADILQTVLPDV
FT                   AWHNNIRAELWRKLAVNCVINPLTAIWNCPNGELRHHPQEIMQICEEVAAVIEREGHHT
FT                   SAEDLRDYVMQVIDATAENISSMLQDIRALRHTEIDYINGFLLRRARAHGIAVPENTRL
FT                   FEMVKRKESEYERIGTGLPRPW"
FT   gene            550421..550912
FT                   /gene="yajQ"
FT                   /locus_tag="G2583_0538"
FT   CDS_pept        550421..550912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="G2583_0538"
FT                   /product="UPF0234 protein yajQ"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55167"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJJ7"
FT                   /protein_id="ADD55167.1"
FT                   /translation="MPSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEASFELNDAS
FT                   KTIKVLSESDFQVNQLLDILRAKLLKRGIEGSSLDVPENIVHSGKTWFVEAKLKQGIES
FT                   ATQKKIVKMIKDSKLKVQAQIQGDEIRVTGKSRDDLQAVMAMVRGGDLGQPFQFKNFRD
FT                   "
FT   gene            complement(551040..552410)
FT                   /gene="yajR"
FT                   /locus_tag="G2583_0539"
FT   CDS_pept        complement(551040..552410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajR"
FT                   /locus_tag="G2583_0539"
FT                   /product="Hypothetical transport protein YajR"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55168"
FT                   /db_xref="GOA:D3QJJ8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJJ8"
FT                   /protein_id="ADD55168.1"
FT                   /translation="MVMNDYKMTPGERRATWGLGTVFSLRMLGMFMVLPVLTTYGMALQ
FT                   GASEALIGIAIGIYGLTQAVFQIPFGLLSDRIGRKPLIVGGLAVFAAGSVIAALSDSIW
FT                   GIILGRALQGSGAIAAAVMALLSDLTREQNRTKAMAFIGVSFGITFAIAMVLGPIITHK
FT                   LGLHALFWMIAILATTGIALTIWVVPNSSTHVLNRESGMVKGSFSKVLAEPRLLKLNFG
FT                   IMCLHILLMSTFVALPGQLADAGFPAAEHWKVYLATMLIAFGSVVPFIIYAEVKRKMKQ
FT                   VFVFCVGLIVVAEIVLRNAQTQFWQLVVGVQLFFVAFNLMEALLPSLISKESPAGYKGT
FT                   AMGVYSTSQFLGVAIGGSLGGWIDGMFDGQGVFLAGAMLAAVWLAVASTMKEPPYVSSL
FT                   RIEIPANIAANEALKVRLLETEGIKEVLIAEEEHSAYVKIDSKVTNRFDVEQAIRQA"
FT   gene            complement(552553..553443)
FT                   /gene="cyoE"
FT                   /locus_tag="G2583_0540"
FT   CDS_pept        complement(552553..553443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="G2583_0540"
FT                   /product="Protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55169"
FT                   /db_xref="GOA:D3QJJ9"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJJ9"
FT                   /protein_id="ADD55169.1"
FT                   /translation="MMFKQYLQVTKPGIIFGNLISVIGGFLLASKGSIDYPLFIYTLVG
FT                   VSLVVASGCVFNNYIDRDIDRKMERTKNRVLVKGLISPAVSLVYATLLGIAGFMLLWFG
FT                   ANPLACWLGVMGFVVYVGVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGEFDSGAA
FT                   ILLAIFSLWQMPHSYAIAIFRFKDYQAANIPVLPVVKGISVAKNHITLYIIAFAVATLM
FT                   LSLGGYAGYKYLVVAAAVSVWWLGMALRGYKVADDRIWARKLFGFSIIAITALSVMMSV
FT                   DFMVPDSHTLLAAVW"
FT   gene            complement(553455..553784)
FT                   /gene="cyoD"
FT                   /locus_tag="G2583_0541"
FT   CDS_pept        complement(553455..553784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="G2583_0541"
FT                   /product="Cytochrome O ubiquinol oxidase protein CyoD"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55170"
FT                   /db_xref="GOA:D3QJK0"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJK0"
FT                   /protein_id="ADD55170.1"
FT                   /translation="MSHSTDHSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAASPAV
FT                   ILGTILAMAVVQVLVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNY
FT                   NMMMH"
FT   gene            complement(553784..554398)
FT                   /gene="cyoC"
FT                   /locus_tag="G2583_0542"
FT   CDS_pept        complement(553784..554398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="G2583_0542"
FT                   /product="Cytochrome o ubiquinol oxidase subunit 3"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55171"
FT                   /db_xref="GOA:D3QJK1"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJK1"
FT                   /protein_id="ADD55171.1"
FT                   /translation="MATDTLTHATVHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFA
FT                   TYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLAL
FT                   TWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQ
FT                   IARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGAM"
FT   gene            complement(554388..556379)
FT                   /gene="cyoB"
FT                   /locus_tag="G2583_0543"
FT   CDS_pept        complement(554388..556379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="G2583_0543"
FT                   /product="Ubiquinol oxidase subunit 1 (Ubiquinol oxidase
FT                   polypeptide I) (Cytochrome o subunit 1) (Oxidase BO(3)
FT                   subunit 1)"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55172"
FT                   /db_xref="GOA:D3QJK2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJK2"
FT                   /protein_id="ADD55172.1"
FT                   /translation="MFGKLSLDAVPFHEPIVMVTIAGIILGGLALVGLITYFGKWTYLW
FT                   KEWLTSVDHKRLGIMYIIVAIVMLLRGFADAIMMRSQQALASAGEAGFLPPHHYDQIFT
FT                   AHGVIMIFFVAMPFVIGLMNLVVPLQIGARDVAFPFLNNLSFWFTVVGVILVNVSLGVG
FT                   EFAQTGWLAYPPLSGIEYSPGVGVDYWIWSLQLSGIGTTLTGINFFVTILKMRAPGMTM
FT                   FKMPVFTWASLCANVLIIASFPILTVTVALLTLDRYLGTHFFTNDMGGNMMMYINLIWA
FT                   WGHPEVYILILPVFGVFSEIAATFSRKRLFGYTSLVWATVCITVLSFIVWLHHFFTMGA
FT                   GANVNAFFGITTMIIAIPTGVKIFNWLFTMYQGRIVFHSAMLWTIGFIVTFSVGGMTGV
FT                   LLAVPGADFVLHNSLFLIAHFHNVIIGGVVFGCFAGMTYWWPKAFGFKLNETWGKRAFW
FT                   FWIIGFFVAFMPLYALGFMGMTRRLSQQIDPQFHTMLMIAASGAVLIALGILCLVIQMY
FT                   VSIRDRDQNRDLTGDPWGGRTLEWATSSPPPFYNFAVVPHVHERDAFWEMKEKGEAYKK
FT                   PDHYEEIHMPKNSGAGIVIAAFSTIFGFAMIWHIWWLAIVGFAGMIITWIVKSFDEDVD
FT                   YYVPVAEIEKLENQHFDEITKAGLKNGN"
FT   gene            complement(556401..557348)
FT                   /gene="cyoA"
FT                   /locus_tag="G2583_0544"
FT   CDS_pept        complement(556401..557348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="G2583_0544"
FT                   /product="Cytochrome o ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55173"
FT                   /db_xref="GOA:D3QJK3"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJK3"
FT                   /protein_id="ADD55173.1"
FT                   /translation="MRLRKYNKSLGWLSLFAGTVLLSGCNSALLDPKGQIGLEQRSLIL
FT                   TAFGLMLIVVIPAILMAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIIIFLA
FT                   VLTWKTTHALEPSKPLAHDEKPITIEVVSMDWKWFFIYPEQGFATVNEIAFPANTPVYF
FT                   KVTSNSVMNSFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGMKFKA
FT                   IATPDRAAFDQWVAKAKQSPNSMSDMAAFEKLAAPSEYNQVEYFSNVKPDLFADVINKF
FT                   MAHGKSMDMTQPEGEHSAHEGMEGMDMSHAESAH"
FT   gene            complement(557808..559283)
FT                   /gene="ampG"
FT                   /locus_tag="G2583_0545"
FT   CDS_pept        complement(557808..559283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG"
FT                   /locus_tag="G2583_0545"
FT                   /product="Regulates beta-lactamase synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55174"
FT                   /db_xref="GOA:D3QJK4"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJK4"
FT                   /protein_id="ADD55174.1"
FT                   /translation="MSSQYLRIFQQPRSAILLILGFASGLPLALTSGTLQAWMTVENID
FT                   LKTIGFFSLVGQAYVFKFLWSPLMDRYTPPFFGRRRGWLLATQILLLVAIAAMGFLEPG
FT                   TQLRWMAALAVVIAFCSASQDIVFDAWKTDVLPAEERGAGAAISVLGYRLGMLVSGGLA
FT                   LWLADKWLGWQGMYWLMAALLIPCIIATLLAPEPTDTIPVPKTLEQAVVAPLRDFFGRN
FT                   NAWLILLLIVLYKLGDAFAMSLTTTFLIRGVGFDAGEVGVVNKTLGLLATIVGALYGGI
FT                   LMQRLSLFRALLIFGILQGASNAGYWLLSITDKHLYSMGAAVFFENLCGGMGTSAFVAL
FT                   LMTLCNKSFSATQFALLSALSAVGRVYVGPVAGWFVEAHGWSTFYLFSVAAAVPGLILL
FT                   LVCRQTLEYTRVNDNFISRTAYPAGYAFAMWTLAAGVSLLAVWLLLLTMDALDLTHFSF
FT                   LPALLEVGVLVALSGVVLGGLLDYLALRKTHLT"
FT   gene            complement(559327..559905)
FT                   /gene="yajG"
FT                   /locus_tag="G2583_0546"
FT   CDS_pept        complement(559327..559905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajG"
FT                   /locus_tag="G2583_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55175"
FT                   /db_xref="InterPro:IPR005619"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJK5"
FT                   /protein_id="ADD55175.1"
FT                   /translation="MFKKILFPLVALFMLAGCARPPTTIEVSPTITLPQQDPSLMGVTV
FT                   SINGADQRTDQALAKVTRDNQIVTLTASRDLRFLLQEVLEKQMTARGYMVGPNGPVNLQ
FT                   IIVSQLYADVSQGNVRYNIATKADIAIIATAQNGNKMTKNYRASYNVEGAFQASNKNIA
FT                   DAVNSVLTDTIADMSQDTSIHEFIKQNAR"
FT   gene            560210..560527
FT                   /gene="bolA"
FT                   /locus_tag="G2583_0547"
FT   CDS_pept        560210..560527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bolA"
FT                   /locus_tag="G2583_0547"
FT                   /product="transcriptional regulator BolA"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55176"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJK6"
FT                   /protein_id="ADD55176.1"
FT                   /translation="MMIRERIEEKLRAAFQPVFLEVVDESYRHNVPAGSESHFKVVLVS
FT                   DRFTGERFLNRHRMIYSTLAEELSTTVHALALHTYTIKEWEGLQDTVFASPPCRGAGSI
FT                   A"
FT   gene            560871..562169
FT                   /gene="tig"
FT                   /locus_tag="G2583_0548"
FT   CDS_pept        560871..562169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="G2583_0548"
FT                   /product="Trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55177"
FT                   /db_xref="GOA:D3QJK7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJK7"
FT                   /protein_id="ADD55177.1"
FT                   /translation="MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFR
FT                   KGKVPMNIVAQRYGASVRQDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEYKLGEDFT
FT                   YSVEFEVYPEVELQGLEAIEVEKPIVEVTDADVDGMLDTLRKQQATWKEKDGAVEAEDR
FT                   VTIDFTGSVDGEEFEGGKASDFVLAMGQGRMIPGFEDGIKGHKAGEEFTIDVTFPEEYH
FT                   AENLKGKAAKFAINLKKVEERELPELTAEFIKRFGVEDGSVEGLRAEVRKNMERELKSA
FT                   IRNRVKSQAIEGLVKANDIDVPAALIDSEIDVLRRQAAQRFGGNEKQALELPRELFEEQ
FT                   AKRRVVVGLLLGEVIRTNELKADEERVKGLIEEMASAYEDPKEVIEFYSKNKELMDNMR
FT                   NVALEEQAVEAVLAKAKVTEKETTFNELMNQQA"
FT   gene            562415..563038
FT                   /gene="clpP"
FT                   /locus_tag="G2583_0549"
FT   CDS_pept        562415..563038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="G2583_0549"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55178"
FT                   /db_xref="GOA:D3QJK8"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJK8"
FT                   /protein_id="ADD55178.1"
FT                   /translation="MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFL
FT                   TGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTI
FT                   CMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRM
FT                   NELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN"
FT   gene            563164..564438
FT                   /gene="clpX"
FT                   /locus_tag="G2583_0550"
FT   CDS_pept        563164..564438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="G2583_0550"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   clpX"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55179"
FT                   /db_xref="GOA:D3QJK9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJK9"
FT                   /protein_id="ADD55179.1"
FT                   /translation="MTDKRKDGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCN
FT                   DIIREEIKEVAPHRERSALPTPHEIRNHLDDYVIGQEQAKKVLAVAVYNHYKRLRNGDT
FT                   SNGVELGKSNILLIGPTGSGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQ
FT                   KLLQKCDYDVQKAQRGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVAAV
FT                   PPQGGRKHPQQEFLQVDTSKILFICGGAFAGLDKVISHRVETGSGIGFGATVKAKSDKA
FT                   SEGELLAQVEPEDLIKFGLIPEFIGRLPVVATLNELSEEALIQILKEPKNALTKQYQAL
FT                   FNLEGVDLEFRDEALDAIAKKAMARKTGARGLRSIVEAALLDTMYDLPSMEDVEKVVID
FT                   ESVIDGQSKPLLIYGKPEAQQASGE"
FT   gene            564581..566980
FT                   /gene="lon"
FT                   /locus_tag="G2583_0551"
FT   CDS_pept        564581..566980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="G2583_0551"
FT                   /product="DNA-binding ATP-dependent protease La"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55180"
FT                   /db_xref="GOA:D3QJL0"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJL0"
FT                   /protein_id="ADD55180.1"
FT                   /translation="MSSDYLAEIKLRESSMNPERSERIEIPVLPLRDVVVYPHMVIPLF
FT                   VGREKSIRCLEAAMDHDKKIMLVAQKEASTDEPGVNDLFTVGTVASILQMLKLPDGTVK
FT                   VLVEGLQRARISALSDNGEHFSAKAEYLESPTIDEREQEVLVRTAISQFEGYIKLNKKI
FT                   PPEVLTSLNSIDDPARLADTIAAHMPLKLADKQSVLEMSDVNERLEYLMAMMESEIDLL
FT                   QVEKRIRNRVKKQMEKSQREYYLNEQMKAIQKELGEMDDAPDENEALKRKIDAAKMPKE
FT                   AKEKAEAELQKLKMMSPMSAEATVVRGYIDWMVQVPWNARSKVKKDLRQAQEILDTDHY
FT                   GLERVKDRILEYLAVQSRVNKIKGPILCLVGPPGVGKTSLGQSIAKATGRKYVRMALGG
FT                   VRDEAEIRGHRRTYIGSMPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPASALLEV
FT                   LDPEQNVAFSDHYLEVDYDLSDVMFVATSNSMNIPAPLLDRMEVIRLSGYTEDEKLNIA
FT                   KRHLLPKQIERNALKKGELTVDDSAIIGIIRYYTREAGVRGLEREISKLCRKAVKQLLL
FT                   DKSLKHIEINGDNLHDYLGVQRFDYGRADNENRVGQVTGLAWTEVGGDLLTIETACVPG
FT                   KGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPS
FT                   AGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPF
FT                   ENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEPSGMQVVTAK"
FT   gene            567189..567461
FT                   /gene="hupB"
FT                   /locus_tag="G2583_0552"
FT   CDS_pept        567189..567461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="G2583_0552"
FT                   /product="DNA-binding protein HU-beta"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55181"
FT                   /db_xref="GOA:D3QJL1"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJL1"
FT                   /protein_id="ADD55181.1"
FT                   /translation="MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALV
FT                   GFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN"
FT   gene            567653..569524
FT                   /gene="ppiD"
FT                   /locus_tag="G2583_0553"
FT   CDS_pept        567653..569524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiD"
FT                   /locus_tag="G2583_0553"
FT                   /product="Peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55182"
FT                   /db_xref="GOA:D3QJL2"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJL2"
FT                   /protein_id="ADD55182.1"
FT                   /translation="MMDSLRTAANSLVLKIIFGIIIVSFILTGVSGYLIGGGNNYAAKV
FT                   NDQEISRGQFENAFNSERNRMQQQLGDQYSELAANEGYMKTLRQQVLNRLIDEALLDQY
FT                   ARELKLGISDEQVKQAIFATPAFQVDGKFDNSRYNGILNQMGMTADQYAQALRNQLTTQ
FT                   QLINGVAGTDFMLKGETDELAALVAQQRVVREATIDVNALAAKQPVTEQEIASYYEQNK
FT                   NNFMTPEQFRVSYIKLDAATMQQPVSDADLQSYYDQHQDQFTQPQRTRYSIIQTKTEDE
FT                   AKAVLDELNKGGDFAALAKEKSADIISARNGGDMGWLEDATIPDELKNAGLKEKGQLSG
FT                   VIKSSVGFLIVRLDDIQPAKVKSLDEVRDDVAAKVKHEKALDAYYALQQKVSDAASNDT
FT                   ESLAGAEQAAGVKATQTGWFSKENLPEELNFKPVADAIFNGGLVGENGAPGINSDIITV
FT                   DGDLAFVLRISEHKPEAVKPLADVQEQVKALVQHNKAEQQAKVDAEKLLVDLKAGKGAE
FT                   AMQAAGLKFGEPKTLSRSGRDPISQAAFALPLPAKDKPSYGMATDMQGNVVLLALDEVK
FT                   QGSMPEDQKKAMVQGITQNNAQIVFEALMSNLRKEAKIKIGDALEQQ"
FT   gene            569675..570046
FT                   /gene="ybaV"
FT                   /locus_tag="G2583_0554"
FT   CDS_pept        569675..570046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaV"
