(data stored in ACNUC7421 zone)

EMBL: CP001849

ID   CP001849; SV 1; circular; genomic DNA; STD; PRO; 1617545 BP.
XX
AC   CP001849;
XX
PR   Project:PRJNA31001;
XX
DT   09-JAN-2010 (Rel. 103, Created)
DT   04-AUG-2013 (Rel. 117, Last updated, Version 4)
XX
DE   Gardnerella vaginalis 409-05, complete genome.
XX
KW   .
XX
OS   Gardnerella vaginalis 409-05
OC   Bacteria; Actinobacteria; Bifidobacteriales; Bifidobacteriaceae;
OC   Gardnerella.
XX
RN   [1]
RP   1-1617545
RA   Durkin A.S., Madupu R., Torralba M., Methe B., Sutton G., Strausberg R.L.,
RA   Nelson K.E.;
RT   "Genome Sequence of Gardnerella vaginalis 409-05";
RL   Unpublished.
XX
RN   [2]
RP   1-1617545
RA   Durkin A.S., Madupu R., Torralba M., Methe B., Sutton G., Strausberg R.L.,
RA   Nelson K.E.;
RT   ;
RL   Submitted (30-DEC-2009) to the INSDC.
RL   The J. Craig Venter Institute, 9704 Medical Center Dr., Rockville, MD
RL   20850, USA
XX
DR   MD5; 9aa4a1025ba3eabaa2783d5b806ce000.
DR   BioSample; SAMN02299422.
DR   EnsemblGenomes-Gn; EBG00001053061.
DR   EnsemblGenomes-Gn; EBG00001053062.
DR   EnsemblGenomes-Gn; EBG00001053063.
DR   EnsemblGenomes-Gn; EBG00001053064.
DR   EnsemblGenomes-Gn; EBG00001053065.
DR   EnsemblGenomes-Gn; EBG00001053066.
DR   EnsemblGenomes-Gn; EBG00001053067.
DR   EnsemblGenomes-Gn; EBG00001053068.
DR   EnsemblGenomes-Gn; EBG00001053069.
DR   EnsemblGenomes-Gn; EBG00001053070.
DR   EnsemblGenomes-Gn; EBG00001053071.
DR   EnsemblGenomes-Gn; EBG00001053072.
DR   EnsemblGenomes-Gn; EBG00001053073.
DR   EnsemblGenomes-Gn; EBG00001053074.
DR   EnsemblGenomes-Gn; EBG00001053075.
DR   EnsemblGenomes-Gn; EBG00001053076.
DR   EnsemblGenomes-Gn; EBG00001053077.
DR   EnsemblGenomes-Gn; EBG00001053078.
DR   EnsemblGenomes-Gn; EBG00001053079.
DR   EnsemblGenomes-Gn; EBG00001053080.
DR   EnsemblGenomes-Gn; EBG00001053081.
DR   EnsemblGenomes-Gn; EBG00001053082.
DR   EnsemblGenomes-Gn; EBG00001053083.
DR   EnsemblGenomes-Gn; EBG00001053084.
DR   EnsemblGenomes-Gn; EBG00001053085.
DR   EnsemblGenomes-Gn; EBG00001053086.
DR   EnsemblGenomes-Gn; EBG00001053087.
DR   EnsemblGenomes-Gn; EBG00001053088.
DR   EnsemblGenomes-Gn; EBG00001053089.
DR   EnsemblGenomes-Gn; EBG00001053090.
DR   EnsemblGenomes-Gn; EBG00001053091.
DR   EnsemblGenomes-Gn; EBG00001053092.
DR   EnsemblGenomes-Gn; EBG00001053093.
DR   EnsemblGenomes-Gn; EBG00001053094.
DR   EnsemblGenomes-Gn; EBG00001053095.
DR   EnsemblGenomes-Gn; EBG00001053096.
DR   EnsemblGenomes-Gn; EBG00001053097.
DR   EnsemblGenomes-Gn; EBG00001053098.
DR   EnsemblGenomes-Gn; EBG00001053099.
DR   EnsemblGenomes-Gn; EBG00001053100.
DR   EnsemblGenomes-Gn; EBG00001053101.
DR   EnsemblGenomes-Gn; EBG00001053102.
DR   EnsemblGenomes-Gn; EBG00001053103.
DR   EnsemblGenomes-Gn; EBG00001053104.
DR   EnsemblGenomes-Gn; EBG00001053105.
DR   EnsemblGenomes-Gn; EBG00001053106.
DR   EnsemblGenomes-Gn; EBG00001053107.
DR   EnsemblGenomes-Gn; EBG00001053108.
DR   EnsemblGenomes-Gn; EBG00001053109.
DR   EnsemblGenomes-Gn; EBG00001053110.
DR   EnsemblGenomes-Gn; EBG00001053111.
DR   EnsemblGenomes-Gn; EBG00001053112.
DR   EnsemblGenomes-Gn; EBG00001053113.
DR   EnsemblGenomes-Gn; EBG00001053114.
DR   EnsemblGenomes-Gn; EBG00001053115.
DR   EnsemblGenomes-Gn; EBG00001053116.
DR   EnsemblGenomes-Gn; EBG00001053117.
DR   EnsemblGenomes-Gn; EBG00001053118.
DR   EnsemblGenomes-Gn; EBG00001053119.
DR   EnsemblGenomes-Gn; HMPREF0424_1351.
DR   EnsemblGenomes-Gn; HMPREF0424_1352.
DR   EnsemblGenomes-Gn; HMPREF0424_1353.
DR   EnsemblGenomes-Gn; HMPREF0424_1354.
DR   EnsemblGenomes-Gn; HMPREF0424_1355.
DR   EnsemblGenomes-Gn; HMPREF0424_1356.
DR   EnsemblGenomes-Gn; HMPREF0424_1357.
DR   EnsemblGenomes-Gn; HMPREF0424_1358.
DR   EnsemblGenomes-Gn; HMPREF0424_1359.
DR   EnsemblGenomes-Gn; HMPREF0424_1360.
DR   EnsemblGenomes-Gn; HMPREF0424_1361.
DR   EnsemblGenomes-Gn; HMPREF0424_1362.
DR   EnsemblGenomes-Gn; HMPREF0424_1363.
DR   EnsemblGenomes-Gn; HMPREF0424_1364.
DR   EnsemblGenomes-Gn; HMPREF0424_1365.
DR   EnsemblGenomes-Gn; HMPREF0424_1366.
DR   EnsemblGenomes-Gn; HMPREF0424_1368.
DR   EnsemblGenomes-Gn; HMPREF0424_1369.
DR   EnsemblGenomes-Gn; HMPREF0424_1371.
DR   EnsemblGenomes-Gn; HMPREF0424_1372.
DR   EnsemblGenomes-Gn; HMPREF0424_1373.
DR   EnsemblGenomes-Gn; HMPREF0424_1374.
DR   EnsemblGenomes-Gn; HMPREF0424_1375.
DR   EnsemblGenomes-Gn; HMPREF0424_1376.
DR   EnsemblGenomes-Gn; HMPREF0424_1377.
DR   EnsemblGenomes-Gn; HMPREF0424_1378.
DR   EnsemblGenomes-Gn; HMPREF0424_1379.
DR   EnsemblGenomes-Gn; HMPREF0424_1381.
DR   EnsemblGenomes-Gn; HMPREF0424_1382.
DR   EnsemblGenomes-Gn; HMPREF0424_1383.
DR   EnsemblGenomes-Gn; HMPREF0424_1384.
DR   EnsemblGenomes-Gn; HMPREF0424_1385.
DR   EnsemblGenomes-Gn; HMPREF0424_1386.
DR   EnsemblGenomes-Gn; HMPREF0424_1388.
DR   EnsemblGenomes-Gn; HMPREF0424_1390.
DR   EnsemblGenomes-Gn; HMPREF0424_1392.
DR   EnsemblGenomes-Gn; HMPREF0424_1394.
DR   EnsemblGenomes-Gn; HMPREF0424_1395.
DR   EnsemblGenomes-Gn; HMPREF0424_1396.
DR   EnsemblGenomes-Gn; HMPREF0424_1397.
DR   EnsemblGenomes-Gn; HMPREF0424_1398.
DR   EnsemblGenomes-Gn; HMPREF0424_1399.
DR   EnsemblGenomes-Gn; HMPREF0424_1400.
DR   EnsemblGenomes-Gn; HMPREF0424_1402.
DR   EnsemblGenomes-Gn; HMPREF0424_1403.
DR   EnsemblGenomes-Gn; HMPREF0424_1404.
DR   EnsemblGenomes-Gn; HMPREF0424_1405.
DR   EnsemblGenomes-Gn; HMPREF0424_1406.
DR   EnsemblGenomes-Gn; HMPREF0424_1407.
DR   EnsemblGenomes-Gn; HMPREF0424_1408.
DR   EnsemblGenomes-Gn; HMPREF0424_1410.
DR   EnsemblGenomes-Gn; HMPREF0424_1411.
DR   EnsemblGenomes-Gn; HMPREF0424_1412.
DR   EnsemblGenomes-Gn; HMPREF0424_1413.
DR   EnsemblGenomes-Tr; EBT00001656004.
DR   EnsemblGenomes-Tr; EBT00001656005.
DR   EnsemblGenomes-Tr; EBT00001656006.
DR   EnsemblGenomes-Tr; EBT00001656007.
DR   EnsemblGenomes-Tr; EBT00001656008.
DR   EnsemblGenomes-Tr; EBT00001656009.
DR   EnsemblGenomes-Tr; EBT00001656010.
DR   EnsemblGenomes-Tr; EBT00001656011.
DR   EnsemblGenomes-Tr; EBT00001656012.
DR   EnsemblGenomes-Tr; EBT00001656013.
DR   EnsemblGenomes-Tr; EBT00001656014.
DR   EnsemblGenomes-Tr; EBT00001656015.
DR   EnsemblGenomes-Tr; EBT00001656016.
DR   EnsemblGenomes-Tr; EBT00001656017.
DR   EnsemblGenomes-Tr; EBT00001656018.
DR   EnsemblGenomes-Tr; EBT00001656019.
DR   EnsemblGenomes-Tr; EBT00001656020.
DR   EnsemblGenomes-Tr; EBT00001656021.
DR   EnsemblGenomes-Tr; EBT00001656022.
DR   EnsemblGenomes-Tr; EBT00001656023.
DR   EnsemblGenomes-Tr; EBT00001656024.
DR   EnsemblGenomes-Tr; EBT00001656025.
DR   EnsemblGenomes-Tr; EBT00001656026.
DR   EnsemblGenomes-Tr; EBT00001656027.
DR   EnsemblGenomes-Tr; EBT00001656028.
DR   EnsemblGenomes-Tr; EBT00001656029.
DR   EnsemblGenomes-Tr; EBT00001656030.
DR   EnsemblGenomes-Tr; EBT00001656031.
DR   EnsemblGenomes-Tr; EBT00001656032.
DR   EnsemblGenomes-Tr; EBT00001656033.
DR   EnsemblGenomes-Tr; EBT00001656034.
DR   EnsemblGenomes-Tr; EBT00001656035.
DR   EnsemblGenomes-Tr; EBT00001656036.
DR   EnsemblGenomes-Tr; EBT00001656037.
DR   EnsemblGenomes-Tr; EBT00001656038.
DR   EnsemblGenomes-Tr; EBT00001656039.
DR   EnsemblGenomes-Tr; EBT00001656040.
DR   EnsemblGenomes-Tr; EBT00001656041.
DR   EnsemblGenomes-Tr; EBT00001656042.
DR   EnsemblGenomes-Tr; EBT00001656043.
DR   EnsemblGenomes-Tr; EBT00001656044.
DR   EnsemblGenomes-Tr; EBT00001656045.
DR   EnsemblGenomes-Tr; EBT00001656046.
DR   EnsemblGenomes-Tr; EBT00001656047.
DR   EnsemblGenomes-Tr; EBT00001656048.
DR   EnsemblGenomes-Tr; EBT00001656049.
DR   EnsemblGenomes-Tr; EBT00001656050.
DR   EnsemblGenomes-Tr; EBT00001656051.
DR   EnsemblGenomes-Tr; EBT00001656052.
DR   EnsemblGenomes-Tr; EBT00001656053.
DR   EnsemblGenomes-Tr; EBT00001656054.
DR   EnsemblGenomes-Tr; EBT00001656055.
DR   EnsemblGenomes-Tr; EBT00001656056.
DR   EnsemblGenomes-Tr; EBT00001656057.
DR   EnsemblGenomes-Tr; EBT00001656058.
DR   EnsemblGenomes-Tr; EBT00001656059.
DR   EnsemblGenomes-Tr; EBT00001656060.
DR   EnsemblGenomes-Tr; EBT00001656061.
DR   EnsemblGenomes-Tr; EBT00001656062.
DR   EnsemblGenomes-Tr; HMPREF0424_1351-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1352-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1353-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1354-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1355-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1356-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1357-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1358-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1359-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1360-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1361-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1362-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1363-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1364-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1365-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1366-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1368-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1369-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1371-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1372-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1373-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1374-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1375-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1376-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1377-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1378-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1379-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1381-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1382-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1383-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1384-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1385-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1386-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1388-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1390-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1392-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1394-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1395-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1396-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1397-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1398-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1399-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1400-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1402-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1403-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1404-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1405-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1406-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1407-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1408-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1410-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1411-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1412-1.
DR   EnsemblGenomes-Tr; HMPREF0424_1413-1.
DR   EuropePMC; PMC2928729; 20865041.
DR   EuropePMC; PMC3201972; 22046340.
DR   EuropePMC; PMC3416817; 22900080.
DR   EuropePMC; PMC3559282; 23259527.
DR   EuropePMC; PMC5604014; 28847941.
DR   EuropePMC; PMC5881158; 29632552.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001849.
DR   SILVA-SSU; CP001849.
XX
CC   This is a reference genome for the Human Microbiome Project. This
CC   project is co-owned with the Human Microbiome Project DACC
CC   Genome Coverage: 34x
CC   Sequencing Technology: 454
CC   DNA/bacteria source:  Brenda Wilson PhD, University of Illinois
CC   Urbana Champaign.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1617545
FT                   /organism="Gardnerella vaginalis 409-05"
FT                   /strain="409-05"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:553190"
FT   gene            complement(12..914)
FT                   /locus_tag="HMPREF0424_0001"
FT   CDS_pept        complement(12..914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0001"
FT                   /product="LysR substrate binding domain protein"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13983"
FT                   /db_xref="GOA:D2RCJ8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCJ8"
FT                   /protein_id="ADB13983.1"
FT                   /translation="MNIRALEYLIAFAQEGSFTKAAVRMRVSQPTLSTQIKKLEETLDV
FT                   ELIERTPGKQILTPAGREVVYYAKRIQADMSRIRQAARRSEDPWSSTVVLGVFPTLGPY
FT                   LLPRIMPALRRLKPKLTIRFIEEKSAKLIDLLDSGQVDAVILSESLNAPSIKVCHVFDE
FT                   DFLLATSTNSLLGHESKPIELSDLSTQKVLLLEDGHCMRRSMLDVCQKVGAKQSEFRAT
FT                   SLETLRYMVVGSKDVTLLPRLATVPPIVQPVGLMLREFKNPKPYRSLYLNWRAASPVDK
FT                   IMEGLCTIISSACSDLHKK"
FT   gene            complement(956..2629)
FT                   /gene="ahpF"
FT                   /locus_tag="HMPREF0424_0002"
FT   CDS_pept        complement(956..2629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="HMPREF0424_0002"
FT                   /product="alkyl hydroperoxide reductase, F subunit"
FT                   /EC_number="1.8.1.-"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR03140"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14675"
FT                   /db_xref="GOA:D2RCJ9"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCJ9"
FT                   /protein_id="ADB14675.1"
FT                   /translation="MSLLNASLTAQLSELLKKMVSKIEIISYVDNSETSQKVKSLLEEV
FT                   SQQSDKISISEVNNNEISNVKRKPSFELRRKLDNPVNGESTVSVSFAGLPLGHEFSSLV
FT                   LALLQVSGYAPKISDEQRDAILKLGSHNVTTYMSVTCLNCPEVVQSLNTISVINPKIQH
FT                   TVVEGSAFREEVDKLGVMSVPAVFENGKLVSSGRAGIDELVSVLASQEKSVEQNENGNN
FT                   GNSVSSANVALAEKMNSQNPYDIVIAGGGPAASAAAIYTARKGLRTAMIMDHRGGQVVE
FT                   TESIENHISQTHTTGSQLAADLTKHISQYDIDVFTPDWADSLDLSKEPYGLHTIHARSG
FT                   GSLKARAVIIATGATWRTLGVPGEDEYRNRGVSFCPHCDGPLFKDKNVVVVGGGNSGVE
FT                   AAIDLAGVAKHVTVVEFMDVLKADQVLLNTLHKLPNAEVITSAAVSSIEGNGSKVTAIR
FT                   YIDRNKADDDENREHIVETDGVFVQIGLAPNTRWLVNNISLNNRGEIITNRAGCTDTPG
FT                   VFAAGDCSDEPYKQIVTAYGSGANAALSAFDYLIRSPQNK"
FT   gene            complement(2759..3322)
FT                   /gene="ahpC"
FT                   /locus_tag="HMPREF0424_0003"
FT   CDS_pept        complement(2759..3322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="HMPREF0424_0003"
FT                   /product="peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534; match to protein
FT                   family HMM TIGR03137"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13446"
FT                   /db_xref="GOA:D2RCK0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCK0"
FT                   /protein_id="ADB13446.1"
FT                   /translation="MSLMNTHILPFKVNGYKNGEFVEVSDTDVLGKWAIFFFYPADFSF
FT                   VCPTELEDLANHYEELQKLGVEVYSVSTDTHFVHKAWHDDSEAIAKVKYTMLGDPSGAL
FT                   SRNFDAWNQESGLAHRATFLVNPQGVIQFFEMTADGIGRNADELLRKVKAAQYIAAHPG
FT                   EVCPAKWEQGEETLEPSIDLVGKI"
FT   gene            3676..4854
FT                   /locus_tag="HMPREF0424_0004"
FT   CDS_pept        3676..4854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0004"
FT                   /product="triacylglycerol lipase"
FT                   /note="identified by match to protein family HMM PF01764"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14272"
FT                   /db_xref="GOA:D2RCK1"
FT                   /db_xref="InterPro:IPR024499"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCK1"
FT                   /protein_id="ADB14272.1"
FT                   /translation="MKRNAVTGFLTSLCMLLSLSAFAMPAMATTADNYAKTPLTAETAK
FT                   QIANGTIGLDLPGALDMSLYHKKPLDPQADLDGDGLTNSQEIYTYTKDGKTYYGYNSHP
FT                   MMNDTDGDGIPDNQDSNPRRWDISPRDMALFSELSYRDDNYINKVLDYTKPLHDIYKNR
FT                   SEYRLMHNELAPFWKVKETYHKRGGFDAVLFENVSPYPFLEQGTVQVLAIRGTSQFNDY
FT                   DDDFAIAVGHNPDQAKDVEQLIERYGRENTVSNLYITGHSLGGYLAQRALIRAKGKGYN
FT                   WIKKIYTFNSPQIWGNIFNRWLRAVANTGDKLTREGYAVHYKVDNDKVIRSVGNFAGAI
FT                   SVSNSAQGHSSRSYLEARMNNFPGFTVGTRGDISGTGRWMEELNNFYDVRTF"
FT   gene            5200..7962
FT                   /locus_tag="HMPREF0424_0005"
FT   CDS_pept        5200..7962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0005"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="identified by match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13472"
FT                   /db_xref="GOA:D2RCK2"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCK2"
FT                   /protein_id="ADB13472.1"
FT                   /translation="MRKVSTVHTISGIVLTFGLIISSLVYIPSLATTAAAEETSPVHVP
FT                   LTAQTAHDISTGRIRLENNQIDSLLYHKAALDPDQDSDGDGLKNSEELYTYVKNGRTYY
FT                   GYNSHPLIKDTDGDGLDDKNDSNPRRWDISPRDMALFMELVYREDSYVKEVLDYSKPLR
FT                   IIYENRNEYRLMHNELAPFWKVKETYHFGSGFDAILFENVNPAYPFIKQNGVQVLAIRG
FT                   TKGATDVWNDVLLGTGSNPGQAADIDKLIDEYKQKNTVSNLYVTGHSLGGYLAQRALIR
FT                   AKSSGATFNIKAYTFNAPRIKGNIFNRWLWETSDFGDKLTKEGYAVHYKVDNDTVIGGI
FT                   GNFEGAISVGSSGAGHGSRSYFEPRMNAFQGFTVGERNKIEGTGRKIDALDGLVNEPVI
FT                   KTDEQAFEPKITNIDIMENDPLPKGTTIKHLLNPNDIPQGSTITDITEYDKIDTSQCGN
FT                   YEGKILLVLSGRILKTIIVPITIHKRLANIEELPNVTAEPGKKIEVKKDNKIPDNFDFK
FT                   PYLKNLPENSTVQVVKQPNTTNTGETTFIIEITFANKAKQKVTLKAHVVEIIPATPLNP
FT                   AKKSITWAELIPAKKSTPWIELTPATPAPTPTPVPPTPVPPTPEPTPSPSPTPTPTPDQ
FT                   QPAVPLQPKPNPVNPTPVPPKPAPKPESQPVPPTPESHSDNSEHSSNGEPDKSANSTTP
FT                   QTNKFDQDHKEIPSMGFPEPTHPSKTLQTPAVSNDSMRENHIELNANSESHTLQQQIPS
FT                   APKSIADLLPALCNTLTVGNNNIAYAGKNNHITVTVNATSEFMRRLQLEKAVKAYAYIY
FT                   SNPKLLYSANGMKYVTVHINEYGRIVFDVVIPEEYKGNHTIVLIDENGKQVAWTNTLVK
FT                   KDPHLHKQSTIANNALPRTGIQIIPIVLSVALMLFVSTIVTIARKRKFN"
FT   gene            complement(8030..8103)
FT                   /locus_tag="HMPREF0424_1351"
FT   tRNA            complement(8030..8103)
FT                   /locus_tag="HMPREF0424_1351"
FT                   /product="tRNA-Gly"
FT   gene            complement(8234..9112)
FT                   /locus_tag="HMPREF0424_0007"
FT   CDS_pept        complement(8234..9112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0007"
FT                   /product="peptidase, M48 family"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13815"
FT                   /db_xref="GOA:D2RCK3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCK3"
FT                   /protein_id="ADB13815.1"
FT                   /translation="MLKGLRIHYGSLKAALFFVVVWLFLALCWVLTGSHLSSLIWFIIP
FT                   GIAFSVFAYWCSSKLAIIAMHATEVSEEEEPVLYAMVRDLSARIGKPMPRVMVSPYESP
FT                   NAFATGRSERHASICCTRGLINILNERELRSVIGHELTHIYNHDILASSLATATATVLT
FT                   YVGSWLVYVGDTYRRDIRKYCKFIGKFLNILFAPIASVIINAIIPGSREFDADKGSSEI
FT                   TGDFAALASALNKITYGMQLHEMKSTAGLQAVASLMIICPWNNNAPALVHLCTARPTVQ
FT                   DRIGRLMSIAA"
FT   gene            complement(9218..10696)
FT                   /locus_tag="HMPREF0424_0008"
FT   CDS_pept        complement(9218..10696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13770"
FT                   /db_xref="GOA:D2RCK4"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCK4"
FT                   /protein_id="ADB13770.1"
FT                   /translation="MEKNNLNENVSQETSQLRIAVIGTGPAGVYSSDIFLRQIAKRGEE
FT                   LGLGSSARIDLFEKLPVPFGLVRYGVAPDHPSIKFIADALEKTLDNPNIHLYANVEFGK
FT                   DIALEDLLHRYDAVLFATGAVEDRPLRGVPGADLDGVYGAAKFVEWYDGYPTSNREWPL
FT                   EAKEVAVIGGGNVAMDVARELLRDPDYLRAHTDIPDDVYEGLQKNKTQTLHLFIRRGVA
FT                   QAKFSVQELREMEKLSGVQIVINEDDFELDDETIEVAGNDKLTRQMVEELFAIRDMAED
FT                   MEDGGNVDFEGKPANKRYIIHFNCAPVEILGEDGHVKAIRVERTTTSADGKMTRTGEFE
FT                   EYAVQAVYHAIGYHPAEVAGIAYDEKRTLLANIDGRLVESVENGEVRERLYATGWAKRG
FT                   PVGLIGSTKSDALLIVNNMLEDLSKAGNAGRIAPDRDENSIDKLLAEKGIKPIDYAGWK
FT                   RVDSYERELGANEQRTRKKVVSASELVNIALGSK"
FT   gene            complement(10989..13220)
FT                   /locus_tag="HMPREF0424_0009"
FT   CDS_pept        complement(10989..13220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0009"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14666"
FT                   /db_xref="GOA:D2RCK5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCK5"
FT                   /protein_id="ADB14666.1"
FT                   /translation="MRKLLAYCRRASQLTVVILAFPFIAALYSCNLPILTTFCEQISNL
FT                   SQQIFDFLNLGCDISISLSIGKTIIAILVLYTSLISLRNMIKNLLRGTLGIDLLAFVAL
FT                   LATLCIGEFWASYLIVVMVWTGEAIEDFAHMKAQRNLSLLVSAAPKTAHLMTLPGLEHG
FT                   MDNNQANDESYEPPCLSENQCKPSSCVLCQHAEFRKVDAANSKQSNISEQNCDYKHNIC
FT                   SFLQASTDGEISSNLQRYKTVPVDELNIGNVIIVLPGETVPVDGELLSGSAILDTSAIN
FT                   GESVPREVYAGAAVLSGCVNGGVVLIMRVTKLSKNSQYQKIMQLVESARSSKAAVVRFA
FT                   DMLSVPFTVLSFVIAGFAWGFSGDALRFAQVLVLATPCPLLIAVPVACMAGTGRLAKLG
FT                   IVVKSQDVLEQLSRVTDVFFDKTGTLTVKQPQVVNVDVIDTTQKADRIVMLAGVLETYS
FT                   QHILAGGIAKAGASLWENAHPSSVPQLPSVREYPVVHSVKETAGQGIQGVVDGILVRVG
FT                   RRKYVTEQNANQTIGKSLAADEMATYVSFDGVLVGRIVLKDVPRDNAKSTIDALCTLGA
FT                   RSISILTGDSLQAATTIGKSVGIETIYADLLPQDKLAHVKKHNYNAYKNKQNSTVTMMV
FT                   GDGVNDAPVLAAADIGVAVTDGTDTAASECAQVVIMNNDISSVASAIRVAKHTKRVMVQ
FT                   SVLMGIGLAIISMIFAAFGFIPAVIGAMMQEAIDVVAIMWALTALRERK"
FT   gene            complement(13557..13760)
FT                   /locus_tag="HMPREF0424_0010"
FT   CDS_pept        complement(13557..13760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13971"
FT                   /db_xref="GOA:D2RCK6"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCK6"
FT                   /protein_id="ADB13971.1"
FT                   /translation="MIYKIKQNIADISAGVVSLLVASFVKGQGWNIQNIMIWLATFVAT
FT                   YITLRLLFMLFKIVRTLFTKEQ"
FT   gene            complement(14067..14142)
FT                   /locus_tag="HMPREF0424_1352"
FT   tRNA            complement(14067..14142)
FT                   /locus_tag="HMPREF0424_1352"
FT                   /product="tRNA-Ala"
FT   gene            complement(14167..14243)
FT                   /locus_tag="HMPREF0424_1353"
FT   tRNA            complement(14167..14243)
FT                   /locus_tag="HMPREF0424_1353"
FT                   /product="tRNA-Ile"
FT   gene            complement(14370..14849)
FT                   /locus_tag="HMPREF0424_0013"
FT   CDS_pept        complement(14370..14849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0013"
FT                   /product="ferritin-like protein"
FT                   /note="identified by match to protein family HMM PF00210"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14382"
FT                   /db_xref="GOA:D2RCK7"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCK7"
FT                   /protein_id="ADB14382.1"
FT                   /translation="MALLHILPGLDEAASEKAVAILQNRLSHEQEAALVLKHAHWNVTG
FT                   PDFIAVHEMLDPQVAEVLAQADETAERIATLGGSPLGRADDVVAARTWKRFALTGRKST
FT                   KEYLQALIEYYNDMIADDRKAIAELDELDLVSSNIIQDHVQQLEKFQWFMRSHLD"
FT   gene            complement(14907..16202)
FT                   /locus_tag="HMPREF0424_0014"
FT   CDS_pept        complement(14907..16202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0014"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01595; match to protein
FT                   family HMM PF03471"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14562"
FT                   /db_xref="GOA:D2RCK8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCK8"
FT                   /protein_id="ADB14562.1"
FT                   /translation="MAIGFNILLIMIFLLFGSVFAATELALVSLRSSQIDRMELQDARG
FT                   ARVAKIARDPNTFLSALQIGVTLSGFLSASFGESALAPYVVPVVCSWGVSSHVAGPLTT
FT                   IFLTLVISYCSIVISELVPKRIAMQRAEQIARAVVPAVDVFSKICKPLIWLIGKNTNGF
FT                   VRILGFDPNEKESEVSDEELRVLVNSNKRLSQDERTILDDVFDASETIVAEVMRPRADV
FT                   EFLDGSLSLEEAAAKIRELPYSRYPVIGKDFDDVIGFVHVRDLLDVRDPNAKTVADVTR
FT                   EGISLPGTSKLLPSLELLRKRGIHLAVVIDEYGGTDGIVTLEDMTEELVGDIRDEYDLP
FT                   GETEQNNVNKTTAFVNGVAKIDGGMTIEDFADITGIELEDGPYETVAGYFLAHTGSMGS
FT                   VGAVLHDADGYDMTVTAVDGRRIATIEVRRRA"
FT   gene            complement(16279..17049)
FT                   /locus_tag="HMPREF0424_0015"
FT   CDS_pept        complement(16279..17049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0015"
FT                   /product="TIGR03943 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13862"
FT                   /db_xref="GOA:D2RCK9"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCK9"
FT                   /protein_id="ADB13862.1"
FT                   /translation="MKKQKCVEHNACKKITLAQLVEAILLLFFAVIIAKVTLSGRYTLF
FT                   TTPRAYYYLLITAILLFILSICAAIGWFSVSSRDVWRMFVAFVVPALLIIVPLRYAQNI
FT                   SVDGFDQYAGGRAIAIRSQNYPLPGLYEKSHEITVDDDDFGSWYDEIDHNAAKYDGYAI
FT                   TLTGFVSRDSTLNANQFRVSRQLMSCCILDMSPFGLVAEKSNIGEIQDHEWVRVRARVS
FT                   RGNIGIPGYQHPGVVLHVISMQTAQAPTGYFYRP"
FT   gene            complement(17046..18140)
FT                   /locus_tag="HMPREF0424_0016"
FT   CDS_pept        complement(17046..18140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0016"
FT                   /product="putative permease"
FT                   /note="identified by match to protein family HMM PF03773"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14090"
FT                   /db_xref="GOA:D2RCL0"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCL0"
FT                   /protein_id="ADB14090.1"
FT                   /translation="MNQSSKDTLDANSANSTNSANYLFLLVGVPLVAFIIAAAPALQGQ
FT                   HPWFLVDTTIRGVSGLLLQAIPFTLIGVLVSAAVETWVTADFIEKHVPKSTANGFLAAI
FT                   LAGVCMPVCDCVVVPTFSRLVARKLPLPCAITFLCAVPVVNPVSVLATFYAFSDAPAVA
FT                   IMRIALGVGIALLVGLSFVIFPSKTNILRKKILVESESSLHCSCELNNESNLTKNNIEK
FT                   HSISAQIRKYVQHIHQDLIKLIPIIVCGTIVASVIRAWLGADPASRVQVSNVFIAIPVM
FT                   MAIAYASSLCSSSDAVIARSLATSLPMSSVLVFLLFGPMLDLKNTLMLVEDCCGKFVWR
FT                   LTLTIAFACFLASLLAHWAWGFIA"
FT   gene            complement(18196..18855)
FT                   /gene="cah"
FT                   /locus_tag="HMPREF0424_0017"
FT   CDS_pept        complement(18196..18855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cah"
FT                   /locus_tag="HMPREF0424_0017"
FT                   /product="carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14052"
FT                   /db_xref="GOA:D2RCL1"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCL1"
FT                   /protein_id="ADB14052.1"
FT                   /translation="MHETVKEDLLKEDSLLATSVWSAMLAGNRKFAEGSLNCHGLSEET
FT                   RLSLIEGQHPGAVVLSCADSRVAPEFVFGAGLGDIFSVRTAGEVLDDAVIASLEYAVSD
FT                   LGVKVLVVLGHEHCGAVQAVLPNVQKLVSKYGEDEANEIIESSGSILLRSLGPAALAGI
FT                   EEDLSTDDIERIHVSNMLAEICDKSQIIREAAFNDNLMLVGARYRMSDGLVEVLSC"
FT   gene            complement(19084..21840)
FT                   /gene="ppc"
FT                   /locus_tag="HMPREF0424_0018"
FT   CDS_pept        complement(19084..21840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="HMPREF0424_0018"
FT                   /product="phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.31"
FT                   /note="identified by match to protein family HMM PF00311"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14120"
FT                   /db_xref="GOA:D2RCL2"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCL2"
FT                   /protein_id="ADB14120.1"
FT                   /translation="MATENQQVTPADATIVTSGLGRKGPEERDLPASLKQDMDLCLHIL
FT                   RDVLGEFDEKLLAVFDDVRLNAVEASAAHFAQMVDAKVTADDGLSKAVSKLNGMNLHDT
FT                   QLLARAFATYFHLANLCEENYRVSVLHQRECEVEDSLPVDPVNELTCAYHKLLTEMSPA
FT                   EAKELLAKLEFHPVFTAHPTEARRKAVAGKIRRISQLLSEHHRLGGSDKRENYRRLYNE
FT                   IDALLRTSPIALKKPTPVEESDTILDIFDATLFDTIPVVYRRFDDWLLGKKAGLVPPRC
FT                   PAFFHPGSWIGSDRDGNPNVTAKVSRQVARKFSDHVLAALENRTREVGKCLTMETRTTP
FT                   PSVELLELWNRQREMSEQLTENASDVSNSEPHRAVMLVMADRLHRTISRDTDLMYHSCE
FT                   DFIEDLQIVQRSLAEGGDPRAAYGPLQDLIWQAQTFGFHMVEMEFRQHSLVHSRALEDI
FT                   REHGLHGERGPLQPMTREVLDTFRALGAIQKRNGMRAARRYIISFAKSAQHVRDVFELN
FT                   RLAFAHPQDAPTIDVIPLFEQLEDLQNSVNVLEEIIKIPEVQARLKATGRKMEVMLGYS
FT                   DSSKDAGPTSATLALHSAQERIAKWAKKHDIDLTLFHGRGGAVGRGGGPANRAVLAQPV
FT                   GSVNCRFKLTEQGEVIFARYGNPILAIRHVESVASATLLQSSPSVEKTNTDMTKKYADM
FT                   AAKLDVAAHERFLDLLQTDDFTPWFSTVTPLSEIGLLPIGSRPAKRGLGAKSLDDLRTI
FT                   PWVFSWAQARINLAAWYGLGTACEKFGDLETLRRAYEEWPLFSTFIDNIEMSLAKTDER
FT                   IARMYLSLGDREDLSDKVLSEMQLTRKWVLQIVDDKWPLQHRHVLGQAIRVRSPYVDAL
FT                   SVIQSLALHKLRNKVDKEELSESQQAEFIYLILCTVSGVAAGLQNTG"
FT   gene            22047..23768
FT                   /locus_tag="HMPREF0424_0019"
FT   CDS_pept        22047..23768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0019"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06738"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14407"
FT                   /db_xref="GOA:D2RCL3"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCL3"
FT                   /protein_id="ADB14407.1"
FT                   /translation="MSTAENNIENNEYDNSINNCDCDKPEILSTGHIVGKPSGRFHTHA
FT                   IPLDMDDVERDWDKPVTQAGIAAKSSIIIRVGALGLGAGTGSYRVRELMHRIGEPMGVH
FT                   VRADVNLTDIEATCTDKHERITEVVDLPTTGVNTERIWLLEHFADWFNVKLGNNSLYHS
FT                   KAAVSKELVDTLQASDDEHTIVQTAKQSEENATKIAKKKALQEAIKKEKPRGIFALQPE
FT                   SAYAEHFSHVNTSSSNGEPKNNHPLTVREVHDRLDLIKNRKPLYKPWFAGLASAVACAS
FT                   FAFLLGGGIYDMIGAFIGAGIGHYIRRRMFMKHLNQFVVTFVAVAIGALSCIGALRLIG
FT                   FFDPSALNHTTAYIGSVLFVIPGFPLITGGLDIAKIDFPSGIQRLCYTMAIILMGTLAG
FT                   WTVASLVHLNPQGFPPLGLNPWLNAVLRLITAFAGVWGFSVLFNSPQRMCLVAGVIGAI
FT                   TDTLRLTMTDFGVAAEIAAFSGALLAGLLASAWRTIVRHGLAPQYLGYPRIGLTVPSIV
FT                   IMVPGLYMYRAMFYLGQFHTLPALDWTFRAFMVIICLPIGLAVARVITDKSWRYDV"
FT   gene            complement(23867..24958)
FT                   /gene="trpS"
FT                   /locus_tag="HMPREF0424_0020"
FT   CDS_pept        complement(23867..24958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="HMPREF0424_0020"
FT                   /product="tryptophan--tRNA ligase"
FT                   /EC_number="6.1.1.2"
FT                   /note="identified by match to protein family HMM PF00579;
FT                   match to protein family HMM TIGR00233"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14269"
FT                   /db_xref="GOA:D2RCL4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCL4"
FT                   /protein_id="ADB14269.1"
FT                   /translation="MPEEAQVTAAGNEMSASFLAARKRSDATLEKLQASPSSFTMLTGD
FT                   RPTGRLHLGHYFGSIRERVAMQQRGVKTNIIIADYQVITDRDTTEHIEDNVLNLVLDYM
FT                   AAGIDPEKTMIFTHSAVPAANQLMLPFLSLVTEAELHRNPTVKSEMESSGHALTGLLLT
FT                   YPVHQACDILFCKANVVPIGKDNLPHVEITRTIARRFNERYAKKNPVFPEPAAILSDAP
FT                   EIPGLDGRKMSKSYGNSIMLGATAEETAKLIKKSPTDSERMITFDPVTRPQVSALLTTA
FT                   GLVTGRDPKEIAEEIGNAGAGALKAYVIENVNNFLAPHRERRAELAKDMDTVRDILHDG
FT                   NKRANAIAEETLSQVRDAMGMKY"
FT   gene            25104..25484
FT                   /locus_tag="HMPREF0424_0021"
FT   CDS_pept        25104..25484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13850"
FT                   /db_xref="InterPro:IPR021426"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCL5"
FT                   /protein_id="ADB13850.1"
FT                   /translation="MGRGRQKAKQQKIARKLKYLTTDTDYDELAKELNSSEPGQGSFDP
FT                   FASSESYEEDTYLPEENDTDQENDVVDASNEDDLDEYAKWAAEAAAKAVSSENSSTNSG
FT                   AHTPAHHHIPMPIPNFIHKHDN"
FT   gene            complement(25602..26018)
FT                   /locus_tag="HMPREF0424_0022"
FT   CDS_pept        complement(25602..26018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14298"
FT                   /db_xref="InterPro:IPR041629"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCL6"
FT                   /protein_id="ADB14298.1"
FT                   /translation="MSVILERDIKRGQCAWQFWRESAIKALGNGIEAMQINSNILNISL
FT                   NDEALAVRYSLYLLENKVPGCAVEVRVAPFGAVKILEGPASDPHNLTPPDVIELEPKVW
FT                   LRLASGVTKWHQEQDFGNISAIGERDDLSDILPL"
FT   gene            26255..28744
FT                   /gene="glgP"
FT                   /locus_tag="HMPREF0424_0023"
FT   CDS_pept        26255..28744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="HMPREF0424_0023"
FT                   /product="phosphorylase, glycogen/starch/alpha-glucan
FT                   family"
FT                   /EC_number="2.4.1.1"
FT                   /note="identified by match to protein family HMM PF00343;
FT                   match to protein family HMM TIGR02093"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13523"
FT                   /db_xref="GOA:D2RCL7"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCL7"
FT                   /protein_id="ADB13523.1"
FT                   /translation="MTKHVAPKAKTTATAFAKELQEHLKYTQGVTPEQATTADVYVAAA
FT                   TAVRRHLMDSWMQTQHDMVNGNTKAVGYLSAEFLMGKQLENALLNAGLTDQFNKAVTKL
FT                   GFDPKAVIDAEYEPGLGNGGLGRLAACFIDSLASIGVPAFGYGIQYRYGIFKQRFDEEG
FT                   KQVETPDYWLSNEEPWGHIDYGRDQRVNFGGEVVEENGKRVWKPAWSVRAVPVDYMVPG
FT                   YNSGRVNTLRLWTAKSYDEFDLLTFNKSEYLDAVKPQVAAENISKILYPEDSTPEGKAL
FT                   RLEQQYFFVAASIHDAIRVFYPGQDKPDLTTFPSKINFQLNDTHPVIGIPELMRVLMDE
FT                   YGYDWNTAWGITTKTFNYTCHTLLPEALEVWPAKLIGELLPRHLEIIQGISEQFRNELR
FT                   GKGVAEDQVERMRIATDADENGEGAVVRMAYLATYGGSYVNGVAELHSELLKDVTLKDF
FT                   SSVYPDKFKNVTNGVTPRRFVRLSNPRMSALITEGLGTDAWQGNLELLEGLKPLADDKA
FT                   FVKKFAEVKKQNKLAFVDFAKQKYGFEINPDTMFNTIVKRLHEYKRQSMKILQVISTYA
FT                   GIKNGTIDVDKMLPRTVFFGAKSAPGYAMAKLTIQLINNVARVVNNDPACKGKLAVFFP
FT                   PNYNIELAMNLIPATDLDEQISQAGKEASGTGNMKFALNGALTVGTLDGANVEIRERVG
FT                   AENFFLFGMTVDEVEKLYAEGYDHGGSRKYYESDPRLKTAVDMVADGTFSNGDKSVYEP
FT                   LVNDWLTHDYFMAMADFSSYMDIQAQIEETYRDPMKWARMAVLNVANSGYFSSDRSIED
FT                   YLDRIWHTGALPTPVAE"
FT   gene            complement(28948..29157)
FT                   /locus_tag="HMPREF0424_0024"
FT   CDS_pept        complement(28948..29157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14218"
FT                   /db_xref="GOA:D2RCL8"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCL8"
FT                   /protein_id="ADB14218.1"
FT                   /translation="MENRSSGGWKFFALLFGALLAGIAALYVYKQHNPDYDPWEEPWEN
FT                   SSSPIDLGLEKEEKEANDTPAAEA"
FT   gene            29319..30023
FT                   /locus_tag="HMPREF0424_0025"
FT   CDS_pept        29319..30023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0025"
FT                   /product="peptidase, S54 family"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14495"
FT                   /db_xref="GOA:D2RCL9"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCL9"
FT                   /protein_id="ADB14495.1"
FT                   /translation="MHNFDIKNILNNIRFRFNTTTAILVYSCIFIWILEMILNFAYPNY
FT                   YSTLISYTAFLPITALQTPWTWFTSMFVHAPNLTHIFFNMLCLWSLGVELERFFGKWKF
FT                   FGLYLISGFGGSVADIVWCKLTNNWFVASYGASGAIMGLIGALLVAQWRLGENMRGTII
FT                   WIAITLAMPIIVPNIAWQAHIGGLVSGTAIAALLGVQNPLLKKASFNTRFLVYFVSLFA
FT                   ILTACAMFCLKA"
FT   gene            30280..31581
FT                   /locus_tag="HMPREF0424_0026"
FT   CDS_pept        30280..31581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13952"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041497"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCM0"
FT                   /protein_id="ADB13952.1"
FT                   /translation="MSTLQVPKTIEPANASTLTFIKENAQLSPSKAALKAPRNANIDIP
FT                   FAINQIAGRQIAQQKLPKWASCNEVIYPAHISMEQCSSQSTAQYKANVAKELLNKLNSE
FT                   NFSSTLVDLTGGFGVDCTIMSEVFDSAICIEQQNELSSIAHHNMNALGITNVKCYNNNS
FT                   LDALKNIPKSTVIYVDPARRNKQGSRTYAIEDCTPNVLDLKNQLLTKAEIVIIKLSPML
FT                   DWHKTVSDFSGNVEAIHIVAHNNECKELLIILSNSQHTKVPVYCANDNQITVIQATYNT
FT                   STNQVSIQPESNVLENNKKDEILDINNWPEWSQYVYEPNAAIMKAGCFSVLETQYNIQQ
FT                   ISANSHVYVSEEYYSEFPGKTWKIENICSMNKREIKQTFADITHANIVTRNFPIPVEAL
FT                   RKKLNLQDGGNTRIIATTDSNKNHILIRAAAATK"
FT   gene            complement(31645..32037)
FT                   /locus_tag="HMPREF0424_0027"
FT   CDS_pept        complement(31645..32037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0027"
FT                   /product="putative septation inhibitor protein"
FT                   /note="identified by match to protein family HMM PF06781"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14370"
FT                   /db_xref="GOA:D2RCM1"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCM1"
FT                   /protein_id="ADB14370.1"
FT                   /translation="MADEELHTTAADDAAKKSDTSNENTYGVPMDEVEAVLNATADKAA
FT                   LSPQIQQMMQRQAENRRRVEESIKGTKANAAWFVPLFCTLMVVGLIWAVVYYLNPVLPI
FT                   PGIGAWNLVIALVIVMTGFIMTMWWR"
FT   gene            32115..32870
FT                   /locus_tag="HMPREF0424_0028"
FT   CDS_pept        32115..32870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0028"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05949"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13837"
FT                   /db_xref="GOA:D2RCM2"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCM2"
FT                   /protein_id="ADB13837.1"
FT                   /translation="MAKRTGKHRAQHSLLSSFAVAVAVFLTGYLFVLNLRVNRSAFVTS
FT                   NTSQMVERNSQRTKNLREDIKSLDSKINLLNKTLGSSTSEGKESSDTGSSTVLPKLEGP
FT                   GIVVTLNDSPLWKGAVNGSGTSGTINDYVIHQQDIEAVVNALWRGGAEAITIQDQRVLF
FT                   NSAVVCIGNVLMLQGHQYSPPYKISAIGPMDSMVDALNNSPAIHTYKEYVSSFGLGWKV
FT                   EKKNNLRFPEASALLQPLRYATVPKVLNK"
FT   gene            32916..34022
FT                   /locus_tag="HMPREF0424_0029"
FT   CDS_pept        32916..34022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0029"
FT                   /product="sortase family protein"
FT                   /note="identified by match to protein family HMM PF04203;
FT                   match to protein family HMM TIGR01076"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14168"
FT                   /db_xref="GOA:D2RCM3"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCM3"
FT                   /protein_id="ADB14168.1"
FT                   /translation="MQSANMQEGKTKRSSSNFWWQAAGIIGELLIAFAVICALYIAWQM
FT                   WWTGEQAEHTQVEARQAISWQNPKTGDKTKIALPQNTDPPALSKPKSEDLVARLYIPRF
FT                   GNQWERNVVEGITPDILSKRGLGHYPTTQMPGAIGNFAVAGHRNGYGQPLGDVDLLKPG
FT                   DAIVVRTKDYWFVYKYTSYKIVTPDHGEVIDANPDHPGEKPTKRMLTLTTCEPKYTAAT
FT                   HRWISYAKFAYWAKISDGIPKELSTIDEQGKVKFINNEQQSLVSRLSSLVPVMVVVLLV
FT                   YMMIFVAGAIAWQWPELRAIHSGLKKKPDASIFGGLLRIQPGITAIRWILSILIYFFIV
FT                   LALFQWIFPWGASTIPFLQQMSNYSTTV"
FT   gene            complement(34425..36428)
FT                   /locus_tag="HMPREF0424_0030"
FT   CDS_pept        complement(34425..36428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0030"
FT                   /product="kinase domain protein"
FT                   /note="identified by match to protein family HMM PF00069;
FT                   match to protein family HMM PF03793; overlaps another CDS
FT                   with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13639"
FT                   /db_xref="GOA:D2RCM4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCM4"
FT                   /protein_id="ADB13639.1"
FT                   /translation="MNTTMPTLLANGRYELGELIGRGGMAEVRVAVDKRLGRTVAVKIM
FT                   RSDLANDEIFLSRFRREAHAIAQMNNPNIVNIYDSGEESVIAENGLEERLPYLVMEYIK
FT                   GKTLRDILKMNGALSQRDAEQVMLGVLNALEYSHRMGIIHRDIKPGNIMISEQGMVKVM
FT                   DFGIARALDDSATTMTQSQGVVGTAQYLSPEQARGEQVDMRSDLYSAGCVLYEMLTGRP
FT                   PFIGDSAVAIAYQHVSEVATPLSTLVPGMPAMWDKICAKAMAKDRQNRYATASEFKNDI
FT                   LAFMNGGVPVAAAFNPLTDLANMKARKQAEQDAATMAMGMTDGAATQSFNPITGQVESA
FT                   NIAFSPSTRASQRATMQAQRRKRVVIGSIVGVLVTVLVLLGVLFMLNRSRATGDVVVPT
FT                   FMETTTQDAAREKLRALGLVPDIREDDHSSQPEGTFTKQSPRGGEHVASGSKVTVWFSV
FT                   GPQSTRVPDVSGKTQEAARKMLERAGFKIANVRVEDSADIKKDHVTRTDPDADSFADKG
FT                   TLITLYIASGLTKIPDGLVGQSKDIVVSQLENFGFTTDVVKEDSDNVPEGSVTRLNPSS
FT                   GSSVKPHSSITVYVSQGASKVEVPSIDLGTVTFKQAKKILEAKGLRVVSDSMAKDDDIV
FT                   MSMSEEAGSKVEKGKAITLVTRPSLGSSSDSD"
FT   gene            complement(36425..37387)
FT                   /locus_tag="HMPREF0424_0031"
FT   CDS_pept        complement(36425..37387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0031"
FT                   /product="kinase domain protein"
FT                   /note="identified by match to protein family HMM PF00069;
FT                   overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13993"
FT                   /db_xref="GOA:D2RCM5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCM5"
FT                   /protein_id="ADB13993.1"
FT                   /translation="MKLVEGQLVHHRYRLDRRLAQGGMGEVWKGFDIQLGRIVAIKALR
FT                   TDTVNVEAKLRRLRAEAHNSANLAHPNIAALFDYYEHDGIGFLIMEYVPSKSLADLYHK
FT                   EKIIDPTKLLPILIQTARGLFVAHSHGVIHRDVKPANIMVSDTGNVKITDFGVSYSSDQ
FT                   EQITQDGMVVGTAQYISPEQAQGEQATAQSDIYSLGVVAYEGLCGHRPFTGATPVDIAA
FT                   AHVNDPVPPLPENVDLQLQQFIMSMLAKNPKDRPKDALVVSKVLSRIERRLLDQETAFN
FT                   NTTGVLSTNLRQRRCIKSMPQNQVNIINIFNTNDRKEQQ"
FT   gene            complement(37384..38850)
FT                   /locus_tag="HMPREF0424_0032"
FT   CDS_pept        complement(37384..38850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0032"
FT                   /product="penicillin-binding protein, transpeptidase domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00905"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13444"
FT                   /db_xref="GOA:D2RCM6"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCM6"
FT                   /protein_id="ADB13444.1"
FT                   /translation="MNKSLRELFTAVLVLFVILGISSTIITSIKANALNSDPRNRRALY
FT                   HEFGAPRGAILTSDGTVIVKSEPSKDAFVYQRQYSNGLVYAPVTGYFSISQRADRGIEA
FT                   SRNSLLSGESDALFWQRFRSLFTGATNRGASIETSIDSRLQNLAYNLLKGKDAALVAIE
FT                   PKTGRIRAMVSTPSYDPNDLALHNINEVNKSYERITSDVSNPMLNRAVSELYAPGSTFK
FT                   TVVAAAALESGKYKPDTKIPAGASYVLPGTKTSLTNVTYQANGVDGKISFEDALAYSSN
FT                   TAFAQLGNSLGSDVIVKQARKFGFFDSLPIDGSDSTGFPIRSVKSTFSIKPTPDRLALE
FT                   SIGQGDAKVTPLQNAMIAAAIANNGTLMKPTLVDCVRSSDLSVLSQTRPTVMNQVMSSD
FT                   SASKLTSMMQAVVTKENPNLALPNIHVAAKTGTAQIGMYNQAANGWVIGFAPAENPRIA
FT                   IAVIVHNTSTFGSYAAGPIMRQVMEEALKQ"
FT   gene            complement(38843..40324)
FT                   /locus_tag="HMPREF0424_0033"
FT   CDS_pept        complement(38843..40324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0033"
FT                   /product="cell cycle protein, FtsW/RodA/SpoVE family"
FT                   /note="identified by match to protein family HMM PF01098"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14330"
FT                   /db_xref="GOA:D2RCM7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCM7"
FT                   /protein_id="ADB14330.1"
FT                   /translation="MNMIATRIRQIALLLFATLLSGMAFLQMFFRIDGYISANYAAMLI
FT                   LVMALFFVFWGVLLVKQPYASQAILPCIMLLTAIGTVLIARIDRQNNTNVAIKQMVWIC
FT                   AALVLSIIFVILLKDYRILRRFSYVNMVIGLILLLSPMVPGLGKEIGGARIWIGFGDHT
FT                   VQPGEFAKLFLSFFFAAYLFNHRDRLAVGGNKVLGVHLPRLQDMGPIALVWAASMGVLV
FT                   IQHDLGTSLMFFAMFVSMLYVATGRRGWIAVGGIAFVAGCLMAVKLFAHVQYRVDSWLH
FT                   PFDNAVYNRFPGGSAQIVSGLFGLAAGGTTGTGLGQGHPSITPLANSDFIYASVGEELG
FT                   LTGLLAVLVLYLIIIASGMITAMKIKDGFGKLLASGLVFTMAFQVFTVVGGITLVIPLT
FT                   GLTLPYMAAGGSSLVANYLLASLLIVISHAANKPEPAPVSDTFQYAALAALRERELQER
FT                   ANTNTNNSEYNNTDYENNIDASAVISSSERGDNNE"
FT   gene            complement(40321..41985)
FT                   /locus_tag="HMPREF0424_0034"
FT   CDS_pept        complement(40321..41985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0034"
FT                   /product="protein phosphatase 2C"
FT                   /note="identified by match to protein family HMM PF00481"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13641"
FT                   /db_xref="GOA:D2RCM8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCM8"
FT                   /protein_id="ADB13641.1"
FT                   /translation="MKQINSNNEEEIQTAVTGQIEKISSITDKNDIKENRANSVEKILF
FT                   MYATAVSDVGTVRSNNQDSAFAGEHLAAICDGMGGHAGGDTASTIAIRSLAHIEQDSRP
FT                   HDVKTVSSMMETSIMAAHDAIVGKAKRERRLAGMGTTVTAVTLVRGYWVLAHLGDSRAY
FT                   LLRDNHLMRMTTDHSYVQHLIDTGHITPEEARNHPQRNVVMRVLGDFDIDPRPDIALRS
FT                   AHPSDRWLLCSDGLCGVLEDSTIQDVMSSISNQEECAQKLVSMALRAGSTDNVTAVIAD
FT                   ATLALDADAFDLPHQTPLIGGAASKDLESIADIVNKAVASAPALREDKNSPAQRAAALA
FT                   QDDDNSKNPDEGTISITRIVQPSHIREEVGELHTPDTNEIPIVKKKNGKVSTDPHDPDV
FT                   ARAVKHEQDEAHRAHSLRRRWTRIGISLGILLVLFVISGVGYGVYAWTQTQYYIGKDSN
FT                   KVVIYQGVPTNIFGIALSHKVESTDIPVNKLDKSWQDQLKEGISFGSLVEARGHASLIR
FT                   REMRAREQEKLNEQNQKKLENKINKNKDNAKQGGKTS"
FT   gene            complement(41989..42525)
FT                   /locus_tag="HMPREF0424_0035"
FT   CDS_pept        complement(41989..42525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0035"
FT                   /product="FHA domain protein"
FT                   /note="identified by match to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13812"
FT                   /db_xref="GOA:D2RCM9"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCM9"
FT                   /protein_id="ADB13812.1"
FT                   /translation="MMFTELTFAILKYGFLVLLWIFVWCAIRSLRCDIEVFSPKKSRFW
FT                   KKSSRRNSREAKFSQVMQVRETPVFAKAENQENTSGSPTLLVVIDGPLAGSSFPLNAAG
FT                   VTLGRAASNTVVLNDEFVSSHHARVYFNQSVNSWVLEDLGSTNGTMIGHNRVNEPVILA
FT                   PRTSVRIGATMFELR"
FT   gene            complement(42559..43260)
FT                   /locus_tag="HMPREF0424_0036"
FT   CDS_pept        complement(42559..43260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0036"
FT                   /product="FHA domain protein"
FT                   /note="identified by match to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14662"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCN0"
FT                   /protein_id="ADB14662.1"
FT                   /translation="MSVFDRFEKSVEGAMNSVFAKFGSKDLQPVDFSSALEREIDAEAM
FT                   PIGRDHTVAPNEYRFKLSTPDFDHIEQWGSEALANELADNLTQYAKSQHYAFVGPVVVI
FT                   FEEDLELTKGNFHLTSESVQGNAVPVTTEDQSQNHPMLEINGNQYLLTKDRTILGRGSG
FT                   CDIVIDDPGISRHHLGIDITPDGVIARDLGSTNGTYVEGHQVPAATLVDGNTITIGRTR
FT                   ILYWASSQDQE"
FT   gene            43416..44153
FT                   /locus_tag="HMPREF0424_0037"
FT   CDS_pept        43416..44153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0037"
FT                   /product="PAP2 family protein"
FT                   /note="identified by match to protein family HMM PF01569"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13948"
FT                   /db_xref="GOA:D2RCN1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCN1"
FT                   /protein_id="ADB13948.1"
FT                   /translation="MMQKNNSNHSGLSVFTRNSATIFTLLLAVVIPFLGKALLVTSKER
FT                   TYESSIVSWFHKSVPSVILSISKILALVFSTKGCIAILVLLAVLSLFVNKNWKMTIIQL
FT                   LISLLPMIYIFAVKFAVNRPRPHIGLNIKLPTDPSFPSGHTSAAVAVCVMAMLILYINK
FT                   PSSIQFGLLFSAILVVIVAVSRIIVAAHFPTDVLAAAIIYPLLSVTILRSFQRHNLYID
FT                   NRNNDKSTYEEQILDFNSQSNIQ"
FT   gene            44177..44587
FT                   /gene="mscL"
FT                   /locus_tag="HMPREF0424_0038"
FT   CDS_pept        44177..44587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="HMPREF0424_0038"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01741;
FT                   match to protein family HMM TIGR00220"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14145"
FT                   /db_xref="GOA:D2RCN2"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCN2"
FT                   /protein_id="ADB14145.1"
FT                   /translation="MIKGFKKFILRGSVIDMAVGVVMGSAVTSVVTTIVNYIINPLIAM
FT                   IFGKPELNGVLTISMNGATISFGAVIGALLNFLIVATAVYFCIVLPINKLREIGADLLQ
FT                   IEHEKTEEEKRKEREEKTIQLLQDIRDELVKR"
FT   gene            complement(44673..45338)
FT                   /locus_tag="HMPREF0424_0039"
FT   CDS_pept        complement(44673..45338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13453"
FT                   /db_xref="GOA:D2RCN3"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCN3"
FT                   /protein_id="ADB13453.1"
FT                   /translation="MSENFEPSQNPMNMNEESARFLSNDTELSAEKMVPSKEVNYSSEE
FT                   NNFDEISGNSSLGNIVKNSSSSGRVSGSSNTYRRTIGGAASSISNKSNATKSGRVPRAR
FT                   RMSLSLVRVDAWSVAKVTFLLSVAGGIIQVIAAGLVWLFLNMIGVFDQVTQIVSSTGLD
FT                   SNGFNLADVFSLPTVLSTVTIFSIVEIIIITVLSAIIALLYNVVGSLVGGIHITLGDD"
FT   gene            complement(45488..48118)
FT                   /gene="gyrA"
FT                   /locus_tag="HMPREF0424_0040"
FT   CDS_pept        complement(45488..48118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="HMPREF0424_0040"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989; match to protein
FT                   family HMM TIGR01063"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14274"
FT                   /db_xref="GOA:D2RCN4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCN4"
FT                   /protein_id="ADB14274.1"
FT                   /translation="MVDEINSARDDAERDQLPDGSMEPQSPQEADNTDYGLMKGARVKN
FT                   MDLQQEMRESYLAYALSVIVERALPDVRDGLKPVHRRVIYAMYDGGYRPDRGYNKCSRV
FT                   VGDVMGKYHPHGDSAIYDTLVRMAQSWSMRYMLVDGQGNFGSPGDDPAAAMRYTECRMA
FT                   PLAMEMVRDIDKDTVDFLPNYDGKTQEPTVLPARFPNLLVNGSAGIAVGMATNIPPHNM
FT                   REVADGVHWALDHPDASKEELLEALIQRIKGPDFPTGATILGHKGIEQAYRTGRGLITM
FT                   RAVVNTEEIKGRMCLVVTELPYQVNPDRLAASIREAVRDGKIQGIADMRDETSGRTGQR
FT                   LVLVLKRDAVPKVVLNNLYKHSQLQQTFGANMLALVDGVPRTLSLDAFIRHWVTHQLEV
FT                   IDRRTRYLKREAEERDHILQGYLKALDMIDEVVALIRSSKDVETARTGLMNLLDVDEVQ
FT                   ADAILAMQLRRLAALERQKILDEHEDLMIKIADYNDILASPERQRKIVGDELDEIVAKY
FT                   GDDRRTKILPFSGEMNVEDLIAEENVVVTVTRAGYIKRTKADEYRAQHRGGKGIKGAKL
FT                   REDDVVDHFFLTSTHNWLLFFTNRGRVYRLKAYELPEGSRDSKGQHVANLLQFTPGETI
FT                   QAVLSIPNYDVAKYLVLATRSGKVKKTALQEYDSPRQGGLIAVRLMANEETGEPVDELI
FT                   GAALCNSEDDIILVSKLGMSLKFRADDEQLRPMGRQTAGVQGMRFREGDELLDMDVVAA
FT                   ETSKDLLVVTNEGFAKRTAIEEYRLQGRNGYGVKAVQLAEGRGSLVGALIVEETDQVMA
FT                   IMKSGKVIRSDINEVKRTGRTTQGVTLAKPDKGDEIISIARNEETDDEENQLEEKEATS
FT                   ENEEA"
FT   gene            complement(48188..50263)
FT                   /gene="gyrB"
FT                   /locus_tag="HMPREF0424_0041"
FT   CDS_pept        complement(48188..50263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="HMPREF0424_0041"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF02518; match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14507"
FT                   /db_xref="GOA:D2RCN5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCN5"
FT                   /protein_id="ADB14507.1"
FT                   /translation="MANTEDNSMDNAVEEHKLDDAQLDDSLAPEHYDASDLRVLEGLEA
FT                   VRIRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGYASHIEVTILPDNAIRVVDDGRGI
FT                   PVDEVPGEGVSGVETVMTKLHAGGKFGGGGYAVSGGLHGVGISVVNALSTRVEIEVRRQ
FT                   GFHWTQTYVDQHPTAPLAKGEPMAEGESTGTSVTFWPDGTIFETTVYDFETLRSRFQQM
FT                   AFLNKGLKISLTDLRKPDEAGDEVAGDSESSSEEKHRSVSYQYEHGIKDYVDYLVKSRK
FT                   AVPVEPDVIDFEAEDLEIGISAEIAMQWTVAYSEAVHTFANTISTTEGGTHEEGFRAAL
FT                   TTLVNRYAREKNILKEKDTNLSGDDVREGLTAVVSVKLTTPQFEGQTKTKLGNSEAKTF
FT                   VQRVMTEKLGDWFDAHPNEAKNIIQKAIEASRARLAAKKARENTRRKSIFETAGMPDKL
FT                   KDCQSSNPEECELFIVEGDSAGGSAIQGRDPITQAILPLRGKILNTERASIDRMMKSET
FT                   IESLITAVGGGYGEDFDLSKVRYHKVIIMADADVDGAHIATLNLTLFFRYMRPMITAGY
FT                   VYVAMPPLYRLKWSKGAHDFVYTDAERDRVLAEGKAAGRQLPKGEGIQRYKGLGEMSYQ
FT                   ELWETTMDPEHRILKQIHIEDAARADETFSMLMGDEVEPRRLFIQRNAHDARFIDA"
FT   gene            complement(50444..50911)
FT                   /locus_tag="HMPREF0424_0042"
FT   CDS_pept        complement(50444..50911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13938"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCN6"
FT                   /protein_id="ADB13938.1"
FT                   /translation="MIPVNILLKIDTRKLPAIIFDPINRKAERENNREKNAEQAWENFG
FT                   KPGRDPKSFCGILKNFASESNWNSQLSIAKLRSSWYKVVGESIAKHCEISQVVNGVLIV
FT                   RAQSTVWATQLSYLIPQLKEKINNNLENIEIKEIKVIGPTTSGLGFLRNKF"
FT   gene            complement(50911..52212)
FT                   /gene="recF"
FT                   /locus_tag="HMPREF0424_0043"
FT   CDS_pept        complement(50911..52212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="HMPREF0424_0043"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by match to protein family HMM PF02463;
FT                   match to protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14617"
FT                   /db_xref="GOA:D2RCN7"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCN7"
FT                   /protein_id="ADB14617.1"
FT                   /translation="MYISRIALDTFRSWNHIICDFNPGINVIYGNNGLGKTNIVEALEV
FT                   TGTGISHRTSSTLPLIKKGYEKSIIRINTINNDINYKKDETNTGLSNIASLESNLNQTT
FT                   YEIDLYVKGSNRAHINSGKALYVKDIVGLLPIVSFTPRDQFLIIGDPNVRRTFIDQAGS
FT                   LLIPNYVQLLQEFKHISKQRAALLKNIRDFSYKNQTVSLSGLEIWTGKFIESGINLTKA
FT                   RQETVQIINKYFKNIIKSFTNEENTEIIYVPSFEEVLFEKKSDENIEDKNELFSKISEH
FT                   FQRIYDGELARGCNLIGPHRDDIDFAINNISAKDFASNGESWTIAIASKMALCKALEEK
FT                   NNDKPIVILDDVFAQLDENRRIRILNFALNQGQVFITTSSLSDIPNKEYIKKTNLINIG
FT                   KLLEKNNEINNFSEEHNNILLDVIEQRKNKQEEK"
FT   gene            complement(52311..53435)
FT                   /gene="dnaN"
FT                   /locus_tag="HMPREF0424_0044"
FT   CDS_pept        complement(52311..53435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="HMPREF0424_0044"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13845"
FT                   /db_xref="GOA:D2RCN8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCN8"
FT                   /protein_id="ADB13845.1"
FT                   /translation="MKVEVNSASFADAVAWTTRVIDSRPANPILAGLKIEAANGTLQLS