FT                   /locus_tag="G2583_0554"
FT                   /product="Competence protein ComEA"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55183"
FT                   /db_xref="GOA:D3QJL3"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJL3"
FT                   /protein_id="ADD55183.1"
FT                   /translation="MKHGIKALLITLSLACAGMSHSALAAASVAKPTAVETKAEAPAAQ
FT                   NKAAVPAKASDEEGSRVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLK
FT                   QVPGMGNSLVERNLAVLTL"
FT   gene            570152..570550
FT                   /gene="ybaW"
FT                   /locus_tag="G2583_0555"
FT   CDS_pept        570152..570550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaW"
FT                   /locus_tag="G2583_0555"
FT                   /product="Thioesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55184"
FT                   /db_xref="GOA:D3QJL4"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJL4"
FT                   /protein_id="ADD55184.1"
FT                   /translation="MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWDGLENSDSFHWMT
FT                   AHNIAFVVVNININYRRPAVLSDLLTITSQLQQLNGKSGILSQVITLEPEGQVVADALI
FT                   TFVCIDLKTQKALALEGELREKLEQMVK"
FT   gene            complement(570602..571297)
FT                   /gene="queC"
FT                   /locus_tag="G2583_0556"
FT   CDS_pept        complement(570602..571297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queC"
FT                   /locus_tag="G2583_0556"
FT                   /product="Queuosine biosynthesis protein queC"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55185"
FT                   /db_xref="GOA:D3QJL5"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJL5"
FT                   /protein_id="ADD55185.1"
FT                   /translation="MKRAVVVFSGGQDSTTCLVQALQQYDEVHCVTFDYGQRHRAEIDV
FT                   ARELALKLGARAHKVLDVTLLNELAVSSLTRDSIPVPDYEPEADGIPNTFVPGRNILFL
FT                   TLAAIYAYQVKAEAVITGVCETDFSGYPDCRDEFVKVLNHAVSLGMAKDIRFETPLMWI
FT                   DKAETWALADYYGKLDLVRNETLTCYNGIKGDGCGHCAACNLRANGLNHYLADKPTVMA
FT                   AMKQKTGLK"
FT   gene            complement(571362..573077)
FT                   /gene="ybaE"
FT                   /locus_tag="G2583_0557"
FT   CDS_pept        complement(571362..573077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaE"
FT                   /locus_tag="G2583_0557"
FT                   /product="Bacterial extracellular solute-binding protein,
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55186"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJL6"
FT                   /protein_id="ADD55186.1"
FT                   /translation="MFRVFMRLLNRLNQYQRLWQPSAGKPQTVTVSELAERCFCSERHV
FT                   RTLLRQAQEAGWLEWQAQSGRGKRGQLRFLVTPESLRNAMMEKALETGKQQDVLELAQL
FT                   APGELRTLLQPFMGGQWQNDTPTLRIPYYRPLEPLQPGFLPGRAEQHLAGQIFSGLTRF
FT                   DNNTQRPIGDLAHHWETSADGLRWDFYLRSTLHWHNGDAVKASHLHQRLLMLLQLPALD
FT                   QLFISVKRIEVTHPQCLTFFLHRPDYWLAHRLASYCSHLAHPQFPLIGTGPFRLTQFTA
FT                   ELVRLESHDYYHLRHPLLKAVEYWITPPLFEKDLGTSCRHPVQITIGKPEELQRVSQVS
FT                   SGISLGFCYLTLRKSPRLSLWQARKVISIIHQSGLLQTLEVGENLITASHALLPGWTIP
FT                   HWQVPDEVKLPKTLTLVYHLPIELHTMAERLQATLAAEGCELTIIFHNAKNWDDTTLLA
FT                   HADLMMGDRLIGEAPEYTLEQWLRCDPLWPHVFDAPAYAHLQSTLDAVQVMPDEENRFN
FT                   ALKAVFSQLMTDATLTPLFNYHYRISAPPGVNGVRLTPRGWFEFTEAWLPAPSQ"
FT   gene            573150..573980
FT                   /gene="cof"
FT                   /locus_tag="G2583_0558"
FT   CDS_pept        573150..573980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cof"
FT                   /locus_tag="G2583_0558"
FT                   /product="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55187"
FT                   /db_xref="GOA:D3QJL7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023938"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJL7"
FT                   /protein_id="ADD55187.1"
FT                   /translation="MEKEMARLAAFDMDGTLLMPDHHLGEKTLSTLARLRERDITLTFA
FT                   TGRHALEMQHILGAISLDAYLITGNGTRVHSLEGELLHRDDLPADVAELVLYQQWDTRA
FT                   SMHIFNDDGWFTGKEIPALLQAFVYSGFRYQIIDVKKMPLGSVTKICFCGDHDDLTRLQ
FT                   IQLYEALGERAHLCFSATDCLEVLPVGCNKGAALTVLTQHLGLSLRDCMAFGDAMNDRE
FT                   MLGSVGSGFIMGNAMPQLRAELPHLPVIGHCRNQAVSHYLTHWLDYPHLPYSPE"
FT   gene            574006..574590
FT                   /gene="ybaO"
FT                   /locus_tag="G2583_0559"
FT   CDS_pept        574006..574590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaO"
FT                   /locus_tag="G2583_0559"
FT                   /product="Putative transcriptional regulator YbaO"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55188"
FT                   /db_xref="GOA:D3QJL8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJL8"
FT                   /protein_id="ADD55188.1"
FT                   /translation="MPGFFALNLSFCAVVFKPHRINCRDFTFKIELKEKKILRGRAMLD
FT                   KIDRKLLALLQQDCTLSLQALAEAVNLTTTPCWKRLKRLEDDGILIGKVALLDPEKIGL
FT                   GLTAFVLIKTQHHSSEWYCRFVTVVTEMPEVLGFWRMAGEYDYLMRVQVADMKRYDEFY
FT                   KRLVNSVPGLSDVTSSFAMEQIKYTTSLPIE"
FT   gene            574620..576392
FT                   /gene="mdlA"
FT                   /locus_tag="G2583_0560"
FT   CDS_pept        574620..576392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlA"
FT                   /locus_tag="G2583_0560"
FT                   /product="Multidrug resistance, ATP-binding protein mdlA"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55189"
FT                   /db_xref="GOA:D3QJL9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D3QJL9"
FT                   /protein_id="ADD55189.1"
FT                   /translation="MRLFAQLSWYFRREWRRYLGAVALLVIIAMLQLVPPKVVGIVVDG
FT                   VTEQHFTTGQILMWIATMVLIAVVVYLLRYVWRVLLFGASYQLAVELREDYYRQLSRQH
FT                   PEFYLRHRTGDLMARATNDVDRVVFAAGEGVLTLVDSLVMGCAVLIMMSTQISWQLTLF
FT                   ALLPMPVMAIMIKRNGDALHERFKLAQAAFSSLNDRTQESLTSIRMIKAFGLEDRQSAL
FT                   FAADAEDTGKKNMRVARIDARFDPTIYIAIGMANLLAIGGGSWMVVQGSLTLGQLTSFM
FT                   MYLGLMIWPMLALAWMFNIVERGSAAYSRIRAMLAEAPVVNDGSEPVPEGRGELDVNIH
FT                   QFTYPQTDHPALENVNFALKPGQMLGICGPTGSGKSTLLSLIQRHFDVSEGDIRFHDIP
FT                   LTKLQLDSWRSRLAVVSQTPFLFSDTVANNIALGCPNATQQEIEHVARLASVHDDILRL
FT                   PQGYDTEVGERGVMLSGGQKQRISIARALLVNAEILILDDALSAVDGRTEHQILHNLRQ
FT                   WGQGRTVIISAHRLSALTEASEIIVMQHGHIAQRGNHDVLAQQSGWYRDMYRYQQLEAA
FT                   LDDAPENREEAVDA"
FT   gene            576385..578166
FT                   /gene="mdlB"
FT                   /locus_tag="G2583_0561"
FT   CDS_pept        576385..578166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlB"
FT                   /locus_tag="G2583_0561"
FT                   /product="Multidrug resistance-like ATP-binding protein
FT                   mdlB"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55190"
FT                   /db_xref="GOA:D3QKD5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKD5"
FT                   /protein_id="ADD55190.1"
FT                   /translation="MRSFSQLWPTLKRLLAYGSPWRKPLGIAVLMMWVAAAAEVSGPLL
FT                   ISYFIDNMVAKNNLPLKVVAGLAAAYVGLQLFAAGLHYAQSLLFNRAAVGVVQQLRTDV
FT                   MDAALRQPLSEFDTQPVGQVISRVTNDTEVIRDLYVTVVATVLRSAALVGAMLVAMFSL
FT                   DWRMALVAIMIFPVVLVVMVIYQRYSTPIVRRVRAYMADINDGFNEIINGMSVIQQFRQ
FT                   QARFGERMGEASRSHYMARMQTLRLDGFLLRPLLSLFSSLILCGLLMLFGFSASGTIEV
FT                   GVLYAFISYLGRLNEPLIELTTQQAMLQQAVVAGERVFELMDGPRQQYGNDDRPLQSGT
FT                   IEVDNVSFAYRDDNLVLKNINLSVPSRNFVALVGHTGSGKSTLASLLMGYYPLTEGEIR
FT                   LDGRPLSSLSHSALRQGVAMVQQDPVVLADTFLANVTLGRDISEERVWQALETVQLAEL
FT                   ARSMSDGIYTPLGEQGNNLSVGQKQLLALARVLVETPQILILDEATASIDSGTEQAIQH
FT                   ALAAVREHTTLVVIAHRLSTIVDADTILVLHRGQAVEQGTHQQLLAAQGRYWQMYQLQL
FT                   AGEELAASVREEESLSA"
FT   gene            578347..578685
FT                   /gene="glnK"
FT                   /locus_tag="G2583_0562"
FT   CDS_pept        578347..578685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="G2583_0562"
FT                   /product="Glutamine synthetase regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55191"
FT                   /db_xref="GOA:D3QKD6"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKD6"
FT                   /protein_id="ADD55191.1"
FT                   /translation="MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAEL
FT                   YRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRT
FT                   GEADEAAL"
FT   gene            578715..580001
FT                   /gene="amtB"
FT                   /locus_tag="G2583_0563"
FT   CDS_pept        578715..580001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="G2583_0563"
FT                   /product="Ammonia channel precursor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55192"
FT                   /db_xref="GOA:D3QKD7"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKD7"
FT                   /protein_id="ADD55192.1"
FT                   /translation="MKIATIKTGLASLAMLPGLVMAAPAVADKADNAFMMICTALVLFM
FT                   TIPGIALFYGGLIRGKNVLSMLTQVTVTFALVCILWVVYGYSLAFGEGNNFFGNINWLM
FT                   LKNIELTAVMGSIYQYIHVAFQGSFACITVGLIVGALAERIRFSAVLIFVVVWLTLSYI
FT                   PIAHMVWGGGLLASHGALDFAGGTVVHINAAIAGLVGAYLIGKRVGFGKEAFKPHNLPM
FT                   VFTGTAILYIGWFGFNAGSAGTANEIAALAFVNTVVATAAAILGWIFGEWALRGKPSLL
FT                   GACSGAIAGLVGVTPACGYIGVGGALIIGVVAGLAGLWGVTMLKRLLRVDDPCDVFGVH
FT                   GVCGIVGCIMTGIFAASSLGGVGFAEGVTMGHQLLVQLESIAITIVWSGVVAFIGYKLA
FT                   DLTVGLRVPEEQEREGLDVNSHGENAYNA"
FT   gene            complement(580050..580910)
FT                   /gene="tesB"
FT                   /locus_tag="G2583_0564"
FT   CDS_pept        complement(580050..580910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="G2583_0564"
FT                   /product="Acyl-CoA thioesterase II"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55193"
FT                   /db_xref="GOA:D3QKD8"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKD8"
FT                   /protein_id="ADD55193.1"
FT                   /translation="MSQALKNLLTLLNLEKIEEGLFRGQSEDLGLRQVFGGQVVGQALY
FT                   AAKETVPEERLVHSFHSYFLRPGDSKKPIIYDVETLRDGNSFSARRVAAIQNGKPIFYM
FT                   TASFQAPEAGFEHQKTMPSAPAPDGLPSETQIAQSLAHLLPPVLKDKFICDRPLEVRPV
FT                   EFHNPLKGHVAEPHRQVWIRANGSVPDDLRVHQYLLGYASDLNFLPVALQPHGIGFLEP
FT                   GIQIATIDHSMWFHRPFNLNEWLLYSVESTSASSARGFVRGEFYTQDGVLVASTVQEGV
FT                   MRNHN"
FT   gene            581128..581700
FT                   /gene="ybaY"
FT                   /locus_tag="G2583_0565"
FT   CDS_pept        581128..581700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaY"
FT                   /locus_tag="G2583_0565"
FT                   /product="Glycoprotein/polysaccharide metabolism precursor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55194"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKD9"
FT                   /protein_id="ADD55194.1"
FT                   /translation="MKLVHMASGLAVAIALAACADKSADIQTPAPAANTSISATQQPAI
FT                   QQPNVSGTVWIRQKVALPPDAVLTVTLSDASLADAPSKVLAQKAVRTEGKQSPFSFVLP
FT                   FNPADVQPNARILLSAAITVNDKLVFITDTVQPVINQGGTKADLTLVPVQQTAVPVQAS
FT                   GGATTTVPSTSPTQVNPSSAVPAPTQY"
FT   gene            complement(581733..582122)
FT                   /gene="ybaZ"
FT                   /locus_tag="G2583_0566"
FT   CDS_pept        complement(581733..582122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaZ"
FT                   /locus_tag="G2583_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55195"
FT                   /db_xref="GOA:D3QKE0"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKE0"
FT                   /protein_id="ADD55195.1"
FT                   /translation="MLVSCAMRLHSSVFPDYAEKLSQEEKMEKEDSFPQRVWQIVAAIP
FT                   EGYVTTYGDVAKLAGSPRAARQVGGVLKRLPEGSTLPWHRVVNRHGTISLTGPDLQRQR
FT                   QALLAEGVMVSGSGQIDLQRYRWNY"
FT   gene            582207..582304
FT                   /gene="srpB"
FT                   /locus_tag="G2583_0567"
FT   ncRNA           582207..582304
FT                   /gene="srpB"
FT                   /locus_tag="G2583_0567"
FT                   /product="srpB"
FT                   /ncRNA_class="other"
FT   gene            582423..582776
FT                   /gene="ybaA"
FT                   /locus_tag="G2583_0568"
FT   CDS_pept        582423..582776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaA"
FT                   /locus_tag="G2583_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55196"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKE1"
FT                   /protein_id="ADD55196.1"
FT                   /translation="MKYVDGFVVAVPADKKDAYREMAAKAAPLFKEFGALRIVECWASD
FT                   VPDGKVTDFRMAVKAEENEEVVFSWIEYPSKEVRDAANQKMMSDPRMKEFGESMPFDGK
FT                   RMIYGGFESIIDE"
FT   gene            complement(582818..584374)
FT                   /gene="ylaB"
FT                   /locus_tag="G2583_0569"
FT   CDS_pept        complement(582818..584374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaB"
FT                   /locus_tag="G2583_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55197"
FT                   /db_xref="GOA:D3QKE2"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKE2"
FT                   /protein_id="ADD55197.1"
FT                   /translation="MLVRTRHLVGLISGVLILSVLLPVGLSIWLAHQQVETSFIEELDT
FT                   YSSRVAIRANKVATQGKDALQELERWQGADCSEAHLMEMRRVSYSYRYIQEVVYIDNNV
FT                   PQCSSLEHESPPDTFPEPGKISKDGYRVWLTSHNDLGIIRYMVAMGTAHYVVMIDPASF
FT                   IDVIPYSSWQIDAAIIGNAHNVVITSSDEIAQGIITRLQKTPGEHIENNGIIYDILPFP
FT                   EMNISIITWASSKMLQKGWHRQVFIWLPLGLVIGLLAAMFVLRILRRIQSPHHRLQDAI
FT                   ENRDICVHYQPIVSLANGKIVGAEALARWPQTDGSWLSPDSFIPLAQQTGLSEPLTLLI
FT                   IRSVFEDMGDWLRQHPQQHISINLESTVLTSEKIPQLLREMINHYQVNPRQIALELTER
FT                   EFADPKTSAPIISRYREAGHEIYLDDFGTGYSSLSYLQDLDVDILKIDKSFVDALEYKN
FT                   VTPHIIEMAKTLKLKMVAEGIETSKQEEWLRQHGVHYGQGWLYSKALPKEDFLRWAEQH
FT                   L"
FT   gene            complement(584532..585041)
FT                   /gene="ylaC"
FT                   /locus_tag="G2583_0570"
FT   CDS_pept        complement(584532..585041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaC"
FT                   /locus_tag="G2583_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55198"
FT                   /db_xref="GOA:D3QKE3"
FT                   /db_xref="InterPro:IPR019713"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKE3"
FT                   /protein_id="ADD55198.1"
FT                   /translation="MFPGKLQIPRRQTMTEIQRLLTETIESLNTREKRDNKPRFSISFI
FT                   RKHPGLFIGMYVAFFATLAVMLQSETLSGSVWLLVVLFILLNGFFFFDVYPRYRYEDID
FT                   VLDFRVCYNGEWYNTRFVPAALVEAILNSPRVADVHKEQLQKMIVRKGELSFYDIFTLA
FT                   RAESTS"
FT   gene            complement(585119..585670)
FT                   /gene="maa"
FT                   /locus_tag="G2583_0571"
FT   CDS_pept        complement(585119..585670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maa"
FT                   /locus_tag="G2583_0571"
FT                   /product="Maltose O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55199"
FT                   /db_xref="GOA:D3QKE4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKE4"
FT                   /protein_id="ADD55199.1"
FT                   /translation="MSTEKEKMIAGELYRSADETLSRDRLRARQLIHRYNHSLAEEHTL
FT                   RQQILADLFGQVTEAYIEPTFRCDYGYNIFLGNNFFANFDCVMLDVCPIRIGDNCMLAP
FT                   GVHIYTATHPIDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVT
FT                   KDVPDNVVVGGNPARIIKKL"
FT   gene            complement(585842..586060)
FT                   /gene="hha"
FT                   /locus_tag="G2583_0572"
FT   CDS_pept        complement(585842..586060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hha"
FT                   /locus_tag="G2583_0572"
FT                   /product="Hemolysin expression modulating protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55200"
FT                   /db_xref="InterPro:IPR007985"
FT                   /db_xref="InterPro:IPR036666"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKE5"
FT                   /protein_id="ADD55200.1"
FT                   /translation="MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYS
FT                   AADHRLAELTMNKLYDKIPSSVWKFIR"
FT   gene            complement(586086..586460)
FT                   /gene="ybaJ"
FT                   /locus_tag="G2583_0573"
FT   CDS_pept        complement(586086..586460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaJ"
FT                   /locus_tag="G2583_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55201"
FT                   /db_xref="InterPro:IPR019693"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKE6"
FT                   /protein_id="ADD55201.1"
FT                   /translation="MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAIN
FT                   LQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYLDDTFMLFSSYGINMQDLQKWRKSG
FT                   NRLFRCFVNATKENPASLSC"
FT   gene            complement(587006..590155)
FT                   /gene="acrB"
FT                   /locus_tag="G2583_0574"
FT   CDS_pept        complement(587006..590155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="G2583_0574"
FT                   /product="Acriflavine resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55202"
FT                   /db_xref="GOA:D3QKE7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKE7"
FT                   /protein_id="ADD55202.1"
FT                   /translation="MPNFFIDRPIFAWVIAIIIMLAGGLAILKLPVAQYPTIAPPAVTI
FT                   SASYPGADAKTVQDTVTQVIEQNMNGIDNLMYMSSNSDSTGTVQITLTFESGTDADIAQ
FT                   VQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVGVINTDGTMTQEDISDYVAANMK
FT                   DAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQNAQVAAGQLGGT
FT                   PPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
FT                   NGQPASGLGIKLATGANALDTAAAIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEV
FT                   VKTLVEAIILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMAEEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAF
FT                   FGGSTGAIYRQFSITIVSAMALSVLVALILTPALCATMLKPIAKGDHGEGKKGFFGWFN
FT                   RMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPDEDQGVFMTMV
FT                   QLPAGATQERTQKVLNEVTHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWA
FT                   DRPGEENKVEAITMRATRAFSQIKDAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEK
FT                   LTQARNQLLAEAAKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAA
FT                   WGGSYVNDFIDRGRVKKVYVMSEAKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYG
FT                   SPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQLASKLPTGVGYDWTGMSYQERLSGN
FT                   QAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVG
FT                   LLTTIGLSAKNAILIVEFAKDLMDKEGKGLIEATLDAVRMRLRPILMTSLAFILGVMPL
FT                   VISTGAGSGAQNAVGTGVMGGMVTATVLAIFFVPVFFVVVRRRFSRKNEDIEHNHTVDH
FT                   H"
FT   gene            complement(590178..591371)
FT                   /gene="acrA"
FT                   /locus_tag="G2583_0575"
FT   CDS_pept        complement(590178..591371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="G2583_0575"
FT                   /product="Acriflavine resistance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55203"
FT                   /db_xref="GOA:D3QKE8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKE8"
FT                   /protein_id="ADD55203.1"
FT                   /translation="MNKNRGFTPLAVVLMLSGSLALTGCDDKQAQQGGQQMPAVGVVTV
FT                   KTEPLQITTELPGRTSAYRIAEVRPQVSGIILKRNFKEGSDIEAGVSLYQIDPATYQAT
FT                   YDSAKGDLAKAQAAANIAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAA
FT                   VETARINLAYTKVTSPISGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSND
FT                   FLRLKQELANGTLKQENGKAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFP
FT                   NPDHTLLPGMFVRARLEEGLNPNAILVPQQGVTRTPRGDATVLVVGADDKVETRPIVAS
FT                   QAIGDKWLVTEGLKAGDRVVISGLQKVRPGVQVKAQEVTADNNQQAASGAQPEQSKS"
FT   gene            591513..592160
FT                   /gene="acrR"
FT                   /locus_tag="G2583_0576"
FT   CDS_pept        591513..592160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrR"
FT                   /locus_tag="G2583_0576"
FT                   /product="DNA-binding transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55204"
FT                   /db_xref="GOA:D3QKE9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKE9"
FT                   /protein_id="ADD55204.1"
FT                   /translation="MARKTKQEAQETRQHILDVALRLFSQQGVSSTSLGEIAKAAGVTR
FT                   GAIYWHFKDKSDLFSEIWELSESNIGELELEYQAKFPGDPLSVLREILIHVLESTVTEE
FT                   RRRLLMEIIFHKCEFVGEMAVVQQAQRNLCLESYDRIEQTLKHCIEAKMLPADLMTRRA
FT                   AIIMRGYISGLMENWLFAPQSFDLKKEARDYVAILLEMYLLCPTLRNPATNE"
FT   gene            592288..595650
FT                   /gene="kefA"
FT                   /locus_tag="G2583_0577"
FT   CDS_pept        592288..595650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefA"
FT                   /locus_tag="G2583_0577"
FT                   /product="Potassium efflux system KefA"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55205"
FT                   /db_xref="GOA:D3QKF0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKF0"
FT                   /protein_id="ADD55205.1"
FT                   /translation="MTMFQYYKRSRHFVFSAFIAFVFVLLCQNTAFARASSNGDLPTKA
FT                   DLQAQLDSLNKQKDLSAQDKLVQQDLTDTLATLDKIDRVKEETVQLRQKVAEAPEKMRQ
FT                   ATAALTALSDVDNDEETRKILSTLSLRQLETRVAQALDDLQNAQNDLASYNSQLVSLQT
FT                   QPERVQNAMYNASQQLQQIRSRLDGTDVGETALRPSQKVLMQAQQALLNAEIDQQRKSL
FT                   EGNTVLQDTLQKQRDYVTANSARLEHQLQLLQEAVNSKRLTLTEKTAQEAVSPDEAARI
FT                   QANPLVKQELEINQQLSQRLITATENGNQLMQQNIKVKNWLERALQSERNIKEQIAVLK
FT                   GSLLLSRILYQQQQTLPSADELENMTNRIADLRLEQFEVNQQRDALFQSDAFVNKLEEG
FT                   HTNEVNSEVHDALLQVVDMRRELLDQLNKQLGNQLMMAINLQINQQQLMSVSKNLKSIL
FT                   TQQIFWVNSNRPMDWDWIKAFPQSLKDEFKSMKITVNWEKAWPAVFIAFLAGLPLLLIA
FT                   GLIHWRLGWLKAYQQKLASAVGSLRNDSQLNTPKAILIDLIRALPVCLIILAVGLILLT
FT                   MQLNISELLWSFSKKLAIFWLVFGLCWKVLEKNGVAVRHFGMPEQQTSHWRRQIVRISL
FT                   ALLPIHFWSVVAELSPLHLMDDVLGQAMIFFNLLLIAFLVWPMCRESWRDKESHTMRLV
FT                   TITVLSIIPIALMVLTATGYFYTTLRLSGRWIETVYLVIIWNLLYQTVLRGLSVAARRI
FT                   AWRRALARRQNLVKEGAEGAEPPEEPTIALEQVNQQTLRITMLLMFALFGVMFWAIWSD
FT                   LITVFSYLDSITLWHYNGTEAGAAVVKNVTMGSLLFAIIASMVAWALIRNLPGLLEVLV
FT                   LSRLNMRQGASYAITTILNYIIIAVGAMTVFGSLGVSWDKLQWLAAALSVGLGFGLQEI
FT                   FGNFVSGLIILFERPVRIGDTVTIGSFSGTVSKIRIRATTITDFDRKEVIIPNKAFVTE
FT                   RLINWSLTDTTTRLVIRLGVAYGSDLEKVRKVLLKAATEHPRVMHEPMPEVFFTAFGAS
FT                   TLDHELRLYVRELRDRSRTVDELNRTIDQLCRENDINIAFNQLEVHLHNEKGDEVTEVK
FT                   RDYKGDDPTPAVG"
FT   gene            complement(595689..595853)
FT                   /gene="ybaM"
FT                   /locus_tag="G2583_0578"
FT   CDS_pept        complement(595689..595853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaM"
FT                   /locus_tag="G2583_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55206"
FT                   /db_xref="InterPro:IPR019630"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKF1"
FT                   /protein_id="ADD55206.1"
FT                   /translation="MSLENAPDDVKLAVDLIVLLEENQIPARTVLRALDIVKRDYEKKL
FT                   QSDEASQSE"
FT   gene            complement(595867..596394)
FT                   /gene="priC"
FT                   /locus_tag="G2583_0579"
FT   CDS_pept        complement(595867..596394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priC"
FT                   /locus_tag="G2583_0579"
FT                   /product="Primosomal replication protein N''"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55207"
FT                   /db_xref="InterPro:IPR010890"
FT                   /db_xref="InterPro:IPR038338"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKF2"
FT                   /protein_id="ADD55207.1"
FT                   /translation="MKTALLLEKLEGQLATLRQRCAPVSQFATLSARFNRHLFQTRATT
FT                   LQACLDEAGDNLAALRHAVEQQQLPQVAWLAEHLAAQLEAIAREATAWSLREWDSAPPQ
FT                   IARWQRKRIQHQDFERRLREMVAERRARLARVTDLVEQQTLHREVEAYEARLARCRHAL
FT                   EKIENRLARLTR"
FT   gene            596464..596841
FT                   /gene="ybaN"
FT                   /locus_tag="G2583_0580"
FT   CDS_pept        596464..596841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaN"
FT                   /locus_tag="G2583_0580"
FT                   /product="Inner membrane protein ybaN"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55208"
FT                   /db_xref="GOA:D3QKF3"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKF3"
FT                   /protein_id="ADD55208.1"
FT                   /translation="MQRIILIIIGWLAVVLGTLGVVLPVLPTTPFILLAAWCFARSSPR
FT                   FHAWLLYRSWFGSYLRFWQKHHAMPRGVKPRAILLILLTFAISLWFVQMPWVRIMLLVI
FT                   LACLLFYMWRIPVIDEKQEKH"
FT   gene            596994..597545
FT                   /gene="apt"
FT                   /locus_tag="G2583_0581"
FT   CDS_pept        596994..597545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="G2583_0581"
FT                   /product="Adenine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55209"
FT                   /db_xref="GOA:D3QKF4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKF4"
FT                   /protein_id="ADD55209.1"
FT                   /translation="MTATAQQLEYLKNSIKSIQDYPKPGILFRDVTSLLEDPKAYALSI
FT                   DLLVERYKNAGINKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
FT                   GTDQLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFIINLFDLGG
FT                   EQRLEKQGITSYSLVPFPGH"
FT   gene            597674..599605
FT                   /gene="dnaX"
FT                   /locus_tag="G2583_0582"
FT   CDS_pept        597674..599605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="G2583_0582"
FT                   /product="DNA polymerase III, tau subunit"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55210"
FT                   /db_xref="GOA:D3QKF5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022001"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKF5"
FT                   /protein_id="ADD55210.1"
FT                   /translation="MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSG
FT                   TRGVGKTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDT
FT                   RDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLP
FT                   VTILSRCLQFHLKALDVEQIRHQLEHILNEEHIAHEPRALQLLARAAEGSLRDALSLTD
FT                   QAIASGDGQVSTQAVSAMLGTLDDDQALSLVEAMVEANGERVMALINEAAARGIEWEAL
FT                   LVEMLGLLHRIAMVQLSPAALGNDMAAIELRMRELARTIPPTDIQLYYQTLLIGRKELP
FT                   YAPDRRMGVEMTLLRALAFHPRMPLPEPEVPRQSFAPVAPTAVMTPTQVPPQPQSAPQQ
FT                   APTVPLPETTSQVLAARQQLQRVQGATKAKKSEPAAATRARPVNNAALERLASVTDRVQ
FT                   ARPVPSALEKAPAKKEAYRWKATTPVMQQKEVVATPKALKKALEHEKTPELAAKLAAEA
FT                   IERDAWAAQVSQLSLPKLVEQVALNAWKEESDNAVCLHLRSSQRHLNNRGAQQKLAEAL
FT                   SMLKGSTVELTIVEDDNPAVRTPLEWRQAIYEEKLAQARESIIADNNIQTLRRFFDAEL
FT                   DEDSIRPI"
FT   gene            599658..599987
FT                   /gene="ybaB"
FT                   /locus_tag="G2583_0583"
FT   CDS_pept        599658..599987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="G2583_0583"
FT                   /product="UPF0133 protein ybaB"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55211"
FT                   /db_xref="GOA:D3QKF6"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKF6"
FT                   /protein_id="ADD55211.1"
FT                   /translation="MFGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVT
FT                   INGAHNCRRVEIDPSLLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPG
FT                   FKMPF"
FT   gene            599987..600592
FT                   /gene="recR"
FT                   /locus_tag="G2583_0584"
FT   CDS_pept        599987..600592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="G2583_0584"
FT                   /product="Recombination protein recR"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55212"
FT                   /db_xref="GOA:D3QKF7"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKF7"
FT                   /protein_id="ADD55212.1"
FT                   /translation="MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQ
FT                   ALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGR
FT                   YFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQ
FT                   YDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF"
FT   gene            600702..602576
FT                   /gene="htpG"
FT                   /locus_tag="G2583_0585"
FT   CDS_pept        600702..602576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="G2583_0585"
FT                   /product="Chaperone protein htpG"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55213"
FT                   /db_xref="GOA:D3QKF8"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKF8"
FT                   /protein_id="ADD55213.1"
FT                   /translation="MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADK
FT                   LRFRALSNPDLYEGDGELRVRVSFDKDKRTLTISDNGVGMTRDEVIDHLGTIAKSGTKS
FT                   FLESLGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYT
FT                   VADITKEDRGTEITLHLREGEDEFLDDWRVRSIISKYSDHIALPVEIEKREEKDGETVI
FT                   SWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTSLLYIP
FT                   SQAPWDMWNRDHKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLNVSREILQ
FT                   DSTVTRNLRNALTKRVLQMLEKLAKDDAEKYQTFWQQFGLVLKEGPAEDFANQEAIAKL
FT                   LRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVL
FT                   LLSDRIDEWMMNYLTEFDGKPFQSVSKVDESLEKLADEVDESAKEAEKALTPFIDRVKA
FT                   LLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEVKYIFELNPDHVL
FT                   VKRAADTEDEAKFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS"
FT   gene            602697..603401
FT                   /gene="adk"
FT                   /locus_tag="G2583_0586"
FT   CDS_pept        602697..603401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="G2583_0586"
FT                   /product="Adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55214"
FT                   /db_xref="GOA:D3QKF9"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKF9"
FT                   /protein_id="ADD55214.1"
FT                   /translation="MVVSFIAFSKNSTHFKGIFAMRIILLGAPGAGKGTQAQFIMEKYG
FT                   IPQISTGDMLRVAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLD
FT                   GFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVE
FT                   GKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPV
FT                   AEVRADLEKILG"
FT   gene            603533..604495
FT                   /gene="hemH"
FT                   /locus_tag="G2583_0587"
FT   CDS_pept        603533..604495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="G2583_0587"
FT                   /product="Ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55215"
FT                   /db_xref="GOA:D3QKG0"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKG0"
FT                   /protein_id="ADD55215.1"
FT                   /translation="MRQTKTGILLANLGTPDAPTPEAVKRYLKQFLSDRRVVDTSRLLW
FT                   WPLLRGVILPLRSPRVAKLYASVWMEGGSPLMVYSRQQQQALAQRLPETPVALGMSYGS
FT                   PSLESAVDELLAEHVDHIVVLPLYPQFSCSTVGAVWDELARILARKRSIPGISFIRDYA
FT                   DNHDYINALANSVRASFAKHGEPDLLLLSYHGIPQRYADEGDDYPQRCRTTTRELASAL
FT                   GMAPEKVMMTFQSRFGREPWLMPYTDETLKMLGEKGVGHIQVMCPGFAADCLETLEEIA
FT                   EQNREVFLGAGGKKYEYIPALNATPEHIEMMANLVAAYR"
FT   gene            complement(604492..605451)
FT                   /gene="aes"
FT                   /locus_tag="G2583_0588"
FT   CDS_pept        complement(604492..605451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aes"
FT                   /locus_tag="G2583_0588"
FT                   /product="Acetyl esterase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55216"
FT                   /db_xref="GOA:D3QKG1"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR023508"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKG1"
FT                   /protein_id="ADD55216.1"
FT                   /translation="MKPENKLPVLDLISAEMKTVVNTLQPDLPPWPATGTIAEQRQYYT
FT                   LERRFWNAGAPEMATKAYMVPTKYGQVETRLFCPQPDSPATLFYLHGGGFILGNLDTHD
FT                   RIMRLLASYSQCTVIGIDYTLSPEARFPQAIEEIVAACCYFHQQAEDYQINMSRIGFAG