FT                   AFNYQISSCHHIEAGVDEEGSILILGKLMADITKSLPAEKTYLKSENNTLTITSGKSTF
FT                   TLQLMPLGEYPDLPELPHKLGQVDAPTFIQAVNQASVSTSREENRPVLTGIRIQFEDDT
FT                   VTMTSTDRFRLSRSTFKWTPEHNDIHSTTLTRGSLLRDIAHSLDDHQNVIIHFNEEDKS
FT                   LLGFENSGRTSTSQIIDGEFPSVDRLFVDEYPIHAIINKQLLINAIKRVSLVAERNAPI
FT                   RMIFSNQELTLSAGTADESQAKEVLDIDMDGEDITVAFNPNYLLEGLGAIPEPFVHMKM
FT                   ATAVKPVEFNGQQESDGDESTDYRYLLVPMRFNN"
FT   gene            complement(53866..55485)
FT                   /gene="dnaA"
FT                   /locus_tag="HMPREF0424_0045"
FT   CDS_pept        complement(53866..55485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="HMPREF0424_0045"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM PF08299; match to protein
FT                   family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14503"
FT                   /db_xref="GOA:D2RCN9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCN9"
FT                   /protein_id="ADB14503.1"
FT                   /translation="MADTLGDSTSQAALVWSNTLTVLQHNALLTARDKGWFEGVKPEAI
FT                   FGTTIVLCVSNAETQQALQNELNSPLLTALKICTGKDMFPAFRIVPQSEYQEKAAQNSS
FT                   NSLSHQAQNNANLNKNKIVTDNTVLPVDNISVSSSNNLSSVTANNSSPVQPDFDHATGI
FT                   STLQQTDISTEQAAQQKMPVSVQRDAITHLNTCATFDTFVPGDSNRFARTVALAVAEGS
FT                   GRDFNPLCIYGGSGLGKTHLLNAIGNYALVKDSSLKVRYVTSEEFTNEFIEALQTPNQS
FT                   QGQIADFNRRYREVDVLLIDDIQFLGGKEATLEQFFHTFNSLYQANKRIVIASDVAPKN
FT                   LKGFEARLISRFESGLTVDIKPPDLETRIAILRMMASMNHCNVPSDVLDLIAERFTENI
FT                   RELEGALTRVTAVASLSNQPVSKALAEQALQDFFATDIEVRPTDIISQVAQYFHMTFDE
FT                   LVGRQRTKNVALARQIAMYLAREMTSMSLVDIGEVFGGRDHTTVMHAYTRVSGEMQEKQ
FT                   EIYNYVMELTVRLKQNPVERRN"
FT   gene            55874..56008
FT                   /gene="rpmH"
FT                   /locus_tag="HMPREF0424_0046"
FT   CDS_pept        55874..56008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="HMPREF0424_0046"
FT                   /product="ribosomal protein L34"
FT                   /note="identified by match to protein family HMM PF00468;
FT                   match to protein family HMM TIGR01030"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13669"
FT                   /db_xref="GOA:D2RCP0"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCP0"
FT                   /protein_id="ADB13669.1"
FT                   /translation="MKRTFQPNNRRRHMKHGFRVRMRTRAGRAVINRRRAKGRKSLSA"
FT   gene            56120..56527
FT                   /locus_tag="HMPREF0424_0047"
FT   CDS_pept        56120..56527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0047"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /note="identified by match to protein family HMM PF00825;
FT                   match to protein family HMM TIGR00188"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14088"
FT                   /db_xref="GOA:D2RCP1"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCP1"
FT                   /protein_id="ADB14088.1"
FT                   /translation="MRDDIAVQSTLNEDRSASLDYIATGFESDTPAAFSGTFLHDQKFE
FT                   HVKRLGLAVSKSVGKAVVRNKVKRRLRVIAKNYESLLPAGCDVVLRAKPSAAQSSFDSL
FT                   QCQIQKLFGKISADLCSTQNCKMHENNQNQG"
FT   gene            56708..56854
FT                   /locus_tag="HMPREF0424_0048"
FT   CDS_pept        56708..56854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0048"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13544"
FT                   /db_xref="GOA:D2RCP2"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCP2"
FT                   /protein_id="ADB13544.1"
FT                   /translation="MARLEVVFLHYYAFYAVDLGQAAVLMMYPANIRFFTDVLGLKHMK
FT                   SHG"
FT   gene            56886..57899
FT                   /locus_tag="HMPREF0424_0049"
FT   CDS_pept        56886..57899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0049"
FT                   /product="membrane protein insertase, YidC/Oxa1 family"
FT                   /note="identified by match to protein family HMM PF02096;
FT                   match to protein family HMM TIGR03592"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13973"
FT                   /db_xref="GOA:D2RCP3"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCP3"
FT                   /protein_id="ADB13973.1"
FT                   /translation="MFNQDNFILDNGFLGWFYKILTPVEWLMTQIMSLFHKLLTLLGMN
FT                   EVGFSWVFSIVFLVLVVHACIFPAFIKSIKGMRKMQAIAPKIKKIQQKYKGKNDPASKE
FT                   AMQREMMKLYQDNKANPAGSCLPMMIQGPAFMSIWYTLSVIPFIARGKHAALGAFDIAT
FT                   AQQFVKTRVFGVGVADTFMTTAGAGKIVIVIFVVLMCAAMWYMQFNNIRKNLPPESKQG
FT                   SQYTVQKLMMWGFPLIYVFSAFAMPFAMLVYWLVNNVINMLRSIWQVYAFPTPGSPAAE
FT                   EKEKRDYQKETARREREGLPSIEEENLQKAREEAERREIEGFQRKQPQRKRKVAKR"
FT   gene            58036..58590
FT                   /locus_tag="HMPREF0424_0050"
FT   CDS_pept        58036..58590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0050"
FT                   /product="R3H domain protein"
FT                   /note="identified by match to protein family HMM PF01424"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14692"
FT                   /db_xref="GOA:D2RCP4"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCP4"
FT                   /protein_id="ADB14692.1"
FT                   /translation="MVQDEKRTVDQLNEEADIAADYLEGLLDIADYEGDIEMGVRNNRP
FT                   MIQIVADDDTDIKNLIGRNGEVVDALQQLSRLAVQQKTGDRSHLIVDVDGFLKRKRQHL
FT                   RDIALDAVDEVRETGEPVNLKPMNSFERKVVHDTVRDEGLRSRSHGEEPRRYVTVYMPS
FT                   VASEDENIDEIDDVEGEYSEE"
FT   gene            58669..59436
FT                   /gene="gidB"
FT                   /locus_tag="HMPREF0424_0051"
FT   CDS_pept        58669..59436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="HMPREF0424_0051"
FT                   /product="16S rRNA methyltransferase GidB"
FT                   /EC_number="2.1.-.-"
FT                   /note="identified by match to protein family HMM PF02527;
FT                   match to protein family HMM TIGR00138"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13828"
FT                   /db_xref="GOA:D2RCP5"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCP5"
FT                   /protein_id="ADB13828.1"
FT                   /translation="MLCYFLFIFYIAFICFGENMEANLDKKYEENTQKIADELEGSPLL
FT                   NEVLGEALEKCKLFHVKLQQEGLIRGLIGPRDMNILWERHILNSAAVVPFIKEAIVGRK
FT                   NKRVADVGSGGGFPGLVLAACLPDYDVTLIEPMERRVDWLRECVALMKLKNVTIFHGRS
FT                   DEVIDKVKSHEIPAFDVVTCRAVAPMTKLAGWTIPLLNKHGKLIALKGKSAQAEVEKAV
FT                   KMIRKAGGIDTHVFEAPVASGLQPTTVVIVNKA"
FT   gene            60342..61313
FT                   /locus_tag="HMPREF0424_0052"
FT   CDS_pept        60342..61313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0052"
FT                   /product="CobQ/CobB/MinD/ParA nucleotide binding domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14405"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCP6"
FT                   /protein_id="ADB14405.1"
FT                   /translation="MESAAETIQRIFGDSKSSLGIELADLTSRFHSIEQAKYPKPKQTR
FT                   FIAVANQKGGVGKTSSAVNLAAAMAVSGSKVLLIDMDPQGNASTALNTPHASGNLSVYD
FT                   VLEERKSIAEVKHACPDIEGLDVVPASIDLSGAELELADMDNRNNLLKDALQEYLDNSS
FT                   EHYDYVFIDCPPSLGLLVINAMCAAREMLIPIQAEYYALEGLGQLIRTIGLVQQHYNPI
FT                   LVVSTMLVTMFDKRTLLGREVFQEVKKHYPNIVLETTIPRTVKIPEAPSFNQSVITYDP
FT                   HGSGAISYREAALEIAKRSKTVLSVIAAKQDANRQEQQQENQ"
FT   gene            61313..62665
FT                   /locus_tag="HMPREF0424_0053"
FT   CDS_pept        61313..62665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0053"
FT                   /product="ParB-like protein"
FT                   /note="identified by match to protein family HMM PF02195;
FT                   match to protein family HMM TIGR00180"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14197"
FT                   /db_xref="GOA:D2RCP7"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCP7"
FT                   /protein_id="ADB14197.1"
FT                   /translation="MSGNKSRLGKGLGALFPALPGEDALADASNNLQFNVSHETKKSES
FT                   VDSQLEEQAKVSRETLHKDNNQSKNVSHETKVPSMSNSIAPHADKSNNKIKNVSRETVP
FT                   SIHTNKHSHKRSTMPSLGDVTRPMDFFFGDSASTTFMSSKAKNNEETVIGEKNNAAEKS
FT                   NKTAKNEPLKPVKGGYLAYLKPLDIVPNAHQPRTIFDEDELRELASSIKEVGVLQPIVV
FT                   RPIVDADKNDEQIAHYELIMGERRWRASQLAELDTVPAIVRTTADENMLRDALLENLHR
FT                   VALNPLEEAAAYSQMIDDFGLTQIQLSQSVSKSRPQIANTLRLLNLPASVQKHVASGVL
FT                   SAGHARALLGLENPEDMESLANRIIAEGLSVRSTEEIVSLKNEDTSHGAVRTRVRRNNQ
FT                   WSSSPVRKQLEEHFATKVSIKGTENHGRIEIVFSSPEEMQRIIGLLVSKKE"
FT   gene            complement(62789..63730)
FT                   /gene="trxB"
FT                   /locus_tag="HMPREF0424_0054"
FT   CDS_pept        complement(62789..63730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="HMPREF0424_0054"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF03486; match to protein
FT                   family HMM PF07992; match to protein family HMM TIGR01292"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13692"
FT                   /db_xref="GOA:D2RCP8"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCP8"
FT                   /protein_id="ADB13692.1"
FT                   /translation="MENKLRKVIIIGSGPAGYTAAIYLGRAGYKPLVIAGALTPGGQLM
FT                   NTTEVENYPGFPEGILGPDLMESMQKQAEKFGAEVLLNEVASVDFKSAVKLVTTDDGIT
FT                   YESDAVIVSTGSQVRKLGVPGELEYSGRGVSYCATCDGFFFRGKPITVVGGGDSAFEEA
FT                   LFLTRFGSSVTLIHRRDEFRASKIMVDRAKENEKIKFITNSVVDEVHGNDVEATSLTVR
FT                   NVITGETQEVESAGLFVAIGHTPATKFLNDQLKLNEDGTIVVDGATTRTSVEGVFAAGD
FT                   VVDNMYRQAISAAGMGCRAALDAQTYLNEKYA"
FT   gene            complement(63765..65984)
FT                   /locus_tag="HMPREF0424_0055"
FT   CDS_pept        complement(63765..65984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14581"
FT                   /db_xref="GOA:D2RCP9"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCP9"
FT                   /protein_id="ADB14581.1"
FT                   /translation="MEPRLGDIVLNRYVLVSLLRNEAGLQVWQANDRILTQDCQLFIVR
FT                   DSRFLPQVNTIASTLALSHSRKFTQVLQLRHHDSVAIIVTALDRGITINDYLALKKAPL
FT                   SYEAIRTIVAETAQALSRLLASNITHHAVSSDTVRISSSGIELADTPVSPLLEDVTQKD
FT                   DDQIPRQNVEHIATKQLASLLYTLITRTSSRIQARFDASLLPDNTPSEFRMICTRSLAS
FT                   NKNNNVIPMASIAELVALLGSYTPLSKLTTRDIVLDGKTSVASISNVRLREAKDDCILP
FT                   LPEGLSQSEEEFDAQLMQRNNQDSNDFSSTNSANTISNNTNGSAKLSDSFKNAGRTLGS
FT                   LLKRSNTNSDSEGIGNNSFSDETNTNTDIDFHDIAAAEIASILAPTELDTDDALFPTLS
FT                   ASYKHFPDTATSKNIFDHVENTRNQTSKNTISETGVVSSFDFGHLLTENNQHTELISRP
FT                   QNLTSEGEATGRVPVVDSHGRFVAPGEESARALRDEINNDQNDDIQENGAPSLPPSFQP
FT                   LEQTATLHKQKQNTQNNNTIADAKIWWGLSTKVIAIGAVSLLLVAGLALALHGLFGNHE
FT                   STDSFGNNGSWDSTSLENVPFGSQGILPQEKQPAKKNMGRKQVKPVPKPKIPTNNVAYE
FT                   ADRYQFLSFPANQAGYGYYIHLTEPQTVYRFVVSIRSSGGHAYLLADTKDDPTKGTQVA
FT                   EFTFDESGTTDVKLKKIVKSQDFMLWVPKDSMPKNSLYINSVKLY"
FT   gene            complement(66150..67946)
FT                   /locus_tag="HMPREF0424_0056"
FT   CDS_pept        complement(66150..67946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0056"
FT                   /product="putative integral membrane protein MviN"
FT                   /note="identified by match to protein family HMM PF03023"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14003"
FT                   /db_xref="GOA:D2RCQ0"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCQ0"
FT                   /protein_id="ADB14003.1"
FT                   /translation="MSSVGRNSVIMASGTAASRITGQIRTILLAAALGTTGLAANAYQA
FT                   GSMIPQLIYTLVSGGIFNAVLVPQIVRTLEKKNAEERLNKLITFAILLLLALTVLMSIA
FT                   TPVLTMLYAGGSAEMQTLTCSFTLWCMPQIFFYGIYTVLGQVLAAKEHFAMYAWSSVAA
FT                   NIISCLGFGVFIIIFGKANRMPLSFWNGNTLLLTAGFWTIGVAAQALVLFLPLIKCGIH
FT                   YKPSFGIRDIGLRSMGPVAAWSMGIVIVTQIVVMITTHITTSVPFVAEKRLGLDQFEVA
FT                   GNATYQNAYTMFLLPYSLVAVSVATAIFPKISRSIASHDLHSARNDLSEALRHVSIIMC
FT                   FFTVVFIVIPTPISLALIPSISVQEANLMSAPLMMLAFGLPLTSSYLIIQRTFFAFEDG
FT                   KSPFIFAAAQLLTELFAFVCCINVLPPTYWVTALGSSVSISYFLTFPSLVHMLRNRFNN
FT                   DLDDRNLIITHIKIIIASIVSIVVGFLVSKPLLHVLNFNSPHMHGVLRWVYAILICAIT
FT                   TIIIAVVYLSALLLLRTRELVDLSSPIISKLAQKIPALVPLAKIFEETAKSQSQHEQKN
FT                   LRIPRRIQSDAKYHDSSNGKNF"
FT   gene            complement(67943..68476)
FT                   /pseudo
FT                   /locus_tag="HMPREF0424_0057"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            complement(68521..70335)
FT                   /pseudo
FT                   /locus_tag="HMPREF0424_0058"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(70316..71092)
FT                   /locus_tag="HMPREF0424_0059"
FT   CDS_pept        complement(70316..71092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0059"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13454"
FT                   /db_xref="GOA:D2RCQ1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCQ1"
FT                   /protein_id="ADB13454.1"
FT                   /translation="MITPADLRRTLAKLADNHAQNQAAPVITPLDLAKMHRKKSCQQDS
FT                   CEEQNVVDIPLFSKDDSTAQDSGSPEDNLQKTSSFSGVSPALMPPRRQADTPTTFASLD
FT                   AQDLPIIREYSAGGLVFDSLGRVAIIARHSRSGHLEWCLPKGHIEKGETPQETAVREIH
FT                   EETGIVGEVVDSIATIDYWFTGTTHRVHKLVHHFALRYVSGDLSVLGDPDHEAEDAIWV
FT                   NFKELNAILSYPNERKIAWLYAKKAHRRSNSEETHA"
FT   gene            71180..72607
FT                   /locus_tag="HMPREF0424_0060"
FT   CDS_pept        71180..72607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0060"
FT                   /product="tRNA adenylyltransferase"
FT                   /EC_number="2.7.7.72"
FT                   /note="identified by match to protein family HMM PF01743;
FT                   match to protein family HMM PF01966; match to protein
FT                   family HMM TIGR00277; match to protein family HMM
FT                   TIGR02692"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14314"
FT                   /db_xref="GOA:D2RCQ2"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR014065"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCQ2"
FT                   /protein_id="ADB14314.1"
FT                   /translation="MTENFEVWPEAIELGRLFAERHYELALVGGPVRDMLLHRVSHDLD
FT                   FCTSARPEEFEPILRRWGHDGFWDMGRKFGTLGAMRRRADGTEVKVEITTYRSDVYDPD
FT                   SRKPEVQYGDTLEGDLSRRDFTVNAMALRVPDLQFVDPFGGASDLAKGVLRTPVDPRQS
FT                   FDDDPLRMMRAVRFVAQLGFSIEANTAEAIVDMADRLDIVSAERIRDEITKMLLSDRPR
FT                   KGLEALVESGIAQRVLPEIPALQLEIDEHHRHKDVFEHTMMVLERAIALETDQEGPVPS
FT                   PDLTLRLAALLHDIGKPKTRKFEDGGKVSFHHHDVVGAKMTRKRLKALHFDHHLIEDVT
FT                   ELVNLHLRFHGYVDEPWTDSAVRRYVKDSGHLYERLNRLTRADATTQNRRKSLMFEHAM
FT                   DEMEERVKELKKQEDFNAIRPDVDGNEIMQLLHLQPGPTVGEAYKHMLDYRLDNGPVDH
FT                   DIAVEELQRWYEETYKK"
FT   gene            complement(72664..73290)
FT                   /locus_tag="HMPREF0424_0061"
FT   CDS_pept        complement(72664..73290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14345"
FT                   /db_xref="GOA:D2RCQ3"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCQ3"
FT                   /protein_id="ADB14345.1"
FT                   /translation="MTQEYDERIARKAFMYQRKRSVLTTVGVGLGVTFIFALLVQFHAF
FT                   GINSVRAPKDNPNYGVPAPCAIIGKEGAKAPYVDNRAVAIRVLNGTKFRGLARAVGEAL
FT                   NARGFNLTEVNNNKSSNIKRTIIYFGKNAINEAYTVNANFTDAIMRMDDRKDKLVDIVL
FT                   GSTFNNLRPKVDVPAAGATIHEVQGCIRADLMKNIPKADQHKEVK"
FT   gene            complement(73420..74328)
FT                   /gene="ksgA"
FT                   /locus_tag="HMPREF0424_0062"
FT   CDS_pept        complement(73420..74328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="HMPREF0424_0062"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00398;
FT                   match to protein family HMM TIGR00755"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13573"
FT                   /db_xref="GOA:D2RCQ4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCQ4"
FT                   /protein_id="ADB13573.1"
FT                   /translation="MLRNLDGKTLTEISIENEGQLLGAADIRRIAAEEGITPTKKFGQN
FT                   FVIDPGTVRKIVAAAEVKSGDIVMEVGPGLGSLTLAILQTGAQLTAVEIDPPLARRLPH
FT                   TVEEFMPQSMQKFNVILKDALTVNADDVPQIAQAKQFTLVANLPYNVATPIILTLLEKF
FT                   SNLQNFLVMVQKEVADRLCAQPGNKVYGTPSVKLAWYGKAQRAGLIGRNVFWPSPNVDS
FT                   ALVSFTRNCTGKGDNNEREGVFAFIDAAFQQRRKTLHAALKNQVPEEAYKNSGIDPTRR
FT                   GETLTCDEFIALYRACKDCKL"
FT   gene            complement(74372..75754)
FT                   /locus_tag="HMPREF0424_0063"
FT   CDS_pept        complement(74372..75754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0063"
FT                   /product="G5 domain protein"
FT                   /note="identified by match to protein family HMM PF03990;
FT                   match to protein family HMM PF07501"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14393"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCQ5"
FT                   /protein_id="ADB14393.1"
FT                   /translation="MARRWTPRRLIVMRRARIIACVLSISLTATSLFIFTAKKSVAMII
FT                   NGKTHIVSTYSTNPIRLLEEQHVPVKTHDQIISSSGDILTNHSTVTVRSAYQTSITVDG
FT                   VTIPFWTVATSVDQLIGFFKANAKNASRITVNLQNIYDKLTCGLSINKKGPISVIADRK
FT                   TRIVQNGDLPASAILDSQGIVLGKEDRVSVEEDDGNTVLRVSRVTHGKETRTVSLPFAT
FT                   QTVVDPKLPANSRVVQQVGVNGEREDVYNVTYVDGKAESATLVSQNLVKPAVNQVIAVG
FT                   KAAPAPIHKNNTNTQKSKQSKQQTNAQPKKQNTEQPAKQEKKNSQQPTQQQTASAAPAP
FT                   AANPPAPAPSSNPDSLVHATPEQAKLFAQGAAAQMGWTGKEWEDLLWLWNRESGWRWNA
FT                   ENPSSHAYGIPQALPGNKMSSAGANWHEDAAIQISWGLSYIKSKYKTPSGAVKHSREIG
FT                   WY"
FT   gene            complement(76203..76279)
FT                   /locus_tag="HMPREF0424_1354"
FT   tRNA            complement(76203..76279)
FT                   /locus_tag="HMPREF0424_1354"
FT                   /product="tRNA-Thr"
FT   gene            76444..78285
FT                   /locus_tag="HMPREF0424_0065"
FT   CDS_pept        76444..78285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0065"
FT                   /product="kinase domain protein"
FT                   /note="identified by match to protein family HMM PF00069;
FT                   match to protein family HMM PF01163"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13726"
FT                   /db_xref="GOA:D2RCQ6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCQ6"
FT                   /protein_id="ADB13726.1"
FT                   /translation="MEDTSMFDLQPGTNVGGYTLISRLGGGAMGSVWRVNDDGGNQYAM
FT                   KILRASVHAKQSEDEDSEQERARIRLKREALALQRIHHPGVCAIVDMELDASIAFIVTE
FT                   LIEGHNLREDVDENGPYIADDLERLAHKLIEAVKAVHEAGIVHRDIKPTNVMISATGPV
FT                   LVDFGIAMGEGESHVTRTGLVMGTPGFIAPEIIEGGDSDELTDWWSVAAVLAFAATGKP
FT                   VFGTKPMMAVLERAASGNADLTGLPPRTMAAFRKALNPIREQRCMPSDLENAISQDAMD
FT                   PLAWPEVNRPFDRNATNITMRKMWCETSRETKEKTAILTNSRTCDAAGTAGITNLNSDG
FT                   EMPTVTVRSTTVMPHSLDNSEDDKTFCVDEKTRINALNDVDFQNIQDDNSNNSRIAQSS
FT                   KLIRSSDNTFDNGNIENEAGDSLHVKSDEVSSVDPVLNKHDYARRGTWILLICIILHLA
FT                   IACLSILDSIGFAMVFMWISATSGYSISSSLRRWQLNDGIIPRHDSVVLIATLPWHIIR
FT                   GFVYMLPRVIAIVVSGGIGAVIYPFFCGNNPELLSIDVGSLRILLPTYSPNIFSSTAVG
FT                   YALGFIVAWVVFAAVKWTTKFRLGLGAVFYSGKSFEK"
FT   gene            78418..79389
FT                   /locus_tag="HMPREF0424_0066"
FT   CDS_pept        78418..79389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13866"
FT                   /db_xref="GOA:D2RCQ7"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCQ7"
FT                   /protein_id="ADB13866.1"
FT                   /translation="MPKIQMRDNKQGDSSATRLQRTIENRERAAREARERRQQAIIGVI
FT                   VVIIVAAMLAAVGITAYQAAYVQPQKKIEQSAKSNHNLDNIDPSIRPSGVNSKNGILFS
FT                   KDGYGKQAAGAPTVATYFDPLCPGCGSFNRTVDETLIKMVEAGQINLELHPMSFLDGLS
FT                   TDHYSTRVSSAIAYIASYDNNPKHLLQFINGIFNEKFQPEESEGYKPVSNKELIKLAKK
FT                   SGIPNEIASKAFNRQYLKWQLLVNKYTPDRKELWNVSGPNKGSMTTPTVTINDKLLDMN
FT                   AINEKKMKVLDALLHCIGLDKKQVGVAGQMPKVSDTSSPIAL"
FT   gene            complement(79485..80444)
FT                   /locus_tag="HMPREF0424_0067"
FT   CDS_pept        complement(79485..80444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14403"
FT                   /db_xref="GOA:D2RCQ8"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCQ8"
FT                   /protein_id="ADB14403.1"
FT                   /translation="MDQQQETTNNEMQKSNTPYSKSLIGIVIALIILAFAAGAGFMTYY
FT                   NSINKPQVKIENPTTNKPDTQTEDTADSQITKEIKKLPSSDIPPASNLQGGILLSKDGY
FT                   GKQAAGAPTVATYFDPLCPGCGSFNRTVDETLIKMVEAGQINLELHPMSFLNRFSSDQY
FT                   SYRVSGGIAYIASHDNDPKHLLKFINSIFSERFQPEEGDGYQATPNKALIDLAEDAGVA
FT                   DKIANEAFNLHYVKWQEVINENTPEEKALWNVSGSNKGAMTTPTVTINGKLVDLNAASE
FT                   KQMDPLEAILKSLGIDKKHVGKSGHMPKVTYKSKPLDL"
FT   gene            80685..81812
FT                   /locus_tag="HMPREF0424_0068"
FT   CDS_pept        80685..81812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0068"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08402"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14124"
FT                   /db_xref="GOA:D2RCQ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCQ9"
FT                   /protein_id="ADB14124.1"
FT                   /translation="MAEVVFDHVTRIYPGNDKPSVDDLNMTIKDGEFLVLVGPSGCGKS
FT                   TTLRMLAGLEEVNKGRILIGGQDVTTMQPKDRDIAMVFQNYALYPHMTVADNMGFALKI
FT                   AGVPKEEIRKRVEKAAEVLDLTEYLDRKPKALSGGQRQRVAMGRAIVREPKVFLMDEPL
FT                   SNLDAKLRVQTRTQIAALQRQLGVTTLYVTHDQTEALTMGDRIAVIKLGILQQVGAPTE
FT                   LYDRPANVFVAGFIGSPSMNINQHPVVNGRAQIGEDSILLPAEAVDKLTAEDNGQIIVG
FT                   FRPEDASLATSDDPNAFSLKVMNVEDLGSDGYIYGNIITDGSPEEASTMMSDQNKLTTI
FT                   RVNPRALPKVGDTVKIKIDPSKMHLFAPSTELRLN"
FT   gene            82062..83477
FT                   /locus_tag="HMPREF0424_0069"
FT   CDS_pept        82062..83477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14547"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR025111"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCR0"
FT                   /protein_id="ADB14547.1"
FT                   /translation="MEWNDAPQLDPRAVQATSVSAQDENASSQEPQALKITAASSNPKM
FT                   FTLPWELPLSQWPADLFVNLPRGISRHVVRFVHVGDEVYAMKEITRQVAEREYELLRRL
FT                   RKLELPTVTPIAVVAGRHDANGEKLEAMLVTKHLKFSLPYRALFARTLRPDTAERLIDA
FT                   LAVLMVRLHLSGFYWGDVSLSNVLFLRDADAFSAFLVDAETGDLHGSLTEGQREYDIDL
FT                   ARTNIIGELMDLSSGQLLPTEVDEISIGNRLVDRYHSLWSTLTDVDKFSPDEMWRIERR
FT                   VNRLNELGFDVDELEMKTSEDGRRVLVRPRVVDAGYASRKLLRLTGLDVQENQARRLLN
FT                   DLDAYRTSTWRQGEELEIVATDWMREIFEPTVRMIPPEFRSQIEPAQFFHEVLDHRWFM
FT                   AEKVGHDVAMQDAVTSYIKNVLPQYKMDKHVLAAINADADSGVVDDEYTYSSPAPVGHD
FT                   IDEDDQDASVWAS"
FT   gene            complement(83629..83701)
FT                   /locus_tag="HMPREF0424_1355"
FT   tRNA            complement(83629..83701)
FT                   /locus_tag="HMPREF0424_1355"
FT                   /product="tRNA-Lys"
FT   gene            complement(83773..84033)
FT                   /locus_tag="HMPREF0424_0071"
FT   CDS_pept        complement(83773..84033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0071"
FT                   /product="glutaredoxin"
FT                   /note="identified by match to protein family HMM PF00462"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13760"
FT                   /db_xref="GOA:D2RCR1"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCR1"
FT                   /protein_id="ADB13760.1"
FT                   /translation="MSDQPTVNVYGADWCGDCKRAKAALIQYGVAFVWHDIETEEGAEE
FT                   KAIEISNQKHIPVVTFADNTFMVEPSATQIKAKLESLGILQ"
FT   gene            84222..85403
FT                   /gene="ftsY"
FT                   /locus_tag="HMPREF0424_0072"
FT   CDS_pept        84222..85403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="HMPREF0424_0072"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM PF02881; match to protein
FT                   family HMM TIGR00064"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13859"
FT                   /db_xref="GOA:D2RCR2"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCR2"
FT                   /protein_id="ADB13859.1"
FT                   /translation="MNMVMDMNMLIWFAAAAVVIVILLVTVAVILRIHSNSHGPVIPES
FT                   VDSAIDTSKNKARGTKKSEKQIESNVAVVPNEEVKSELLPESTSSRIKRLRGRLAHSAN
FT                   PFGRALFNIISKDHLSEEDWEDVEDTLLMADVGSRASEELVEDLRKDARIAGTSNSEDV
FT                   HSALRTKLLKIVDEDADRRLNVDKSDAHHPSVIMMVGVNGTGKTTTAGKLARLFIAKKR
FT                   SVMFAAADTFRAAAADQLETWASAVSVPVVRANKDGADPASVAFIAANKAKEEQTDLLI
FT                   VDTAGRLQNKANLMEELGKIRRVIEKTMPVDEVLLVLDATTGQNGMSQAKVFAEAIGIT
FT                   GVVLTKLDGSAKGGIVIAVQRELGVPVKLVGLGEGPDDLVPFDAQSFVDGLLA"
FT   gene            85566..87344
FT                   /locus_tag="HMPREF0424_0073"
FT   CDS_pept        85566..87344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0073"
FT                   /product="ammonium transporter"
FT                   /note="identified by match to protein family HMM PF00909"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13650"
FT                   /db_xref="GOA:D2RCR3"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCR3"
FT                   /protein_id="ADB13650.1"
FT                   /translation="MTTMDPQWALLAGALVFIITPGIALFYGGRERATSMVNMMMLSAG
FT                   AIAVTTLVWTLWGWSLAFAGKDMAGGVIGDPLSGLLFRDSMVADHGVFTSMDANSGLSG
FT                   GIPAAFRLACAVVAVALITGALAGRVRYAIWLIFVAVWITLVFAPLAHMVCGGGLLSPN
FT                   GAISQALGISVHDFAGGSILHIAAAVSAFAIVMIIGGHAHFPLKRFVLHIKNVAHTSGN
FT                   ANSGATNSRNPKSRLSRALWADVEHAKNAASETVVSPVATVTEVAAESTATQSAVENGV
FT                   AARHPHNVPFVMLGVFLIWFGWLGLMIGSSAGVPGVAGYAWVSSTITASASMLAWGVTE
FT                   RLHSGCFTALGAASGVMAGLAASAAAADVIAPLWALVLGVLSGVITSLVTHSRTFVRYD
FT                   GALHVVSVNGVAALIGVLAVGLFADGSGLLAVGDWHQLVAQLCLIGITVLYAGAVTAVL
FT                   AFVLEKLFGWRISEAKERKGVDLVDQGERAYDFSSIAQSHDGAVVAVADDDANKTQMAV
FT                   LTSVDIDMGENEVEQSDFMVNQSEANPEQGDSEVDSKSEVEQKESSSEEEFETVKKDES
FT                   SQKNKKTEKRNNSAKE"
FT   gene            87765..89126
FT                   /locus_tag="HMPREF0424_0074"
FT   CDS_pept        87765..89126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0074"
FT                   /product="MATE efflux family protein"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14399"
FT                   /db_xref="GOA:D2RCR4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCR4"
FT                   /protein_id="ADB14399.1"
FT                   /translation="MTNQKLDNQNKKDVLRNIWLLAVPTFGQLISEPAFVLIDTAIIGH
FT                   IGKSALAGLSIGSTVLLTTTGLCLFLAYNTTSQVARLLGAGKRQEGFSIGMDGLWLALL
FT                   LGIILTVILIFATEPLCYAIGARGSTLQNAIVYTQMVMPGLPAMLLVYAANGIFRGLCN
FT                   VRITLFAAVSGAVLNTILDIIAVFGLNMGIAGSGIATMIAQWYMGLVLTIPAIIWATQS
FT                   GARLKPHFQHILHSAGTGMPLFVRTLALRVCMVATVVTATHLGTNTLAAYQVANSCWNF