FT                   DSAGAMLALASALWLRDKQIDCGKVAGVLLWYGLYGLRDSVTRRLLGGVWDGLTQQDLQ
FT                   MYEEAYLSNDADRESPYYCLFNNDLTREVPPCFIAGAEFDPLLDDSRLLYQTLAAHQQS
FT                   CEFKLYPGTLHAFLHYSRMMKTADEALRDGAQFFTAQL"
FT   gene            605603..606907
FT                   /gene="gsk"
FT                   /locus_tag="G2583_0589"
FT   CDS_pept        605603..606907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsk"
FT                   /locus_tag="G2583_0589"
FT                   /product="Inosine-guanosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55217"
FT                   /db_xref="GOA:D3QKG2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKG2"
FT                   /protein_id="ADD55217.1"
FT                   /translation="MKFPGKRKSKHYFPVNARDPLLQQFQPENETSAAWVVGIDQTLVD
FT                   IEAKVDDEFIERYGLSAGHSLVIEDDVAEALYQELKQKNLITHQFAGGTIGNTMHNYSV
FT                   LADDRSVLLGVMCSNIEIGSYAYRYLCNTSSRTDLNYLQGVDGPIGRCFTLIGESGERT
FT                   FAISPGHMNQLRAESIPEDVIAGASALVLTSYLVRCKPGEPMPEATMKAIEYAKKYNVP
FT                   VVLTLGTKFVIAENPQWWQQFLKDHVSILAMNEDEAEALTGESDPLLASDKALDWVDLV
FT                   LCTAGPIGLYMAGFTEDEAKRKTQHPLLPGAIAEFNQYEFSRAMRHKDCQNPLRVYSHI
FT                   APYMGGPEKIMNTNGAGDGALAALLHDITANSYHRSNVPNSSKHKFTWLTYSSLAQVCK
FT                   YANRVSYQVLNQHSPRLTRGLPEREDSLEESYWDR"
FT   gene            complement(607040..608716)
FT                   /gene="ybaL"
FT                   /locus_tag="G2583_0590"
FT   CDS_pept        complement(607040..608716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaL"
FT                   /locus_tag="G2583_0590"
FT                   /product="Transporter, monovalent cation:proton
FT                   antiporter-2 family"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55218"
FT                   /db_xref="GOA:D3QKG3"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKG3"
FT                   /protein_id="ADD55218.1"
FT                   /translation="MHHATPLITTIVGGLVLAFILGMLANKLRISPLVGYLLAGVLAGP
FT                   FTPGFVADTKLAPELAELGVILLMFGVGLHFSLKDLMAVKAIAIPGAIAQIAVATLLGM
FT                   ALSAVLGWSLMTGIVFGLCLSTASTVVLLRALEERQLIDSQRGQIAIGWLIVEDLVMVL
FT                   TLVLLPAVAGMMEQGDVGFATLAVDMGITIGKVIAFIAIMMLVGRRLVPWIMARSAATG
FT                   SRELFTLSVLALALGIAFGAVELFDVSFALGAFFAGMVLNESELSHRAAHDTLPLRDAF
FT                   AVLFFVSVGMLFDPLILIQQPLAVLATLAIILFGKSLAAFFLVRLFGHSQRTALTIAAS
FT                   LAQIGEFAFILAGLGMALNLLPQAGQNLVLAGAILSIMLNPVLFALLEKYLAKTETLEE
FT                   QTLEEAIEEEKQIPVDICNHALLVGYGRVGSLLGEKLLASDIPLVVIETSRTRVDELRE
FT                   RGVRAVLGNAANEEIMQLAHLECAKWLILTIPNGYEAGEIVASARAKNPDIEIIARAHY
FT                   DDEVAYITERGANQVVMGEREIARTMLELLETPPAGEVVTG"
FT   gene            complement(608954..610174)
FT                   /gene="fsr"
FT                   /locus_tag="G2583_0591"
FT   CDS_pept        complement(608954..610174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fsr"
FT                   /locus_tag="G2583_0591"
FT                   /product="Fosmidomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55219"
FT                   /db_xref="GOA:D3QKG4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKG4"
FT                   /protein_id="ADD55219.1"
FT                   /translation="MAMSEQTQPVAGAAASTTKARTSFGILGAISLSHLLNDMIQSLIL
FT                   AIYPLLQSEFSLTFMQIGMITLTFQLASSLLQPVVGYWTDKYPMPWSLPIGMCFTLSGL
FT                   VLLALAGSFGAVLLAAALVGTGSSVFHPESSRVARMASGGRHGLAQSIFQVGGNFGSSL
FT                   GPLLAAVIIAPYGKGNVAWFVLAALLAIVVLAQISRWYSAQHRMNKGKPKATIINPLPR
FT                   NKVVLAVSILLILIFSKYFYMASISSYYTFYLMQKFGLSIQNAQLHLFAFLFAVAAGTV
FT                   IGGPVGDKIGRKYVIWGSILGVAPFTLILPYASLHWTGVLTVIIGFILASAFSAILVYA
FT                   QELLPGRIGMVSGLFFGFAFGMGGLGAAVLGLIADHTSIELVYKICAFLPLLGMLTIFL
FT                   PDNRHKD"
FT   gene            610392..612044
FT                   /gene="ushA"
FT                   /locus_tag="G2583_0592"
FT   CDS_pept        610392..612044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ushA"
FT                   /locus_tag="G2583_0592"
FT                   /product="UDP-sugar hydrolase/5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55220"
FT                   /db_xref="GOA:D3QKG5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKG5"
FT                   /protein_id="ADD55220.1"
FT                   /translation="MKLLQRGVALALLTTFTLASEAALAYEQDKTYKITVLHTNDHHGH
FT                   FWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVPESDLQDAEPDFRGM
FT                   NLVGYDAMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDL
FT                   KIAVIGLTTDDTAKLGNPENFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYD
FT                   NGDHGSNAPGDVEMARALPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCKPDQQN
FT                   GIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVTWEDGKSERVLYTPEIA
FT                   ENQQMISLLSPFQNKGKAQLEVKIGETNGRLEGDRDKVRFVQTNMGRLILAAQMDRTGA
FT                   DFAVMSGGGIRDSIEAGDISYKNVLKVQPFGNVVVYADMTGKEVIDYLTAVAQMKPDSG
FT                   AYPQFANVSFVAKDGKLNDLKIKGEPVDPAKTYRMATLNFNATGGDGYPRLDNKPGYVN
FT                   TGFIDAEVLKAYIQKSSPLDVSVYEPKGEVSWQ"
FT   gene            complement(612081..612560)
FT                   /gene="ybaK"
FT                   /locus_tag="G2583_0593"
FT   CDS_pept        complement(612081..612560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="G2583_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55221"
FT                   /db_xref="GOA:D3QKG6"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKG6"
FT                   /protein_id="ADD55221.1"
FT                   /translation="MTPAVKLLEKNKISFQIHTYEHDPAETNFGDEVVKKLGLNPDQVY
FT                   KTLLVAVNGDMKHLAVAVTPVAGQLDLKKVAKALGAKKVEMADPMVAQRSTGYLVGGIS
FT                   PLGQKKRLPTIIDAPAQEFATIYVSGGKRGLDIELAAGDLAKILDAKFADIARRD"
FT   gene            612683..612765
FT                   /gene="sroB"
FT                   /locus_tag="G2583_0594"
FT   ncRNA           612683..612765
FT                   /gene="sroB"
FT                   /locus_tag="G2583_0594"
FT                   /product="sroB"
FT                   /ncRNA_class="other"
FT   gene            complement(612764..613558)
FT                   /gene="ybaP"
FT                   /locus_tag="G2583_0595"
FT   CDS_pept        complement(612764..613558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaP"
FT                   /locus_tag="G2583_0595"
FT                   /product="GumN family protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55222"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKG7"
FT                   /protein_id="ADD55222.1"
FT                   /translation="MDLLYRVKTLWAALRGNHYTWPAIDISLPGNRHFHLIGSIHMGSH
FT                   DMAPLPTRLLKKLKNADALIVEADVSTSDTPFANLPACEALEERISEEQLQKLQHISQE
FT                   MGISPSLFSTQPLWQIAMVLQATQAQKLGLRAEYGIDYQLLQAAKQQHKPVIELEGAEN
FT                   QIAMLLQLPDKGLALLDDTLTHWHTNARLLQQMMSWWLNAPPQNNEITLPNTFSQSLYD
FT                   VLMHQRNLAWRDKLRAMPPGRYVVAVGALHLYGEGNLPQMLR"
FT   gene            613642..614037
FT                   /gene="ybaQ"
FT                   /locus_tag="G2583_0596"
FT   CDS_pept        613642..614037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaQ"
FT                   /locus_tag="G2583_0596"
FT                   /product="Addiction module antidote protein, HigA family"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55223"
FT                   /db_xref="GOA:D3QKG8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKG8"
FT                   /protein_id="ADD55223.1"
FT                   /translation="MIQYVLVSLFTGKQQLKTMKQATRKPTTPGDILLYEYLEPLDLKI
FT                   NELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLWEVENNM
FT                   RTQEELGRIETVAEYLARREERAKKVA"
FT   gene            complement(614252..616756)
FT                   /gene="copA"
FT                   /locus_tag="G2583_0597"
FT   CDS_pept        complement(614252..616756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copA"
FT                   /locus_tag="G2583_0597"
FT                   /product="Copper-transporting P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55224"
FT                   /db_xref="GOA:D3QKG9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKG9"
FT                   /protein_id="ADD55224.1"
FT                   /translation="MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVEQADVSITEAHVTG
FT                   TASAEQLIETIKQAGYDASVSHPKAKPLAESSIPSEALTAVSEALPAATADDDDSQQLL
FT                   LSGMSCASCVTRVQNALQSVPGVTQARVNLAERTALVMGSASPQDLVQAVEKAGYGAEA
FT                   IEDDAKRRERQQETAVATMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTADNRSLWLVI
FT                   GLITLAVMVFAGGHFYRSAWKSLLNGAATMDTLVALGTGVAWLYSMSVNLWPQWFPMEA
FT                   RHLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLTPPTARLVTDEGEKSVPLAE
FT                   VQPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSV
FT                   LFRASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVVIALVSAAIWYFF
FT                   GPAPQIVYTLVIATTVLIIACPCALGLATPMSIISGVGRAAEFGVLVRDADALQRASTL
FT                   DTVVFDKTGTLTEGKPQVVAVKTFADFDEAQALRLAAALEQGSSHPLARAILDKASDMQ
FT                   LPQVNGFRTLRGLGVSGEAEGHALLLGNQALLNDQQVDTKAIEADISAQASQGATPVLL
FT                   AVDGKAVALLAVRDPLRSDSVAALQRLHKAGYRLVMLTGDNPTTANAIAKEAGIDEVIA
FT                   GVLPDGKAEAIKRLQSEGRQVAMVGDGINDAPALAQADVGIAMGGGSDVAIETAAITLM
FT                   RHSLMGVADALAISRATLRNMKQNLLGAFIYNSIGIPVAAGILWPFTGTLLNPVVAGAA
FT                   MALSSITVVSNANRLLRFKPKE"
FT   gene            617018..617950
FT                   /gene="ybaS"
FT                   /locus_tag="G2583_0598"
FT   CDS_pept        617018..617950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaS"
FT                   /locus_tag="G2583_0598"
FT                   /product="Glutaminase 1"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55225"
FT                   /db_xref="GOA:D3QKH0"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKH0"
FT                   /protein_id="ADD55225.1"
FT                   /translation="MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAI
FT                   VTSDGNVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIAL
FT                   ELHGGKPLSPLVNAGAIATTSLINAENAEQRWQRILHIQQQLAGELVALSDEVNQSEQT
FT                   TNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLINTVELATLGATLAAGGVNPLTH
FT                   KRVLQADNVPYILAEMMMEGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSP
FT                   PLDEEGNSVRGQKMVASVAKQLGYNVFKG"
FT   gene            617953..619245
FT                   /gene="ybaT"
FT                   /locus_tag="G2583_0599"
FT   CDS_pept        617953..619245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaT"
FT                   /locus_tag="G2583_0599"
FT                   /product="Amino acid permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55226"
FT                   /db_xref="GOA:D3QKH1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKH1"
FT                   /protein_id="ADD55226.1"
FT                   /translation="MMNTEGNNGNKPLGLWNVVSIGIGAMVGAGIFALLGQAALLMEAS
FT                   TWVAFAFGGIVAMFSGYAYARLGASYPSNGGIIDFFRRGLGNGVFSLALSLLYLLTLAV
FT                   SIAMVARAFGAYAVQFLHEGSQEEHLILLYALGIIAVMTLFNSLSNHAVGRLEVILVGI
FT                   KMMILLLLIIAGVWSLQPAHISVSAPPSSGAFFSCIGITFLAYAGFGMMANAADKVKDP
FT                   QVIMPRAFLVAIGVTTLLYISLALVLLSDVSALELEKYADTAVAQAASPLLGHVGYVIV
FT                   VIGALLATASAINANLFAVFNIMDNMGSERELPKLMNKSLWRQSTWGNIIVVVLIMLMT
FT                   AALNLGSLASVASATFLICYLAVFVVAIRLRHDIHASLPILIVGTLVMLLVIVGFIYSL
FT                   WSQGSRALIWIIGAILLSLIVAMVMKRNKTV"
FT   gene            619583..620938
FT                   /locus_tag="G2583_0600"
FT   CDS_pept        619583..620938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0600"
FT                   /product="Putative outer membrane export protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55227"
FT                   /db_xref="GOA:D3QKH2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKH2"
FT                   /protein_id="ADD55227.1"
FT                   /translation="MARFQFKNRKNNGLIFFISFMVMGEAAIAAPLPQWANAPAVTPVA
FT                   QLSLQESILRAFARNPGVTQQAAQIGIGEAQIDEAKSAWYPHVGLTGNAGPSRQTDSSG
FT                   RLDNNVSYGITLTQLVYDFGKTNNDINLQTAARDSYRFKLMATLTDVAEKTATAYMEVS
FT                   RYQALCDAAQRNIHSLENVYNMAALRANAGLNSSSDELQAQTRIAGMRSTLEQYQAQMA
FT                   SAKAQLAVLTGVQPEAIAAPPAELAEQPVSLKNIDYQSIPLVLAAENLRQSAQYGVEKA
FT                   KAQYWPTLSIQGGKTRYQTSDRSYWDDQLQLNVNAPLYQGGAVSAQVQQAEGQQKISAS
FT                   QVEQAKLDVLQRASVAYANWTGARGREEAGLAQSESAHKTRDVYQNEYKLGKRSLNDLL
FT                   TVEQDVFQAQSAEINANYDGWVAAVNYAAAVNNLIPLAGIKQGLYNDLPDLK"
FT   gene            621041..641818
FT                   /locus_tag="G2583_0601"
FT   CDS_pept        621041..641818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55228"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019960"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKH3"
FT                   /protein_id="ADD55228.1"
FT                   /translation="MSLIIDVISRKTSVKQTLINPGDVTVVIYEPSVVQVHAQASAVAR
FT                   YVREGNDLLIYMQDGTVIRCNGYFLQAANTAEQSELVFADGQQLTHITFADTAAGGLAP
FT                   VELTAQTTAIESIAPFLDTVAQTSAFPWGWLAGAAVGGGALGALLASGGDGDSKTEVIN
FT                   NPTPPAEPGNATPSFLVTDNQGDQRGILATNDITDDTTPTFSGSGQAGATIQIKDSNGN
FT                   TIASTQVDNNGHWSVSLPTQSAGEHTWSVVQIVGSTITDAGSITLTIDNSQASVQVATT
FT                   AGDNIINASEQAAGFTLSGTSSHLAQGTELTVTLNGKTYTTSVGANGAWSVQVPTADAQ
FT                   ALGEGNQAVLVSGKDATGNTVTGAQLLTVDTQPPTLAINTIAQDNIISAAEHNVALVLS
FT                   GTSNAEAGQTVTLTVNGKSHTATVGSDGTWQVTLPATEVQALAEGNYAVNASVSDRAGN
FT                   TTSHSANFTVDTSAPVVSVNTVAGDDILNNAEQAVAQIISGQVSGASPGDTVTVKLGTH
FT                   VLTGIVLADGSWNVALDPAVTRTLDRGANTIFVTVTDAAGNTGAASRAITLVGVSPLIT
FT                   INTVSGDDIISGAEKGAPLTLTGSTQQAETGQTVTVTLAGQSFTTTVQADGSWSLTVPA
FT                   AAMGNLPDGAVAITASVTDLSGNTGNTSRTITVDSQAPALSIDPLTADNIINAAESGQD
FT                   LPITGTTDAQPGQTVTVTLNGQTYQGVVQPDGTWSVTVPAANVGALADGNATVTASVND
FT                   VAGNPSSVSRVALVDATPPVVTINPVATDNVINTPEHAQAQIISGTVTGAQAGDIVTVT
FT                   LNNVDYTTVVDGSGNWSLGVPASVVSGLADGSYPVSVSVTDKAGNTGSQSLTVTVNTAA
FT                   PLIGINSIAGDDVINASEKGADLQITGTSDQPVNTAITVTLNGQNYTTTTDASGNWSVT
FT                   VPASAVTALGQANYTVTAAVTSDIGNSATASHNVLVDSALPGVTINPVATDDIINAAEA
FT                   GVAQTISGQVTGAEDGDTVTITLGGNTYTATVGSNLTWSVDVPAADIQALGNGDLTVNA
FT                   SVTNQNGNTGSGTRDITIDANLPGLRVDTVAGDDVVNIIEHGQALVVTGSSSGLAESTP
FT                   LTVTINNVEYTTAVQADGSWSVGVTAAQVSAWPAGTVNIAVSGESSAGNSVSITHPVTV
FT                   DLTPAAITINTIATDDVINAAEKGADLTLSGTTTNVELGQTVTVTFGGKNYTASVASDG
FT                   SWTATVPAADLASLPEGSASALASVSNINGNSASAVHNYSVDSSAPTIIINTVASDNIV
FT                   NASEADAGVTVSGSTTAEAGQIVTITLNSPTVQTYQATVQADGSWSINIPAADLEALTD
FT                   GSHTLTATVNDKAGNPASTTHNLAVDLTVPVLTINTIAGDDIINATEHGQALVISGSST
FT                   GGEAGDVVTVTLNSKTYTTTLDASGNWSVGVPAADVTALGSGPQTVTATVTDAAGNSDN
FT                   ETHTVTVNLTAPTIDINTIATDDIINASEKGADLQISGTSNQPAGTTITLALNGQNYTA
FT                   TTDAAGNWSTTVPASAVGALGEASYTVTANVTDSAGNSNSASHNVQVNTALPGVTINPV
FT                   ATDDIINAAESGNAQTISGQVTGAAAGDTVTVTLGGKTYTATVQGNLSWSVDVPAADIQ
FT                   AIGNGNLTVNASVTNGVGNTGSGSRDITIDANLPGLRVDTVAGDDVVNSIEHAQALVIT
FT                   GSSSGLAAGAALTVVINTVTYAATVLADGTWSVGVPAADVSNWPAGTVNITVSGTNTAG
FT                   TTSTITHPVTVDLAAVAISINTVSGDDVINAAEKGADLTLSGSTSGVEVGQTVTVTFGG
FT                   KTYTATVAGDGSWTTTVPAADLSVLRDGDATVQASVSTINGNTASATHAYSVDATAPTL
FT                   AINTIATDDILNAAEAGNPLTISGSSTAEAGQTVTVTLNGVTYSGSVQADGSWSVSLPT
FT                   ADLSNLTASQYTVSASVSDKAGNPASANHGLAVDLTVPVLTINTVSGDDIINAAEHGQA
FT                   LVISGSSTGGEAGDVITVTLNSKTYTTMLDASGNWSVGVPAADVTALGSGPQTITAAIT
FT                   DAAGNSDDASRTVTVNLAAPTIGINTIATDDVIKATEKGADLQITGTSNQPAGTTITVT
FT                   LNGQNYTATTDSNGNWSATVPASAVSALGEANYTVTANVTDTAGNSNSASHNVLVNSAL
FT                   PAVTINAVATDDIINAAESGNAQTISGQVTGAAQGDTVTVTLGGNTYTATVQSNLSWSV
FT                   DVPAADIQALGNGDLTVNASVTNGVGNTGSGSRDITIDANLPGLRVDTVAGDDVINSIE
FT                   HNQALVITGSSSGLTAGTALTVEINNVTYGATVLADGTWSLGVPAVDVSNWPAGTVNIT
FT                   VSGTNSAGTTSTITHPVTVDLAGVAITINTLSGDDVINAVEKGETLVVSGSTSGVEAGQ
FT                   TVTVTFGGKNYTTTVEANGSWTVNVPPADLAALPDGAGNVQASVSNINGNSAQADRAYS
FT                   VDATAPLVTINTIASDDILNVSEAGAGITISGTTTAQAGQTLTVTLNNNTYQTTVLADG
FT                   TWSVNVPAADLSGLTASSYTVTATVSDKAGNPASADHALAVDITAPDLTINTVAGDDII
FT                   NAIEHGQALVVSGTSTGAAAGDVVTVTLNGKNYTTTLDASGNWSVGIPAADVTALATGS