FT                   VMNILDAIGIAAQTIVAAALGAGCRKRAGMITRICAQVGAVSSVGVGLFMIFVGWSCAP
FT                   LFSQHTDIQFLISVGMTILGLFLPLAGWMWALDGVLIGAGDHRYLAKACSVMAAVYLTF
FT                   LALTSVFDVVVDANDVVRTITLWVVLNAVYIGGRAIGNSLRIRNDTWMDSALKM"
FT   gene            89207..90652
FT                   /gene="dnaB"
FT                   /locus_tag="HMPREF0424_0075"
FT   CDS_pept        89207..90652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="HMPREF0424_0075"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00772;
FT                   match to protein family HMM PF03796; match to protein
FT                   family HMM TIGR00665"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13888"
FT                   /db_xref="GOA:D2RCR5"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCR5"
FT                   /protein_id="ADB13888.1"
FT                   /translation="MWQSTKGNVIRAGSNRGGNGDASAYGSGVANRGAEVGATLFDRVP
FT                   PHDVDAEMAVLGGMLMSKDAIGEVSQLLETSDFYLPQHQTIYDAILTLFAGSQPVDVVL
FT                   VANELMKDGNLDKVGGADYLHSLVASVPTAANAMYYADIVHQNAVLRNVITAGTKIAQM
FT                   GYSASGAQAEDIVNLAQSEVYEMSAGKVRQDYVAIGPVLQNTLDQLDKMQNHELEQGVP
FT                   TGFRDIDEVTQGLQPGQMIVVAGRPAMGKSTLGIDFARSAALHHNMTSIVFSLEMSKVE
FT                   LAQRIIAAETNIPLAAMRRAEDITPDRWNTLNTFWTKMQNAPLFIDDSPNMSLMEIRAK
FT                   CRRLKQTNDLKLVVIDYLQLMSSGKRVESRQQEVSEFSRALKLLAKELEVPVVALSQLN
FT                   RGPEMRNDKKPQLSDLRESGSIEQDADVVFLVHRPDFYNKEDRPGEADIIMAKHRNGPT
FT                   DTFNLAFLGATSKFMDMPQDYQQ"
FT   gene            90668..92086
FT                   /locus_tag="HMPREF0424_0076"
FT   CDS_pept        90668..92086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0076"
FT                   /product="Mur ligase middle domain protein"
FT                   /note="identified by match to protein family HMM PF08245;
FT                   match to protein family HMM PF08353"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14572"
FT                   /db_xref="GOA:D2RCR6"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCR6"
FT                   /protein_id="ADB14572.1"
FT                   /translation="MSSRDHESHKKLRQNLHKHWYSFAMPAVGKLVCALSRVLHHGGSA
FT                   LPGKVIESLDSGFLARTLASLPYGIVLISGTNGKTTTTRMVTSMLRDAGLNVFTNPTGS
FT                   NFTRGVVASLAKIMPAFGTKLNADIAVLELDEAYAVHFVNQIKPRYSLLLNVMRDQLDR
FT                   FGEIDTTAKLLSNVAAATEGTVVLNREDSRICALAKVVPSGTCVRYFGLDDAVKSMFPT
FT                   DDDLHNTAEKSENCKDTAESKANNLPKADVVLSKVGDHEAEFILDGKSKTTSVKLDGAY
FT                   NIFNAAAAATVVRAILADATKQNSALQKFDDDALMEAISHVTPAFGRGEVIEVNGAPVE
FT                   LVLVKNPIGFRLAIASDHPQNHDTMIAICDEYADGRDMSWLWDVDFASFSGTGVACVSG
FT                   TRAWDMALRLQYDKVEARNVNTDLEEDAKAFVNGDFSGNTKNAKRIYCTYTAMLRVRAA
FT                   LAQLAEVKDVGVGK"
FT   gene            92092..92886
FT                   /locus_tag="HMPREF0424_0077"
FT   CDS_pept        92092..92886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0077"
FT                   /product="CobB/CobQ-like protein"
FT                   /note="identified by match to protein family HMM PF07685"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13813"
FT                   /db_xref="GOA:D2RCR7"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCR7"
FT                   /protein_id="ADB13813.1"
FT                   /translation="MNGSSDISKANATFEENRVLDIVSLYPKDMNIYGDYGNVLTIMRR
FT                   AELYGYEPVLREYNVGDLWPEHVDMILGGGGQDHGQSRVTEDLFARADAIRGLAKDGVP
FT                   MLMICGLYQLFGEYFETVDGQKLKGIEILGEHTVGQDVRMIGNLVEHSADFGDIVGYEN
FT                   HSGRTSLEDGTLPLGSVDSENCGNNGKDHTEGARKYNVIGTYMHGSVLPKNPRLADFLI
FT                   RTAAQNRYGEFSPKRTDAQRAELAKLDELAERARKVAVTRPR"
FT   gene            93164..93583
FT                   /locus_tag="HMPREF0424_0078"
FT   CDS_pept        93164..93583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0078"
FT                   /product="toxin-antitoxin system, antitoxin component, HicB
FT                   family"
FT                   /note="identified by match to protein family HMM PF03681"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13781"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCR8"
FT                   /protein_id="ADB13781.1"
FT                   /translation="MKLAYPVILTPYEDNSGGFVAEVPDLPGCVTGGSNLADALIMAED
FT                   AASGWVLTELESGKTAPKASDINDIVVENPNSKLSMVALDMDSYAAKYGSQSVRKNVTL
FT                   PAWLDTWAQKAGISYSGTLRDALESLYAKGAVNKA"
FT   gene            complement(93729..94367)
FT                   /gene="upp"
FT                   /locus_tag="HMPREF0424_0079"
FT   CDS_pept        complement(93729..94367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="HMPREF0424_0079"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01091"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14621"
FT                   /db_xref="GOA:D2RCR9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCR9"
FT                   /protein_id="ADB14621.1"
FT                   /translation="MDLHVLHHPLVDHKLTVLRDKNTPSNIFRELVSELVTLEAYEATR
FT                   NLEVSDREIETPICKMTGKHLNRPRPMVVPVLRAGLGMLDGMTRLLPTAEVGFLGMKRD
FT                   EQTLDIVTYANRLPEDLTGRQCFLLDPMLATGGTLIAATHYLAERGAKDVTAINILAAP
FT                   EGLERLEKELDPSIDFKVVVCAVDEHLNDKAYIVPGLGDAGDRLYGLID"
FT   gene            complement(94686..95339)
FT                   /locus_tag="HMPREF0424_0080"
FT   CDS_pept        complement(94686..95339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14243"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCS0"
FT                   /protein_id="ADB14243.1"
FT                   /translation="MPSPTGSARPSRPAQMDPAMLAQIEGGTDPQVVNEISHTSAAVLL
FT                   NRVHKTQSPEIVERVLNLVENEGIEVIADLWSHAEAESIPGMLWRLYLLRMSLRKQREA
FT                   YAEYWSLGEPETTSASAITGIDEAPTGEDIARLADSILSGAFTGDFAVALYRSSAFTSI
FT                   IARGMQVYAKKLDKQANTMHTQKIAKVLHISANMHALSLSFAHGAKLWRAEKLE"
FT   gene            complement(95386..96582)
FT                   /locus_tag="HMPREF0424_0081"
FT   CDS_pept        complement(95386..96582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0081"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293;
FT                   match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14496"
FT                   /db_xref="GOA:D2RCS1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCS1"
FT                   /protein_id="ADB14496.1"
FT                   /translation="MSAVTTQYVEAAGGIIYRKRNTTNSSNADEETKTDSNAINPNHAN
FT                   KPISAIKSSDDDFELCLVYRPKYDDWSWPKGKNEPNESHRHTAVREVGEETGYSVTLGP
FT                   HIAKIEYPLEREGKKSSKNSSSNNSQNRNSQPEVIKRIHYWMMRLIDKPTAAKRLPAFG
FT                   PIKPAKPTEIGNVLWLTPSQARKKLTHDSDREVLDAFLEKLHAGKAEYSTLLLVRHGKA
FT                   ESRKTWQGSEATRPITPLGAAASYALGRELACYAPNKIISSPWKRCVETVAAFAHDSSL
FT                   SIEQVAELTEDHHEKQPKSTLSVLINEIQNLECHTQNTSETSNASTTNNATVICLHRPV
FT                   IGTFFDYLREITKPRAHKRIFSQKSPYMPTGSAIVLHIISTPKGARIIDIEKVLPSVY"
FT   gene            97158..98432
FT                   /gene="dcm"
FT                   /locus_tag="HMPREF0424_0082"
FT   CDS_pept        97158..98432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcm"
FT                   /locus_tag="HMPREF0424_0082"
FT                   /product="DNA (cytosine-5-)-methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /note="identified by match to protein family HMM PF00145;
FT                   match to protein family HMM TIGR00675"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13807"
FT                   /db_xref="GOA:D2RCS2"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCS2"
FT                   /protein_id="ADB13807.1"
FT                   /translation="MSKTIKVAELFAGVGGFRLGLEGYTPSEENNFTAEPAGPFKTVWA
FT                   NQWEPAGQESKQFAWRCYEKRFGKGSCVNEDIAEVLKKFEHGECDIPNFDMLVGGFPCQ
FT                   DYSVAKPLALSSGIDGKKGVLWWSINKMLELRHPKYVLLENVDRLLKSPAAQRGRDFAI
FT                   ILSCLFRLGYSVEWRVINAADYGMPQRRRRVYIFAEHDSKKWPNKLSRLLQNGVIARAF
FT                   PVSVAEKNAAQYEFSISDNPYVISQDFGKQAKVSLFQNAGVMQDGIVYTVKTDAVFSGN
FT                   AMTLGSVLVDANQVPKEYWIEEDKLASWQYLKGGKRELRTASNGFEYMYSEGPVAFPDK
FT                   IDAPSRTILTGEGGKSASRTKHVVMQNGRLRRLVPDELDQLQMFPKGWTNDGMSDGHRA
FT                   FCMGNALVTGIPHKIGEVLANDILA"
FT   gene            98542..99990
FT                   /locus_tag="HMPREF0424_0083"
FT   CDS_pept        98542..99990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0083"
FT                   /product="DNA mismatch repair enzyme MutH"
FT                   /note="identified by match to protein family HMM PF02976"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13937"
FT                   /db_xref="GOA:D2RCS3"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011337"
FT                   /db_xref="InterPro:IPR037057"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCS3"
FT                   /protein_id="ADB13937.1"
FT                   /translation="MSNHIGGNRKFSDIDEITALLTGINGKTFREIDKTGRGEKAGNKG
FT                   SLGNIIEESVFGYSINSDKQPDIMVADEFYELKVTPIRSNKKKKIVAKERLVVDIINYL
FT                   TLCNEVFDNSSFWQKARQMIIIYYLDNRTDKTNQSRLDCTIYGSFVLKYEPGELETIRK
FT                   DWEYIKNKVAAGHADALSESDTNYLAACTKGESAAKSFRDAPAPSGFESKYIRAKQRAF
FT                   SYKPSYMTIVAQRVLGEGSLFERLPMSINENLNDYVQKKIGRYVGYKISDLANKFNVEL
FT                   KTHYSFNSQLALKMLGVKKNRIEEIEQFAAASVTQLKTTVLYDDGKPEQNMSFPALKED
FT                   DWAELADPNMQWHDSRLYKFFENNKFYFVVFKSNGKNRKSTCYKDDVLVGGFLWNMPEE
FT                   DIEKYVAPAWNKVHEIMISGESTGYGTDENQLPKMLFNHVFHMRPHGKNGNDVITLPNG
FT                   ETITKQCWWLDRLYIAKIVAENIS"
FT   gene            complement(100273..102510)
FT                   /gene="ppk1"
FT                   /locus_tag="HMPREF0424_0084"
FT   CDS_pept        complement(100273..102510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk1"
FT                   /locus_tag="HMPREF0424_0084"
FT                   /product="polyphosphate kinase 1"
FT                   /EC_number="2.7.4.1"
FT                   /note="identified by match to protein family HMM PF02503;
FT                   match to protein family HMM TIGR03705"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14660"
FT                   /db_xref="GOA:D2RCS4"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCS4"
FT                   /protein_id="ADB14660.1"
FT                   /translation="MVQIFDAPSKAILRGQIAEHIAEDEKAEKREAREGELPLPKDRFF
FT                   DRELSWLKFNRRVLELAQNTDLPLLERANFAAIFASNLDEFFMVRVAGLKRRIDSGIAV
FT                   TAASGLSPRQQLRAISEVTHRRQDEHAHYVIEHILPELAKQRIVLLSWDKLTESEKARL
FT                   SDYYKKQVFPVLTPLAVDPAHPFPYISGKSINLAVIVENPNSGKSHFARVKIPDNLNRL
FT                   VPVDDLTDEEGREERYGFITMEKLIAAHLESLFPGMIIKEARSFRVTRNEDIDVEEDDA
FT                   ENLLNAMEKELLRRRFGPPIRLEISNEASPFLSQLLANQLRVSPEEVYRLPSPLDMTVL
FT                   FELQALDRPDLKYRPFIPTTNRQIAEVETSHAQDIFASIREHDILLHHPYDSFSTSVQA
FT                   FLAQAAADPKVLAIKQTLYRTSSNSPIIDALVDAAHAGKQVLALVEIKARFDEDANIAW
FT                   ARKLERAGVHVVYGIVGLKTHCKLSLVVRQEAEGLRRYCHVGTGNYNPKTARLYTDLGL
FT                   LTCDPVVGQDLTRLFNQLSGYAPKSSFHRLLVAPRTVRTGIIQRIRREEAAALAGKEAW
FT                   IKIKVNSVVDEQTIDALYRASQAGVKIDIVERGICSLKPGIEGLSENIRVRSILGRFLE
FT                   HSRIYAFANSCGPQIGDGPASGPEVWIGSADLMHRNLDRRVETLVRITAPDQVEALIQY
FT                   IDLQMADSTVSWWMDGDGTYTLHSRDKEGRPLVDSQAYLIHTHTRKPRGAN"
FT   gene            complement(102494..102634)
FT                   /locus_tag="HMPREF0424_0085"
FT   CDS_pept        complement(102494..102634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0085"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14095"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCS5"
FT                   /protein_id="ADB14095.1"
FT                   /translation="MLNYVRMRHTPACRKIFLERKASNKIDTQSRTSLATHTITEYGTN
FT                   F"
FT   gene            103173..103904
FT                   /locus_tag="HMPREF0424_0086"
FT   CDS_pept        103173..103904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0086"
FT                   /product="MIP family channel protein"
FT                   /note="identified by match to protein family HMM PF00230"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13564"
FT                   /db_xref="GOA:D2RCS6"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCS6"
FT                   /protein_id="ADB13564.1"
FT                   /translation="MQHSFMAMLAAEFIGTAILMIFGNGAVANVELKNTKGHHAGWLNI
FT                   AMGYGFGVMFPVLMFGGISGAHINPAMTIAQAVNGMFPWANVAPYIVAQLLGALVGQLI
FT                   VYVTYLPHYNETEESEAILGTFCTTDAYNNKINYFLNEFFGTLVLVLAALCCLTSPWGE
FT                   KNLAGASIVVGFVVWGLVTSMGGPTGPALNPARDLMPRLLHAILPIPHKGSSRWGEAWI
FT                   PVIAPIAGAILGVVMYKSLFA"
FT   gene            104005..105129
FT                   /locus_tag="HMPREF0424_0087"
FT   CDS_pept        104005..105129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0087"
FT                   /product="tRNA ligase class I (E and Q), catalytic domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00749"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13565"
FT                   /db_xref="GOA:D2RCS7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCS7"
FT                   /protein_id="ADB13565.1"
FT                   /translation="MLCKLVLIKKNIGKDFKKDFKKDEIMFSKSTIAIGRFAPTPSGRM
FT                   HIGNMVAMLAAWLSAKSQGGHMLLRLEDLDIARMPKDASARVIDDLKWAGLDWVGEPTY
FT                   QHKRTAIYQEALDALESLQDADGNSLIYPCFCSRSDIRAIAAPQEGDGFIRYPGTCRNL
FT                   CKTAEGLAQIERLLQNNQQHSLRLAVPPADSLQANVSFEDAIFGAQSFNINRDLGDMVI
FT                   RRADGVFSYQLAVVVDDVLSGVNDIVRGRDLLRSAALQIWIGELLEKSGFFAAYGVHYV
FT                   RPQFAHLPLIDNAQGERLAKSKHSLDVGALRESGWSAERMIGYCMYLLGYKKPGQNQPV
FT                   DMSADDALALFKSLDTPWGSVRANLADKSVPFLD"
FT   gene            105164..105964
FT                   /locus_tag="HMPREF0424_0088"
FT   CDS_pept        105164..105964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0088"
FT                   /product="pyridoxal phosphate enzyme, YggS family"
FT                   /note="identified by match to protein family HMM PF01168;
FT                   match to protein family HMM TIGR00044"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14239"
FT                   /db_xref="GOA:D2RCS8"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCS8"
FT                   /protein_id="ADB14239.1"
FT                   /translation="MAYMAQKDLANTEVDCVRARQIADGVHSVQDAIAQAESHYGRKAE
FT                   SVTLLAATKTRDVGEIMAALKAGVRVIGENRPQEIVAKAEILRAEAAREGLSVGVNGEI
FT                   PLYLIGQLQSNKINKVLPLANGIQSVDGIELAQKISARAQNLGLCVDVMLEVNVSGEAT
FT                   KSGCAPERAIDEAFAISSLPALNLHGFMTLGARVDDETIVRSGFAKLREIRDCVSKQLV
FT                   QDYDGSSVKLELSMGMSGDFAWAIAEGSTMVRIGSAIFGPRAFV"
FT   gene            105986..106801
FT                   /locus_tag="HMPREF0424_0089"
FT   CDS_pept        105986..106801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0089"
FT                   /product="FAH family protein"
FT                   /note="identified by match to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13710"
FT                   /db_xref="GOA:D2RCS9"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR018833"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCS9"
FT                   /protein_id="ADB13710.1"
FT                   /translation="MRIARFSYNEVPQYAFVQKDKADGKDYLVALEGHPLSSQGVKPTG
FT                   KRYALDADGVRLLVPVIPSKVYGLAKNYDTRSDDERATSSAASSHTAADMVIFTKPSTS
FT                   VIGPDDPIVIPTCSNDMNFEPEVAVVMGKIAKNVTADTAMNYVFGFTCVNDVTLRDCAG
FT                   SDPMWTRAKGFDTSCPLGPWITTELNWRDAHISFTLNGENVPEASGTTARLIHSIPEQI
FT                   AAISSFSTLLPGDVILTGTPYPAGTLRAGDEAIVHVDGIGSLRNVVVSE"
FT   gene            complement(106875..108143)
FT                   /locus_tag="HMPREF0424_0090"
FT   CDS_pept        complement(106875..108143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0090"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14401"
FT                   /db_xref="GOA:D2RCT0"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCT0"
FT                   /protein_id="ADB14401.1"
FT                   /translation="MKQLSKKIIIVLLCFSATVIASAILFLLFWQQMPTQISYKQANLS
FT                   HAVGAVAISDMTAGKEKKRDGFIVLLNNDGTSQTITTSAIESPNILWNTDGLYFVDAKF
FT                   DYFLAQKSNMRIAIKHHKKLPAAQAGIFENNQHEVISVLDHGFTRTRKNQLEFNSITLG
FT                   KPRNTDIMQSRIYDVSSACESGTYTISPSDNGTNSFNGTNGFVIKKLQDSIPVKHILKD
FT                   SETTVHSFSTIGNDTAPCIRNTIISIGDTTEYKKDDPEFTFTTYGINRWNTQSGKFDFI
FT                   PLTLQNKRIAYNYGEKHDFENISYGNRTMLNDRELLALDQGTGALYKINTITGKTQITF
FT                   TIPVNTSSKFNPKRYWMQTTKNAIAILDNANGEKTPQSTLYFLNKKNFKLQQTVHFDNT
FT                   TSNLLAGKVDGCHFSDFAINPQM"
FT   gene            complement(108151..108858)
FT                   /locus_tag="HMPREF0424_0091"
FT   CDS_pept        complement(108151..108858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0091"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13764"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCT1"
FT                   /protein_id="ADB13764.1"
FT                   /translation="MNKKLFKTITIAAVLCVLWPTSSAFAKESYDDKLSDFANALPYYV
FT                   NKEKLDKSVQEIAQYHHWSKEKALDAEMELLQNPNINKYQQDKSSSQTTITLPNAQHRG
FT                   DFYFTPAGLHGHTGIYSQKNKIVEAVGPGEVAREKLAFKTLVAPGAIIRSVNTSNANRA
FT                   KAADRARTYIGRGYNSAFFQPHKNDWGGLHCAQLVWASYKYGAGIDIDDGNDELVWPWD
FT                   LEKTTKATTYRKL"
FT   gene            109250..111844
FT                   /gene="clpB"
FT                   /locus_tag="HMPREF0424_0092"
FT   CDS_pept        109250..111844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="HMPREF0424_0092"
FT                   /product="ATP-dependent chaperone protein ClpB"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02861; match to protein
FT                   family HMM PF07724; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR03346"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14437"
FT                   /db_xref="GOA:D2RCT2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCT2"
FT                   /protein_id="ADB14437.1"
FT                   /translation="MEQKFTTLAQDALSDAVQSAAAAGNAQVDTLHLADALLRQEQGVV
FT                   RALIAQTGADAQQIGAEIRNALVALPSSTGSTTTKPDASRQLLAALSQAEKEMHAMGDE
FT                   YVSTEHMLIGIVASAPNAVADIFKKHNVSADALRKAVPTVRGGAKVTSPDAEGNYKALE
FT                   KYSVDMTARAREGKLDPVIGRDQEIRRVIQILSRRTKNNPVLIGEPGVGKTAVVEGLAQ
FT                   RIVAGDVPTTLQNKRLISLDLASMVAGSKYRGEFEERLKAVLKEIQQSDGQIITFIDEI
FT                   HTVVGAGSAEGSMDAGNMLKPMLARGELRLVGATTLNEYREHIEKDSALERRFQQVFVG
FT                   EPSVEDTVTILRGLKQRYEAHHKVTISDDAIVAAATLSNRYITGRQLPDKAIDLVDEAA
FT                   AHLRMELDSQPEEIDELQRKVTRLEMEEMQLKKAEDAAARERLEKLQEELANSREKLAG
FT                   LKARWDAEKAGHNKVGDLRAQLDAKRVEADKFTREGNLEQASRILYGEIPSIQKALEEA
FT                   ESQAANAKSEAKEPMVPDQVDADSIAGVVSEWTGIPVGRLMQGENEKLLNMEKELSKRV
FT                   VGQSEAIQAIADAVRRSRAGIADPNRPTGSFLFLGPTGVGKTELAKALADFLFDDERAM
FT                   VRIDMSEYMEKASVSRLIGAAPGYIGYEEGGQLTEAVRRRPYSVVLFDEVEKAHPEVFD
FT                   VLLQVLDDGRLTDGQGRTVDFTNTILIMTSNLGSQFLVQEGLDDAAKRKAVMNAVHAEF
FT                   KPEFINRLDELVMFHPLSREELGGIVDIQVRQVAARLSDRRISLDVSDSARAWLAEHGY
FT                   DPVYGARPLRRLVQTEIGDQLARLLLSGKVHDGARVVADCENTSDHVTLKIA"
FT   gene            112188..112514
FT                   /locus_tag="HMPREF0424_0093"
FT   CDS_pept        112188..112514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0093"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14378"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCT3"
FT                   /protein_id="ADB14378.1"
FT                   /translation="MFAKKGFAIVALAAIVYAVPMSAYAQMSGSVVGIDRESIPCAASV
FT                   HNNQAKLVCHHSPKFVRARIACRFWPDQLTNWIKDGVEYSGGCIFGVNDTPSGNPVTME
FT                   VGSN"
FT   gene            112562..113329
FT                   /locus_tag="HMPREF0424_0094"
FT   CDS_pept        112562..113329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0094"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13991"
FT                   /db_xref="GOA:D2RCT4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCT4"
FT                   /protein_id="ADB13991.1"
FT                   /translation="MQESYTCSDVQLVNVNFSYGKKQILHNLSIDLSFGICGLLGPNGA
FT                   GKTTLLNVIATIYAPSSGKLFVHGFDVTDRAERAKARSNIGYLPQSFELMNASSVLKNV
FT                   QYAAWARGLSWSAAYQAAWNALKQVGLEKQAHRIVAKISGGQRQRAGIACVIASQPAVL
FT                   ILDEPTVGLDPEQRIDIRNFLKSYSQKHTVIVSTHLVEDLAVIADRVIVLNEGIILLDG
FT                   KMDNLLQYANREDLMVTPWESGYRHLLSKFHKN"
FT   gene            113401..114957
FT                   /locus_tag="HMPREF0424_0095"
FT   CDS_pept        113401..114957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0095"
FT                   /product="hypothetical protein"
FT                   /note="overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14696"
FT                   /db_xref="GOA:D2RCT5"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCT5"
FT                   /protein_id="ADB14696.1"
FT                   /translation="MRQYSNFLTEFRFFTKSHKKCTIISRIMYPLSLISSCIFSLFLIA
FT                   YPIFLGVANFLAHNNNYALWLRIDVTWMHCLSDIVACIFGAWCSCKACSPRCLVNPAWC
FT                   AGKSASRYAIPILKGAILCSLLYCVSILPTVIQSDVNITNFPYFPLLCGGVTPSAFFAI
FT                   GFTLGVIIGNRWAIVFSALLSFAIIWCCIYGVIIMRNGTIPQGDIFPRYWGSSLYAILP
FT                   VSDAGIGAEPGLRMNPWLVTLRIFFVCVVIVSCILCCAHIRYFWQKGSYWCIKAISLSL
FT                   IMPIVCACCIAMWGPKPWIRSGPFVPQCTTFKDTAFSVCVHPEEAYIRKLRAVKHLKTV
FT                   ASWFPKNQRDSQGKGIVLVLGNAFTPTNTEKSWNLTNSGLIKLRNLKATVIQQQTDTFV
FT                   RRSEKYGDMTGIAQEVLQRFVPAKCASSAMKEVYVKKNLDSNASVTAFLLAQLPSRISN
FT                   DVYGSYGFIPGEANDKVAMSINNADDAKLKQFVKNHVKELNQCRITPQQVLSELGDKHE
FT                   K"
FT   gene            114947..115678
FT                   /locus_tag="HMPREF0424_0096"
FT   CDS_pept        114947..115678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0096"
FT                   /product="hypothetical protein"
FT                   /note="overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14135"
FT                   /db_xref="GOA:D2RCT6"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCT6"
FT                   /protein_id="ADB14135.1"
FT                   /translation="MKNNFRAWLEGRHYIVAIVAILLSVVLPSLMLVIFRSFVTQLPVY
FT                   VGYICLPDSANVHNAVEGITFQCQSGSSAVNFVVPLYEVIVVGFIAAAFVCLAPIMVSW
FT                   ERFVMKRLRIYALSAALLCLFVSFGASVLIVRIIDLQLLSTLQMILGNAWIDIVLIMIG
FT                   LACFGRFYGLAFGVFLAVMNIATQGLQSKIGLILRWYPSGTLPVIPGQSILLYVIVVLT
FT                   VIAVCLWSGTCGRGLLYFERA"
FT   gene            115733..117073
FT                   /locus_tag="HMPREF0424_0097"
FT   CDS_pept        115733..117073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0097"
FT                   /product="RmuC domain protein"
FT                   /note="identified by match to protein family HMM PF02646"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14207"
FT                   /db_xref="GOA:D2RCT7"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCT7"
FT                   /protein_id="ADB14207.1"
FT                   /translation="MFDNIVMFVLMVVAVVITAIVVLAIVKHNSGTQGANGVNQREFNE
FT                   LRSQYEQARAQAQENGNQAIRYRTQAEQLAERLKFVEAELAKAQQAEQLRVNREEQLRA
FT                   EREERERLNREKTLKEQGKVLEALAPVKDNLEALKNKVSQIEEGRKQEMGVLSTQLKGL
FT                   SEQQTRLDRETSSLSAALRNNKVRGAWGEAQLKNIVESAGLLEHVDFDTQVVVTGVNGE
FT                   QQRPDMVVHLPGGKTIPVDAKVPYADYQRACEIPDNASDEELARRSELLKAHAKALREH
FT                   VRVLGAKAYWQAFETAPDFVVAFIPNEALLQAALEADPTLMDDAFAQKVALTSPVTLWA
FT                   VLKSVAYAWQQQSLTDDAKELFDLSRELYDRFAVLGENASKLGVSLARTVAAYNKFASS
FT                   LESRVLVTARKLQKLDQSKVIASIDLIDSDKADVKELSAPEVSVEDR"
FT   gene            117131..117898
FT                   /locus_tag="HMPREF0424_0098"
FT   CDS_pept        117131..117898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13514"
FT                   /db_xref="GOA:D2RCT8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCT8"
FT                   /protein_id="ADB13514.1"
FT                   /translation="MAELQEERAELKRMLCADMSAKPFSELFSVTFNQRGSKLVGDVLF
FT                   DAIEKAGYSLERDVDAVGALTAAAVPMVFALIHAAERKGIALDGFVMDFVFPATKGPSV
FT                   KGKRVLLLDSWLSEKSYVQTSSLVTLRHGNELSLDFGIVNQQGAQILAIVALIGGVDAD
FT                   EQGTRHLQLVNPISEESTKMAFVQAFGEEELRADADHDDCCNDNCCGGHCEVKCTGDCA
FT                   HDGCTEPCCEDNCCGGHCKSGCTGDCATDGCQD"
FT   gene            117956..118762
FT                   /locus_tag="HMPREF0424_0099"
FT   CDS_pept        117956..118762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0099"
FT                   /product="RNA methyltransferase, TrmH family"
FT                   /note="identified by match to protein family HMM PF00588"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14364"
FT                   /db_xref="GOA:D2RCT9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCT9"
FT                   /protein_id="ADB14364.1"
FT                   /translation="MHEPNPITLAAKASDEPEFRPIGVGPWEEEHPGEPRPDNPESPNY
FT                   DARFSTELLDEGDQRNVLDRYRYWKVEAIKADLDSKGRHEFEVAVENWTHDFNIGSMVR
FT                   TANAFTAKKVYIVGPHKWNRKGSLMTELYQYVECCPTIETLVTNWRENIVREAEEAHQL
FT                   LLKAQAEGNKEAEKIANIKEHDAKNARVIALDIIPGAVAMENYKFPKRCLMLFGAEGPG
FT                   LSKKALEMADDVVYISQFGSVRSLNAGAAAAVSMHAWIAQHAAPNC"
FT   gene            118908..119900
FT                   /locus_tag="HMPREF0424_0100"
FT   CDS_pept        118908..119900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0100"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13701"
FT                   /db_xref="GOA:D2RCU0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCU0"
FT                   /protein_id="ADB13701.1"
FT                   /translation="MLEFQHITKRFGAKTALNDVSFVAEDGKVTGFLGPNGAGKSTTMR
FT                   CALNLIHANSGTSLIDGKPYAKIASPMTEVGAVLDAKSAHRGRTAYNHLYSLALTHGIS
FT                   KKRVDEVIDITGLTSVKNRKAGSFSLGMGQRLSIAAALLADPHNLILDEPVNGLDPEGV
FT                   KWVRELCKYYASQGRAILLSSHLMSEVALTADNLVIIAHGEILARTTVQDFVNAHSQHA
FT                   IRLVTPEGEKLKSVLTQNHPECKILSDNRTPQDVQEGELFKVTGCELNQLAREIADNQI
FT                   MVYQLNQEHASLEEAYLALTHGQEQYVTKALPNATAATGTQYADGGNAK"
FT   gene            119897..120871
FT                   /locus_tag="HMPREF0424_0101"
FT   CDS_pept        119897..120871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13875"
FT                   /db_xref="GOA:D2RCU1"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCU1"
FT                   /protein_id="ADB13875.1"
FT                   /translation="MSEQINQSVDQSVNQETSNSYKTGRSMNAQHLRLTFMHSLKSEMV
FT                   KLRGLASTWWCMALAIVLPVIFSFIIAIVQKTISKVDFTKHGASAGKSSGVVTMGPSDK
FT                   SSLISSQEGIFNLVISFASISLIIIAIFAVLAITAEHSTTSIQASLTSVPRRGMFFTAK
FT                   FVAITIYVFVVQLIAMAVSLVAAELAFMGENISGLSGSRTWQLPLTLFLGSPVIMVVVA
FT                   AMAYGFGMICKSTAGGIMCVIGAVMILPTFVSIIMITSNFAKWTSILMQLLPAKAVSRF
FT                   LGTGEQLPPDATAFEWWQSGLVVLAWAVVMYAIGYVIEKHRDI"
FT   gene            complement(120940..121071)
FT                   /locus_tag="HMPREF0424_0102"
FT   CDS_pept        complement(120940..121071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0102"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14506"
FT                   /db_xref="GOA:D2RCU2"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCU2"
FT                   /protein_id="ADB14506.1"
FT                   /translation="MSLVPELVPSIIAMVARGVMLFAVGALLLAKRIKTSIGKSCNK"
FT   gene            complement(121784..123334)
FT                   /locus_tag="HMPREF0424_0103"