FT                   QTITASLSDRAGNSDSTTHDVTVDLSGPTLTINTVSGDDIINNAEKTQDLTISGGSSGL
FT                   ATGTTVTVMLNGLAYSATTDSSGNWSVTVPASAVGALGEAVYQISASATDSAGNSGSTT
FT                   HTVNVESLLPGVIINTVAGDDIINAAEIVVAQTISGQVTGTAVAGNTVIVTIGGNQYNA
FT                   TVQSDLSWSVSVPANVLQALGNGELTISASLTNSANNTGTATHDIVIDANLPGLRVDTV
FT                   AGDDVINSIEHTQALVITGSSSGLAAGAALTVVINSVTYGATVLADGSWSVGVPVADVT
FT                   NWPAGTVNIAVSGTNTAGTTTSISHPVTVDLAAVAITINTLSTDDVINAAEKGSDLQLS
FT                   GTTSGVEAGQTITVIFGGKSYTTTVAADNTWGLTIPAADVATLPDGAANVQASVSNVAG
FT                   NSTQATHAYSVDATAPSVTINTIATDDILNAAEAGSALTISGTSTAEAGQTVTVTLNGV
FT                   NYSGNVQADGSWSVSVPTGDLASLTASSYTVNASVSDKARNPASATHNLTVDLAAPVVT
FT                   INTVAGDDIINATEHGQAQIISGSATGATTGNTVSVTIGTTTYTTVLDANGNWSIGVPA
FT                   SVISALAQGDVTITATVTDSAGNSGTASHTVTVALGAPVLAINTIAVDDIINATEKGAD
FT                   LAITGTSNQPAGTQITVTLNGQNYTTTADASGNWSVTVPASRVSALGEATYTVTAAATD
FT                   ADGNSGSASHNVQVNTALPGVTINVVATDDIINAAEAGVEQTISGQVTGAAAGDTVTVT
FT                   LGGATYTATVQANLSWSVDVPASALQELGNGELTISASVTNSVGNTGNGTREITIDANL
FT                   PGLRVDTVAGDDVVNIIEHGQALVITGSSSGLAAGSNVTLTINGQTYVAAVLADGTWSV
FT                   GVPAVDVSAWPAGSVTIAASGSTSAGNPVSVTHPVTVDLSAVAVSINAITADDVINAAE
FT                   KGAALTLSGSTSGVEAGQTVTVTFGGKTYSATVAANGSWSTSVPAADMAALRDGDASAQ
FT                   ASVSNVNGNSATTTHAYSVDASAPTVTINTIAGDDILNAAEAGAALTITGSSTAEAGQT
FT                   VTVTLNGTNYTGTVQTDGSWSVSVPSADLSTLTASNYTVNAAVSDKAGNPASVNHNLTV
FT                   DTSVPVVTINTVAGDDVINATEHAQAQIISGSATGAATGSTVTVTIGTNTFTTVLDASG
FT                   NWSVGVPASVVSALANGTVTINASVTDAGGNSGSATHQVTVNTGLPTITFNAISGDNIL
FT                   NADEKGQPLTISGGSTGLATGAQVTVTLNGHNYSATTDASGNWTLTVPVSDLAALGQAN
FT                   YTVSASATSAAGNTASSQTNLLVDSGLPDVTINTVAGDDIINAAEAGADQTISGVVTRA
FT                   AAGDTVTVTLGGNTYTATVQSNLSWSVSVPTADLQALGNGDLTITASVTNANGNTGSGT
FT                   RDITIDANLPGLRVDTVAGDDIVNSIEHGQALVITGGSSGLNAGAVLTVTINSVAYSAT
FT                   VQADGSWSVGIPAANVSAWPAGPLTVEVDGQSSANNPVSVSHPFTVDLTAVAISINTVA
FT                   SDDVINAAEKGTNLTLSGSTSGIESGQTVTVTFGGKTYTASVAANGSWSVNVPAADLAT
FT                   LPEGAANVQASVSSASGNSASATHAYSVDASAPTLTINTIASDDILNAAEAGSPLTISG
FT                   TSTAETGQTVTVTLNGATYTGTVQADGSWSVSVPTSALGALNASNYTVSATVNDKAGNP
FT                   GSASHNLAVDTTAPVLTINTVAGDDIINDAEHAQALVISGTSSGGEAGDVVSVVLNGKT
FT                   YTTTLDASGNWSVGVPAADVTALGSGAQTITASVSDRAGNSDDASRTVTVSLSAPVISI
FT                   NTIAGDDVINATEKGSDLALSGTSDQPAGTAITVTLNGQNYSATTDASGNWSVTVPASA
FT                   VSALGEATYSVTASVTNAQGNSSTASHNVQVNTALPGITINPVATDDIINASEAGSAQT
FT                   ISGQVTGAAAGSTVTVELGGKTYTATVQADLSWNVSVPAADWQALGNGELTVNASVTNA
FT                   VGNTGSGTRDITIDASLPGLRVDTVAGDDVVNIIEHAQAQVITGSSSGFAAGTALTVVI
FT                   NNQTYAATVLANGSWSVGVPATDVSNWPAGTLNITVSGANSAGTQTSITHPLTVDLTAV
FT                   AISMNSITSDDAINAAEKGAALTLSGSTSGVEAGQTVTVTFGGKTYTTTVAANGSWSTT
FT                   VPAADLAALRDGDASAQVRVTNVNGNSATATHEYSVDSAAPTVTINTIASDNIINASEA
FT                   AAGVTVSGTSTAQTGQTLTVTLNGTNYQTTVQTDGSWSLTLPASDLTALANNGYTLTAT
FT                   VSDLAGNPGSASKGVTVDTTAPVISFNTVAGDDVINNVEHIQAQIISGTATGAVAGDRL
FT                   VVTIAGQQYVTSTDASGNWSVGVPASVISGLADGTVTISATITDSAGNSSTQTHNVQVN
FT                   TAAVSLSVSTISGDNLINAAEAGSALTLSGTGTNFATGTVVTVLLNGKGYSATIQSNGS
FT                   WSVNVPAADVAALSDGTSYTVSASAQDSAGNSATASRSVAVDLTAPVISINTVSTDDRL
FT                   NAAEQQQPLTLNGSTSAEVGQTVTVTFGGKTYTATVAANGTWALNVPAVDLAALGQGAQ
FT                   TITASVNDRAGNPGQATHALTVDTVAPTVTIATVAGDDIINNAEQLAGQTISGTTTAEV
FT                   GQTVTVTFNGQTWSATVGSGGSWSVFIPAQQFAGLSDGSYTISATVSDQAGNPGSASRG
FT                   VTLNGDVPTVTINTFAGDDVVNAAEHGSSLVISGTTTAPVGQTLTLTLNGKTYTTTVQT
FT                   GGSWSYTLGSADVTALADGNAYVINASVSNAIGNTGSSNHTITVDLSAPAMGINIDSLQ
FT                   ADTGLSASDFITSVSPVVVNGSLTAALASNETAQISIDGGTTWTTLTVTGTTWRYNDSR
FT                   TLTDGNYLYQVRVIDAAGNVGATDSQNVVIDTTAPDPAVKTIAISAITTDMGLITNDFV
FT                   TSDTTLAVSGTLGATLSAGEFAQISIDGGTTWQNLSVSGLTWSYLDGRTLTDGNYNYQV
FT                   RVIDTAGNIGATASQIVTVDTTAPLASKTIAIAGISDDTGLSSSDFVTRDTTLTVRGTL
FT                   GAALAADERAQISLDGGVTWTTLTVVGTSWSYADGRTLTDGTWNYTVRVVDLAGNVGQT
FT                   ATQNVVVDTTSPEAAKSITITGISDDTGTSSSDFITSDTTLTVRGVLGAALGANEFAQI
FT                   STDNGATWVNVTVAADSLNWSYVDGRTLTNGTTTWQVRVVDLAGNVGATSSQSALIDTV
FT                   NPAQVLTIASISTDTGSSATDFITSDTMLTLTGSLGAGLASGEVAQISLDSGATWTTLT
FT                   TNGTQWTYTDSRTLTDGSYVYQVRVLDLAGNTGPVVSKTVVVDTINPTATPTIVSYTDD
FT                   VGQRQGTLSSSQATDDTTPLLNGVLSAPLASGEVVYLYRNGLLLGAVTMVGALNWTYSD
FT                   SGLVSGAYTYSARVVDLAGNITSSSDFVLTVDTSIPTTLAQITSQTTRDTTPIISGVIT
FT                   AALASGQYVEVVINGKTYTSEPGGAVVVDPAHNTWYVQLPDTDALTVSATAYTVTAQVK
FT                   SSAGNGNNANISNGTVTVNAAIDYTPTWTTASKTTAWGLTYGLDSHGMWTVLANQQVMQ
FT                   STDPLTWSKTALTLYQSGNNYATSSIADYDRNGTGDLFITRDDYGTGYINGFTNNGDGT
FT                   FSSAIQVTVGTLTWYGSIVAFDKEGDGYLDFWIGDAGGPDSNTFLWNNAGTLVGNSTTS
FT                   NSGGSATVGGAVTGYLSLNEGSGVDLNNDGRIDLVQHTYNLNNYYTLSSLINQGNGTFV
FT                   WGQNTTNTFLSGAGSGAMSSSVSMTWADFDGDGDMDLFLPASQGRANYGSLLFNTNGVL
FT                   GSPVAVGATATTYASQFSLAVDWNHDGLMDIARIAQTGQSYLYTNVSNASNWTQSALGG
FT                   SQSGTTSGVAAMDYDWDGAVDVLVSKQSGSVFLIRNTNTVSYGTSLHLRITDPNGINVY
FT                   YGNTVKLYNSAGVLVATQIINPQSGMGVNDTSALVNFYGLNAGETYNAVLIKSTGTTAS
FT                   NIDQTVNTSWGGLQATDATHAYDLSAEAGTASNNGKFVGTGYNDTFFATAGTDTYDGSG
FT                   GWVYSSGTGTWLANGGMDVVDFRLSTVGVTANLSSTAAQATGFNTSTFTNIEGISGSNF
FT                   NDILTGSSGDNQLEGRGGNDTLNIGNGGHDTLLYKLLNASDATGGNGSDVVNGFTVGTW
FT                   EGTADTDRIDIRELLQGSGYTGNGKASYVNGVATLDAQAGNIGDFVKVTQSGSDTIVQI
FT                   DRDGTGGTFATTNVVTLTGVHTDLATLLANHQLMVV"
FT   gene            641822..643984
FT                   /locus_tag="G2583_0602"
FT   CDS_pept        641822..643984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0602"
FT                   /product="Putative cytoplasmic membrane export protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55229"
FT                   /db_xref="GOA:D3QKH4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKH4"
FT                   /protein_id="ADD55229.1"
FT                   /translation="MKKNAQSVEAWLEAMIAVARYYRLDFSQENVRATVNWERDSKREE
FT                   LLTDMARQLGMGLRLVEFSADSLNPWRLPLIAVFDNQQIGVITRRDNHDNISVQFSGDE
FT                   GLETTLNVADIEDKIVELALLRPLSAIPDARVDDYIRPYQANWFWSLSLKDWRRYGDIM
FT                   LASLVANVLALAAMIFSMQVYDRVVPAQSYPTLWVLFAGVMMAILFEFCMRMVRTHLSD
FT                   VIGKRADLRISDRVFGHALRLKNNVRSKSTGSFISQIRELESVRELITSTTIGAVADLP
FT                   FFLLFVFILWMIGGWLVLVVLLALPLLVIPGLLVQRPLARLANEGMRESAVRNATLVEA
FT                   VQSIEDIKLLRAEQRFQNQWNHTNDVASSISMKQRFLTGLLLTWTQEVQSIVYVVVLLV
FT                   GCFMVMNGDMTTGALVGTTILASRTIAPLSQISGVLSRWQQAKVARNGLDELMKRPVDQ
FT                   PEHGKLVHKAVLHGNYQFSNAVFYYDEEEKIADVAIGKLNIQAGEKIAILGRNGAGKST
FT                   LLQMLAGMRIAQQGQVLLDNISIGQLDPADLRRDMGLLSQTGRLFFGSLRENLTMGMPE
FT                   ASDEDIERALTLSGALPFVQKQKNGLNYMIQEGGFGLSGGQRQTLLLARLLISQPNIVL
FT                   LDEPSASLDEMAEAYLIEQLKQWIGHRTLIIATHRTAMLQLVDRIIVMDQGRIVMDGAK
FT                   EAILREQGELTARRVVLQEKNKGSAA"
FT   gene            643981..645156
FT                   /locus_tag="G2583_0603"
FT   CDS_pept        643981..645156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0603"
FT                   /product="Membrane spanning export protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55230"
FT                   /db_xref="GOA:D3QKH5"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKH5"
FT                   /protein_id="ADD55230.1"
FT                   /translation="MNGQLQYNRGLTEPRLPRSALAVRVTAVMLLCFLGWAWYFQLDEV
FT                   TTGSGTVEPSGREQVVQSLEGGILYHLDVKVGDIVEQGQPLAQLNRTKTESDVQEAMSR
FT                   LYAALATSARLRAEVSNKPLVFPDELNKFPELIESETALYNTRRDGLNKATTGLTQGIS
FT                   LVNRELAMTQPLVKQGAASSVEVLRLQRQANELENKLSDVRTQYYVQAREELAKANAEV
FT                   ETQRSVIRGREDSLTRLNFTAPVRGIVQDIDVTTVGGVIAPGGKLMTIVPLDEQLLIEA
FT                   KISPRDVAFIHPGQKSLVKITAYDYSIYGGLPGEVAVISPDTVQDEVRRDVYYYRVYIR
FT                   TFSNHLENKSKQQFPIFPGMVATVDIRTGKKSVLDYLLKPFNKAQEALRER"
FT   gene            645153..645560
FT                   /gene="cueR"
FT                   /locus_tag="G2583_0604"
FT   CDS_pept        645153..645560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueR"
FT                   /locus_tag="G2583_0604"
FT                   /product="DNA-binding transcriptional activator of
FT                   copper-responsive regulon genes"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55231"
FT                   /db_xref="GOA:D3QKH6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKH6"
FT                   /protein_id="ADD55231.1"
FT                   /translation="MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLN
FT                   ELTLLRQARQVGFNLEESGELVNLFNDPQRHSADVKRRTLEKVAEIERHIEELQSMRNQ
FT                   LLALANACPGDDSADCPIIENLSGCCHHRAG"
FT   gene            complement(645764..646186)
FT                   /locus_tag="G2583_0605"
FT   CDS_pept        complement(645764..646186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55232"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKH7"
FT                   /protein_id="ADD55232.1"
FT                   /translation="MMNSSIKSFSLLAVILLAGCSSPTSRIADCQAQGVSHDTCYLAEQ
FT                   QRQAAILSASEAQAFKNAEAAQHAQAAKKAIYKGFGMTFRMSSKNFAYLNDSLCAIDED
FT                   NKDATVYQSGLYNVIVYHHTGKVALMKEGQFVGYLK"
FT   gene            complement(646271..647287)
FT                   /locus_tag="G2583_0606"
FT   CDS_pept        complement(646271..647287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55233"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKH8"
FT                   /protein_id="ADD55233.1"
FT                   /translation="MKTVNVALLALIISATSSPVVLAGDTIEAAATELSAINSGMSQSE
FT                   IEQKITRFLERTDNSPAAYTYLTEHHYIPSETPDTTQTPTVQTDPDAGQKTVAATGDVQ
FT                   TTARYQSMINARQSAVTDAQQTQITEQQAQIVATQKTLAATGDTQNTAHYQEMINARLA
FT                   AQNEANQRTATEQGQKMNALTTDVAVQQQNERTQYDKQMQSLAQESAQAHEQIDSLSQD
FT                   VTQTHQQLTNTQKRVADNSQQINTLNNHFSSLKNEVDDNRKEANAGTASAIAIASQPQV
FT                   KTGDVMMVSAGAGTFNGESAVSVGTSFNAGTHTVLKAGISADTQSDFGAGVGVGYSF"
FT   gene            647654..648016
FT                   /locus_tag="G2583_0607"
FT   CDS_pept        647654..648016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55234"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKH9"
FT                   /protein_id="ADD55234.1"
FT                   /translation="MNEFEKIFNEMNLDRALLPILFRSNRSTVWKYLSGDSTAPASAMS
FT                   LIMLLQLIQKRNPDLLAEWLTLSDFTIPPEVYLDQPDYWKGWVYTQHKVNKNVLEYLKK
FT                   HYPDEDQKSMSKGREE"
FT   gene            complement(648195..648653)
FT                   /gene="ybbJ"
FT                   /locus_tag="G2583_0608"
FT   CDS_pept        complement(648195..648653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="G2583_0608"
FT                   /product="Nodulation efficiency family protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55235"
FT                   /db_xref="GOA:D3QKI0"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKI0"
FT                   /protein_id="ADD55235.1"
FT                   /translation="MMELIVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLV
FT                   VWLVPLGWEWQGVMFAVLTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLE
FT                   SPLVNGRGHMRVGDSSWPVSASEDLGAGTHVEVIAIEGITLIIRAVIA"
FT   gene            complement(648650..649567)
FT                   /gene="qmcA"
FT                   /locus_tag="G2583_0609"
FT   CDS_pept        complement(648650..649567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qmcA"
FT                   /locus_tag="G2583_0609"
FT                   /product="putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55236"
FT                   /db_xref="GOA:D3QKI1"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKI1"
FT                   /protein_id="ADD55236.1"
FT                   /translation="MLIFIPILIFVALVIVGAGVKIVPQGYQWTVERFGRYTKTLQPGL
FT                   SLVVPFMDRIGRKINMMEQVLDIPSQEVISKDNANVTIDAVCFIQVIDAPRAAYEVSNL
FT                   ELAIINLTMTNIRTVLGSMELDEMLSQRDSINSRLLRIVDEATNPWGIKVTRIEIRDVR
FT                   PPAELISSMNAQMKAERTKRAYILEAEGIRQAEILKAEGEKQSQILKAEGERQSAFLQA
FT                   EARERSAEAEARATKMVSEAIASGDIQAVNYFVAQKYTEALQQIGSSSNSKVVMMPLEA
FT                   SSLMGSIAGIAELVKDSANKRTQP"
FT   gene            649713..650390
FT                   /gene="ybbL"
FT                   /locus_tag="G2583_0610"
FT   CDS_pept        649713..650390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbL"
FT                   /locus_tag="G2583_0610"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55237"
FT                   /db_xref="GOA:D3QKI2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKI2"
FT                   /protein_id="ADD55237.1"
FT                   /translation="MQENSPLLQLQNVGYLAGDAKILNNINFSLRAGEFKLITGPSGCG
FT                   KSTLLKIVASLISPTSGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFP
FT                   WQIRNQQPDPAIFLDFLERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDE
FT                   ITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARY
FT                   ELA"
FT   gene            650350..651156
FT                   /gene="ybbM"
FT                   /locus_tag="G2583_0611"
FT   CDS_pept        650350..651156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbM"
FT                   /locus_tag="G2583_0611"
FT                   /product="Putative metal resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55238"
FT                   /db_xref="GOA:D3QKI3"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKI3"
FT                   /protein_id="ADD55238.1"
FT                   /translation="MPEKCRKHAMNSHNITNESLALALMLVVVAILISHKEKLALEKDI
FT                   LWSVGRAIIQLIIVGYVLKYIFSVDDASLTLLMVLFICFNAAWNAQKRSKYIAKAFISS
FT                   FIAITVGAGITLAVLILSGSIEFIPMQVIPIAGMIAGNAMVAVGLCYNNLGQRVISEQQ
FT                   QIQEKLSLGATPKQASAILIRDSIRAALIPTVDSAKTVGLVSLPGMMSGLIFAGIDPVK
FT                   AIKYQIMVTFMLLSTASLSTIIACYLTYRKFYNSRHQLVVTQLKKK"
FT   gene            complement(651219..652109)
FT                   /gene="ybbN"
FT                   /locus_tag="G2583_0612"
FT   CDS_pept        complement(651219..652109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbN"
FT                   /locus_tag="G2583_0612"
FT                   /product="putative thioredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55239"
FT                   /db_xref="GOA:D3QKI4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKI4"
FT                   /protein_id="ADD55239.1"
FT                   /translation="MSKKISTTESDSMSVENIVNINESNLQQVLEQSMTTPVLFYFWSE
FT                   RSQHCLQLTPILESLAAQYNGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDG
FT                   FQGPQPEEAIRALLDKVLPREEELKAQQAMQLMQEGNYTDALPLLKDAWQLSNQNGEIG
FT                   LLLAETLIALNRSEDAEAVLKTIPLQDQDTRYQGLVAQIELLKQAADTPEIQQLQQQVA
FT                   ENPEDAALATQLALQLHQVGRNEEALELLFGHLRKDLTAADGQTRKTFQEILAALGTGD
FT                   ALASKYRRQLYALLY"
FT   gene            complement(652134..652943)
FT                   /gene="ybbO"
FT                   /locus_tag="G2583_0613"
FT   CDS_pept        complement(652134..652943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbO"
FT                   /locus_tag="G2583_0613"
FT                   /product="Oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55240"
FT                   /db_xref="GOA:D3QKI5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKI5"
FT                   /protein_id="ADD55240.1"
FT                   /translation="MTHKATEILTGKVMQKSVLITGCSSGIGLESALELKRQGFHVLAG
FT                   CRKPDDVERMNSMGFTGVLIDLDSPESVDRAADEVIALTDNCLYGIFNNAGFGMYGPLS
FT                   TISRAQMEQQFSANFFGAHQLTMRLLPAMLPHGEGRIVMTSSVMGLISTPGRGAYAASK
FT                   YALEAWSDALRMELRRSGIKVSLIEPGPIRTRFTDNVNQTQSDKPVENPGIAARFTLGP
FT                   EAVVDKVRHAFISEKPKMRYPVTLVTWAVMVLKRLLPGRVMDKILQG"
FT   gene            complement(652933..653559)
FT                   /gene="tesA"
FT                   /locus_tag="G2583_0614"
FT   CDS_pept        complement(652933..653559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesA"
FT                   /locus_tag="G2583_0614"
FT                   /product="Acyl-CoA thioesterase I"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55242"