FT   CDS_pept        complement(121784..123334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0103"
FT                   /product="Thiol-activated cytolysin"
FT                   /note="identified by match to protein family HMM PF01289"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14641"
FT                   /db_xref="GOA:D2RCU3"
FT                   /db_xref="InterPro:IPR001869"
FT                   /db_xref="InterPro:IPR035390"
FT                   /db_xref="InterPro:IPR036359"
FT                   /db_xref="InterPro:IPR036363"
FT                   /db_xref="InterPro:IPR038700"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCU3"
FT                   /protein_id="ADB14641.1"
FT                   /translation="MKSTKFYRNAAMLLLAGATIIPQCLAVPAMADSSAKPSAPAASCA
FT                   ASKDSLNNYLWDLHYDKTNILARHGETINNKFSSDSFNNNGEFVVVEHQKKNITNTTSN
FT                   LSVTSANNDRVYPGALFRADQNLMDNMPSLISANRAPLTLSIDLPGFHGGESAVTVQHP
FT                   TKSSVTSAVNGLVSKWNAQYAASHHVAARMQYDSASAQSMNQLKAKFGADFAKIGVPLK
FT                   IDFDAVHKGEKQTQIVNFKQTYYTVSVDAPDSPADFFAPCTTPESLKNRGVDSKRPPVY
FT                   VSNVAYGRSMYVKFDTTSKSTDFQAAVEAAIKGVDIKPNTEFHRILQNTSVTAVILGGS
FT                   ANGAAKVITGNIDTLKALIQEGANLSTSSPAVPIAYTTSFVKDNEVATLQSNSDYVETK
FT                   VSAYRDGYLTLDHRGAYVARYYVYWDEYGTDIDGTPYVRSRAWEGNGKYRTAHFSTTIQ
FT                   FKGNVRNLRIKLEEKTGLVWEPWRTVYNRTDLPLVRQRTIKNWGTTLWPRVAETVKND"
FT   gene            123833..124129
FT                   /gene="gatC"
FT                   /locus_tag="HMPREF0424_0104"
FT   CDS_pept        123833..124129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="HMPREF0424_0104"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase,
FT                   C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF02686;
FT                   match to protein family HMM TIGR00135"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13961"
FT                   /db_xref="GOA:D2RCU4"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCU4"
FT                   /protein_id="ADB13961.1"
FT                   /translation="MPTFTREEIEHLGVLSQIALSDEEISRLQGELNVIAESINKVQEV
FT                   AGEDVPPTANPVPLEAYLRPDEPATPLTQEEALSGAPRSESGMFVAPRILGEE"
FT   gene            124132..125673
FT                   /gene="gatA"
FT                   /locus_tag="HMPREF0424_0105"
FT   CDS_pept        124132..125673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="HMPREF0424_0105"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase,
FT                   A subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425;
FT                   match to protein family HMM TIGR00132"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14169"
FT                   /db_xref="GOA:D2RCU5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCU5"
FT                   /protein_id="ADB14169.1"
FT                   /translation="MTNTQDLVKLSAADMAKAVKAKEVSSRELVEAHLAVIEAAEPEIK
FT                   AFLHVSADVALEQADAFDKKNANGEAEGLPELAGVPIAIKDMIVTKGIPTTAASKILEG
FT                   WVPPYDATVIEKLKAAGMPILGKTNLDEFAQGSSTEHSAYQTTCNPWDTERVPGGSGGG
FT                   SAAAVAAFEAPIALGTDTGGSIRQPGALTGTVGAKPTYGGVSRFGAIAMASSLDQIGPV
FT                   SRTVLDSALLQEIIGGNDRRDSTSIPAPVPPMAQAAREGARRDLKGLKVGLVKELSGDG
FT                   FQPGVEARFNEAVQLLKDMGAEVTEVSCPHFPYSLAAYYIIMPSEVSSNLARYDGMRYG
FT                   LRVMPPADKPQTAANMMAATREAGFGDEVKRRIILGTYALSAGYYDAWYGSAQKVRTLI
FT                   IRDFEEAFKKVDVLISPTSPTTAFKFGEKMDDPLSMYMNDIATIPANMAGVPALSLPAG
FT                   LSDDGLPVGIQIIAPQCHDEKMYKPAAALEAALEEKWSGPIWKSLKAGWLDSLAK"
FT   gene            125706..127205
FT                   /gene="gatB"
FT                   /locus_tag="HMPREF0424_0106"
FT   CDS_pept        125706..127205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="HMPREF0424_0106"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase,
FT                   B subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01162;
FT                   match to protein family HMM PF02637; match to protein
FT                   family HMM PF02934; match to protein family HMM TIGR00133"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13590"
FT                   /db_xref="GOA:D2RCU6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCU6"
FT                   /protein_id="ADB13590.1"
FT                   /translation="MAEKLMKYADAVEQFDPVFGLETHVELSTRTKLFCPAEVSFGGEP
FT                   NTQLTPVSLGLPGSLPVVNKTAVDYAIKLGLALHCEIAEWSQFARKNYFYPDMPRDYQI
FT                   SQYDKPTNGNGYLDVELEDGTVFRVPIERAHIEDDAGKNTHVGGADGRIEGANHSLVDY
FT                   NRAGVPLIEIVTKPIEGAGSRAPEIAGAYMRAIRDIVRALNISHARMEQGNMRADVNVS
FT                   LRRKPTDSFGTRSETKNVNTFRGIEKTLQYEIRRQAAILSEGGEILQETRHWDEATQTT
FT                   AGGRVKSDADDYRYFPDPDLVMLHITKEHIERMKAQMPEMPRERRNRLQSEWGISDLEM
FT                   RDILNADALDLVEETVKAGATAAGAKKWWLGELAREANTRGVTLEELPITPQDVAQVEK
FT                   LIASGNLNDKLAKQTVACVLAGEGKPDEVVKKHGFKVMNDDGALEAAVDAALAADPEVA
FT                   EKLKSGNMKPMGAIIGAVMRATKGQADAKAVTKIVMAKIKG"
FT   gene            127462..128370
FT                   /locus_tag="HMPREF0424_0107"
FT   CDS_pept        127462..128370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0107"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14569"
FT                   /db_xref="GOA:D2RCU7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCU7"
FT                   /protein_id="ADB14569.1"
FT                   /translation="MQQTNDGVINSRELPKSIVIPQIRGEMAHLRPATCNDLQRMDDLC
FT                   AFDGAAVITGKDANSERSMVHSWVESSMQWTKDSLIGENPSESCRFAGDVQLRHTIAWA
FT                   IVPDVLDDSNNASGDIIGMIFLIDIDGWSRSARIQVVLGKNYRGRGYSRDAMPRVMTYA
FT                   FASEPTGLGLHRIWVGVPATNTRSLSVYQSLGFVKTGTARDALWDAQNQKYQDFVVMDT
FT                   LVDEYDAIRSLDAFGLHVIEENPGVIEALSAHEHSVAIPVHRDNLDEAWPYNVNVSEGS
FT                   SSKKAWWRIIGRGRKRNTEGK"
FT   gene            128370..128684
FT                   /locus_tag="HMPREF0424_0108"
FT   CDS_pept        128370..128684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13989"
FT                   /db_xref="InterPro:IPR019592"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCU8"
FT                   /protein_id="ADB13989.1"
FT                   /translation="MSAEDLDNYETDAELALYKEYRDVIKLFTYVVETERRFYLANKVD
FT                   FNVRSAGQDVYFDVQLTDAWVWDVYRPSRFVKNVRIVTFKDVNVEEVQKTDIDIPESIA
FT                   "
FT   gene            128776..130395
FT                   /locus_tag="HMPREF0424_0109"
FT   CDS_pept        128776..130395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0109"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14183"
FT                   /db_xref="GOA:D2RCU9"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCU9"
FT                   /protein_id="ADB14183.1"
FT                   /translation="MTDTQSPKESVVIIGGGPAGLTAAWELVKDGGSSRYDVTVLEATR
FT                   EFGGISRTVKYNGNRMDIGGHRFFSKDDRIMQWWREMLPLQGAPSYDDKKLGRHHDLEA
FT                   GGPDPEVEDEVMLKRHRVSRIFWNHHFFDYPISLSAATLRSMGFILTMKVGFSYLWSMI
FT                   HKLPETNLENFYINRFGKKLYSMFFEGYTEKLWGRHPSQISADWGAQRVKGLSIVEVLK
FT                   NAFSKLFPKKKGKEKEVETSLIEEFWYPKLGPGQLWETVERRCRENGATVRTDAKVVAI
FT                   KQADGKISSVVVEDANGERSELHADQFISSMPIKDLVAALEQGANGDEKAEVPAEMQRV
FT                   AKGLPYRDFVTVGLLVKRVRLRNTTTIPTLGNPPIVPDCWIYVQDPGYKVGRLQIFNNW
FT                   SPYLVKDVDNTVWIGLEYFCDEGDDFWNMSDDDARKMAIDELTRMQVINGEEDVLDSHR
FT                   ERVPKAYPAYFDTYAQMPELIDYLDGFGNLYCVGRNGQHRYNNQDHSMATAIEAVEDIR
FT                   TGETSKKNVWSVNTEKSYHEKK"
FT   gene            130733..132703
FT                   /gene="rho"
FT                   /locus_tag="HMPREF0424_0110"
FT   CDS_pept        130733..132703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="HMPREF0424_0110"
FT                   /product="transcription termination factor Rho"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF07497; match to protein
FT                   family HMM PF07498; match to protein family HMM TIGR00767"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13452"
FT                   /db_xref="GOA:D2RCV0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCV0"
FT                   /protein_id="ADB13452.1"
FT                   /translation="MATGQNLEKMKLSELKDLAKQMGLRGTSTMRKPELVATLTAARNG
FT                   GEAPAGVSVRVPRDVVNANKTADTSTDIEDVRSSKDNSDLEALEVLVPNAASDRRYRDE
FT                   EDFGNKNYRRDANRNNTFQRRRSSEDRNDNRDRREDGMDSHELDQILATLPGEDSHAEG
FT                   EQRRQRVASRDFDREEQQNRADRFQRRMRGRARDYDESRSDYSDRQNRSERMDRVERDD
FT                   RDERRAERGERQDRNDRNVRLDRDARDARDSREEHDLREIRREEPQEELVPVAGIVDVL
FT                   ESYAFVRTSGYLPGPNDVYVSMSQIKKYGLRKGDAVQGSIRAPREGDRRNQRQKFVPLQ
FT                   TVNSINGMSVEEAQSRPQFAKLTPLYPQERLKQETTPNRMLGRVIDLVAPIGKGQRGLI
FT                   VSPPKAGKTITLQNIANAITTNNPEVHLMVVLVDERPEEVTDMERTVQGEVISSTFDRP
FT                   ATDHTTVAELAIERAKRLVELGQDVVVLLDSMTRLARAYNIAAPTSGRILSGGVDAQAL
FT                   YPPKKFFGAARNIEDGGSLTIISSALVETGSKMDEVIFEEFKGTGNMELRLSRDLADKR
FT                   LFPAVDINASGTRREELITPAADLPVIYRLRRLFGGLEAEQAYQTLIPRLKKTASNRDF
FT                   LAAITQQTGTATNNSSSTTIA"
FT   gene            complement(132800..134005)
FT                   /locus_tag="HMPREF0424_0111"
FT   CDS_pept        complement(132800..134005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0111"
FT                   /product="aminotransferase, class I/II"
FT                   /EC_number="2.6.1.-"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14565"
FT                   /db_xref="GOA:D2RCV1"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCV1"
FT                   /protein_id="ADB14565.1"
FT                   /translation="MAKVAKHAISIPRSGIRDVFDRVEQIPDAISLCLGEPGETASSHI
FT                   VEAACNSLREGKTKYTDVLGIPEFREAAANYTNRVKGLNYNADTEIQAVDGATIGLYLA
FT                   IKSVIDPGDEVIIPSPYFTSYDAEVLMCEGIPVTVALKPEHGMHINAAEIRKTISPRTK
FT                   AIIINSPCNPTGAVTTAEELEEVAKLCQEFNLWVISDEVYHPFVFASNPETEPCGNAVA
FT                   PSIAAAEGMHERTIIVESLSKTYAMTGWRIGYILAPSRVIEQTSKIAEMMHSSVNSTAQ
FT                   YGGVAALTGPQDHVREMREEYRAKRQLVIDGLANCNALRLIEPQGAFYVFVDVRPTGLS
FT                   SEEFSKKLLDEEKVAVVPGEAFGAEGSGFVRLSYAGKAEELKECVARISKFALAQQALH
FT                   AA"
FT   gene            134288..134749
FT                   /locus_tag="HMPREF0424_0112"
FT   CDS_pept        134288..134749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0112"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14160"
FT                   /db_xref="GOA:D2RCV2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCV2"
FT                   /protein_id="ADB14160.1"
FT                   /translation="MAGNPHKAETSIAMDSTDAIIVDILEHDGRATLTRLAKASGLSVS
FT                   AVQSRVQKLERKGVITGYRALIDYERRGLPVSAFVSVTPLDFGQEATIPNKLRDISGIE
FT                   ACYSITGSPSFMLVVRVATPSKLEELINTIHRIVPVSTETTMVLQTYFD"
FT   gene            134755..135096
FT                   /locus_tag="HMPREF0424_0113"
FT   CDS_pept        134755..135096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0113"
FT                   /product="chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /note="identified by match to protein family HMM PF01817;
FT                   match to protein family HMM TIGR01795"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13495"
FT                   /db_xref="GOA:D2RCV3"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR010951"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCV3"
FT                   /protein_id="ADB13495.1"
FT                   /translation="MCDFSETTVDARDTSLTTCCKVAAEEIIVLRQSVDNFDNAIIALL
FT                   AERFKTTKRIGELKAEAGFAPEDSKREQQQIESLLNIAENAGLDSSIALKYHEFVVTEA
FT                   KKRHQQMQS"
FT   gene            135243..136298
FT                   /gene="fbaA"
FT                   /locus_tag="HMPREF0424_0114"
FT   CDS_pept        135243..136298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbaA"
FT                   /locus_tag="HMPREF0424_0114"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.13"
FT                   /note="identified by match to protein family HMM PF01116;
FT                   match to protein family HMM TIGR00167; match to protein
FT                   family HMM TIGR01520"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14068"
FT                   /db_xref="GOA:D2RCV4"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCV4"
FT                   /protein_id="ADB14068.1"
FT                   /translation="MTIATVERYAHMLDAASRGGYAYPAINVTSTQTLNAALQGFAQAE
FT                   SDGIIQVSVGGSAYFSGQSLNNRVVGSIAFAKFAHEVAAQYPNITIALHTDHCAEQYLD
FT                   DWIQPLISYETEQVKKGEEPLFQSHMWDGSTVPLQHNLDVAEQLLDASQKSRTILEIEI
FT                   GAVGGEEDGHRADIDERLYSTPEDALRVVDKLGLGERGRYMAAFTFGNVHGAYKPGVVK
FT                   LHPKLLQEIQKTVYQNYQNICDTRTFGASKKPFLLVFHGGSGSTAQEIAEAVRYGVIKM
FT                   NIDTDTQYAFTRAIAGHMFSNYDSVLKIDGEVGEKKLYDPRSWGREAEKAMAQRVAEAC
FT                   VQLGSAGKALK"
FT   gene            136414..137715
FT                   /gene="purA"
FT                   /locus_tag="HMPREF0424_0115"
FT   CDS_pept        136414..137715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="HMPREF0424_0115"
FT                   /product="adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="identified by match to protein family HMM PF00709;
FT                   match to protein family HMM TIGR00184"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13603"
FT                   /db_xref="GOA:D2RCV5"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCV5"
FT                   /protein_id="ADB13603.1"
FT                   /translation="MPGIVLIGAQWGDEGKGKATDLIGSKVDIVARFNGGNNAGHTVVV
FT                   GDKSYALHLLPSGIISPNVTPVIGNGVVVDPEVLLEEIDALESRGVDCSRLLVSEAAHV
FT                   ITPYHRVIDKVTERFLGKHKIGTTGRGIGPTYADKINRVGIRVHDLFNADHLRDKVEAS
FT                   LHQKNQMLVKLYNQHPIDIDAVTAQLVELGKRLKKYVADTSLVLNEAMDEGKTVLFEGG
FT                   QATMLDVDHGTYPFVTSSNPTAGGACTGTGVGPTRITRVIGVAKAYITRVGEGPFPTEL
FT                   LDEQGDWLREQGHEYGVTTGRPRRCGWFDSVVSRYATRVNGLTDIVLTKLDVLTGLKEI
FT                   PVCVAYDVALSDGTVQRMEEMPVDQSLFASAKPVYEMLPGWNEDISQIHKFEDLPQNTQ
FT                   SYVKRLEELSHCRISAIGTGPQRDHIISVHSLTD"
FT   gene            137894..138313
FT                   /locus_tag="HMPREF0424_0116"
FT   CDS_pept        137894..138313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0116"
FT                   /product="CrcB-like protein"
FT                   /note="identified by match to protein family HMM PF02537"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14284"
FT                   /db_xref="GOA:D2RCV6"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCV6"
FT                   /protein_id="ADB14284.1"
FT                   /translation="MRAVISSYAHTIHQVDGQSFIFGQLTLGTFLSNMIACFIFALVTA
FT                   ISVKALTQEKQTLYKYALGTGFCGGLSTMSTFAFESAMSFMAPRMTLVVLGMLFSLLFG
FT                   VFMAFVGNWVGAGIANCMNKKQSRSVAEANTKVMK"
FT   gene            138313..138723
FT                   /locus_tag="HMPREF0424_0117"
FT   CDS_pept        138313..138723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0117"
FT                   /product="putative protein CrcB"
FT                   /note="identified by match to protein family HMM PF02537"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13708"
FT                   /db_xref="GOA:D2RCV7"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCV7"
FT                   /protein_id="ADB13708.1"
FT                   /translation="MNSLYVFIMFILPCFFGGLGAVLRCAMTKKISAAHKSEVPVATLF
FT                   INCVASFAIGVVSNVFMVAAAICGVRFAYLMILGFLGGFSTFSTAIFEGVDLIQRKRIK
FT                   DGVFLLFAELIVPFFAASVGYIVSQILLLHVI"
FT   gene            138763..140130
FT                   /locus_tag="HMPREF0424_0118"
FT   CDS_pept        138763..140130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0118"
FT                   /product="chloride transporter, ClC family"
FT                   /note="identified by match to protein family HMM PF00654"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14420"
FT                   /db_xref="GOA:D2RCV8"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCV8"
FT                   /protein_id="ADB14420.1"
FT                   /translation="MKFKNALSFLSNKLKQISKTFCQLRWKVILAGIFVGAVSGSLVAS
FT                   YRLGIEYGTDFARWMYLQIRHNAWWILPCLIFAVIAGLIIGWMSRKESMASGSGIPQVV
FT                   GYVNRGLNMRWHTILPVRFVGGLLGSLFGLSLGREGPSIQIGACGAQMLSRIFRKGRRD
FT                   DIKEHYVVTAGAAAGLSAAFSAPLSGVMFAMEEIQHGLTSIVLIGAAAAALCADFVSQT
FT                   CFGLRPVLDFGQIPDLPMNLHIWIIPLGIFAGFVGSIMNRSLLGLQTLYGYLPKWMPVA
FT                   IACLIAIPVGLFLPEVLGGGSNLVRLSEYGKASLAMLCLLFVAKMLFTSTSFGCGAPGG
FT                   IFMPILAVGALAGGVAARWITSVSAFGIDTKFVSVFAVCVMAGTLSASVKAPLTSILLT
FT                   VEMSGTMIHTLPVAASAFIALLISDILKTKPIYGELLERYMKVNKDLVLPSVNSVK"
FT   gene            140254..141429
FT                   /locus_tag="HMPREF0424_0119"
FT   CDS_pept        140254..141429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13902"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCV9"
FT                   /protein_id="ADB13902.1"
FT                   /translation="MNMSVNNKSIGVKQIDKNYNNGEAVGAFRDVKRYVYPPQVADKSI
FT                   YESVSNGIKIAPCIADDHTVMTLFPKSSQDVESFQNTERSQDISIKHKSRMFNNAEEDN
FT                   LIARDSLDPLPKNILVGMSAADGIGLSTSLSILSRYISEQGHSVALVDADLTHGGLDVL
FT                   LGLESDEGRRLQEVDAPLGRCDGYVLRNELLHWDNVGVLAFSPWHGKYPEPWVLEAAIR
FT                   GLADAVDVVIVDIGSGETAMKSYRNIPQFIDSATLAAVELSVLDLARFRALLQKLDTLC
FT                   DSGVKFNKFAVVGLSPRGLTQKSYVLSIDEASEYLSTTFLGSLQHDARMHTDIIGGYGI
FT                   RNVPSSMKETMQCINNWLIGDVISNTKNAVTKYRRSQYRRSKYSRGKYDRK"
FT   gene            141416..142492
FT                   /locus_tag="HMPREF0424_0120"
FT   CDS_pept        141416..142492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0120"
FT                   /product="type II/IV secretion system protein"
FT                   /note="identified by match to protein family HMM PF00437"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14599"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCW0"
FT                   /protein_id="ADB14599.1"
FT                   /translation="MIVNNIRDIDFGILQEFANDVRVTDMVVSESGRVWVDCGQGLKER
FT                   ATRVPLNNPALLREYAVWLCAQLGKRLDDACPIADASSTSGIRIHAVLAPLVSQGAALS
FT                   IRFPSINRYDLVSLSDQGMFPKELSCILSVLVKKRANIMITGSTGSGKTTLMKALLAAA
FT                   DCEDRIVSVEEIRELGELTQNHVSLSAREANVEGVGEIGLSQLVKATLRMRPDRIILGE
FT                   CRGEEIADLLRVFTSGHKGGMTTLHADEIEKVPARLMALGLLAGLEPAALCALAAGAFD
FT                   VVIHVERSSNGRRMIKELGILQYASSASLLCGVPVLQLSCGIDGSIVMKFLPAWVKFSN
FT                   YWNLPENMASVCVDSSNN"
FT   gene            142522..143097
FT                   /locus_tag="HMPREF0424_0121"
FT   CDS_pept        142522..143097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13700"
FT                   /db_xref="GOA:D2RCW1"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCW1"
FT                   /protein_id="ADB13700.1"
FT                   /translation="MDIEEVLAGMIAALRSGSTFAMIVHSDSKSQQCICSNAVNTKIIY
FT                   KWLYERCFPKKRNMNKTQRRQLEKHMHTVSESLMASYELSNTLGCVMAECVEATAASYH
FT                   AQKRAEDLRADVAAMPKATIKLLTALPILALFAGELLGGHPILMLITTVNGWILLTIGG
FT                   ICYGLGLAWVSSMLQISQHAMDAASLEG"
FT   gene            143101..143748
FT                   /locus_tag="HMPREF0424_0122"
FT   CDS_pept        143101..143748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14033"
FT                   /db_xref="GOA:D2RCW2"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCW2"
FT                   /protein_id="ADB14033.1"
FT                   /translation="MESTKQLLFIIPLFVVIVWQWVSLKLECDSLDNRMRFNSKIMLFK
FT                   YEWRNSKVSYVDPLLGLHMIIVSLRSGVAITRALSAVGQVFPCGQGMWLCSVSNALLAG
FT                   DTWHEAWSSTYTRQDNFELENKSKFTNRKNLDSSEILARWLMTSLKESWCYGSSPVPVL
FT                   SALAQHYERNMANIARQESSRLSVRLLLPVGLCFLPSFICIGILPTVMSLMR"
FT   gene            143884..144162
FT                   /locus_tag="HMPREF0424_0123"
FT   CDS_pept        143884..144162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13615"
FT                   /db_xref="GOA:D2RCW3"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCW3"
FT                   /protein_id="ADB13615.1"
FT                   /translation="MMVGIMQKLVARCSVSMLQVNEQLVNIESCLCQKRKLYADGLKNK
FT                   DSGAVTAEYAVVIIAATGFAALLVAILKSDTVRTTLTDLVKKALKIG"
FT   gene            144345..144572
FT                   /locus_tag="HMPREF0424_0124"
FT   CDS_pept        144345..144572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13471"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCW4"
FT                   /protein_id="ADB13471.1"
FT                   /translation="MNCHDAAAQVAYYLVTHKDDKAAASIVQSVAGQGASVKISRSNNM
FT                   VNIVVKCPLVPDPLHILPPLVESHVSQVLV"
FT   gene            144569..144973
FT                   /locus_tag="HMPREF0424_0125"
FT   CDS_pept        144569..144973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0125"
FT                   /product="TadE-like protein"
FT                   /note="identified by match to protein family HMM TIGR03816"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14316"
FT                   /db_xref="GOA:D2RCW5"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCW5"
FT                   /protein_id="ADB14316.1"
FT                   /translation="MSRRKNFVKHSINFIHKRCKGIDCGSGTMLGIMLVIAVCSILVLS
FT                   AILCNVLGAKHQAYAVATSAALSGASALQRMEDNACEVVARTVASSNAFLKSCNSTSND
FT                   VTVRVSVGLNIPFASNVEVSARAGLEDCNK"
FT   gene            145079..147484
FT                   /gene="dnaX"
FT                   /locus_tag="HMPREF0424_0126"
FT   CDS_pept        145079..147484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="HMPREF0424_0126"
FT                   /product="DNA polymerase III, subunit gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM TIGR02397"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14035"
FT                   /db_xref="GOA:D2RCW6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCW6"
FT                   /protein_id="ADB14035.1"
FT                   /translation="MALALYRRYRPDTFDGVIGQDQVTIPLSRALDQGKITHAYLFSGP
FT                   RGCGKTSSARILARCINCEKGPTSHPCGECQSCKDLATGGAGSIDVVEIDAASHNGVDD
FT                   ARELRERAGFAPARDRYKIFILDEAHMVTQQGFNALLKIVEEPPEHVMFIFATTEPDKV
FT                   IGTIRSRTHHYPFRLVPPEVMSPYLEDICKKEGILPQPGVLRLVMRAGAGSMRDTLSVL
FT                   DQLMVGAVDGSISLDSAVALLGFTPNSLISEFIDDLINHDGASIYDVVRRVIVGGYDTR
FT                   KFVEDLLGRVRDLLLMVSAGPKAASSLLNDVSPEDLEILNKQSASMTLHDLARMAQTIN
FT                   DALSAMASAISPRMNLEILVARLLADSETSNTVATNLRINNVQQQNISTSTQNIQNKVS
FT                   SGAHFVGSTSNKKYVSADSENNSTSNSSLPSETTASPIAKAETQSATNTKETESKKVFL
FT                   NDAHNANSKNDSMDTDAMWDKVVSKLPDDVREYVTREYVPTVQLTSAQSGRQRLILTFN
FT                   EPMSQHAFALAVCTTSPYDGQKVPKVVMNEVHEIFGTQVMIAPAPVAANGEQVESVARM
FT                   DPQKLAKVKRDILLRKTGISAGFSNKTDSDSSGINKNPTKKESSGFSGADGSAASVASE
FT                   NTADELSDVANADDDVWADMSSMPMSDVIAMPENSSSEESSSKGSSIEDEPMNHDDEIT
FT                   IQKSSHSHNQDEAISGVLDQDKLQSQVQNATNTSELSAESIQTTVSPTNGATADECSMD
FT                   DASLESATSVSTDELKQIFEVKSVEEFASTDPKNPKNAIMSVKKKQEE"
FT   gene            147491..148099
FT                   /gene="recR"
FT                   /locus_tag="HMPREF0424_0127"
FT   CDS_pept        147491..148099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="HMPREF0424_0127"
FT                   /product="recombination protein RecR"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF02132; match to protein
FT                   family HMM TIGR00615"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14594"
FT                   /db_xref="GOA:D2RCW7"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCW7"
FT                   /protein_id="ADB14594.1"
FT                   /translation="MHNSSSYDGAIGRLIEAFSKLPGIGPKGAQRIAFYLLSSSDKDVQ
FT                   ELIDAINNMKESVRFCDVCGNVCEQSPCIVCADPRRDHSKICVVEEPKDIMSIERTHEY
FT                   SGVYHVLGGAINPMANVGPGDLAITQLLERLKDAKVQEIILALDPDIEGEATVTYLARL
FT                   LDPLGIKVTRLASGLPVGGDLEYADEITLGRAFSGRQSV"
FT   gene            148229..148993
FT                   /pseudo
FT                   /locus_tag="HMPREF0424_0128"
FT                   /note="amino acid kinase family protein; this gene contains
FT                   a premature stop which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00657"
FT   gene            149057..149626
FT                   /pseudo
FT                   /locus_tag="HMPREF0424_0129"
FT                   /note="ACT domain protein; this gene contains a premature
FT                   stop which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF01842"
FT   gene            149711..150778
FT                   /gene="asd"
FT                   /locus_tag="HMPREF0424_0130"
FT   CDS_pept        149711..150778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="HMPREF0424_0130"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF02774; match to protein
FT                   family HMM TIGR01296"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13591"
FT                   /db_xref="GOA:D2RCW8"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCW8"
FT                   /protein_id="ADB13591.1"
FT                   /translation="MTIINEKGVNVAVLGATGQVGMVMRRVLDERDFPIKDLRFMASAH
FT                   SAGTVLQYRGKDVVVEDVEKADLHGIDIAIFSAGGGTSKIWAPKFAEAGAIVVDNSSQW
FT                   RMHNDVPLVVAEVNPEDLDTIPRGIVANPNCTTMACMPVLKPLADAFGLKRLIVSSYQA
FT                   VSGAGRAGALQLMNEAQAALNQGADKLVFDGSAIDFPEPTKVACTIAFNVVPFIGSIVD
FT                   DGSEETDEEQKLRNESRKILHLPNLAASCTCVRVGVFTGHGMSVNAEFEHDVTPDMARE
FT                   VLSKAEGVELNDIPTPQLAAGKSASYVGRIRQDQAIDGNKGLALFITNDNLRKGAALNA
FT                   VQLAEIIAKKRNFLN"
FT   gene            150831..151451
FT                   /locus_tag="HMPREF0424_0131"
FT   CDS_pept        150831..151451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13582"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCW9"
FT                   /protein_id="ADB13582.1"
FT                   /translation="MSIASEEIQQQLDRIVALGYPDVADMSADAFRKLANPILCALENS
FT                   SLGANILLVPTRELVSPESLISRTSINRMAGFTTMPPRDIISFLPKDGYEFPKGPFYIV
FT                   VDPHTGSSYLNREPDVARKLIDSDERLPLTLEEGLAIATQHPDWLESKNGFNLLGSQSA
FT                   DGRVPSIWMSQCAPRLGAVWPNSRHTWLGNAYCMERCGVSSLK"
FT   gene            151561..152262
FT                   /locus_tag="HMPREF0424_0132"
FT   CDS_pept        151561..152262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0132"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13777"
FT                   /db_xref="GOA:D2RCX0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCX0"
FT                   /protein_id="ADB13777.1"
FT                   /translation="MAYITFDHVVKEYPSGSGAVRALDDASFTAQSGELTVILGASGAG
FT                   KTTALNILGGMDTATSGRVVVGDCDVTKLKGRNLVRYRREDIGFVFQFYNLVPNLTALE
FT                   NVELASQICADHFDPAQTLIDVGLKERLHNFPAQLSGGEQQRVSIARALAKKPKLLLCD
FT                   EPTGALDYETGKAVLQLLQDICRTEGMTVLIITHNAAIAPMAHKVVRFRSGKVVDETVQ
FT                   EHPMAIADIEW"
FT   gene            152276..155029
FT                   /locus_tag="HMPREF0424_0133"
FT   CDS_pept        152276..155029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0133"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14538"
FT                   /db_xref="GOA:D2RCX1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCX1"
FT                   /protein_id="ADB14538.1"
FT                   /translation="MRKVAAVSKQSDNKNANNGGEVKRMHSLLPIVFISAIRMWVREWR