FT                   /db_xref="GOA:D3QKI6"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKI6"
FT                   /protein_id="ADD55242.1"
FT                   /translation="MMNFNNVFRWHLPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSA
FT                   SAAWPALLNDKWQSKTSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRG
FT                   FQPQQTEQTLRQILQDVKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLL
FT                   PFLMEEVYLKPQWMQDDGIHPNRDAQPFIADWMAKQLQPLVNHDS"
FT   gene            653527..654213
FT                   /gene="ybbA"
FT                   /locus_tag="G2583_0615"
FT   CDS_pept        653527..654213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbA"
FT                   /locus_tag="G2583_0615"
FT                   /product="Uncharacterized ABC transporter ATP-binding
FT                   protein ybbA"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55241"
FT                   /db_xref="GOA:D3QKI7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKI7"
FT                   /protein_id="ADD55241.1"
FT                   /translation="MPAENIVEVHHLKKSVGQGEHELSILTGVELVVKRGETIALVGES
FT                   GSGKSTLLAILAGLDDGSSGEVSLVGQPLHNMDEEARAKLRAKHVGFVFQSFMLIPTLN
FT                   ALENVELPALLRGESSAESRNGAKALLEQLGLGKRLDHLPAQLSGGEQQRVALARAFNG
FT                   RPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLIMVTHDLQLAARCDRCLRLVNG
FT                   QLQEEA"
FT   gene            654210..656624
FT                   /gene="ybbP"
FT                   /locus_tag="G2583_0616"
FT   CDS_pept        654210..656624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbP"
FT                   /locus_tag="G2583_0616"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55243"
FT                   /db_xref="GOA:D3QKI8"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKI8"
FT                   /protein_id="ADD55243.1"
FT                   /translation="MIARWFWREWRSPSLLIVWLALSLAVACVLALGNISDRMEKGLSQ
FT                   QSREFMAGDRALRSSREVPQAWLEEAQKRGLKVGKQLTFATMTFAGDTPQLANVKAVDD
FT                   IYPMYGDLQTNPPGLKPQAGSVLLAPRLMALLNLKTGDTIDVGDATLRIAGEVIQEPDS
FT                   GFNPFQMAPRLMMNLADVDKTGAVQPGSRVTWRYKFGGSENQLDSYEKWLLPQLKPEQR
FT                   WYGLEQDEGALGRSMERSQQFLLLSALLTLLLAVAAVAVAMNHYCRSRYDLVAILKTLG
FT                   AGRAQLRKLIVGQWLMVLTLSAVTGGAIGLLFENVLMVLLKPVLPAALPPASLWPWLWA
FT                   LGTMTVISLLVGLRPYRLLLATQPLRVLRNDVVANVWPLKFYLPIVSVVVVLLLAGLMG
FT                   GSMLLWAVLAGAVVLALLCGVLGWMLLNVLRRMTLKSLPLRLAVSRLLRQPWSTLSQLS
FT                   AFSLSFMLLALLLVLRGDLLDRWQQQLPPESPNYFLINIATEQVTPLKAFLAEHQIVPE
FT                   SFYPVVRARLTAINGKPTEGNEDEALNRELNLTWQNTRPDHNPIVAGNWPPKADEVSME
FT                   EGLAKRLNVTLGDTVTFMGDTQEFRAKVTSLRKVDWESLRPNFYFIFPEGALDGQPQSW
FT                   LTSFRWENGNGMLTQLNRQFPTISLLDIGAILKQVGQVLEQVSRALEVMVVLVTACGML
FT                   LLLAQVQVGMRQRHQELVVWRTLGAGKKLLRTTLWCEFAMLGFVSGLVAAIGAETALAV
FT                   LQAKVFDFPWEPDWRLWIVLPCSGALLLSLFGGWLGARLVKGKALFRQFAG"
FT   gene            657054..661251
FT                   /pseudo
FT                   /gene="rhsD"
FT                   /locus_tag="G2583_0617"
FT                   /note="RHS Repeat family protein"
FT   gene            661232..661492
FT                   /gene="ybbD"
FT                   /locus_tag="G2583_0618"
FT   CDS_pept        661232..661492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbD"
FT                   /locus_tag="G2583_0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55244"
FT                   /db_xref="GOA:D3QKI9"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKI9"
FT                   /protein_id="ADD55244.1"
FT                   /translation="MLAISSNLSKMIIFIIAIIIIVVLCVITYLYLYKDESLVSKHYIN
FT                   YMAIPENDGVFTWLPDFFPHVAVDISIYTNVEDDYFFLIFP"
FT   gene            661531..661680
FT                   /locus_tag="G2583_0620"
FT   CDS_pept        661531..661680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55245"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKJ0"
FT                   /protein_id="ADD55245.1"
FT                   /translation="MRAREQVAKIVSKNDPDTKKVWCKYGKIPGQGDGVNLFLLVKLML
FT                   RIIL"
FT   gene            complement(661675..661827)
FT                   /locus_tag="G2583_0621"
FT   CDS_pept        complement(661675..661827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55246"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKJ1"
FT                   /protein_id="ADD55246.1"
FT                   /translation="MALHNSRHVFSQSGILLFLTTKLTTSIWDRLLIQAITLHKHQAIQ
FT                   LQYLL"
FT   gene            complement(662236..662643)
FT                   /gene="ylbG"
FT                   /locus_tag="G2583_0622"
FT   CDS_pept        complement(662236..662643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbG"
FT                   /locus_tag="G2583_0622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55247"
FT                   /db_xref="GOA:D3QKJ2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKJ2"
FT                   /protein_id="ADD55247.1"
FT                   /translation="MSNPYPKQEVTLMLHTANPVIKHKAGLLNLAEELSNVSKACKIMG
FT                   VSRDTFYRYRELVAEGGVDAQINRSRRAPNLKNRTDEATEQAVVDYAVAFPTHGQHRAS
FT                   NELRKQGVFISDSGVRSVWLLHNLENLKRRY"
FT   gene            complement(662723..663817)
FT                   /gene="ybbB"
FT                   /locus_tag="G2583_0623"
FT   CDS_pept        complement(662723..663817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbB"
FT                   /locus_tag="G2583_0623"
FT                   /product="tRNA 2-selenouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55248"
FT                   /db_xref="GOA:D3QKJ3"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKJ3"
FT                   /protein_id="ADD55248.1"
FT                   /translation="MQERHTEQDYRALLIADTPIIDVRAPIEFEQGAMPAAINLPLMNN
FT                   DERAAVGTCYKQQGSDAALALGHKLVAGEIRQQRMDAWRAACLQNPQGILCCARGGQRS
FT                   HIVQSWLHAAGIDYPLVEGGYKALRQTAIQATIELAQKPIVLIGGCTGSGKTLLVQQQP
FT                   NGVDLEGLARHRGSAFGRTLQPQLSQASFENLLAAEMLKTDARQNLRLWVLEDESRMIG
FT                   SNHLPECLRERMTQAAIAVVEDPFEIRLERLNEEYFLRMHHDFTHAYGDEQGWQEYCEY
FT                   LHHGLSAIKRRLGLQRYNELAARLDAALTTQLTTGSTDGHLAWLVPLLEEYYDPMYRYQ
FT                   LEKKAEKVVFRGEWAEVAEWVKAQ"
FT   gene            complement(663886..664812)
FT                   /gene="allS"
FT                   /locus_tag="G2583_0624"
FT   CDS_pept        complement(663886..664812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allS"
FT                   /locus_tag="G2583_0624"
FT                   /product="DNA-binding transcriptional activator of the allD
FT                   operon"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55249"
FT                   /db_xref="GOA:D3QKJ4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKJ4"
FT                   /protein_id="ADD55249.1"
FT                   /translation="MFDPETLRTFIAVAETGSFSKAAERLCKTTATISYRIKLLEENTG
FT                   VALFFRTTRSVTLTAAGEHLLSQARDWLSWLESMPSELQQVNDGVERQVNIVINNLLYN
FT                   PQAVAQLLAWLNERYPFTQFHISRQIYMGVWDSLLYEGFSLAIGVTGTEALANTFSLDP
FT                   LGSVQWRFVMAADHPLANVEEPLTEAQLRRFPAVNIEDSARTLTKRVAWRLPGQKEIIV
FT                   PDMETKIAAHLAGVGIGFLPKSLCQSMIDNQQLVSRVIPTMRPPSPLSLAWRKFGSGKA
FT                   VEDIVTLFTQRRPEISGFLEIFGNPRS"
FT   gene            665042..665524
FT                   /gene="allA"
FT                   /locus_tag="G2583_0625"
FT   CDS_pept        665042..665524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allA"
FT                   /locus_tag="G2583_0625"
FT                   /product="Ureidoglycolate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55250"
FT                   /db_xref="GOA:D3QKJ5"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR023525"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKJ5"
FT                   /protein_id="ADD55250.1"
FT                   /translation="MKLQVLPLSQEAFSAYGDVIETQQRDFFHINNGLVERYHDLALVE
FT                   ILEQDRTLISINRAQPANLPLTIHELERHPLGTQAFIPMKGEVFVVVVALGDDKPDLST
FT                   LRAFITNGEQGVNYHRNVWHHPLFAWQRVTDFLTIDRGGSDNCDVESIPEQELCFA"
FT   gene            665602..666417
FT                   /gene="allR"
FT                   /locus_tag="G2583_0626"
FT   CDS_pept        665602..666417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allR"
FT                   /locus_tag="G2583_0626"
FT                   /product="Putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55251"
FT                   /db_xref="GOA:D3QKJ6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKJ6"
FT                   /protein_id="ADD55251.1"
FT                   /translation="MTEVRRRGRPGQAEPVAQKGAQALERGIAILQYLEKSGGSSSVSD
FT                   ISLNLDLPLSTTFRLLKVLQAADFVYQDSQLGWWHIGLGVFNVGAAYIHNRDVLSVAGP
FT                   FMRRLMLLSGETVNVAIRNGNEAVLIGQLECKSMVRMCAPLGSRLPLHASGAGKALLYP
FT                   LAEEELMSIILQTGLQQFTPTTLVDMPTLLKDLEQARELGYTVDKEEHVVGLNCIASAI
FT                   YDDVGSVVAAISISGPSSRLTEDRFVSQGELVRDTARDISTALGLKAHP"
FT   gene            666507..668288
FT                   /gene="gcl"
FT                   /locus_tag="G2583_0627"
FT   CDS_pept        666507..668288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcl"
FT                   /locus_tag="G2583_0627"
FT                   /product="Glyoxylate carboligase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55252"
FT                   /db_xref="GOA:D3QKJ7"
FT                   /db_xref="InterPro:IPR006397"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKJ7"
FT                   /protein_id="ADD55252.1"
FT                   /translation="MAKMRAVDAAMYVLEKEGITTAFGVPGAAINPFYSAMRKHGGIRH
FT                   ILARHVEGASHMAEGYTRATAGNIGVCLGTSGPAGTDMITALYSASADSIPILCITGQA
FT                   PRARLHKEDFQAVDIEAIAKPVSKMAVTVREAALVPRVLQQAFHLMRSGRPGPVLVDLP
FT                   FDVQVAEIEFDPDMYEPLPVYKPAASRMQIEKAVEMLIQAERPVIVAGGGVINADAAAL
FT                   LQQFAELTSVPVIPTLMGWGCIPDDHELMAGMVGLQTAHRYGNATLLASDMVFGIGNRF
FT                   ANRHTGSVEKYTEGRKIVHIDIEPTQIGRVLCPDLGIVSDAKAALTLLVEVAQEMQKAG
FT                   RLPCRKEWVADCQQRKRTLLRKTHFDNVPVKPQRVYEEMNKAFGRDVCYVTTIGLSQIA
FT                   AAQMLHVFKDRHWINCGQAGPLGWTIPAALGVCAADPKRNVVAISGDFDFQFLIEELAV
FT                   GAQFNIPYIHVLVNNAYLGLIRQSQRAFDMDYCVQLAFENINSSEVNGYGVDHVKVAEG
FT                   LGCKAIRVFKPEDIAPAFEQAKALMAQYRVPVVVEVILERVTNISMGSELDNVMEFEDI
FT                   ADNAADAPTETCFMHYE"
FT   gene            668301..669077
FT                   /gene="hyi"
FT                   /locus_tag="G2583_0628"
FT   CDS_pept        668301..669077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyi"
FT                   /locus_tag="G2583_0628"
FT                   /product="Glyoxylate-induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55253"
FT                   /db_xref="GOA:D3QKJ8"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR017643"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKJ8"
FT                   /protein_id="ADD55253.1"
FT                   /translation="MLRFSANLSMLFGEYDFLARFEKAAQCGFRGVEFMFPYDYDIEEL
FT                   KQVLASNKLEHTLHNLPAGDWAAGERGIACIPGREEEFRDGVAAAIRYARALGNKKINC
FT                   LVGKTPAGFSSEQIHATLVENLRYAANMLMKEDILLLIEPINHFDIPGFHLTGTRQALK
FT                   LIDDVGCCNLKIQYDIYHMQRMEGELTNTMTQWADKIGHLQIADNPHRGEPGTGEINYD
FT                   YLFKVIENSDYNGWVGCEYKPQTTTEAGLRWMDPYR"
FT   gene            669178..670056
FT                   /gene="glxR"
FT                   /locus_tag="G2583_0629"
FT   CDS_pept        669178..670056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxR"
FT                   /locus_tag="G2583_0629"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55254"
FT                   /db_xref="GOA:D3QKJ9"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006398"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKJ9"
FT                   /protein_id="ADD55254.1"
FT                   /translation="MKLGFIGLGIMGTPMAINLARAGHQLHVTTIGPVADELLSLGAVN
FT                   VDTARQVTEAADIIFIMVPDTPQVEEVLFGENGCTKASLKGKTIVDMSSISPIETKRFA
FT                   RQVNELGGDYLDAPVSGGEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVGGNG
FT                   DGQTCKVANQIIVALNIEAVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMI
FT                   KRTFNPGFKIALHQKDLNLALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSALVQ
FT                   ALELMANHKLA"
FT   gene            670088..670366
FT                   /gene="ybbV"
FT                   /locus_tag="G2583_0630"
FT   CDS_pept        670088..670366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbV"
FT                   /locus_tag="G2583_0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55255"
FT                   /db_xref="GOA:D3QKK0"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKK0"
FT                   /protein_id="ADD55255.1"
FT                   /translation="MNRPAILKKKAAKDVASVLKIIFLFYFFLIARLKQRYSIREIKRD
FT                   LWNIRENYSSNAAIAKIYCRKRKASGPGKHLTILPYGWVRFITFPIM"
FT   gene            670225..671616
FT                   /gene="ybbW"
FT                   /locus_tag="G2583_0631"
FT   CDS_pept        670225..671616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbW"
FT                   /locus_tag="G2583_0631"
FT                   /product="Cytosine/uracil/thiamine/allantoin permease"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55256"
FT                   /db_xref="GOA:D3QKK1"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKK1"
FT                   /protein_id="ADD55256.1"
FT                   /translation="MEHQRKLFQQRGYSEDLLPKTQSQRTWKTFNYFTLWMGSVHNVPN
FT                   YVMVGGFFILGLSTFSIMLAIILSAFFIAAVMVLNGAAGSKYGVPFAMILRASYGVRGA
FT                   LFPGLLRGGIAAIMWFGLQCYAGSLACLILIGKIWPGFLTLGGDFTLLGLSLPGLITFL
FT                   LFWLVNVGIGFGGGKVLNKFTAILNPCIYIVFGGMAIWAISLVGLGPIFDYIPSGIQKA
FT                   ENSGFLFLVVINAVVAVWAAPAVSASDFTQNAHSFREQALGQTLGLVVAYILFAVAGVC
FT                   IIAGASIHYGADTWNVLDIVQRWDSLFASFFAVLVILMTTISTNATGNIIPAGYQIAAI
FT                   APTKLTYKNGVLIASIISLLICPWKLMENQDSIYLFLDIIGGMLGPVIGVMMAHYFVVM
FT                   RGQINLDELYTAPGDYKYYDNGFNLTAFSVTLVAVILSLGGKFIPLMEPLSRVSWFVGV
FT                   IVAFA"
FT   gene            671653..673014
FT                   /gene="allB"
FT                   /locus_tag="G2583_0632"
FT   CDS_pept        671653..673014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allB"
FT                   /locus_tag="G2583_0632"
FT                   /product="Dihydroorotase-like cyclic amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55257"
FT                   /db_xref="GOA:D3QKK2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR017593"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKK2"
FT                   /protein_id="ADD55257.1"
FT                   /translation="MSFDLIIKNGTVILENEARVVDIAVKGGKIAAIGQDLGDAKEVMD
FT                   ASGLVVSPGMVDAHTHISEPGRSHWEGYETGTRAAAKGGITTMIEMPLNQLPATVDRAS
FT                   IELKFDAAKGKLTIDAAQLGGLVSYNIDRLHELDEVGVVGFKCFVATCGDRGIDNDFRD
FT                   VNDWQFFKGAQKLGELGQPVLVHCENALICDALGEEAKREGRVTAHDYVASRPVFTEVE
FT                   AIRRVLYLAKVAGCRLHVCHISSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEI
FT                   GTLAKCSPPIRDLENQKGMWEKLFNGEIDRLVSDHSPCPPEMKAGNIMEAWGGIAGLQN
FT                   CMDVMFDEAVQKRGMSLPMFGKLMATNAADIFGLQQKGRIAPGKDADFVFIQPNSSYVL
FT                   TNDDLEYRHKVSPYVGRTIGARITKTILRGDVIYDIEQGFPVAPKGQFILKHQQ"
FT   gene            673065..674372
FT                   /gene="ybbY"
FT                   /locus_tag="G2583_0633"
FT   CDS_pept        673065..674372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbY"
FT                   /locus_tag="G2583_0633"
FT                   /product="Putative purine permease ybbY"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55258"
FT                   /db_xref="GOA:D3QKK3"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKK3"
FT                   /protein_id="ADD55258.1"
FT                   /translation="MFMFNFAVSSESLLSGFQWFFFIFCNTVVVPPTLLSAFQLPQSSL
FT                   LTLTQYAFLATALACFAQAFCGHRRAIMEGPGGLWWGTILTITLGEASRGTPINDIATS
FT                   LAVGIALSGVLTMLIGFSGLGHRLARLFTPSVMVLFMLMLGAQLTTIFFKGMLGLPFGI
FT                   ADPNFKIQLPPFALSVAVMCLVLAMIIFLPQRFARYGLLVGTITGWLLWYFCFPSSHSL
FT                   SGELHWQWFPLGSGGALSPGIILTAVITGLVNISNTYGAIRGTDVFYPQQGAGNTRYRR
FT                   SFVATGFMTLITVPLAVIPFSPFVSSIGLLTQTGDYTRRSFIYGSVICLLVALVPALTR
FT                   LFCSIPLPVSSAVMLVSYLPLLFSALVFSQQITFTARNIYRLALPLFVGIFLMALPPVY
FT                   LQDLPLTLRPLLSNGLLVGILLAVLMDNLIPWERIE"
FT   gene            674394..675539
FT                   /gene="glxK"
FT                   /locus_tag="G2583_0634"