FT                   RFCVLAVIAMLGVAVMTGIYAGCNDMFLATNDMYAKLHAYDLQIVSTLGLTKDDVAALR
FT                   ALPSVSEVEAERSWKATAHATDDAKSSYAMNFVHYVESQKNLNRLHLLKGNMPKNNSEA
FT                   VVTQRFLHDSGLSIGNVIVVNVQQNAGVGSLGSSNSKSKTYRLRITGSVLDSNDLNNPD
FT                   GYQSKAFRNSVTSRYPIFTSAAPDNVASLPYTAISVRLNDAQRVNVFSKDYRGIVDDAS
FT                   EQIQERVQSKRETARRNQIIDKQVNLELKNIIANDPRLQRAPNFVKEQAKKQIRKQIKS
FT                   EIQKRVPQAQWHISTRIANDSYASLRSDVASIQSLGYAFPAVFLVVAMMMSLTAMARMV
FT                   EEERGLIGTYLSLGYGRSTAVTRHAFFAIFACFVGGGIGDIMGFLAIPSLLLKILRGLY
FT                   AVPDVRLKYDWLYGSLCVLAFVIPVAICTIVVSWRETKQVPAALLRPKAPKAGSRVLLE
FT                   RLPWIWKRMSFLNKVTVRNLARFKGRLCMTIGGVAGCTALIVCGLALNDTVATLGIRQY
FT                   EGIYRYDMISISAPGSFQNMKKSVERDKSNNKVETILPAYVGSGEIAKNQSNKSHSRHV
FT                   EDAESVQLIVVKDTKALSYLVNLQDVGNNLQAIKLTDEGPLLSQSAAASLDITRGSEIN
FT                   VTNTSFKRAKVKVKAIVRNLIGSNIYMTERCYERLFNGENSKLLKHNALILRLRGSDNN
FT                   KIKYADKVSERDGVLAVMNITRMKHAFSFDLMNAVVALIVTLAAGLALAVLFTLASTNI
FT                   SERTREMATLKVLGFYRREVHSYVHKEMLTLTVIGIAVGLPLGRLIAGLLTSALRMPSL
FT                   YFEVEVAPLSYCIAGVATLIFALIVQWATNPALDRIDPVSSLKSVE"
FT   gene            155117..156700
FT                   /locus_tag="HMPREF0424_0134"
FT   CDS_pept        155117..156700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0134"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14477"
FT                   /db_xref="GOA:D2RCX2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCX2"
FT                   /protein_id="ADB14477.1"
FT                   /translation="MSETVNSDINVGSKQTESAETHNSTSSHNQSSNQSSRVSAQENAS
FT                   SNTNQMERSLTKRHVQFIAIGGTIGTGLFLGSGKSISLTGPSIVFVYIIVGLIMFLLMR
FT                   GIGELMYKDPNQHTFISFITRYLGRGWGNFAGWSYWFVLVLIGMSEITAVSTYCVTFFQ
FT                   TFDIDVSHWKWLIEVVFLAALVCINLVAVKLFGETEFWFSMIKITLIVALIVTAVVMAL
FT                   IGYHYSATPLHGGVMSPAGHAGLDNIFNNFSLMPNGWLSFLMSFQMVFYAYQLIEFVGV
FT                   TVSETKNPRQVLPKAVNEIIVRVLVFYVGALIAIMLIVPWQQFRATNAEGVFMSPFIMV
FT                   FQYAGLHWASALVFFVVITAASSALNSLLYSAGRHMYQIALESPSPLLGKLRKVSRTKV
FT                   PARAILFSSALILLSPIINSIPGIHGAFILFASASSAVIIMIYILIMVTHRKYRESADF
FT                   MPDGFVMPHYKLLNSLTIAFFAFVYVTLFISDDTRASAIGGLVWLVLFGGYCALHQHWQ
FT                   NRDLAEALGK"
FT   gene            156737..157444
FT                   /locus_tag="HMPREF0424_0135"
FT   CDS_pept        156737..157444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0135"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01939"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13645"
FT                   /db_xref="GOA:D2RCX3"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCX3"
FT                   /protein_id="ADB13645.1"
FT                   /translation="MRIIVADCSAEYTGRLNATLPLAKRVLLIKADGSVLIFSELGAYK
FT                   PLNWMVAPCSMRVLRKEDSGESDAGVVVDGCILRVAAAKSDDLLMISLEHVYSDNTYDL
FT                   GEDPGLIKDGVEDHLQRYLAEQIERIGDGATLVRREYPTAIGPVDIMAQDADGVHVAIE
FT                   IKRHGGIDGVEQLTRYCELLNRDPLLKPVRGIFAAQTISPQARVLAEDRGFTCLILDYD
FT                   EMRGVESNDLRLF"
FT   gene            complement(157529..158518)
FT                   /locus_tag="HMPREF0424_0136"
FT   CDS_pept        complement(157529..158518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0136"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
FT                   /note="identified by match to protein family HMM PF00254"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14106"
FT                   /db_xref="GOA:D2RCX4"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCX4"
FT                   /protein_id="ADB14106.1"
FT                   /translation="MKKIKTLEQKSFLLRTFATISAVAMCVVLASCGESSNNKNNLTDE
FT                   NAQKAGMQLLEGVSASGALGKKPKITLKTPVKVKQNTYAVLQRGNGETIKEGDRVCSQG
FT                   IVFDSKTGKELMNTWEKGKVDCSIYINKNSTSRPYYALIKGKKINTTIAFGVSEGYKNP
FT                   SYVMVLTMVSRSKAITRATGKAVTNIPANLPKVTLDKSGAPTLDKNNYVPDGKLVSQTL
FT                   IEGTGKKVTAKDTVSAHYTGWTTDKDGKLHQFDSSWLRGIPADFQLAGGVIPGWTKGLT
FT                   GKKVGSQVLLVIPPEDGYGKEEKKDARGNVTIPANATLYFVVDILYAS"
FT   gene            158598..160394
FT                   /locus_tag="HMPREF0424_0137"
FT   CDS_pept        158598..160394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13596"
FT                   /db_xref="GOA:D2RCX5"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCX5"
FT                   /protein_id="ADB13596.1"
FT                   /translation="MTNIEDASDTEGRPMRRPMRRLTLRSKIMRGVVAPFFALLAVLSV
FT                   VLGVANATFWKPSNVVIAYANVSGTRYIVTDPGVLNLVDNRVRISVAALHTRKPICVAV
FT                   GLTKDVRGWVAGSPVQRITGLRDWNNLSVSEVSGKTSVQAGDSVDIKDPDVKFQESNLW
FT                   PIVTCQLGLAKLAINTADYVQSSGSASYDHAVASGTMPKSGTRASKSNSHDASSSSLRS
FT                   QAARRVLLIDLGDNVPEASVELRWRRNQIPDFATPLYFVGALFAVLAILSATIFAMAPH
FT                   RRRNKQLIASRSGVLAVKSAQRDEVTFAEAISGTMSGIFGHKRHKKDSGSHARHGDHAR
FT                   RRKDSMQSGDSNGMQTRIASASTAVASTDSLAETTVIAQDEMLAFATRFMQQHDDNSYL
FT                   DGLDNADDEFNDLHNQDAAANGEDLANAEDIGNAKYSGNSAGSANSENKQYKRNSQNIK
FT                   TPRNKKKSSISASDGNSLNDYKNKRQQQNKYAQQNNKRRNRQNDRNNANNSEKFAKKRL
FT                   ETVKPSDSNSKISYESSKKKLNEHENYRNSESNKRQNSSKNSNDKQSRIKRNGFRGDGG
FT                   NGRYRKNGKGYRGNSSSERGNE"
FT   gene            160396..161451
FT                   /locus_tag="HMPREF0424_0138"
FT   CDS_pept        160396..161451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13630"
FT                   /db_xref="GOA:D2RCX6"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCX6"
FT                   /protein_id="ADB13630.1"
FT                   /translation="MRNSNVDIHRVKSKNRGVLRNNVVTLIACVVSTVMVTGLSACDGQ
FT                   VPKPAEARSNQELPNVTMLQEKDIRLGLLRTLEKANDEKDVDSLSQAVSGPALDIRTSE
FT                   LTIANKTGNLDPKATIPREAAQTIVPTNSGWPRDLMTITTTTKDQQSKRLLVLRQQRAR
FT                   SNYKLWAVARLFPGVHLPKFAVPSIGSSMGKSNDTGLVMTPDEAVAAYADVLQNGENSK
FT                   YAKHFADDYLRKKLVELSKAVQAGMERNKGSQEQIFTPNLKQISIMRSSDGSDLVVARI
FT                   DSVWTRKAGEGRESRPASDEEKALFGDGKAKGTMRVTYVNVIALVVPPASSHMKIIPVG
FT                   AERQPIKVEAL"
FT   gene            161495..162517
FT                   /locus_tag="HMPREF0424_0139"
FT   CDS_pept        161495..162517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14162"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCX7"
FT                   /protein_id="ADB14162.1"
FT                   /translation="MSSKAQGMNPGGFSLAGAVDLEGVKRRVEAQAKQAAKAASGSTGS
FT                   SAPKAGGYVIDVNEQSFQAMVQTSVSFPIVILLWQANDEAYYDVAQKLADAVNALDGRM
FT                   QLARIDSDESPSIAQALQAQQLPAIYGLIGGRPMPIAQGLPSDEELQQICGTILPQLVQ
FT                   VAERSGVAGTAPFVESSVEKKSETSKDADQDSSENNSVESVPPAHEQAHSLAMKGDYEG
FT                   AAREYAKVMEADPHDVLASREHAKALLLSRNTNTDVAAVRKAAGDNKDDLDSQLAVADV
FT                   DMIDGHIDDAFGRLLDFLASGHKSDADAIRSRMLEYFAILPADDERLARARRRLAILLY
FT                   "
FT   gene            complement(162615..162691)
FT                   /locus_tag="HMPREF0424_1356"
FT   tRNA            complement(162615..162691)
FT                   /locus_tag="HMPREF0424_1356"
FT                   /product="tRNA-Met"
FT   gene            162847..163878
FT                   /gene="metA"
FT                   /locus_tag="HMPREF0424_0141"
FT   CDS_pept        162847..163878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metA"
FT                   /locus_tag="HMPREF0424_0141"
FT                   /product="homoserine O-succinyltransferase"
FT                   /EC_number="2.3.1.46"
FT                   /note="identified by match to protein family HMM PF04204;
FT                   match to protein family HMM TIGR01001"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13537"
FT                   /db_xref="GOA:D2RCX8"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCX8"
FT                   /protein_id="ADB13537.1"
FT                   /translation="MPIKIPEGLPARSILDAERIFALERPEAEQQDVRPLRLLILNLMP
FT                   KKIETETQLLRLISKSPLQVDVDFMKTSTHVSTHVSADHLVKFYENLDALRNNYYDGFV
FT                   VTGAPVEHMEFEDVDYWHEFTQILDWASTHVFSTMYLCWGAMGALYYRYGVKKHVLSKK
FT                   VFGVFPQYLQDEYCFLTNGFDEIALQPHSRIASVDVDSISADQRLQILTYGPESGPGLV
FT                   ATRDFSEVFALGHWEYGKMTLAQEYERDMLKGLSNVPFPYNYFPHDDPKLEPLFSWRAH
FT                   ANLLWRNWLNWVYETTPYNLSDIPHLRTAGRLGTERSIRHEPASPRSDNFYPFDGVKYG
FT                   MNK"
FT   gene            164081..164935
FT                   /gene="atpB"
FT                   /locus_tag="HMPREF0424_0142"
FT   CDS_pept        164081..164935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="HMPREF0424_0142"
FT                   /product="ATP synthase F0, A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00119;
FT                   match to protein family HMM TIGR01131"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13870"
FT                   /db_xref="GOA:D2RCX9"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCX9"
FT                   /protein_id="ADB13870.1"
FT                   /translation="MNVMVDVLQKTTTVASTVASNKPELPDISEFLPPEILFQGTPFAM
FT                   NRIVMVRLIMAVIVMIIFGIGAARAKVVPGRFQSVLEILMDFVRFNIVYEMIGEERGKR
FT                   YVPMMTTLFITIFFFNLCSVIPGLNMAATATITGPLVFALWVVCQYLITGIREKGFLTF
FT                   FRESLFPAGVPWPIYFILTPLQLLELLIVRPLSLTIRLFANMIAGHLLVATCLVFTNFF
FT                   VVDSSNKLLALGGALWLLGGILFTVFEVIVAGLQAFIFTVLASVYISESYPEKEEKSAV
FT                   AIA"
FT   gene            165036..165269
FT                   /locus_tag="HMPREF0424_0143"
FT   CDS_pept        165036..165269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0143"
FT                   /product="ATP synthase subunit C"
FT                   /note="identified by match to protein family HMM PF00137"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14389"
FT                   /db_xref="GOA:D2RCY0"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCY0"
FT                   /protein_id="ADB14389.1"
FT                   /translation="MNSIIALAGLTGNLSILGFAVATLSPAIGMAMVVSKAMESTARQP
FT                   EVGNRIQLFMFIGLAFIEVLGLLGFVAYIMGS"
FT   gene            165330..165872
FT                   /gene="atpF"
FT                   /locus_tag="HMPREF0424_0144"
FT   CDS_pept        165330..165872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="HMPREF0424_0144"
FT                   /product="ATP synthase F0, B subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00430;
FT                   match to protein family HMM TIGR01144"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14012"
FT                   /db_xref="GOA:D2RCY1"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCY1"
FT                   /protein_id="ADB14012.1"
FT                   /translation="MAYAAETNKLALFLPEPYDVIWSLVILVVLAAFFYKFVMPKFQAI
FT                   LDERAEKIEGGMAKAANVQREADELKSQIENELSQAQTDAAKTREEARAEASKIIGEAR
FT                   QRAEKDAAKIISEAQHSIEAQHKHAMSSLQGEVSVLAAALAGKILASKLDDDTVSSKII
FT                   DHVIDEVGDTKNSDQSK"
FT   gene            165972..166553
FT                   /gene="atpH"
FT                   /locus_tag="HMPREF0424_0145"
FT   CDS_pept        165972..166553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="HMPREF0424_0145"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00213;
FT                   match to protein family HMM TIGR01145"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13829"
FT                   /db_xref="GOA:D2RCY2"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCY2"
FT                   /protein_id="ADB13829.1"
FT                   /translation="MPEKASRANDSLSRSSLAQAISDAHDEAQRISDELSSMMDMIDKY
FT                   PELSDAITDPNRSSEDKSRLIDELIGGKAHPVVLRIMHYLVGTWHGGAESGKTGSFGGA
FT                   WSGFEREAGETLVTVTTAQPLTDKQIKRLIEIYSNKLGHRAYINPIVDPNVLGGMRIQI
FT                   GDQITDRTMLMQLKQLQRSARNGAWTQAVK"
FT   gene            166570..168231
FT                   /gene="atpA"
FT                   /locus_tag="HMPREF0424_0146"
FT   CDS_pept        166570..168231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="HMPREF0424_0146"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM TIGR00962"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14519"
FT                   /db_xref="GOA:D2RCY3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCY3"
FT                   /protein_id="ADB14519.1"
FT                   /translation="MAELSIDPALIRKALDGFVDSYKPTDMPTQEVGYVVTAGDGIAHV
FT                   AGLSGCMANELLTFENDTLGLAFNLDAHEIGVVILGDFTGIEEGQEVYRTGEVLSVPVG
FT                   DAYLGRTVDPLGNPIDGLGAIECSERRILEAQAPDVIHRHPVDEPLSTGLKAIDAMTPI
FT                   GRGQRQLIIGDRQTGKTAIAIDTIINQRANWETGDPKKQVRCIYVAIGQKGSTIASVRQ
FT                   SLEEAGAMKYTTIVASPASDSAGFKYIAPYTGSAIGQHWMYNGKHVLIVFDDLSKQAEA
FT                   YRSISLLLRRPPGREAYPGDVFYLHSRLLERCAKLSDDLGGGSMTGLPIIETKANDVSA
FT                   YIPTNVISITDGQIFLQSDLFNAGQRPAVDVGISVSRVGGAAQAKALKKVSGMLKISLA
FT                   RYKSLESFAMFASDLDAASKAQLTRGARLTELLKQKQFSPRAMEQEVVSVWAGTHGKLD
FT                   DIPVKDVLRFESELLDYLDKGTDILQVIRDTEDFTKETEAKLDAAIDDFRRTFKTSAGK
FT                   PLIVKDSLPPAENPAPVEKEQLVAKPKADSREPEGK"
FT   gene            168235..169239
FT                   /gene="atpG"
FT                   /locus_tag="HMPREF0424_0147"
FT   CDS_pept        168235..169239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="HMPREF0424_0147"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00231;
FT                   match to protein family HMM TIGR01146"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14291"
FT                   /db_xref="GOA:D2RCY4"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCY4"
FT                   /protein_id="ADB14291.1"
FT                   /translation="MSSQLALKSRIISTQSLGKIFKAQEMIASSHIAKARDIALNAKPY
FT                   SDAIFDAVQALVAHHEANIKHPIFGKEHAGNRVAVLALTSDRGMAGAFTSSIIRETEAL
FT                   LAKLDAEGKHAELYVYGRRGATYYKYRNRDVAGTWEGSTDHPDVTIAEKISDTLMDAYM
FT                   TPEAEGGVSELYIVFTEFINMVRQKVRTLRMLPVELVPLKDGEEFSMHRPDYEAASGPS
FT                   AALSSTSAVSAREEAVSRSNPEAVEYCFEPSPDEVLDAVLPKYIQSRIHECLLTSAASE
FT                   TASRQNAMHTATDNARNLVDDLTRKLNASRQASITQELTEIIGSADALNNEED"
FT   gene            169246..170733
FT                   /gene="atpD"
FT                   /locus_tag="HMPREF0424_0148"
FT   CDS_pept        169246..170733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="HMPREF0424_0148"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM TIGR01039"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13445"
FT                   /db_xref="GOA:D2RCY5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCY5"
FT                   /protein_id="ADB13445.1"
FT                   /translation="MAENQTTAPPEAEQEVDPTAGRVTRVQGSVIDVEFPVGYLPDIYN
FT                   ALKVDINTVGNTEGDTVHEITLEVEQHLGDSTVRAVALKPTDGLVRGALVRDTGGPISV
FT                   PVGDVTKGHVFDVTGNILNAKPGEHIEITERWPIHRNPPAFDQLESKTQMFETGIKVID
FT                   LLTPYVQGGKIGLFGGAGVGKTVLIQEMIQRVAQNHGGVSVFAGVGERTREGNDLIGEM
FT                   ADAGVLEKTALVFGQMDEPPGTRLRVPLTALTMAEYFRDVQNQDVLLFIDNIFRFTQAG
FT                   SEVSTLLGRMPSAVGYQPNLADEMGALQERITSTRGHSITSLQAIYVPADDYTDPAPAT
FT                   TFTHLDATTELSRDIAAKGIYPAVDPLTSTSRILDPRYVGQAHYDCANRVKAILQRNKE
FT                   LQDIIALIGIDELGEEDKTTVSRARKIEQFLGQNFYVAEKFTGRPGSYVPADETIEAFT
FT                   RICDGVYDEIPEQAFSGIGGIDDLERRWHDMQQEFGA"
FT   gene            170817..171050
FT                   /locus_tag="HMPREF0424_0149"
FT   CDS_pept        170817..171050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0149"
FT                   /product="putative ATP synthase, delta/epsilon subunit,
FT                   beta-sandwich domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13766"
FT                   /db_xref="GOA:D2RCY6"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCY6"
FT                   /protein_id="ADB13766.1"
FT                   /translation="MVIPSVNGAMGVLPGHEAVLALIDHGFVKVDDLKGVRHVFKVTDG
FT                   FYSVDSDNITIAVEHSCNVDKDGNVLPNAKVI"
FT   gene            171790..171975
FT                   /locus_tag="HMPREF0424_0150"
FT   CDS_pept        171790..171975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0150"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13832"
FT                   /db_xref="InterPro:IPR041535"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCY7"
FT                   /protein_id="ADB13832.1"
FT                   /translation="MIDKETQRRRQENLGLAIASGKLEGNSPSKEFLYDANQYANGLIS
FT                   SNEFVARMRSRYGVMD"
FT   gene            171994..172713
FT                   /locus_tag="HMPREF0424_0151"
FT   CDS_pept        171994..172713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0151"
FT                   /product="putative toxin-antitoxin system, toxin component,
FT                   Fic family"
FT                   /note="identified by match to protein family HMM PF02661"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14469"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCY8"
FT                   /protein_id="ADB14469.1"
FT                   /translation="METVFDPYLIPHTRVLKNKSNINNQIELDKYENDAVLTRCSILYE
FT                   NLPHAEGTVKQLQWIHHYLFQDVYDWAGQIRTIDMTKGGGEPFHPLEYMGVGIRYCEQT
FT                   LKNDNLLQGLSIDEFISKLSVNYNNFNVLHPFREGNGRTQRVFWDIVARDAGYHFDWGL
FT                   ITQRVNDEASIQAKDANDTKLLEDMFHIITKPLNVELLAQQQFAHLVEEEYEYAPNVAS
FT                   ILQDKDYAAYKTRYGID"
FT   gene            173008..174258
FT                   /locus_tag="HMPREF0424_0152"
FT   CDS_pept        173008..174258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0152"
FT                   /product="Fic family protein"
FT                   /note="identified by match to protein family HMM PF02661"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13618"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCY9"
FT                   /protein_id="ADB13618.1"
FT                   /translation="MDYKTIRKIVAMSKSNAKPCDIAEEEYCLRIDNPVTYRSGIVFDA
FT                   HEIFAMCVTDLVTYMNYIANTEKAVEKAWNELPRFAQREYLMQLIAKEVQNTNIIEGVH
FT                   STRKELSKALDAANEQNNHTRFSEFTKLFLELADSNECDTSIPQTLQDIRKIYDSIMQG
FT                   ELEANNIPDGEIFRSGKVSIRDGANNVVHDGDATEAEIQDHLTQMLSLMNSSEVPTLIK
FT                   ACMCHYAFESVHPFYDGNGRTGRFLLALQLHEHLSMPTILSLSSIIYAEKSGYYAAFSK
FT                   AQELFNCNDLTMFCCTMLEYIVKAQGEVFENISVQLKHIIYCMGKLRELFSEEEISKVQ
FT                   REVLSILLQNKLFSYNPTPMTRKQLSEYVGNAIAEQVGERKIVSALNGLIELGMVDSIG
FT                   ERPIRYELSKKANEMFA"
FT   gene            174289..175338
FT                   /locus_tag="HMPREF0424_0153"
FT   CDS_pept        174289..175338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14149"
FT                   /db_xref="GOA:D2RCZ0"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCZ0"
FT                   /protein_id="ADB14149.1"
FT                   /translation="MFGNVMAIERALGTGIIISSSVPISQRVQNRIRDFIEEYESVLSR
FT                   FRADSLVSRMACAEHGGEFEFPTWAQPLFAIYSEFYDATHGAFDACIGADLLALGYNNS
FT                   VQFVPESAASAGKNDNSSSYSCSNYRRALPVKWADISRDDGGATLHTNKPVQLDFGAAG
FT                   KGYFVDLVMQIIKEEFSDDSTANNYFPSDFDFLVNAGGDMRACFSKKNSQIKVALENPF
FT                   DTTQAVGVASIASGALCASSAARRRWKVKDTNCLAADAFESNVVATHLINALDGVPSQK
FT                   LSASWTYVPAKTCAFPTAYADALATALFISQESDLQKIAQTTGAEFAVMQPNHALRKTC
FT                   AFPARFFAE"
FT   gene            complement(175667..177004)
FT                   /locus_tag="HMPREF0424_0154"
FT   CDS_pept        complement(175667..177004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0154"
FT                   /product="ATPase/histidine kinase/DNA gyrase B/HSP90 domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13996"
FT                   /db_xref="GOA:D2RCZ1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCZ1"
FT                   /protein_id="ADB13996.1"
FT                   /translation="MNIIAFVVLIGNYAPDKEISPYSIAKETGEALQLSASGDYALSKN
FT                   MSSKLTNSGAWAILIDNNTLKVVWKTENVPADIPNNYTLSDIANLSVGYIDGYPTYTGK
FT                   NKDGVVVVGFPHNSFWKHTRPSWNYSLILNFPQIVLSVLFINILLILGIYLIANIKLLK
FT                   SINPITKGIQRLSSGESVHIPETGALSEISSNINSASDILQIQKEQLRKRETARANWIA
FT                   GVSHDIRTPLSMVMGYAGQLENSLHILEEDRKKATMIIKQSVRMKNLINDLNLASKLEY
FT                   NMQPIMKKEENVVAVVRQVVVDFMNMGMQDEFSIKWETDAELTVCNINVDKDLLKRAIS
FT                   NLIQNSISHNENGCTIYVSVAANNNNCIICVEDNGIGVSDEKIEKLNHAPHYMICDTST
FT                   AEQRHGLGLLIVQQIIGAHNGTVDISRSKYGGFKVELTVPSKKFEL"
FT   gene            complement(177083..177784)
FT                   /locus_tag="HMPREF0424_0155"
FT   CDS_pept        complement(177083..177784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0155"
FT                   /product="response regulator receiver domain protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14619"
FT                   /db_xref="GOA:D2RCZ2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCZ2"
FT                   /protein_id="ADB14619.1"
FT                   /translation="MNLNDYLLNKHLLLVDDEQGLLDMVVSILNEYGFYNITTAKSIKD
FT                   AIEATQKLRPELAILDVMLPDGNGFELMKQIKQYSDCPILFLTACGEDEDKFKGFGLGA
FT                   DDYIVKPFLPKELTFRIMAILRRSYKSENPIVKLKNSQIDFSSAQVIKNNEHIQLTAKE
FT                   YDLLSALYRNAGCIVTIDALCEATWGANPFGYENSLMAHIRRIREKIELNPSQPVSLIT
FT                   VKGLGYKLIVE"
FT   gene            177924..178688
FT                   /locus_tag="HMPREF0424_0156"
FT   CDS_pept        177924..178688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0156"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13794"
FT                   /db_xref="GOA:D2RCZ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCZ3"
FT                   /protein_id="ADB13794.1"
FT                   /translation="MNNIVTTEHLTKKYKSFIAVNDVSLHIRKGSIYGFLGPNGAGKST
FT                   TMKMLLGLTAPTKGVFTIDGKQFPADRIPILKEIGSFIESPSFYANLTGRENLDIIRRI
FT                   LELPKSAVDDALELVGLSEFGDRLAKKYSLGMKQRLGLAGALLGRPPILILDEPTNGLD
FT                   PSGIHEIRNLIKSLPDLYDCTILISSHMLSEIELIADDIGILNHGHLLFEGSLDELRHH
FT                   ALQSGFASDNLEDMFLSMIDEDNKIRKQSARL"
FT   gene            178685..179410
FT                   /locus_tag="HMPREF0424_0157"
FT   CDS_pept        178685..179410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14497"
FT                   /db_xref="GOA:D2RCZ4"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCZ4"
FT                   /protein_id="ADB14497.1"
FT                   /translation="MKTLVIELKKCKRTGFIALMIAIGVMGAAYAFVNFIVRKNTLLNL
FT                   PLAPMDILLTQLYGMIMVLNMFGIIVAACIIYNMEFKGNAVKKMHMLPMSVPTMYLCKF
FT                   MLLTVLLLIAICIQNLALAKIGVTDLPQGTFNVSTLISFAAYSFITSMPVLSFMIFVSS
FT                   RFENMWVTLGIGVAGFLSGMALASSDIVLFMASPFIVMLKPAVAMSAQPNTTVVIVSIV
FT                   ETILFLCSGLWAAKKLHYE"
FT   gene            179424..180188
FT                   /locus_tag="HMPREF0424_0158"
FT   CDS_pept        179424..180188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14502"
FT                   /db_xref="GOA:D2RCZ5"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCZ5"
FT                   /protein_id="ADB14502.1"
FT                   /translation="MRFFELLKIEFTKVKRSKIVPLIFIAPLIVVGSGVASLHRYFTPE
FT                   YTHAWSAMFIQSALVYSYYLLPLSMIVICVMIAGRETSNNGILKMLALPVSRYAISAAK
FT                   FCVLLFYLLMEMVVFFAVFVIAGLFATSSTGVTETLPIMYLLKWCLDLFLTMIPSVIVM
FT                   WAITVLFEKSMLSVGLNILLVIPGVLIANTPLWIVYPYCYSGYMVSRSLHAVTSTGLGN
FT                   GFNLIPFLPCAIAISVFVFLIAITQFGKKEMR"
FT   gene            180292..180897
FT                   /locus_tag="HMPREF0424_0159"
FT   CDS_pept        180292..180897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0159"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13660"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCZ6"
FT                   /protein_id="ADB13660.1"
FT                   /translation="METNRTKTKKLSVLNAPSSKQNRKQHIQHSKPPHAQQTPTQIRDK
FT                   NVLASIRLMVDASPQLRSKKKLIEGFIAQLNENELDKLADSGGNITVYDSNGNKVSIVD
FT                   CWSEYVEQKYNHDLAQLVQSEGLNDALTRKFMEKSFSVGEVSELGTDINDLMPRMSRFG
FT                   AAAKARAEKKSRIVESMRNMFNEFVGLIGFSQYDSQKD"
FT   gene            181139..182857
FT                   /locus_tag="HMPREF0424_0160"
FT   CDS_pept        181139..182857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0160"
FT                   /product="iron permease FTR1 family"
FT                   /note="identified by match to protein family HMM PF03239"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14313"
FT                   /db_xref="GOA:D2RCZ7"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCZ7"
FT                   /protein_id="ADB14313.1"
FT                   /translation="MRACVKVRRIIRDSAALILAVCMLVGCIVSSFVTTIPAFATDADR
FT                   SYTSWTEVSKAIDNELLQGQSEYNSGNNSGAATRFEAAYNSVYVASNMITVVRDAIGQN
FT                   KVQAQTDQFQQLQTLVYQQNQGSQISAISTALAADVAQTASSLDANLKVDKPNVYAQKL
FT                   RAQIKAERKKLDAAKKKNLGRNGRTWGQVAREMNVILDKSVATYKFAKGNKTQVASAVD
FT                   LINEAYYQYYEKLGFEKNVMNAISGSRVSTVEYQFKECRQTMNNGGTIEQAKKFVTDLK
FT                   SMLIEDAAKLDKGASSSANPFMQFITSSFGQAFVILLREGLEALLVVAAIIAYLVKSGH
FT                   KNMVKYIYLGIAAGIVASLAVAALFGLLFNGSGPQQEITEGVVALFAMLMLLYTSNWMI
FT                   SRSSVQAWNKYISEQTTAAVSKGSLVSLALLSFLAVFREGAETVIFYQAIFAVSNGADS
FT                   MIWGGFISAAAVLVVIFLLIRFASVHIPIRPFFTGTSALMSVLVVIFAGGGVHALIEGD
FT                   ALEGMYIQGLPTNDWLGFYPYVETIVAQIVAAIVVISLLCVSIARSRVKRAVENK"
FT   gene            182953..183597
FT                   /locus_tag="HMPREF0424_0161"
FT   CDS_pept        182953..183597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14388"
FT                   /db_xref="InterPro:IPR018470"
FT                   /db_xref="InterPro:IPR038482"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCZ8"
FT                   /protein_id="ADB14388.1"
FT                   /translation="MKNNKMMAIAALALAGLLALAGCGSNGNSAKTDAKSQATEQKADD
FT                   KADDKGGDKGFEEVPVGPHQDQNIGPLTIGAVYFQPVDMVPAGMGLKASEASFHLEADI
FT                   HANQKGTKLGYGKGEFIPDLTVNYEIVDKASGESVGKGTFMQMNASDGPHYGANVKLDK
FT                   AGNYKLVLSIESPEKKGWMLHVDPATGVTGRFWTEPIKATFDDWKYTPRQW"
FT   gene            183670..184941
FT                   /locus_tag="HMPREF0424_0162"
FT   CDS_pept        183670..184941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13510"
FT                   /db_xref="GOA:D2RCZ9"
FT                   /db_xref="InterPro:IPR018758"
FT                   /db_xref="UniProtKB/TrEMBL:D2RCZ9"
FT                   /protein_id="ADB13510.1"
FT                   /translation="MLRLFVAVMPGLLPLALLTMGLSTSLTVGEGRDKPLSARWRLYGL
FT                   SAGTVAALIFAILRASVVINQRNFINMPALCIAVPLDIAAIIVVIFSHKIIKNWRNCPL
FT                   LMHISNAIGACCLAFTVFYALPDVILQLTIFVDSSTPPFTSDMLLRALGFVLGVIAAIC
FT                   LSLMVRSLRTTSNAICFKIAVVLSMIILLVQHITSLLQIMQGSILLYMDDFSFSVLVWL
FT                   INNAPLMIMAQISVFMIPAAASVIIGFKTAVVGENAAEIRTKRAFKRKSRKSALAALLA
FT                   AITVILTLTVGVSIMNIKPTLTPPEPYELHDGVATINYVQVSDGHLHRFQYKAKDGTIM
FT                   RFIIIKKNGGAYGVGLDACENCGDAGYYEKDGKIICRKCDVAINLATIGFKGGCNPIPF
FT                   PYKAGHGKITIHTADLDVLSSHFK"
FT   gene            184954..186288
FT                   /locus_tag="HMPREF0424_0163"
FT   CDS_pept        184954..186288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0163"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14208"
FT                   /db_xref="GOA:D2RD00"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD00"
FT                   /protein_id="ADB14208.1"
FT                   /translation="MFMMRMVARSLVRQLKKRVLIALVVCLSACVSVSMLSVVYDVGDK
FT                   INAELSSYGSNIVVQPKSSAVVNDLYASREQIDTNGSESLKAAESHESTASLKESDAAK