FT   CDS_pept        674394..675539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="G2583_0634"
FT                   /product="Glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55259"
FT                   /db_xref="GOA:D3QKK4"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKK4"
FT                   /protein_id="ADD55259.1"
FT                   /translation="MKIVIAPDSFKESLSAEKCCQAIKAGFSTLFPDANYICLPIADGG
FT                   EGTVDAMVAATGGNIVTLEVCGPMGEKVNAFYGITGDGKTAVIEMAAASGLMLVAPEKR
FT                   NPLLASSFGTGELIRHALDNGIRHIILGIGGSATVDGGMGMAQALGVRFLDADGQVLVA
FT                   NGGNLARVASIEMEECDPRLANCHIEVACDVDNPLVGARGAAAVFGPQKGATPEMVEEL
FT                   EQGLQNYARVLQQQTEINVCQMAGGGAAGGMGIAAAVFLNADIKPGIEIVLRAVNLEQA
FT                   VQGAALVITGEGRIDSQTAGGKAPLGVASVAKQFNVPVIGIAGVLGDGVEVVHQYGIDA
FT                   VFSILPRLAPLAEVLASGETNLFNSARNIACAIKIGQGIKN"
FT   gene            complement(675767..676552)
FT                   /gene="ylbA"
FT                   /locus_tag="G2583_0635"
FT   CDS_pept        complement(675767..676552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbA"
FT                   /locus_tag="G2583_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55260"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKK5"
FT                   /protein_id="ADD55260.1"
FT                   /translation="MGYLNNVTGYRDDLLANRAIVKHGNFALLTPDGLVKNIIPGFENC
FT                   DATILSTPKLGASFVDYLVTLHQNGGNQQGFGGEGIETFLYVISGNITAKAEGKTFSLS
FT                   EGGYLYCPPGSLMTFVNAQAEDSQIFLYKRRYVPVEGYAPWLVSGNASELERIHYEGMD
FT                   DVILLDFLPKELGFDMNMHILSFAPGASHGYIETHVQEHGAYILSGQGVYNLDNNWIPV
FT                   KKGDYIFMGAYSLQAGYGVGRGEAFSYIYSKDCNRDVEI"
FT   gene            complement(676563..677798)
FT                   /gene="allC"
FT                   /locus_tag="G2583_0636"
FT   CDS_pept        complement(676563..677798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allC"
FT                   /locus_tag="G2583_0636"
FT                   /product="Allantoate amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55261"
FT                   /db_xref="GOA:D3QKK6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR017591"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKK6"
FT                   /protein_id="ADD55261.1"
FT                   /translation="MITHFRQTIEEALPWLSSFGADPAGGMTRLLYSPEWLETQQQFKK
FT                   RMAASGLETRFDEVGNLYGRLSGTEYPQEVILSGSHIDTVVNGGNLDGQFGALAARLAI
FT                   DWLKTQYGAPLRTVEVVAMAEEEGSRFPYVFWGSKNIFGLANPDDVRNICDAKGNSFVD
FT                   AMKACGFTLPDAPLTPRQDIKAFVELHIEQGCVLESNGQSIGVVNAIVGQRRYTVTLNG
FT                   ESNHAGTTPMGYRRDTVYAFSRICHQSIEKAKKMGDPLVLTFGKVEPRPNTVNVVPGKT
FT                   TFTIDCRHTDAAVLRDFTQQLENDMRAICDEMDIRIDIDLWMDEEPVPMNKDLVATLTE
FT                   LCESEKLNYRVMHSGAGHDAQIFAPRVPTCMIFIPSINGISHNPAERTNITDLAEGVKT
FT                   LALMLYQLAWQK"
FT   gene            complement(677820..678869)
FT                   /gene="allD"
FT                   /locus_tag="G2583_0637"
FT   CDS_pept        complement(677820..678869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allD"
FT                   /locus_tag="G2583_0637"
FT                   /product="Ureidoglycolate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55262"
FT                   /db_xref="GOA:D3QKK7"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR017590"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKK7"
FT                   /protein_id="ADD55262.1"
FT                   /translation="MKISRETLHQLIENKLCQAGLKREHAATVAEVLVYADARGIHSHG
FT                   AVRVEYYAERISKGGTNREPEFRLEETGPCSAILHADNAAGQVAAKMGMEHAIKTAQQN
FT                   GVAVVGISRMGHSGAISYFVQQAARAGLIGISMCQSDPMVVPFGGAEIYYGTNPLAFAA
FT                   PGEGDEILTFDMATTVQAWGKVLDARSRNMSIPDTWAVDKNGAPTTDPFAVHALLPAAG
FT                   PKGYGLMMMIDVLSGVLLGLPFGRQVSSMYDDLHAGRNLGQLHVVINPNFFSSSELFRQ
FT                   HLSQTMRELNAITPAPGFNQVYYPGQDQDIKQRQAAVEGIEIVDDIYQYLISDALYNTS
FT                   YETKNPFAQ"
FT   gene            679186..680853
FT                   /gene="fdrA"
FT                   /locus_tag="G2583_0638"
FT   CDS_pept        679186..680853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdrA"
FT                   /locus_tag="G2583_0638"
FT                   /product="Bacterial FdrA protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55263"
FT                   /db_xref="GOA:D3QKK8"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKK8"
FT                   /protein_id="ADD55263.1"
FT                   /translation="MIHAFIKKGCFQDSVSLMIISRKLSESENVDDVSVMMGTPANKAL
FT                   LDTTGFWHDDFNNATPNDICVAIRSEAADAGIAQAIMQQLEEALKQLAQGSGSSQALTQ
FT                   VRRWDSACQKLPDANLALISVAGEYAAELANQALDRNLNVMMFSDNVTLEDEIQLKTRA
FT                   REKGLLVMGPDCGTSMIAGTPLAFANVMPEGNIGVIGASGTGIQELCSQIALAGEGITH
FT                   AIGLGGRDLSREVGGISALTALEMLSADEKSEVLAFVSKPPAEAVRLKIVNAMKATGKP
FT                   TVALFLGYTPAVARDENVWFASSLDEAARLACLLSRVTARRNAIMPASSGFICGLYTGG
FT                   TLAAEAAGLLAGHLGVEADDAHHHGMMLDADGHQIIDLGDDFYTVGRPHPMIDPTLRNQ
FT                   LITDLGAKPQVRVLLLDVVIGFGATADPAASLVSAWQKACAARSDNQPLYAIATVTGTE
FT                   RDPQCRSQQIATLEDAGIAVVSSLPEATLLAAALIHPLSPAAQQHTPSLLENVAVINIG
FT                   LRSFALELQSASKPVVHYQWSPVAGGNKKLARLLERLQ"
FT   gene            680863..682122
FT                   /gene="ylbE"
FT                   /locus_tag="G2583_0639"
FT   CDS_pept        680863..682122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbE"
FT                   /locus_tag="G2583_0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55264"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKK9"
FT                   /protein_id="ADD55264.1"
FT                   /translation="MFTSVAQANAAVIEQIRRARPHWLDVQPASSLISELNEGKTLLHA
FT                   GPPMRWQEMTGPMKGACVGACLFEGWAKDEAQALAILEQGEVNFIPCHHVNAVGPMGGI
FT                   TSASMPMLVVENVTDGNRAYCNLNEGIGKVMRFGAYGEDVLTRHRWMRDVLMPVLSAAL
FT                   GRMERGIDLTAMMAQGITMGDEFHQRNIASSALLMRALAPQIARLDHDKQHIAEVMDFL
FT                   SVTDQFFLNLAMAYCKAAMDAGAMIRAGSIVTAMTRNGNMFGIRVSGLGERWFTAPVNT
FT                   PQGLFFTGFSQEQANPDMGDSAITETFGIGGAAMIAAPGVTRFVGAGGMEAARAVSEEM
FT                   AEIYLERNMQLQIPSWDFQGACLGLDIRRVVETGITPLINTGIAHKEAGIGQIGAGTVR
FT                   APLACFEQALEALAESMGIG"
FT   gene            682133..682948
FT                   /gene="ylbF"
FT                   /locus_tag="G2583_0640"
FT   CDS_pept        682133..682948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbF"
FT                   /locus_tag="G2583_0640"
FT                   /product="putative carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55265"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKL0"
FT                   /protein_id="ADD55265.1"
FT                   /translation="MTIIHPLLASSSAPNYRQSWRLAGVWRRAINLMTESGELLTLHRQ
FT                   GSGFGPGGWVLRRAQFDALCGGLCGNERPQVVAQGIRLGRFTVKQPQRYCLLRITPPAH
FT                   PQPLAAAWMQRAEETGLFGPLALAASDPLPAELRQFRHCFQAALNGVKTDWRHWLGKGP
FT                   GLTPSHDDTLSGMLLAAWYYGALDARSGRPFFACSDNLQLVTTAVSVSYLRYAAQGYFA
FT                   SPLLHFVHALSCPKRTAVAIDSLLALGHTSGADTLLGFWLGQQLLQGKP"
FT   gene            682945..683838
FT                   /gene="ybcF"
FT                   /locus_tag="G2583_0641"
FT   CDS_pept        682945..683838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcF"
FT                   /locus_tag="G2583_0641"
FT                   /product="Carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55266"
FT                   /db_xref="GOA:D3QKL1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKL1"
FT                   /protein_id="ADD55266.1"
FT                   /translation="MKTLVVALGGNALLQRGEALTAENQYRNIASAVPALARLARSYRL
FT                   AIVHGNGPQVGLLALQNLAWKEVEPYPLDVLVAESQGMIGYMLAQSLSAQPQMPPVTTV
FT                   RTRIEVSPDDPAFLQPEKFIGPVYQPEEQEALEAAYGWQMKRDGKYLRRVVASPQPRKI
FT                   LDSEAIELLLKEGHVVICSGGGGVPVTDDGAGSEAVIDKDLAAALLAEQINADGLVILT
FT                   DADAVYENWGTPQQRAIRHATPDELAPFAKADGSMGPKVTAVSGYVRSRGKPAWIGALS
FT                   RIEETLAGEAGTCISL"
FT   gene            complement(683977..685044)
FT                   /gene="purK"
FT                   /locus_tag="G2583_0642"
FT   CDS_pept        complement(683977..685044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="G2583_0642"
FT                   /product="Phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55267"
FT                   /db_xref="GOA:D3QKL2"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKL2"
FT                   /protein_id="ADD55267.1"
FT                   /translation="MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSV
FT                   ITAEIERWPETALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERS
FT                   EWPAVFDRLGELAIVKRRTGGYDGRGQWRLRADETEQLPAECYGECIVEQGINFSGEVS
FT                   LVGARCFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQAQAEEMLSAIMQELGYVGV
FT                   MAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSV
FT                   MINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLSATLEALIPLLP
FT                   PEYASGVMWAQSKFS"
FT   gene            complement(685041..685550)
FT                   /gene="purE"
FT                   /locus_tag="G2583_0643"
FT   CDS_pept        complement(685041..685550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="G2583_0643"
FT                   /product="Phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55268"
FT                   /db_xref="GOA:D3QKL3"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKL3"
FT                   /protein_id="ADD55268.1"
FT                   /translation="MSSRNNPARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAH
FT                   RTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSL
FT                   YSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENP
FT                   DPRGAA"
FT   gene            complement(685668..686390)
FT                   /gene="lpxH"
FT                   /locus_tag="G2583_0644"
FT   CDS_pept        complement(685668..686390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxH"
FT                   /locus_tag="G2583_0644"
FT                   /product="UDP-2,3-diacylglucosamine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55269"
FT                   /db_xref="GOA:D3QKL4"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKL4"
FT                   /protein_id="ADD55269.1"
FT                   /translation="MATLFIADLHLCVEEPAITAGFLRFLAGEARKADALYILGDLFEA
FT                   WIGDDDPNPLHRQMAAAIKAVSDSGVPCYFIHGNRDFLLGKRFARESGMTLLPEEKVLE
FT                   LYGRRVLIMHGDTLCTDDAGYQAFRTKVHKPWLQTLFLALPLFVRKRIAVRMRANSKEA
FT                   NSSKSLAIMDVNQNAVVSAMEKHQVQWLIHGHTHRPAVHELIANQQPAFRVVLGAWHTE
FT                   GSMVKVTADDVELIHFPF"
FT   gene            complement(686393..686887)
FT                   /gene="ppiB"
FT                   /locus_tag="G2583_0645"
FT   CDS_pept        complement(686393..686887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiB"
FT                   /locus_tag="G2583_0645"
FT                   /product="Peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55270"
FT                   /db_xref="GOA:D3QKL5"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKL5"
FT                   /protein_id="ADD55270.1"
FT                   /translation="MVTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGFYNNTIFHRVI
FT                   NGFMIQGGGFEPGMKQKATKEPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVD
FT                   NDFLNFSGESLQGWGYCVFAEVVEGMDVVDKIKGVATGRSGMHQDVPKEDVIIESVTVS
FT                   E"
FT   gene            687061..688446
FT                   /gene="cysS"
FT                   /locus_tag="G2583_0646"
FT   CDS_pept        687061..688446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="G2583_0646"
FT                   /product="Cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55271"
FT                   /db_xref="GOA:D3QKL6"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKL6"
FT                   /protein_id="ADD55271.1"
FT                   /translation="MLKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFV
FT                   AFDVVARYLRFLGYKLKYVRNITDIDDKIIKRANENGESFVALVDRMIAEMHKDFDALN
FT                   ILRPDMEPRATHHIAEIIELTEQLIAKGHAYVADNGDVMFDVPTDPTYGVLSRQDLDQL
FT                   QAGARVDVVDDKRNPMDFVLWKMSKEGEPSWPSPWGAGRPGWHIECSAMNCKQLGNHFD
FT                   IHGGGSDLMFPHHENEIAQSTCAHDGQYVNYWMHSGMVMVDREKMSKSLGNFFTVRDVL
FT                   KYYDAETVRYFLMSGHYRSQLNYSEENLKQARAALERLYTALRGTDKTVAPAGGEAFEA
FT                   RFIEAMDDDFNTPEAYSVLFDMAREVNRLKVEDMAAANAMASHLRKLSAVLGLLEQEPE
FT                   AFLQSGAQADDSEVAEIEALIQQRLDARKAKDWAAADAARDRLNEMGIVLEDGPQGTTW
FT                   RRK"
FT   gene            complement(688482..689003)
FT                   /gene="ybcI"
FT                   /locus_tag="G2583_0647"
FT   CDS_pept        complement(688482..689003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcI"
FT                   /locus_tag="G2583_0647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55272"
FT                   /db_xref="GOA:D3QKL7"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKL7"
FT                   /protein_id="ADD55272.1"
FT                   /translation="MPTVITHAAVPLCIGLGLGSKVIPPRLLFAGIILAMLPDADVLSF
FT                   NFGVAYGNVFGHRGFTHSLVFAFVVPLLCVLIGRRWFRAGLIRCWLFLTVSLLSHSLLD
FT                   SVTTGGKGVGWLWPWSDERFFAPWQVIKVAPFALSRYTTAYGHQVIISELMWVWLPGML
FT                   LMGMLWWRRR"
FT   gene            complement(689111..689323)
FT                   /gene="ybcJ"
FT                   /locus_tag="G2583_0648"
FT   CDS_pept        complement(689111..689323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcJ"
FT                   /locus_tag="G2583_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55273"
FT                   /db_xref="GOA:D3QKL8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKL8"
FT                   /protein_id="ADD55273.1"
FT                   /translation="MATFSLGKHPHVELCDLLKLEGWSESGAQAKIAIAEGQVKVDGAV
FT                   ETRKRCKIVAGQTVSFAGHSVQVVA"
FT   gene            complement(689325..690191)
FT                   /gene="folD"
FT                   /locus_tag="G2583_0649"
FT   CDS_pept        complement(689325..690191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="G2583_0649"
FT                   /product="Bifunctional protein folD [Includes:
FT                   Methylenetetrahydrofolate dehydrogenase]"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55274"
FT                   /db_xref="GOA:D3QKL9"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKL9"
FT                   /protein_id="ADD55274.1"
FT                   /translation="MAAKIIDGKTIAQQVRSEVAQKVQARIAAGLRAPGLAVVLVGSNP
FT                   ASQIYVASKRKACEEVGFVSRSYDLPETTSEAELLELIDALNADNTIDGILVQLPLPAG
FT                   IDNVKVLERIHPDKDVDGFHPYNVGRLCQRAPRLRPCTPRGIVTLLERYNIDTFGLNAV
FT                   VIGASNIVGRPMSMELLLAGCTTTVTHRFTKNLRHHVENADLLIVAVGKPGFIPGDWIK
FT                   EGAIVIDVGINRLENGKVVGDVVFEDAAKRASYITPVPGGVGPMTVATLIENTLQACVE
FT                   YHDPQGE"
FT   gene            690638..691213
FT                   /gene="sfmA"
FT                   /locus_tag="G2583_0650"
FT   CDS_pept        690638..691213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmA"
FT                   /locus_tag="G2583_0650"
FT                   /product="Putative fimbrial-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55275"
FT                   /db_xref="GOA:D3QKM0"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKM0"
FT                   /protein_id="ADD55275.1"
FT                   /translation="MESINEIEGIYMKLRFISSALAAALFAATGSYAAVVDGGTIHFEG
FT                   ELVNAACSVNTDSADQVVTLGQYRTDIFNAVGNTSALIPFTIQLNDCDPVVAANAAVAF
FT                   SGQADAINDNLLAIASSTNTTTATGVGIEILDNTSAILKPDGNSFSTNQNLIPGTNVLH
FT                   FSARYKGTGTSASAGQANADATFIMRYE"
FT   gene            691433..692125
FT                   /gene="sfmC"
FT                   /locus_tag="G2583_0651"
FT   CDS_pept        691433..692125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmC"
FT                   /locus_tag="G2583_0651"
FT                   /product="Chaperone protein FimC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55276"
FT                   /db_xref="GOA:D3QKM1"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKM1"
FT                   /protein_id="ADD55276.1"
FT                   /translation="MMTKIKLLMLIIFYLIISASVHAAGGIALGATRIIYPADAKQTAV
FT                   WIRNSHTNERFLVNSWIENSSGVKEKSFIITPPLFVSEPKSENTLRIIYTGPPLAADRE
FT                   SLFWMNVKTIPSVDKNALNGRNVLQLAILSLMKLFLRPIQLQELPAEAPDTLKFSRSGN
FT                   YINVHNPSPFYVTLVNLQVGSQKLGNAMAAPRVNSQIPLPSGVQGKLKFQTVNDYGSVT
FT                   PVREVNLN"
FT   gene            692156..694765
FT                   /gene="sfmD"
FT                   /locus_tag="G2583_0652"
FT   CDS_pept        692156..694765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmD"
FT                   /locus_tag="G2583_0652"
FT                   /product="Outer membrane usher protein SfmD"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55277"
FT                   /db_xref="GOA:D3QKM2"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKM2"
FT                   /protein_id="ADD55277.1"
FT                   /translation="MKIPTTTDIPQRYTWCLAGICYSSLAILPSFLSYAESYFNPAFLL
FT                   ENGTSVADLSRFERGNHQPAGVYRVDLWRNDEFIGSQDIVFESTTENTGDKSGGLMPCF
FT                   NQVLLERIGLNSSAFPELAQQQNNKCINLLKAVPDATINFDFAAMRLNITIPQIALLSS
FT                   AHGYIPPEEWDEGVPALLLNYNFTGNRGNGNDSYFFSELSGINIGPWRLRNNGSWNYFR
FT                   GNGYHSEQWNNIGTWVQRAIIPLKSELVMGDGNTGSDIFDGVGFRGVRLYSSDNMYPDS
FT                   QQGFAPTVRGIARTAAQLTIRQNGFIIYQSYVSPGAFEITDLHPTSSNGDLDVTIDERD
FT                   GNQQNYTIPYSTVPILQREGRFKFDLTAGDFRSSNSQQSSPFFFQGTALGGLPQEFTAY
FT                   GGTQLSANYTAFLLGLGRNLGNWGAVSLDVTHARSQLADDSRHEGDSIRFLYAKSMNTF
FT                   GTNFQLMGYRYSTQGFYTLDDVAYRRMEGYEYDYDYDGEHRDEPIIVNYHNLRFSRKDR
FT                   LQLNISQSLNDFGSLYISGTHQKYWNTSDSDTWYQVGYTSSWVGISYSLSFSWNESVGI
FT                   PDNERIVGLNVSVPFNVLTKRRYTRENALDRAYASFNANRNSNGQNSWLAGVGGTLLEG
FT                   HNLSYHVSQGDTSNNGYTGSATANWQAAYGTLGVGYNYDRDQHDVNWQLSGGVVGHENG
FT                   ITLSQPLGDTNVLIKAPGAGGVRIENQTGILTDWRGYAVMPYATVYRYNRIALDTNTMG
FT                   NSIDVEKNISSVVPTQGALVRANFDTRIGVRALITVTQGGKPVPFGSLVRENSTGITSM
FT                   VGDDGQVYLSGAPLSGELLVQWGDGANSRCIAHYVLPKQSLQQAVTVISAVCTHPGS"
FT   gene            694778..695785
FT                   /gene="sfmH"
FT                   /locus_tag="G2583_0653"
FT   CDS_pept        694778..695785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmH"
FT                   /locus_tag="G2583_0653"
FT                   /product="Involved in fimbrial asembly precursor"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55278"
FT                   /db_xref="GOA:D3QKM3"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKM3"
FT                   /protein_id="ADD55278.1"
FT                   /translation="MKIICRLLLAMACLCLANISWATVCANSTGVAEDEHYDLSNVFNS
FT                   TNNQPGQIVVLPEKSGWVGVSAICPPGTLVNYTYRSYVTNFIVQETIDNYKYMQLNDYL
FT                   LGAMSLVDSVMDIQFPPQNYIRMGTDPNVSQNLPFGVMDSRLIFRLKVIRPFINMVEIP
FT                   RQVMFTVYVTSTPYDPLVTPVYTISFGGRVEVPQNCELNAGQIVEFDFGDIGASLFSAA
FT                   GPGNRPAGVMPQTKSIAVKCTNVAAQAYLTMRLEASAVSGQAMVSDNQDLGFIVADQND
FT                   TPITPNDLNSVIPFRLDAAAAANVTLRAWPISITGQKPTEGPFSALGYLRVDYQ"
FT   gene            695796..696311
FT                   /gene="sfmF"
FT                   /locus_tag="G2583_0654"
FT   CDS_pept        695796..696311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmF"
FT                   /locus_tag="G2583_0654"
FT                   /product="Putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55279"
FT                   /db_xref="GOA:D3QKM4"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKM4"
FT                   /protein_id="ADD55279.1"
FT                   /translation="MRRVFFSCFCGLLWSSSGWAADPLGTININLHGNVVDFSCTVNTA
FT                   DIDKTVDLGRWPTTQLLNAGDTTALLPFSLRLEGCPPGSVAILFTGTPASDANLLALDD
FT                   PAMAQTVAIELRNSDRSRLALGEASPTEEVDANGNVTLNFFANYRALASGVRPGVAKAD
FT                   AIFMINYN"
FT   gene            complement(696314..697009)
FT                   /gene="fimZ"
FT                   /locus_tag="G2583_0655"
FT   CDS_pept        complement(696314..697009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimZ"
FT                   /locus_tag="G2583_0655"
FT                   /product="Fimbrial Z protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55280"
FT                   /db_xref="GOA:D3QKM5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKM5"
FT                   /protein_id="ADD55280.1"
FT                   /translation="MYQSTIYRPNGKLSAPMRLVTMKPTSVIIMDTHPIIRMSIEVLLQ
FT                   KNSELQIVLKTDDYRITIDYLRPRPVDLIIMDIDLPGTDGFTFLKRIKQIQSTVKVLFL
FT                   SSKSECFYAGRAIQAGANGFVSKCNDQNDIFHAVQMILSGYTFFPSETLNYIKSNKCST
FT                   NSSTVTVLSNREVTILRYLVSGLSNKEIADKLLLSNKTVSAHKSNIYGKLGLHSIVELI
FT                   DYAKLYELI"
FT   gene            697188..697266
FT                   /locus_tag="G2583_0656"
FT   tRNA            697188..697266
FT                   /locus_tag="G2583_0656"
FT                   /product="tRNA-Arg"
FT   gene            complement(697281..698444)
FT                   /gene="intD"
FT                   /locus_tag="G2583_0657"
FT   CDS_pept        complement(697281..698444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="intD"
FT                   /locus_tag="G2583_0657"
FT                   /product="Prophage DLP12 integrase"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55281"
FT                   /db_xref="GOA:D3QKM6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKM6"
FT                   /protein_id="ADD55281.1"
FT                   /translation="MSLFRRNEIWYASYSLPGGKRIKESLGTKDKRQAQELHDKRKAEL
FT                   WRVEKLGDLPDVTFEEACLRWLEEKADKKSLDSDKSRIEFWLEHFEGIRLKDISEAKIY
FT                   SAVSRMHNRKTKEIWKQKVQAAIRKGKEPPVYEPKPVSTQTKAKHLAMIKAILRAAERD
FT                   WKWLEKAPVIKIPAVRNKRVRWLEKEEAKRLIDECPEPLKSVVKFALATGLRKSNIINL
FT                   EWQQIDMQRRVAWVNPEESKSNRAIGVALNDTACKVLRDQIGKHHKWVFVHTKAAKRAD
FT                   GTSTPAVRKMRIDSKTSWLSACRRAGIEDFRFHDLRHTWASWLIQSGVPLSVLQEMGGW
FT                   ESIEMVRRYAHLAPNHLTEHARKIDDIFGDNVPNMSHSGIMEDIKKA"
FT   gene            complement(698643..698921)
FT                   /locus_tag="G2583_0658"
FT   CDS_pept        complement(698643..698921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0658"
FT                   /product="Hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55282"
FT                   /db_xref="InterPro:IPR025317"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKM7"
FT                   /protein_id="ADD55282.1"
FT                   /translation="MFRIIFPNTCYVDHHGTPCKILRSTHNKVHYIRKGRTCIASMFRF
FT                   NHDFEPVNKADADRIAEEIETAEHIKKLRDMRSKSRGNHGIIQPHTR"
FT   gene            complement(698969..699187)
FT                   /locus_tag="G2583_0659"
FT   CDS_pept        complement(698969..699187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0659"
FT                   /product="Hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55283"
FT                   /db_xref="GOA:D3QKM8"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKM8"
FT                   /protein_id="ADD55283.1"
FT                   /translation="MADIIDSASEIEELQRNTAIKMRRLNYQTVSATHCCECGDPIDER
FT                   RRLAVQGCRTCASCQEEIELKNKQWGL"
FT   gene            complement(699286..699567)
FT                   /locus_tag="G2583_0660"
FT   CDS_pept        complement(699286..699567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0660"
FT                   /product="Unknown protein encoded within prophage"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55284"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKM9"
FT                   /protein_id="ADD55284.1"
FT                   /translation="MHFSGSGLHILCAYACRHGACSMTPQQENALRSIARQANSEIKKA
FT                   RQHFPDKNVDDICRSVLKKHRETVTLMGFTPTHLSLAIGMLNGVFKER"
FT   gene            complement(699578..699769)
FT                   /locus_tag="G2583_0661"
FT   CDS_pept        complement(699578..699769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0661"
FT                   /product="protein of unknown function DUF1382"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55286"
FT                   /db_xref="InterPro:IPR009814"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKN0"
FT                   /protein_id="ADD55286.1"
FT                   /translation="MHKASPVELRTSIEMAHSLAQIGVRFVPIPVETDEEFHTLATSLS
FT                   QKLEMMVAKAEADERDQA"
FT   gene            699721..700047
FT                   /locus_tag="G2583_0662"
FT   CDS_pept        699721..700047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55285"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKN1"
FT                   /protein_id="ADD55285.1"
FT                   /translation="MPSQYSFLTQQEMLCAYRLPFIIYLLSQPLCFQWISDNRKAGKYP
FT                   ASLCNGVDESDRAYPDIIVRMRHRHCSPNTKPISASASSIFSMNSGTISSKLAMYFSFR
FT                   SITT"
FT   gene            complement(699921..700601)
FT                   /gene="ybcC"
FT                   /locus_tag="G2583_0663"
FT   CDS_pept        complement(699921..700601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcC"
FT                   /locus_tag="G2583_0663"
FT                   /product="Putative exonuclease encoded by prophage CP-933K"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55287"
FT                   /db_xref="GOA:D3QKN2"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKN2"
FT                   /protein_id="ADD55287.1"
FT                   /translation="MIPDIILQRTGIDVRAVEQGDDAWHKLRLGVITASEVHNVIAKPR
FT                   SGKKWPDMKMSYFHTLLAEVCTGVAPEVNAKALAWGKRYENDARTLFEFTSGVNVTESP
FT                   IIYRDESMRTACSPDGLCSDGNGLELKCPFTSRDFMKFRLGGFEAIKSAYMAQVQYSMW
FT                   VTRKDAWYFANYDPRMKREGLHYVVIERNEKYMASFDEMVPEFIEKMDEALAEIGFVFG
FT                   EQWR"
FT   gene            complement(700598..701383)
FT                   /gene="betW"
FT                   /locus_tag="G2583_0664"
FT   CDS_pept        complement(700598..701383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betW"
FT                   /locus_tag="G2583_0664"
FT                   /product="Bet protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55288"
FT                   /db_xref="GOA:D3QKN3"
FT                   /db_xref="InterPro:IPR010183"
FT                   /db_xref="InterPro:IPR018330"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKN3"
FT                   /protein_id="ADD55288.1"
FT                   /translation="MSTALATLAGKLAERVGMDSVDPQELITTLRQTAFKGDASDAQFI
FT                   ALLIVANQYGLNPWTKEIYAFPDKQNGIVPVVGVDGWSRIINENQQFDGMDFEQDNESC
FT                   TCRIYRKDRNHPICVTEWMDECRREPFKTREGREITGPWQSHPKRMLRHKAMIQCARLA
FT                   FGFAGIYDKDEAERIVENTAYTAERQPERDITPVNDETMQEINTLLIALDKTWDDDLLP
FT                   LCSQIFRRDIRASSELTQAEAVKALGFLKQKATEQKVAA"
FT   gene            complement(701389..701685)
FT                   /gene="gam"
FT                   /locus_tag="G2583_0665"
FT   CDS_pept        complement(701389..701685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gam"
FT                   /locus_tag="G2583_0665"
FT                   /product="Host-nuclease inhibitor protein gam"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55289"
FT                   /db_xref="GOA:D3QKN4"
FT                   /db_xref="InterPro:IPR009274"
FT                   /db_xref="InterPro:IPR042034"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKN4"
FT                   /protein_id="ADD55289.1"
FT                   /translation="MNAYYIQDRLEAQSWARHYQQIAREEKEAELADDMEKGLPQHLFE
FT                   SLCIDHLQRHGASKKAITRAFDDDVEFQERMAEHIRYMVETIAHHQVDIDSEV"
FT   gene            complement(701761..701967)
FT                   /gene="kil"
FT                   /locus_tag="G2583_0666"
FT   CDS_pept        complement(701761..701967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kil"
FT                   /locus_tag="G2583_0666"
FT                   /product="Prophage Kil protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55290"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKN5"
FT                   /protein_id="ADD55290.1"
FT                   /translation="MVHQHYGTQTVNRGAVMPGMLVKHKDGTWTASANLRGRLYLHRGI
FT                   ERTYTRDLLVEVFLDGRGNGLNH"
FT   gene            complement(702448..702825)
FT                   /locus_tag="G2583_0667"
FT   CDS_pept        complement(702448..702825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0667"
FT                   /product="Hypothetical phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55291"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKN6"
FT                   /protein_id="ADD55291.1"
FT                   /translation="MKVLLSIKPEFAEKILNGTKRFEFRKGIFKNPQISTVVIYATMPL
FT                   GKVVGQFRIESILSDEPESLWKKTEKHAGISKQFYDSYYSGREKAYAIKIGEVERYKEP
FT                   IPISALGSNIKPPQSYLYLPA"
FT   gene            complement(702803..703864)
FT                   /locus_tag="G2583_0668"
FT   CDS_pept        complement(702803..703864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55292"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKN7"
FT                   /protein_id="ADD55292.1"
FT                   /translation="MDTLKYEKFSDFDHNAPFFDSLKKDYKEFPLWLEKKAREGESAYV
FT                   LYDDKHKIEGFMYLKENDDANDINPALPPGRHLKIGTFKFESKGTLRGQRFLKKAFDHA
FT                   FSSKSDDIYVTVFDKHVHLIKLFQTYGFYIHGEKETHNGKEFVYARSLHEPYGDILLDY
FT                   PRIMTSRANKYLLAIYPEYHTRLFPDSKLVNESPDIVKDISHANSIHKIYICGMRSVMG
FT                   MKRGDIIVIYRTGDKKGPARYRSVASTLCVVESVKNISEFLSEDSFVDYCIRFSVFSED
FT                   ELRKIYKERRYPFIIRFTYNLSLPKRPNRAILIDHVGLNGSRAFRWSHFKLTNEQFLKI
FT                   IELGKINESFIIH"
FT   gene            complement(703945..704559)
FT                   /locus_tag="G2583_0669"
FT   CDS_pept        complement(703945..704559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0669"
FT                   /product="Putative repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55293"
FT                   /db_xref="GOA:D3QKN8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKN8"
FT                   /protein_id="ADD55293.1"
FT                   /translation="MVGVSQAAIQKIETGKANQTTKIVEIANALGVRAEWLSSGVGNMS
FT                   DSTVQPIQPTVSHSKYFKIDVLDIEVSAGPGVINREFVEVLRSVEYSFDDARHMFDGRK
FT                   AENIRIINVRGDSMSGTIEPGDLLFVDITVKSFDGDGIYAFLYDDTAHVKRLQMMKDKL
FT                   LVISDNKSYSPWDPIEKDEMNRVFIFGKVIGSMPQTYRKHG"
FT   gene            704739..704969
FT                   /locus_tag="G2583_0670"
FT   CDS_pept        704739..704969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55294"
FT                   /db_xref="GOA:D3QKN9"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR031856"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKN9"
FT                   /protein_id="ADD55294.1"
FT                   /translation="MNPAIKTAINIVGSQKKLGAACEVSQQAVYKWLHNKAKVSPEHVG
FT                   SIVTATGGVVKAHQIRPDLPKLFPHTEKNAA"
FT   gene            705039..705578
FT                   /locus_tag="G2583_0671"
FT   CDS_pept        705039..705578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55295"
FT                   /db_xref="InterPro:IPR009364"
FT                   /db_xref="InterPro:IPR037042"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKP0"
FT                   /protein_id="ADD55295.1"
FT                   /translation="MQPLTYQQTSGFSPTAVINRSQTKQVPGHEKIRDAVRAWSAEDNQ
FT                   DVVATLIVNEYREQGGGTIDFPDDVSRARQKLFRFLDNKFDSEKYRNNVRELTPAILAV
FT                   LPLEYRGYLVEQDSFMARLAEMEKELSEAKQAVILNAPRHQKLKEISEGIVSMFRVDPD
FT                   LAGPLMAMVTTMLGAI"
FT   gene            705575..706594
FT                   /locus_tag="G2583_0672"
FT   CDS_pept        705575..706594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0672"
FT                   /product="Phage replication protein O"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55296"
FT                   /db_xref="GOA:D3QKP1"
FT                   /db_xref="InterPro:IPR006497"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKP1"
FT                   /protein_id="ADD55296.1"
FT                   /translation="MTGSEMAKAGLLEQNRLSGANRNALIAGGIMANTAEIFNFPVPDV
FT                   AQKEPRVADLDDGYTRIANELLEAVMLAGLTQHQLLVFLAVMRKTYGFNKKLDWVSNEQ
FT                   LSELTGILPHKCSAAKSVLVKRGILIQSGRNTGINNVVSEWSTLPESGKKNKVYLKEVN
FT                   LPESGKKSLPKSGKDVYPNQVNTKDKITKDNIKPYSSENSGESSDQPENDLPVVKPDAA
FT                   IQSGSKWGTAEDLTAAEWMFDMVKTIAPSARKPNFAGWANDIRLMRERDGRNHRDMCVL
FT                   FRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVTAGKSKLDLTNTDWIYGVDL"
FT   gene            706591..707292
FT                   /locus_tag="G2583_0673"
FT   CDS_pept        706591..707292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G2583_0673"
FT                   /product="replication protein P"
FT                   /db_xref="EnsemblGenomes-Gn:G2583_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADD55297"
FT                   /db_xref="GOA:D3QKP2"
FT                   /db_xref="InterPro:IPR009731"
FT                   /db_xref="UniProtKB/TrEMBL:D3QKP2"
FT