FT                   IKMIFWAFNITNFAPKIIVHANLEAKSSGDLVVPIIGTWFNRKLALASGETTVVGVRGL
FT                   RSWWKINAGRWAKDNKSEAMVGAQLAERLHLKLGQRLRLIRDGREVSLRLVGVYDSGDD
FT                   DNNAIYAGSSDAQGLANKPNKVDSIEVKALTTPENDLARKAAKNPAALSQEEWETWYCT
FT                   AYPSSITYQIEEVIPGAVAKQVRQVAALQGNVLNKTRAVMVLMTALSLIAAAVAVANLM
FT                   AASISERSGELALLKALGARDGAVARLMLMETAVIAFGGTLLGMALGFAVAQIIGFTVF
FT                   GSSILFRPMVFVLVFVLLALTVLAAAGSSIRSILSVRPAEVLHGR"
FT   gene            186278..187645
FT                   /locus_tag="HMPREF0424_0164"
FT   CDS_pept        186278..187645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0164"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13581"
FT                   /db_xref="GOA:D2RD01"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD01"
FT                   /protein_id="ADB13581.1"
FT                   /translation="MAGKSYMTSNNSMFITMLFSAVFRRKSRALMAVIATLVGAATLFC
FT                   LAAICLVVPQQMSDEMRAYGANIIVTPIEGEWKNGIDRAMVLHTNDMVLAKGAMRSATY
FT                   RYENVRINAAPYVLAGIDVRSVKSLNKHWNVDGSWPSSGNVMVGRDVALAMGLKIGSRI
FT                   AIAYRSSDNTAGSHKPAEKSANKSANKSTSESANKSTNQSADKPAENQAQNSSANSSDQ
FT                   SAQNSSQQKLVEGRVSTDIMDTHGTTFRVCGILDTGGAEDSMLYALNADVNSLTGVKRG
FT                   ADVIAYSSSSPSVDAVVRSINDMTSMRVRAQQVTKVTAADTGIITMLRSLFCIVSLVVL
FT                   VLMMVGVSTTISSIVQQRRNEIGLRKALGASARSIGVEFTAEAGVYGFVGSIAGTAVGY
FT                   VFARLLAAMVFSRDLGVNWWLVVFSIVFSVAASCVAALPPVLRASKIDPAIVLREE"
FT   gene            187686..188531
FT                   /locus_tag="HMPREF0424_0165"
FT   CDS_pept        187686..188531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0165"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14098"
FT                   /db_xref="GOA:D2RD02"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD02"
FT                   /protein_id="ADB14098.1"
FT                   /translation="MTENIENKLDSAESKPKMLLTLDHISKIYGSLRAVDDLSLTVPEG
FT                   EWLSIVGSSGSGKTTLMNIIGCMDSPSKGSVSLQGRKLEDLNAGQLADVRKNVIGLVFQ
FT                   KFYLVPHLTAVENVMVAQYYHSVVDEAQAMDALDRVGLKDRAHHLPSQLSGGEQQRVCV
FT                   ARALINCPKLLLADEPTGNLDEKNEQIVLDLFKQLHNQGTTIIVVTHDSLVAQCADREI
FT                   MLNHGVLVGERWNNEDARKAYEAIGGKPAFTSAHVDESVVEALQDHEPTKSPKLANLDD
FT                   "
FT   gene            188577..189176
FT                   /locus_tag="HMPREF0424_0166"
FT   CDS_pept        188577..189176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14687"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD03"
FT                   /protein_id="ADB14687.1"
FT                   /translation="MVSDNMFHDVSRDDLKSKKVTKTVAALAIVAASSAMFSACGEPSA
FT                   VPMNDEFAGNSGQSADDGGNPSGKYDAGAQQSKSSAQSEDSQNQQNQPKTDTGNYKDGD
FT                   YKVKATYGPVAEDSFDVRLSVANGDVSDVQMTPHPFTPISRGHMDAFSKDIPGKIVGKP
FT                   LKDLHISVVAGASWTSDAFNKALDVARQEASIQSAK"
FT   gene            complement(189189..189425)
FT                   /locus_tag="HMPREF0424_0167"
FT   CDS_pept        complement(189189..189425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0167"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14216"
FT                   /db_xref="GOA:D2RD04"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD04"
FT                   /protein_id="ADB14216.1"
FT                   /translation="MSKDSIKVIKKTLIWILKWALFTAVEFLLLYVAIISWNHDFAQFM
FT                   DEYSDAIIPFMAATGAMAATMIRDEGTILEVKD"
FT   gene            complement(189608..190111)
FT                   /locus_tag="HMPREF0424_0168"
FT   CDS_pept        complement(189608..190111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0168"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14539"
FT                   /db_xref="GOA:D2RD05"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD05"
FT                   /protein_id="ADB14539.1"
FT                   /translation="MTKRLVVLHSAEVAAMALASTAAFMRSFGFFVLWLVLGLLSVALY
FT                   SYAYFFLRKSVIKAKNAYIGNNISNLNGAGANSISSDVENIENNKDYITTLEQKRKKVE
FT                   SQNKQILSNYLNNLTNIISCFICGLIHVPWIYYYGIANGVLTLVILWRVIKRPQGHPID
FT                   ESDL"
FT   gene            190305..191045
FT                   /locus_tag="HMPREF0424_0169"
FT   CDS_pept        190305..191045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0169"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13842"
FT                   /db_xref="GOA:D2RD06"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD06"
FT                   /protein_id="ADB13842.1"
FT                   /translation="MQKTYAIVDNDPLVLAVMRNVLSKLLPSEYVCKWCVKSGVQALKY
FT                   CQVTKTTPDYILIDMSMKDMSGVEVIRAIREKNNNIILIGMTSYDCRSYASSVAQVGGQ
FT                   AMVAKDNFKGLAEALQYCDNQKVYGCRCVRDVAYDFATPQESFIRLSKSRSRSVLPPQE
FT                   LKIMDLLSKGCTTNQIAAQLGLMPNTINTHIHRIYKKLHVSNRVQAISAFAAMQNREQT
FT                   SNLQYFNNSLQNHPNPSQETDNAC"
FT   gene            191039..192256
FT                   /locus_tag="HMPREF0424_0170"
FT   CDS_pept        191039..192256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0170"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14326"
FT                   /db_xref="GOA:D2RD07"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD07"
FT                   /protein_id="ADB14326.1"
FT                   /translation="MLMKTFSRVIELVKSWKIQRTLFIILAILVVSMDVQSCNTAGLWH
FT                   NPQQSACQYVWMFAIFLLIAFPRQVSLVTPILYCVTLAVPGVNATCVLFALIASMFVAG
FT                   FYDSWKYLLCAYIVSLNIMYFAKIAYISLTFPCFILISMICGYVLRKYLNMLEENNRAK
FT                   MDIVRSKFQSYIASVALQLHDDVNNEITDITLLATDALYAKNNEHTKESLEQIIEHSRN
FT                   ALSKARLVISLLEQTEQKYDDSLDSNIASTQFVYSSNSNDCMNLADFLCNIRARLQAER
FT                   QICEQLGYYGSLTVVDKSSGSGDFAASATVSTEKAQCAIRMCSELLTNIRKHCSTSVDF
FT                   SMNVTVDERECKIMCMNSLSNKFGGRLVFGKGLLFHKKSVERLGGSLNAQKDDDAWLVN
FT                   VVIPLN"
FT   gene            complement(192295..192555)
FT                   /locus_tag="HMPREF0424_0171"
FT   CDS_pept        complement(192295..192555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0171"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13761"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD08"
FT                   /protein_id="ADB13761.1"
FT                   /translation="MSQDFGVKNWNPSAAANISNDDDNLSEEDFDKLAAELEQFFTKYV
FT                   VLENNKFVVHDDAIIADGYEEYLEGFHILAEKFTAGLEEDR"
FT   gene            complement(192745..192957)
FT                   /locus_tag="HMPREF0424_0172"
FT   CDS_pept        complement(192745..192957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14014"
FT                   /db_xref="GOA:D2RD09"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD09"
FT                   /protein_id="ADB14014.1"
FT                   /translation="MKKQILAYFKRLIKREATYMPLTFIGLLGIFAIFSGNTIAYISSP
FT                   NRWIETFVFTLIVAFARAFIPDNRY"
FT   gene            193519..193647
FT                   /locus_tag="HMPREF0424_0173"
FT   CDS_pept        193519..193647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0173"
FT                   /product="putative addiction module killer protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14550"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD10"
FT                   /protein_id="ADB14550.1"
FT                   /translation="MYFAQKGLKLMLLLAGGDKSSQSKDIKQAKILLAQLIEEKKW"
FT   gene            193641..193928
FT                   /locus_tag="HMPREF0424_0174"
FT   CDS_pept        193641..193928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0174"
FT                   /product="putative addiction module antidote protein"
FT                   /note="identified by match to protein family HMM TIGR02684"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14006"
FT                   /db_xref="GOA:D2RD11"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD11"
FT                   /protein_id="ADB14006.1"
FT                   /translation="MVNISKWDASEYLEDDDDVIAYLNAAAELNDPRLLQAAIGDIAKA
FT                   RGMKEIAQKAEVGRESLYKSLRRDGNPSFQTIAKVVRALGGRIAIEPANA"
FT   gene            complement(194140..194724)
FT                   /locus_tag="HMPREF0424_0175"
FT   CDS_pept        complement(194140..194724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14329"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD12"
FT                   /protein_id="ADB14329.1"
FT                   /translation="MTYKKLLCVVVLFSSLVGLAACGNSEANKPVPTKISRHSTKKHSK
FT                   PIKKASKKKIAEAFVKGQEGTLEALGETKRVIWDAYPDQLAYVKDAFYHWTLQDDWFQV
FT                   NTGHYMVVDRLNSSGILLKKLQKGMPVKLNGKDYKVADYKDFEGGGSSDKLLKVFKEYV
FT                   EQFPKSAYFIQTCLDARTYGGQRLVVLDVAK"
FT   gene            complement(195105..196184)
FT                   /locus_tag="HMPREF0424_0176"
FT   CDS_pept        complement(195105..196184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0176"
FT                   /product="ribonucleoside-diphosphate reductase, beta
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="identified by match to protein family HMM PF00268"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13903"
FT                   /db_xref="GOA:D2RD13"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD13"
FT                   /protein_id="ADB13903.1"
FT                   /translation="MTELSPTELRSSLDKPFGTNRVIADDAMMAASITPSQYRYHHGSR
FT                   VRPVNWNNIVDDKDLDVWNRLIANFWLPEKVPLSNDIPSWRSLTDLERKTTTRVFTGLT
FT                   LLDTSQATIGELCQIEHARTEHEQAIYTNIAFMQSIHARSYSSIFSTLCSSEEIDEAYR
FT                   WAVGNDVLQQRVTTVLCEYESEDPLKRKIAATMLSSLLLYAGFYLPLYFASRGKMMNTA
FT                   DMIRLILRDKAIHGYYSGYKFQRGLELRSENDKKNLEKFTMNLLDTLYDLEVEYSGQIY
FT                   EGFDFHDDVFDFVRYNANKALMNLGYPAKYSEEETHVSPEILAALSPAADENHDFFSGS
FT                   GSSYIMGKSVETDDDDWDF"
FT   gene            complement(196267..198492)
FT                   /locus_tag="HMPREF0424_0177"
FT   CDS_pept        complement(196267..198492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0177"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="identified by match to protein family HMM PF00317;
FT                   match to protein family HMM PF02867; match to protein
FT                   family HMM PF08343; match to protein family HMM TIGR02506"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14125"
FT                   /db_xref="GOA:D2RD14"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD14"
FT                   /protein_id="ADB14125.1"
FT                   /translation="MNSTDPMSESTSLNLDHTDSASATASTTAERIRNSRDYHVLNAML
FT                   GLFDPEKGIQFDKDQEAEKLYVSGYVQEHSMKFASTRERLNYLIDNYYYNGNVFNKYSD
FT                   EFLDKFYEHAEAAHHTFGTFLGAFKFYTSYALKTFDGKQYLENFAQRAAAVALELADGD
FT                   EKAATNYLDEMLAGRFQPATPTFLNLGKAQRGEAVSCFLVRLEDNMESIARGINSALQL
FT                   SKRGGGVALLLTNLRELGAPIKRIENQSSGVVPVMKLLEDSFSYANQLGARQGAGAVYI
FT                   SAHHPDIMRFLDAKRENADEKIRIKSLSLGVVIPDITFELAKRKEKMALFSPYDVEREY
FT                   GKPFADISVTEHYDEMVANPRIHKKYIDAREFFMTIAEIQFESGYPYILFEDTVNRTNP
FT                   IEGRITMSNLCSEILQTQEASTYNADLSYSHVGRDISCNLGSLNIAKAMDGDLGTSVDL
FT                   AVRALTSVSEHTSIDSVPSIRRGNAEGHAIGLGQMNLHGFLAREHMQYGSEEALDFTDM
FT                   YFMTVAYHAYKASHALAVERGHAFANFKTSAYAKPAGKGNYFDKYTDGSRSLEPKTQKV
FT                   RDLFARFNVAIPTVSDWEQLRDEILSDGIYNEYLQAVPPTGSISYINHSTSSIHPIASR
FT                   IEIRKEGKVGRVYYPAAYMTNDNMQYFKDAYEIGWKAIIDTYAEATQHVDQGLSLTLFF
FT                   PDTTTTRDLNKAQIYAWRKGIKTLYYIRIRQKALEGTEIEGCVSCTL"
FT   gene            complement(198578..199078)
FT                   /gene="nrdI"
FT                   /locus_tag="HMPREF0424_0178"
FT   CDS_pept        complement(198578..199078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdI"
FT                   /locus_tag="HMPREF0424_0178"
FT                   /product="nrdI protein"
FT                   /note="identified by match to protein family HMM PF07972;
FT                   match to protein family HMM TIGR00333"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13563"
FT                   /db_xref="GOA:D2RD15"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD15"
FT                   /protein_id="ADB13563.1"
FT                   /translation="MCEQENITQQSEPESSAQGESIGAVVYFSSVSENTLRFVQNCDFP
FT                   SNNVNVYRIPLRPKEPELNVREPYVLIVPTYGGGNIAKAIPMQVRKFLNNRENRSFIRG
FT                   VISSGNTNFGEAYCAAGDQIAGKCGIPNMYSFELTGTAEDIEKVAQGIPRFLKQLKETE
FT                   ETK"
FT   gene            complement(199082..199342)
FT                   /locus_tag="HMPREF0424_0179"
FT   CDS_pept        complement(199082..199342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0179"
FT                   /product="glutaredoxin"
FT                   /note="identified by match to protein family HMM PF00462;
FT                   match to protein family HMM TIGR02194"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14266"
FT                   /db_xref="GOA:D2RD16"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011909"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD16"
FT                   /protein_id="ADB14266.1"
FT                   /translation="MTITVFTKPHCPQCDATKRQFTKLGVNFETVDLSKSPESLEQLKN
FT                   AGYRQAPVVIAPDASWSGYRPDLIAQIADKLGTSAEAAKEA"
FT   gene            199768..201222
FT                   /gene="gnd"
FT                   /locus_tag="HMPREF0424_0180"
FT   CDS_pept        199768..201222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="HMPREF0424_0180"
FT                   /product="phosphogluconate dehydrogenase (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="identified by match to protein family HMM PF00393;
FT                   match to protein family HMM PF03446; match to protein
FT                   family HMM TIGR00873"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13913"
FT                   /db_xref="GOA:D2RD17"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD17"
FT                   /protein_id="ADB13913.1"
FT                   /translation="MTQAQANIGVVGLAAMGSNLARNLAHHGNTVAVYNRHYSRTETLM
FT                   NEHGSEGAFVPSKTVEEFVASLKRPRTAIIMVKAGAPTDAVIEELANAMEPGDIIVDGG
FT                   NSYFEDTIRRERDIRARGLHYVGCGVSGGEEGALRGPSMMPGGTEESWKTLGPILKSIA
FT                   AVAEGEPCVTHIGTDGAGHFVKMVHNGIEYSDMQLIAESYDLMLRGLGMKSDEIADVFS
FT                   EWNKGELDSYLIEITADVLRQKDAKTGKPLVEMMVDHAGMKGTGTWTVQSALSLGIPVT
FT                   GIAEAVFARGLSSQVALREAAESQGLTGPDVHFDLNDAERKAFIEDIRQALYASKIVSY
FT                   AQGFDEIAAAAIEHDWKIDQAAVARIWRGGCIIRAQFLNRVSEAFESGEASVSLLFAPY
FT                   FKAAIEKSQAAWRRVIARAVEHGVPVPAFSSLLAYYDGLRSKRLPASLIQAQRDFFGAH
FT                   TYGRIDEPGVFHTLWADPNRPEVKQD"
FT   gene            complement(201312..202649)
FT                   /locus_tag="HMPREF0424_0181"
FT   CDS_pept        complement(201312..202649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14392"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD18"
FT                   /protein_id="ADB14392.1"
FT                   /translation="MFDRKIYKEMLKWKHEYAPNYALFLKGARRVGKTTLAEKLGKEEY
FT                   KSYILIRFDQTEEDIKQLFINSLRDLDTLFNTIQLAYNTRLYKRESLIILDEIQLFPQA
FT                   RQAIKTLLEDARYDYIETGSLASITKKSKDILIPSEEYTLEVLPLDYEEYSLANNNNMI
FT                   FPTIKDHFESLKPMGSMHQSIMKSFREYMLVGGMPQAVQAYVDTKDFAKVDFAKQQIIN
FT                   LYKQDMQDQEEENPSYVTNFFDRIPAELSKHDKRYMLSHVDSNARIKEYRDPIRWLEEA
FT                   MIVNIANSVEDPSVALNLSTINPSFKCYMMDTGLLTSLAYKDKPYLENELYKAILLDKL
FT                   HINEGMIIENIVSQCLKANGHNAYFYKKTNTNTKKTVMEIDFLLRKNNKIIPIEVKSGS
FT                   SKNVKSITNFMEAFSKTSSEGIVLHHGEIKREGKLLYLPYYMASVL"
FT   gene            complement(202697..202879)
FT                   /locus_tag="HMPREF0424_0182"
FT   CDS_pept        complement(202697..202879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13714"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD19"
FT                   /protein_id="ADB13714.1"
FT                   /translation="MRYTNWRKCENSVFKTWRIWENRPLKTWRIWENLLDKICRIWENL
FT                   YKTVEITRKTALGNT"
FT   gene            complement(202930..203754)
FT                   /gene="pgl"
FT                   /locus_tag="HMPREF0424_0183"
FT   CDS_pept        complement(202930..203754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgl"
FT                   /locus_tag="HMPREF0424_0183"
FT                   /product="6-phosphogluconolactonase"
FT                   /EC_number="3.1.1.31"
FT                   /note="identified by match to protein family HMM TIGR01198"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14147"
FT                   /db_xref="GOA:D2RD20"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD20"
FT                   /protein_id="ADB14147.1"
FT                   /translation="MTNNEVTFAHNASIYGYDNRDVLAAVAAQRLVTLIMESQNDVQNL
FT                   NKPFHLLLTGGTDSIRMFQMLASNPLLPAINWNLVHIWWADERFVAYDSEDRNARKARE
FT                   MFLNLLTSNKALAESHIHEMPADERNAEEIAAASDAENDAILDAAARDYEEEIVSILGK
FT                   EPVFDLAILGMGPDAHMASLFPGLPQVNNRDRIVVGVNHSPKLPPMRLTLTVPVLAHSH
FT                   CTWFLTAGAEKGAALMNSLSGANNPEYPASFANGTDEISWLTTAETLQAAIE"
FT   gene            complement(203809..204750)
FT                   /locus_tag="HMPREF0424_0184"
FT   CDS_pept        complement(203809..204750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0184"
FT                   /product="putative opcA protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13552"
FT                   /db_xref="InterPro:IPR004555"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD21"
FT                   /protein_id="ADB13552.1"
FT                   /translation="MIINLPDTNTSKIAAKIDELHEERGESATGRVLTLLIDTTLKELE
FT                   HALDAANAASREHPCRVIAMVRDWSSEHAAERGEVVPNLDAQVRFGADAGAGEIIILYP
FT                   HNGLVRHPDTLVIPLLVPDAPIVAWWPTNAPEDPAHDLLGAMASSRITDAQRADDTLKT
FT                   VQNLRKNWSPQDADLSWTRLTPWRALLASMLDQPPHLPILSAKIVGPTHYVSLHLLAAW
FT                   LKSSLHVPVEIVENPEAQAITSVTLEREDGTLSLTRPAGGDQALISLPGQAAQPIALPI
FT                   RTLDDCLSEELRRIDPDEIYAQLVRDNPAENA"
FT   gene            complement(204747..206327)
FT                   /gene="zwf"
FT                   /locus_tag="HMPREF0424_0185"
FT   CDS_pept        complement(204747..206327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="HMPREF0424_0185"
FT                   /product="glucose-6-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="identified by match to protein family HMM PF00479;
FT                   match to protein family HMM PF02781; match to protein
FT                   family HMM TIGR00871"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14094"
FT                   /db_xref="GOA:D2RD22"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD22"
FT                   /protein_id="ADB14094.1"
FT                   /translation="MTELRTLRDSQDAGESVSTWTNPLRDPRDLRLARIAGPCSLVIFG
FT                   ITGDLARKKLMPAVYDLANRGLLPPGFGLTGFARRDWTDEHFVNFVRENIEQHCRTPFR
FT                   ESTWINLAKGIRFVRGTFDDASAFERLSKTVNELDRDRGTRGNHAFYMSIPPSSFPVVA
FT                   QQLAASGLSHSSEHAWRRVIIEKPFGHDLASARELDRVVSEVFDPNSVFRIDHYLGKET
FT                   VQNLLAFRFANAMYEPIWNANYVDHVQITMAEDIGIGGRAGYYDGIGAARDVIQNHLLQ
FT                   LMALTAMEEPVSFRASDLTAEKTKVLSAIRLPQDLAANTARGQYAAGWQGSYKAVGYLE
FT                   EQGIDPQSTTETYAAVRLDVDTRRWAGVPFYLRTGKRLGKRVTEIAVIFKRAPHLPFES
FT                   TAVRELGSNAIVIRVQPDEGVTMRFGAKVPGGTAMEVRDVSMDFSYGRSFTESSPEAYE
FT                   RLILDVLLGEPPLFPTTQEVDLSWKILDPIEEFWSSLGTQPQPYRAGTWGPAEADAMLA
FT                   RDNRHWRLP"
FT   gene            complement(206431..208851)
FT                   /locus_tag="HMPREF0424_0186"
FT   CDS_pept        complement(206431..208851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0186"
FT                   /product="acyltransferase"
FT                   /note="identified by match to protein family HMM PF01757"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14671"
FT                   /db_xref="GOA:D2RD23"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD23"
FT                   /protein_id="ADB14671.1"
FT                   /translation="MNTSTASQAGQSFKTKKVPAEKNASKTTSTNLSTNSNNTVEKTIN
FT                   SAKAENKQSSTLPTNTVSKRNKAIDGLRALAIIGIVCFHMRPSLLMGGFLGVTLFLVLA
FT                   GYFCTRSVLRYLNADENAKNAKNIEDNNKNTQGIRHYWEYLLKRVKRIWPPTLGIIAIT
FT                   APIMWLFSPSLLPKLQADALSGSGFFSNIMYVARKLSYFEQSGLPSPIKHLWYLGLLMQ
FT                   AFVIWPIILAALIKFVRSKLIRMYITAGLAILSSILTFTFAYLFNNYTTPARVYYSLDT
FT                   RASEFLMGAMLAMYGAWFAKHSFHAWLIHALHLLMGKKNISVSLASSVKLDSNADSSVD
FT                   NSALTKKSDKAYANNEKVFAEDGIPADLREGLQIDLSDNSVAPDIQELPNNAFNKPKTV
FT                   FYNPLHAWQRSCIGLLATIVLCYCFVYAEGTSSVFVFGGYTITAAACTLILWSCTQTDN
FT                   ICSRIFAWAPLAYIGRRSFAIYLVHFPVLELFNPANRTTAVSTGEQVLQALVIVALAEC
FT                   LYQLFEKPIQDQQLFKLIRSVSLTLCCIIIVSLIILPVNWQDIAKHRSMQLRPELTAQV
FT                   EQSSSSNKKPTAFDKTNSKQETKEKAVPKGVQKNVVKQSLPPTPSKYRILFPIAEKVPR
FT                   NLVTTHTRIDKRRNTCSVNLTMVGDSITEGAKPYLMQVMPNAYIDGKVSRQIFHGADEY
FT                   EKDISVKHAGDVVIFALGTNGPPHDDSVLQHMVDVAKGRPVYFVTTRVPQPWQDATNDS
FT                   LRKFAATHHNVGIIDWHGLSNGHSEYLTDDGVHLTPIGGPQYAKMIRLAVCGG"
FT   gene            209173..209667
FT                   /gene="ppa"
FT                   /locus_tag="HMPREF0424_0187"
FT   CDS_pept        209173..209667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="HMPREF0424_0187"
FT                   /product="inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="identified by match to protein family HMM PF00719"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13963"
FT                   /db_xref="GOA:D2RD24"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD24"
FT                   /protein_id="ADB13963.1"
FT                   /translation="MAETFNVVVEIPRGSKNKYEVDHETGRVFLDRTLFTAMGYPDDYG
FT                   YIDGTLGEDGDPLDALVMIPNSVFPGCVVECRAVGLYHMVDEAGGDDKVLCVPADVRFD
FT                   DIKDIDDVNEYHKAEIKHFFEQYKALEPGKEVLPGDFWAGVEQAEKEIVAARKRLEESE
FT                   K"
FT   gene            complement(209817..210608)
FT                   /locus_tag="HMPREF0424_0188"
FT   CDS_pept        complement(209817..210608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14508"
FT                   /db_xref="GOA:D2RD25"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD25"
FT                   /protein_id="ADB14508.1"
FT                   /translation="MSNETRICNDKMQKNDNSCVNVQKHTRIPSMNALAMFVSQIFVVV
FT                   LLAIAAILPIATAKITLILCLIIMLTFIALWPLHGNVIDRAIALCAGIASTWFATGVLK
FT                   GWLPKSVIIDNETVSMSKFIAAIHPYERWAVSFALILVAATFVTFLRQMLRENRTNLVR
FT                   NLSHTLTASIACAALPGWLFLPSIISFMPSLRNLDGGILVIVLCIFMLIALSGLSYLWV
FT                   RNNYEEYETGIVSHDIAISILPIMLSGILVYIAGLGMLVAA"
FT   gene            210750..211640
FT                   /locus_tag="HMPREF0424_0189"
FT   CDS_pept        210750..211640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0189"
FT                   /product="transcriptional regulatory protein, C-terminal
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13715"
FT                   /db_xref="GOA:D2RD26"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD26"
FT                   /protein_id="ADB13715.1"
FT                   /translation="MQVLRLSLFFAVWFTIPVKAEFATTSIVCWRHHMTDITLMTSCAS
FT                   PSSVLPSLTLLSHKVRLLSLDTSSLAKLPAQTILLLDAREDLALAKSMCSSLRVANITV
FT                   PVILVITEGGFTVVNPSWNISDVVLTNASPAEVEGRLRLASLQHGSSDDLFVHSQGSEI
FT                   DDSFNSDNGTMRSGDLVVDMRSYTVSLHGHPVDLAYKEFELLKYFVQHPRRVFTRTHLL
FT                   QEVWGYDYYGGTRTVDVHIRRLRAKLGVEYEHLIGTVRNVGYRFDPSESDENSEISESS
FT                   IEDDSENDADKQSAQ"
FT   gene            211640..212314
FT                   /gene="nth"
FT                   /locus_tag="HMPREF0424_0190"
FT   CDS_pept        211640..212314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="HMPREF0424_0190"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730; match to protein
FT                   family HMM TIGR01083"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14570"
FT                   /db_xref="GOA:D2RD27"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD27"
FT                   /protein_id="ADB14570.1"
FT                   /translation="MIYQSSNMRESKQAKLARIYAEYDLLCKEIPEPKCALNFKNPFEL
FT                   LIATVLSAQTTDKRVNIVTPELFSIFPNASSLAAAPVSQVESIIYPLGFYRVKAQNIIS
FT                   LSACLLNNFSGIVPSNMEALISLPGVGRKTANVVLGNAFGLPGFPVDTHVIRVTGRLGW
FT                   RKVQNRPNPVAIEREITAYFAPKEWTNLSHRLILHGRKICTARNPKCVSCPLNTTCPSA
FT                   II"
FT   gene            212445..213932
FT                   /locus_tag="HMPREF0424_0191"
FT   CDS_pept        212445..213932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0191"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   family 5"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13985"
FT                   /db_xref="GOA:D2RD28"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD28"
FT                   /protein_id="ADB13985.1"
FT                   /translation="MVVSVIMSGILWCGWQMYQGHSPFAAIMHPASNSVLKVGLRTAPE
FT                   SLDIRNDDSDALQQALIGNVYETLVKRGDDNSLQPGLAKSWDISKDGLTYRFNLRQGVH
FT                   FSNGSEMTSNSVLQSLKQGITNNYPGYSALTNIKTVNNPDDYTLVITLNNPDALLLRRL
FT                   AGRVGIVYDTKSMIDYASAALGTGPFTVSDYNKGNSLVLLRNDKYWGTPASCASITLQY
FT                   FNSDTALAEAMEKGNIQMAVPLEGNENKRLAAVANTQMVEGQSTRVRFIAINTTVSSIF
FT                   CDEQARKAARYALNAQTVLAADGNGGVPVGGPIDPLSTGYEDLNGLYPYNPGKAAPLFH
FT                   YFSASYLGTINFLVPQGEGGVGGELSKQISSVSGFKVNLEEVDQQTMRKRISEGKYDLA
FT                   LTTSNRTLDEGMFAESGSPFVLQDARAQQAWTDAVHSKNANEYETNARAYAREVSNNAA
FT                   AHWLYARKSIMAVKSNVSGYTKNMTDQLLPLQSIVVK"
FT   gene            213981..216758
FT                   /gene="valS"
FT                   /locus_tag="HMPREF0424_0192"
FT   CDS_pept        213981..216758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="HMPREF0424_0192"
FT                   /product="valine--tRNA ligase"
FT                   /EC_number="6.1.1.9"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF08264; match to protein
FT                   family HMM PF09334"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14537"
FT                   /db_xref="GOA:D2RD29"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022874"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD29"
FT                   /protein_id="ADB14537.1"
FT                   /translation="MSEQDNNAVKHAYLTPLPNKVGVDGLEDKWRSNWDEAKTYAFHNS
FT                   RDRKAVYSIDTPPPTVSGHLHVGHVFSYTHTDVIARYKRMQGFDVFYPMGWDDNGLPTE
FT                   RRVQNYYGVRVDTSLKYDPDFKPPFEGTEGKKIEAKDQVPVSRQNFIELCERLTSQDEK
FT                   LFEALWRRLGLSVDWSQTYHTIGEQPRRVAQKAFLRNLARGEAYQKDAPGLWDVTFQTA
FT                   VAQAELESREYPGFYHKIAFRFEDGTPIYIETTRPELLAACTSLIANPEDERYKKYFGQ
FT                   EVYSPLFKVKVPILAHSAAQMDKGAGIAMCCTFGDVTDVEWWRDLNLPTRPIIQRNGRI
FT                   VMTTPDWITDESGREMFEKIAGKTTFSARKEIVEALQAAGDMEGEPKPTKRMTNFYEKG
FT                   DKPLEIVTSRQWYLKNGGTDEKLNAELIERGKELNFHPDFMRVRYENWVHGLNGDWLIS
FT                   RQRFFGVPFPLWYPVNENGEVDYEHPLTPSEDRLPIDPTIDVPEGFDESQRDQPNGFTA
FT                   EQDIMDTWATSSLTPQIVTRWEEPGEENQALFKATFPMDLRPQGQDIIRTWLFSTVDRA
FT                   HLENGCLPWKHAALSGWILDPDHKKMSKSKGNVVVPNKPIEEFGADAVRYWATSAKLGL
FT                   DATYDEGQMKIGRRLAIKLLNATKFALAIGREDDEHQVLESASADWDFADVTEVLDRSV
FT                   MAKLASVIRTATDALESYEHSKALEAIETFFWEFCDDYIELAKNRAYGTAESTGRTPSE
FT                   AAVKSARTTLGLALDALARLLAPYLPYATEEVWSWMHDGEGSVHRASWPCAKAYESAAN
FT                   GVSADTLAYAGEALATLRKIKSEAKVSMKTPILQVTLNVAENAYKAVEETLDDVAEAGR
FT                   VTGEVKLNAVKAAVAGDSSASESESASDSAESDAANVNVSVAQSELGEAPAKKK"
FT   gene            complement(216854..217120)
FT                   /locus_tag="HMPREF0424_0193"
FT   CDS_pept        complement(216854..217120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0193"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="identified by match to protein family HMM PF05016;
FT                   match to protein family HMM TIGR02385"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13895"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD30"
FT                   /protein_id="ADB13895.1"
FT                   /translation="MIWKINLSKRAEKQLGKIDKTIAKQIVKELREISNLDNPRIRGKA
FT                   LTGNYSGFWRYRVRDYRIICAIENNVLTVFVVDIDHRSRIYNK"
FT   gene            complement(217104..217454)
FT                   /locus_tag="HMPREF0424_0194"
FT   CDS_pept        complement(217104..217454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14283"
FT                   /db_xref="GOA:D2RD31"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD31"
FT                   /protein_id="ADB14283.1"
FT                   /translation="MVYSLALPRDASRLQPIGLHYSECKVIYVLHVLHWRLKMVATITG
FT                   LRVPSNVLDRYDQLAKTTHRTRSFYMNQALEAQIDELEHEYGLMADIEAYKRGELETSP
FT                   LDDVVKRLDLED"
FT   gene            217453..219249
FT                   /gene="argS"
FT                   /locus_tag="HMPREF0424_0195"
FT   CDS_pept        217453..219249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="HMPREF0424_0195"
FT                   /product="arginine--tRNA ligase"
FT                   /EC_number="6.1.1.19"
FT                   /note="identified by match to protein family HMM PF00750;
FT                   match to protein family HMM PF03485; match to protein
FT                   family HMM PF05746; match to protein family HMM TIGR00456"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13757"
FT                   /db_xref="GOA:D2RD32"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD32"
FT                   /protein_id="ADB13757.1"
FT                   /translation="MNPESLSELIEKIAKDLVASGKAGNLTEDLIPAAEKLAVMRPKDR
FT                   AHGDWATNVAMQLAKKAGMKPRDLAELFAERLQEAEGIARVEVAGPGFINITLDSASAA
FT                   AVVDEVLKQGAAFGKNTHLSGKTLNLEFVSANPTGPIHIGGTRWAAVGDSMARVLEANG
FT                   AKVVREYYFNDHGEQINRFAKSLVAAAHGEETPADGYKGAYINEIADSVIKEANADGVD
FT                   VLSLPRIDLGKDEEGLPLGEGDSEQREEFRKRAVPMMFAEIRKSMRDFRVSFDVWFHEN
FT                   SLYEDGEVERAIADLRERGDIFEKDGATWFESTKHGDDKDRVIIKSDGNYAYFAADIAY
FT                   YRNKRHREQNPADVAIYMLGADHHGYIGRMMAMCAAFGDKPGENMQILIGQLVNVMKDG
FT                   KPVRMSKRAGNVITIDDLVDAIGVDASRYSLARTDYNTSVDIDLDLLASHSNDNPVYYV
FT                   QYAHARSCNVARNAADAGITQDGADLSLLNTETDGEVLAALAQWPAALAQAGDLRAPHR
FT                   VAHYLEDLAASYHKWYNLERVVPMELTDPENRLPEAEREAQRIAKCPEPARAAARLKLN
FT                   AAVRTVIATGLDLLGVSAPEKM"
FT   gene            219492..221063
FT                   /gene="brnQ"
FT                   /locus_tag="HMPREF0424_0196"
FT   CDS_pept        219492..221063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="HMPREF0424_0196"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /note="identified by match to protein family HMM PF05525;
FT                   match to protein family HMM TIGR00796"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14080"
FT                   /db_xref="GOA:D2RD33"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD33"
FT                   /protein_id="ADB14080.1"
FT                   /translation="MGGVSMSVTTQSVSTDSAPKKRNLTIIESAYVAVMLFGMFFGAGN
FT                   LIFPVFLGANAGTNFVPATIGFIVTGVGLPLLGVTALAMSRANGLFELSSKPSRKYGMF
FT                   FTCVLYLTIGPFFAIPRCATTSYTVGLERVIPQDGNGQLYLFLFSVVFFALAFFFAMKP
FT                   SGILTWVGKVLTPIFLVFLGILVFTALFSPVSGASADAAPIGKYVNESFFTGFLDGYNT
FT                   MDALASLAFGIIVVSTIRSFGVKDPKDVAVNTVRSGFFSCLLMALIYVAIVVVGVRSRA
FT                   LFKPAENGGVTLAQVARYHLGNVGLLVLAATVTLACLKTAVGLIVSCSETFSKLFPKGP
FT                   SYRVWSVLITLVSFGLANFGLSTIIEYAVPVLMFLYPLSIVLILLALCGRLFGNSKVVY
FT                   AWTLGFTGVAAVYDFLNSLPQALRSALHMNDMLVVVQNWLPFSEFGMAWVCPAVVGFVV
FT                   GYVRMVLFENKDMEEVARLAAGPDLEGSVASDDYYSSSDAEFNEPADFAVSAKSTVDEP
FT                   NFSEQS"
FT   gene            complement(221177..221524)
FT                   /locus_tag="HMPREF0424_0197"
FT   CDS_pept        complement(221177..221524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13569"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD34"
FT                   /protein_id="ADB13569.1"
FT                   /translation="MPVIHTHVSVSTTPAQRDALKAAYGKAISAVPGKSEHWLMCPFED
FT                   NMPIYFAGDNTKPAAYVEVNVFGSSVPGSAWEKLTEQIMAALERELGIPQDRTYIRYTA
FT                   TTDWGWNGGNF"
FT   gene            221600..222115
FT                   /locus_tag="HMPREF0424_0198"
FT   CDS_pept        221600..222115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0198"
FT                   /product="GtrA-like protein"
FT                   /note="identified by match to protein family HMM PF04138"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14050"
FT                   /db_xref="GOA:D2RD35"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD35"
FT                   /protein_id="ADB14050.1"
FT                   /translation="MDIMKKLIEQVVKFGIVGIIALIIDVALLNLLMLAHLNNVVAGTI
FT                   SFVISLIFNYIASMKYVFKHREDMAKWMELLIFVISAVIGLLINDLIIWASTLGMVESL
FT                   RGSAVYVLRTNIGKLVATVVVAVWNFVIRKWLLDDTKSQQPGYVAQEDTSFAHRLGMWS
FT                   LNHTKNRK"
FT   gene            222150..222842
FT                   /locus_tag="HMPREF0424_0199"
FT   CDS_pept        222150..222842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0199"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14408"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD36"
FT                   /protein_id="ADB14408.1"
FT                   /translation="MPATTIHFVRHGEVDNPNHVLYERLSGFHLSARGVRMAQATAKYI
FT                   ATVPQMRGITAIYSSPLERTRETAREIENALRNIADSAYVKAHCDEDSAQSQESDIILD
FT                   KRLIEAGNNFRGKRIGYGEGALWKNNNWKLVANLWKPSWGESYRSIAARVGDFVREQVR
FT                   KHPGEQIVAVTHESPIWSYRHLLETGHAEHNMLLRHTALASITSITYDCETLRVLSITY
FT                   VDPAGRVK"
FT   gene            222871..223839
FT                   /locus_tag="HMPREF0424_0200"
FT   CDS_pept        222871..223839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14245"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD37"
FT                   /protein_id="ADB14245.1"
FT                   /translation="MVSSVDSVKDSEDIKNNEKSMLMLNDAAQSAAKLTELWPLTEARH
FT                   LDNDAKYAENLEVRSMRAIARILTNLDVTVPDAEFVYEGADEIPGRPQEIVDALLAAAD
FT                   AYDNMDSCYEPNYDEAEEAILENSNNINSIFSKIASHSAEDSNAINAAADMLNVEGNWS
FT                   ISDIDFAINYAKQMVSCYENKSLEMQKIIVVLSLLTNLIKKTNEICETLPIFLYINEIC
FT                   ECAGLPRMMFKDAQWREIVDCVRNSSDKCNCDISGDISALVNFISPLLISEWGKHREDV
FT                   LWDPEVAKKLAKEEDDRKSREALAAKFAHVEGNKESTQALD"
FT   gene            223905..225458
FT                   /gene="gltX"
FT                   /locus_tag="HMPREF0424_0201"
FT   CDS_pept        223905..225458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="HMPREF0424_0201"
FT                   /product="glutamate--tRNA ligase"
FT                   /EC_number="6.1.1.17"
FT                   /note="identified by match to protein family HMM PF00749;
FT                   match to protein family HMM TIGR00464"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13863"
FT                   /db_xref="GOA:D2RD38"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD38"
FT                   /protein_id="ADB13863.1"
FT                   /translation="MTDIEETQEVANNATKSAKPELPKNVRVRFCPSPTGTPHVGMVRT
FT                   ALFNWAEARHTHGKLLFRIEDTDNERDSEESYQQIIEALRWLNIDWDEGIDVGGDNGPY
FT                   RQSQRMEIYKDVAQKLFEAGYAYESFSTPEEIKERNIAAGRPAEFGYDGYDRNLTEEQK
FT                   QAFRDEGRKPALRLKMPNEDITFNDLIRGEITFKAGSVPDYVIVRPNGDPLYTLTNPVD
FT                   DALMDVNVVLRGEDILSSTPRQIVLYRYLMEMGIAKETPLYGHMPYVMGEGKKKLSKRD
FT                   PESNLFLHRDNGFIPEGLLNYLALLGWSIAPDRDVFTMDEMVEKFDVRDVKANPAHFDL
FT                   DKAISINAEHIRMLEPQDFLNRSVPYLHKDGVVSADNWDALTDREREVLTAAAPLVQSR
FT                   VRLLGEVAGMVGSLLSEDGYIAPDDDARKQLKESAGEVLDAALAALKDVDASDWHTDSL
FT                   HELLNKKLVEEAGYKPRLAFGPVRVALSGRRVSPPLFESMEIVGKDVTLARLAGLREHL
FT                   "
FT   gene            225507..225641
FT                   /locus_tag="HMPREF0424_0202"
FT   CDS_pept        225507..225641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0202"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14458"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD39"
FT                   /protein_id="ADB14458.1"
FT                   /translation="MALLLHFRLFICFMLNIFSTRRGCKYLLYVVKSLFVASRGVADK"
FT   gene            225644..225719
FT                   /locus_tag="HMPREF0424_1357"
FT   tRNA            225644..225719
FT                   /locus_tag="HMPREF0424_1357"
FT                   /product="tRNA-Glu"
FT   gene            225757..225831
FT                   /locus_tag="HMPREF0424_1358"
FT   tRNA            225757..225831
FT                   /locus_tag="HMPREF0424_1358"
FT                   /product="tRNA-Gln"
FT   gene            226360..227652
FT                   /locus_tag="HMPREF0424_0205"
FT   CDS_pept        226360..227652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0205"
FT                   /product="Ser/Thr phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13520"
FT                   /db_xref="GOA:D2RD40"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD40"
FT                   /protein_id="ADB13520.1"
FT                   /translation="MTDSAQSEAHASAALPLSVSARLGRLQFHLSGKFRVLQCADVQDG
FT                   LRISQDTIRLIASACDAVRPDLVVFTGNQIAGYERVFAKTFQRRLWQESSNISASDKKQ
FT                   LVDKVHEFVAKLMKPLEDRSIPWVVTYGNHDFQCGLSNEELDKIYQDFPCCMNRSASNV
FT                   SSASAMQSTKCVLPKQIIFTCEPGTFALPVMDEKHEKVVFSIVLVDSGDYAKSGGYGSP
FT                   SKKTIEFISGLPSYLPEHICVFQHFPLPQYYRVLREVPQELAAREHAIEGYRTFAGRYY
FT                   ALDEKHVLPDGYLGEGISCPDADSGEYAALLDAGAFALIAGHDHRNSFAAKDPESNMLF
FT                   VATPTCGFGSYGPEPAKRGVRLLEFDIRHPFEPRTQMLEFGNLVGKPSSKKAYTYALTA
FT                   ESEHELPEVDLLRKPSLLTRLIRRWRQRSTR"
FT   gene            227744..229105
FT                   /gene="murA"
FT                   /locus_tag="HMPREF0424_0206"
FT   CDS_pept        227744..229105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="HMPREF0424_0206"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="identified by match to protein family HMM PF00275;
FT                   match to protein family HMM TIGR01072"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13934"
FT                   /db_xref="GOA:D2RD41"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD41"
FT                   /protein_id="ADB13934.1"
FT                   /translation="MSAHNTAEQNNNSGIDAADVLHVEGGKPLNGTIKVRGAKNFVSKA
FT                   MVAALLAPGKSVLKNVPEIRDVHVVSDLLRLHGVDVEVNGPEGIVTIDATKVQLADVAD
FT                   VDTLSGSSRIPILFSGPLLHRLGEAFIPALGGCNIGGRPIDFHLETLRKLGANVDKDHE
FT                   DGIHITAPNGLHGTKIHLPYPSVGATEQTLLAAVLAEGRTELSGAAIEPEIMDLVAVLQ
FT                   KMGAIISVDVDRTFRIEGVKELQGYTHTSLTDRIEAASWASAALATHGDVFIKGATQPE
FT                   MMTFLNVFRKVGGQFDVTDKGIRFWHPGGDLHPVAIETDVHPGFMTDWQQPLVVALTQA
FT                   KGLSIVHETVYENRFGFTKPLVQMGAMIQLYRECLGSLPCRFQQRNYKHSAVIFGPTPL
FT                   TGQDIDVPDLRGGFSHLIAALTAQGPSNVRGISLIDRGYADFRGKLLALGANID"
FT   gene            229296..231209
FT                   /locus_tag="HMPREF0424_0207"
FT   CDS_pept        229296..231209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0207"
FT                   /product="kinase domain protein"
FT                   /note="identified by match to protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13690"
FT                   /db_xref="GOA:D2RD42"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD42"
FT                   /protein_id="ADB13690.1"
FT                   /translation="MVCVGGRYQLLGELGRGGTSTVFLAVDTVLHKQWAVKETLLQGDE
FT                   EYQRRIIQSLRAEANVLKECDHPAIPRIVDFFEENGRAYAVRDYVKGRSLKSIVEESGL
FT                   QNVETVLDLGMQLCSILSYLHSHYPPIIYGDLKPSQVMISEDGTVRLIDFGAATQLYAN
FT                   GGVLDLRTIDQCDARFATNIFTAPEILNENSAATTSSDVYSIGMTLRYALLPTEVPKTN
FT                   VQSAVLLSHENREVVEQLVSVLAIATATKPSHRYKDCDEMFSALEACEHTEKHSQQCDT
FT                   STNVLRRKQCKNSFKPRKKRYAITALIVVVLVFIVILFNCLGLFVGNAFVNRNKQSFDG
FT                   EPSSKRIEEIRKNNKSYDSYMQLAERESNSDIACRYISHAMQVQNSMIKKKYISKISFK
FT                   PLQILLQIQLADQQWSANEEQCFVGLINKYEQNLRPVNKDWLNISIEIGKAYWYYFAGF
FT                   SGKVSQTERLSRMRVAKVWFQEAQKYEKDANKASSQAVETNSDGISHTASNQKMLSAYI
FT                   AISDAYAQLVDVSKDCASVETYKNYVNQLQQLMQIVEKDHGDVLFVDTGELVLQSIHSW
FT                   LPMFLESGASKQEIQQMCDKAEYLLKQAHASNDEAVSRKKNAIDSVKKVQDEINLAFLQ
FT                   KK"
FT   gene            231245..233578
FT                   /locus_tag="HMPREF0424_0208"
FT   CDS_pept        231245..233578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0208"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14192"
FT                   /db_xref="GOA:D2RD43"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD43"
FT                   /protein_id="ADB14192.1"
FT                   /translation="MCKQRNLGDMWFFKRFKCGCARIGVYIGIIVFISAAIVVALLPLN
FT                   SIAYAKSSYNAAKGLHIANVSVMTKQKTVRTQGEYMFTKRAASLLITFDGLDASEIRNA
FT                   HKATVSVGRYQIVSAKVDLAKIEAVSSLVNIRYKIRPRVLGIVRVELQKEGIYDLQDIS
FT                   IRLAAVTMHPKRIWGGVDSNSHVSKQTNYISNESKLSGNKLRSRKPILSIPDSVLNASD
FT                   LTKDNSYSKRPRYIVIDKTAPRLSVSYDNNASYEGKYFRNNRASRILIQDDSFVFSYLL
FT                   HDSYPIAKVFADGKQVMVLTAKSFKNDGVHTNVWYADVSFSGDASWDVRYCVEDLSGNV
FT                   SSSISNKFIIDTLVPTVSITGVQQGGAYSHAVVPTLVIKDRWLKPASVTYSLRRMRYAK
FT                   ELRSFVSRKADSQSVSVLYAGFYNGIQDDDVYQLQWSAKDLVDHVISGKLQFSINRSGS
FT                   SFSIDSSTKAMNRKQLQNAKDIHIEELNPSGLASPAKISVMQDGVEKILSKQDFSVNSR
FT                   IDHGWQRLTYTIFKRNFADNAHYRVRIMSVDKAGNHSCSESAVSKKEGMLQFAPASVQF
FT                   TVDNLAPITTVFDMQNNSTYRTNKEGKTLRISAKDNIALQYVTIDVDGKTNRIWSGKDV
FT                   NKSVLSTKLKPDGFTHDVLVKAADYAGNITTLQYKNVKIVSIANKLVKKSEADKKSKNS
FT                   ESKDADSSDDGLDDDSDNSSDNDDWIARSQVKKSEKSFENADSFKRKSVNYIEIVAYIG
FT                   TGIIAILCAALGISIIFKKKISNQ"
FT   gene            complement(233668..233740)
FT                   /locus_tag="HMPREF0424_1359"
FT   tRNA            complement(233668..233740)
FT                   /locus_tag="HMPREF0424_1359"
FT                   /product="tRNA-Ala"
FT   gene            complement(233856..234542)
FT                   /locus_tag="HMPREF0424_0210"
FT   CDS_pept        complement(233856..234542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0210"
FT                   /product="SNARE-like domain protein"
FT                   /note="identified by match to protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14248"
FT                   /db_xref="GOA:D2RD44"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD44"
FT                   /protein_id="ADB14248.1"
FT                   /translation="MGFIHFIVNLLKDPRSAIASWIAMGTAPALGLIFLIVFIETGVVF
FT                   FPFLPGDSLLFAAGFFAAPDAQTGHSALPLPLLLAVVWLAPIIGDQCNYFIGHFFGRKI
FT                   VESGKVKALTPERVAKTEKMIDKWGPLAVFLGRFFPFIRTFMPFISGISGMRWIRFTPF
FT                   SVLGGLVWSSLFTFLGYFFGKIDFVQKNFELVIVAILLISLVPTFIGLYKAHKAKKAAK
FT                   LNKENK"
FT   gene            234770..235513
FT                   /locus_tag="HMPREF0424_0211"
FT   CDS_pept        234770..235513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13709"
FT                   /db_xref="GOA:D2RD45"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD45"
FT                   /protein_id="ADB13709.1"
FT                   /translation="MKLNDEHDGEYPQSFAPLKPRKRSARVINANEVLKKNDDSKSKIP
FT                   DEYVNIGLPETDLSIADFSRKHSNPKNWWIYFGVLLVAIVIPYWIGRTMAARHTSWVIS
FT                   HCSGLSSQGVVFISWVITVSAFTSLAMALIDTHRWIWRIMFAVFLALEQLIAGLCMLNM
FT                   SFWYSTYVVYGHASGLANAANLGIISAGIGVAVFAVIFVGLLVIVPKTSALNVLTRSWA
FT                   SFIMFYAIEVLAILVVLFGGFMTAM"
FT   gene            235644..235913
FT                   /gene="rpsO"
FT                   /locus_tag="HMPREF0424_0212"
FT   CDS_pept        235644..235913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="HMPREF0424_0212"
FT                   /product="ribosomal protein S15"
FT                   /note="identified by match to protein family HMM PF00312;
FT                   match to protein family HMM TIGR00952"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14416"
FT                   /db_xref="GOA:D2RD46"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD46"
FT                   /protein_id="ADB14416.1"
FT                   /translation="MALTAEDKKNIINEYATHEGDTGSPEVQVALLSKRIADLTEHLKE
FT                   HKHDHHSRRGLLLMVGDRRRLLDYLKRVDINRYRSLIERLGLRR"
FT   gene            236259..239039
FT                   /gene="gpsI"
FT                   /locus_tag="HMPREF0424_0213"
FT   CDS_pept        236259..239039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsI"
FT                   /locus_tag="HMPREF0424_0213"
FT                   /product="guanosine pentaphosphate synthetase
FT                   I/polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.-.-"
FT                   /EC_number="2.7.7.8"
FT                   /note="identified by match to protein family HMM PF00013;
FT                   match to protein family HMM PF00575; match to protein
FT                   family HMM PF01138; match to protein family HMM PF03725;
FT                   match to protein family HMM PF03726; match to protein
FT                   family HMM TIGR02696; match to protein family HMM
FT                   TIGR03591"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13476"
FT                   /db_xref="GOA:D2RD47"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014069"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD47"
FT                   /protein_id="ADB13476.1"
FT                   /translation="MEGPEIKAVEAVIDNGSFGKRTLRFETGRLAQQADGAVAAYLDDD
FT                   SMILSTTTAGSSPKENYDFFPLTVDVEEKMYAAGKIPGSFFRREGRPSNEATLACRIID
FT                   RPLRPLFPHTLRNEVQVVETILAINPDDAYDVIALNAASASTMISGLPFEGPVSGVRLA
FT                   LIDGQWVAFPRWSERERAVFEIVVAGRVIENGDVAIAMIEAGAGKNAWNLIYNDGQTKP
FT                   DEQVVAGGLEAAKPFIKVICDAQNELKRIAAKETKEFQLFPEYTDELYARIDEIAHADL
FT                   NEALSIAEKLPRQDRIAEIKEGVRAAIAEEFTDMDEAEKEKELGNAFKELQRQIVRRRI
FT                   LTEDYRIDGRGLRDIRTLSAEVDVVPRVHGSALFQRGETQILGVTTLNMLKMEQQVDAL
FT                   SGPQTKRYMHNYEMPPYSTGETGRVGSPKRREIGHGALAEKALVPVLPGREEFPYAIRQ
FT                   VSEAIGSNGSTSMGSVCASTLSLLAAGVPLKAPVAGIAMGLVSGDVDGKHIFKTLTDIL
FT                   GAEDAFGDMDFKVAGTSEFITALQLDTKLDGIPADILAAALQQAHEARATILEVINECI
FT                   DCPAEMSPFAPRIITTTIPVDKIGEVIGPKGKMINQIQEETGAEIAIEDDGTVYISSEG
FT                   GEAAEKAKGIIDSIANPRVPKAGETFTGKVVKTTSFGAFVNLTPGTDGLLHISQIRNLA
FT                   NGERIDTVEDVLKEGDNVEVIVQSVDERGKISLAIPGFEDQESSAPAVRENRSRSSRDD
FT                   RDSRDSRGDYRRSRRDDRDNHDRADRADRDERPRRRMRDDRDDRDRMDRNDRYMDRDNR
FT                   YDDRNTRRDDRRADRADRDNRYSDNDFDERPRRRVRDDRDDRYENRDDRDDRADRDDRE
FT                   DRSNRRDSENRRVSDRKPRYAADDDHYDEYRSAREERAERPRRRVRRDFDPFEED"
FT   gene            239286..240149
FT                   /locus_tag="HMPREF0424_0214"
FT   CDS_pept        239286..240149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0214"
FT                   /product="oxidoreductase, aldo/keto reductase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14020"
FT                   /db_xref="GOA:D2RD48"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD48"
FT                   /protein_id="ADB14020.1"
FT                   /translation="MVMHRALGSFDTTAIGFGEMPLTIENNLGHDMGIETIHAALDAGC
FT                   THIDTAWAYYCSGGEEQTGEKLVREALESWKGDKSSILVATKVGHFRNFTDGRPTWGKD
FT                   GKPEHLIAHAKESAMTLGVDTIDLLYFHRPDPEVPYNESIEAMQELLDEGVAREIGISN
FT                   ASVEQIDIARNILGEKLVAVQNQYSPVHLENEDTLQYCEKLGIAFVCWSPLGGFRHPYD
FT                   EHLFDPFRKVAENHSVSYQQVVLAWELAKGDHIFVIPGAHRPATILDSLKASDLQLSNE
FT                   ELAYLG"
FT   gene            240164..241129
FT                   /locus_tag="HMPREF0424_0215"
FT   CDS_pept        240164..241129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0215"
FT                   /product="conserved hypothetical protein, YfiH family"
FT                   /note="identified by match to protein family HMM PF02578"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14557"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD49"
FT                   /protein_id="ADB14557.1"
FT                   /translation="MQETSVTGMPLPHEDEDGTPIPVTIPVPLGSRTHAVFTTRLGGIS
FT                   EGSFASLNLGGRAGDSEEAVASNRAALQKALQADLSLVAQVHSREVFDADSVVDSWNTS
FT                   YGFDATGFADSQLRIEADAQVSTACSLALGMFAADCLPVLLADDEAGVIAAAHCGRKGL
FT                   MAGVLDAVIEAMCEKGAERSRIEAVLGPCICGDCYEVGESIARDFEKRYPQTVTKTRFG
FT                   GIGIDIAEAARIDLAIAGVANIVDALPRVTAATQYLQEDEELRTICEVDGEGESLPERL
FT                   QNLQNPMCTLENPLWYSHRRASLAGKSHEGRLLALVIRDK"
FT   gene            241306..242730
FT                   /locus_tag="HMPREF0424_0216"
FT   CDS_pept        241306..242730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13900"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD50"
FT                   /protein_id="ADB13900.1"
FT                   /translation="MVADLFPTALRGYDKDKVNEAFANYERTISRLREQVRSSDESILQ
FT                   LQAQLQEEKNNVKRAKSGNTFASLGANAQQLLASAEQTSSQLLERAKQDAASIKKNAQA
FT                   QAGTLLNNAKLDAAHLMQEAQTKADTMLSNATQKSTQLMQAAQEDSARLRDTTAKDVQA
FT                   QKDAAELALQNTQEEHTKRMASERAQQESSISQLKSEAAQKIAEQRAAANEEIARAKAE
FT                   TNDQIESALAEANKKLADMREHASKMMADAQRKAGEITDAAAAKAQEIADDAQVERTRT
FT                   LSQVSAEVEQIRADIAAQQEEATKKVNALLSGLKEKERAAQEEADALVDRAKTVHQEAD
FT                   EYAAQTHQAADSQAADIVRKAMQEATAQVEERRAAAQQELDGMTTRLTQLQHREATITQ
FT                   RVTELRSLFANAFSGFDFGDAQQNQQVAQASDDNEDSSDVQSSADAKQAQRDVQAALAE
FT                   SEEANESQEDQDTDNQ"
FT   gene            242842..244176
FT                   /locus_tag="HMPREF0424_0217"
FT   CDS_pept        242842..244176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0217"
FT                   /product="peptidase C1-like family"
FT                   /note="identified by match to protein family HMM PF03051"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14478"
FT                   /db_xref="GOA:D2RD51"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD51"
FT                   /protein_id="ADB14478.1"
FT                   /translation="MTEITALTDEKLQGLREDFDANPLNRLAMNGVTAAGIDKVARNYD
FT                   RARLLQRRFSTIVDNGDATHQDRSGRCWLFSSLNVARFIAKKSLGLKEFEFSQNYAMYY
FT                   DKLERINYFLKDVAALVRAGEPSDSRLIQHLLHDVMGDGGQWTMAMNVYKKYGAVPKDL
FT                   FPETASSKNTGAMNTQLRALLHTAVAHMYANATEIDEIIADATAAGHRILTIHLGEPPK
FT                   SFDWEWTDSDGKFHRDGEITPVEFWKKYVNAGLEDYVCLVDDPRAEHPKGKKIAIEHLG
FT                   NVAGGDATEYLNVPNQFMKDCVRKILVEKGIPVWFGADCHPMMDRENGAWATDLFEYGR
FT                   VYGVDFDLDKEARVRFADSAMNHAMAFAGVDVADDGTTTRRWRVENSWGTDIADKGYFT
FT                   MSDDWFTEYVYEVAVPKNLLPEEYRKALEEPAIVLPAWDPMGALA"
FT   gene            244375..245556
FT                   /locus_tag="HMPREF0424_0218"
FT   CDS_pept        244375..245556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0218"
FT                   /product="3-deoxy-7-phosphoheptulonate synthase"
FT                   /EC_number="2.5.1.54"
FT                   /note="identified by match to protein family HMM PF00793;
FT                   match to protein family HMM TIGR00034"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13940"
FT                   /db_xref="GOA:D2RD52"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD52"
FT                   /protein_id="ADB13940.1"
FT                   /translation="MASTAEQRTSRAVKKEVEEGRNPLNSAKFQRWEDQVGVDRIINRR
FT                   VLELEPLPTPAQVLGELPLSPYAQDIVAQSRDEIRSCLNGEDDRLLVIVGPCSVHDPKA
FT                   ALDYASRLAKLRSELEDELLIVMRVYFEKPRTALGWKGLINDPDIDGTHDIHKGLLLAR
FT                   KTLLGVLDAGLAAATEFLEPTSPQFIADAVSWGAIGARNTESQIHRQLASGLSMPVGFK
FT                   NATDGSVSAAVNGCLAASQHHTFFGIDHLGRACAVQTLGNPDCHVVLRGSSKGPNYDAA
FT                   SVASAVASIRLRLGTGCMASNGVVVDCSHGNSGKDERRQIEVVREIADRLADGEQGIKG
FT                   VMMESFLQGGNQDPAPLSELEYGKSITDRCISWEDTANLLRILAKSVATRRRA"
FT   gene            245670..246167
FT                   /locus_tag="HMPREF0424_0219"
FT   CDS_pept        245670..246167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0219"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13516"
FT                   /db_xref="GOA:D2RD53"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD53"
FT                   /protein_id="ADB13516.1"
FT                   /translation="MYNKDLNKANKANKGFMCKALPVVRYILLALIYNGVLLLAFAWYR
FT                   GTHSAGYTLVTFSALWFSVFIPFVTGIALIVFASGWRRIVGTLVCVLLIAGFFAFLALQ
FT                   DQIIAFFNVPVVNPWFDFTCGALLKIATLTFVIMTLVCVFLVKNNDKCVSSEVKKDDSA
FT                   NA"
FT   gene            246160..246870
FT                   /gene="mtnN"
FT                   /locus_tag="HMPREF0424_0220"
FT   CDS_pept        246160..246870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnN"
FT                   /locus_tag="HMPREF0424_0220"
FT                   /product="MTA/SAH nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /note="identified by match to protein family HMM PF01048;
FT                   match to protein family HMM TIGR01704"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14222"
FT                   /db_xref="GOA:D2RD54"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD54"
FT                   /protein_id="ADB14222.1"
FT                   /translation="MPSTEKITKVAVVGALEEEVAHIASALENVTHDHSASLDVSCGTL
FT                   DSANGSKIEVAATVGGMGLVNAAATVQYLIDAYNPQVVIFSGIAGNLNKNLHTNDVVLG
FT                   KTVKYLDTDMRLIGQWKPFASEFNSDDYLLKVASKVLTDMKITHIAGTIASGGYFVDSP
FT                   EKVAEVIAATQADAVEMEGAAVLHVAARNDVPALVVRAMSDNADTKYEDFHTFDISEYA
FT                   DTAAKITVNILRNL"
FT   gene            247077..248303
FT                   /gene="pstS"
FT                   /locus_tag="HMPREF0424_0221"
FT   CDS_pept        247077..248303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="HMPREF0424_0221"
FT                   /product="phosphate ABC transporter, phosphate-binding
FT                   protein PstS"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR00975"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14366"
FT                   /db_xref="GOA:D2RD55"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D2RD55"
FT                   /protein_id="ADB14366.1"
FT                   /translation="MWWGARQFFAKGKKNMRNDMNKSNMNKFNTTKSALKFRSIAAAAL
FT                   TFGLCATCSACGDNVPADNSNASGSQNTKISGNFQGSGASSQQVAMEAWIAGFQSKNPG
FT                   AKIAYNPTGSGAGVTTFMTGATAWAGSDKALSNDEVEKSKSVCAHGTTAFDVPVYVSPI
FT                   AIIFNLKGVSDAGKHINLDASTIAKIFDGKITRWNDEDIKKQNPKLKLPDTPITVVHRS
FT                   DKSGTTQNFLSYVKDAAPDDWKYDLSENWPNSVGQGAKGTSGVVSTIRMANGAIGYADF
FT                   SQVGKLGTVAVKVGDTYNEISPEAASKTLADSEIDADASAKYPNRVVMKINHNTQSKGA
FT                   YPIVLVSYDIACPVYKDAGTARFVKSWLSYVTSAEGQNAASSAAGTAPLPQNLVSKINA
FT                   SIKSVKTGK"
FT   gene            248353..249357
FT                   /gene="pstC"
FT                   /locus_tag="HMPREF0424_0222"
FT   CDS_pept        248353..249357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="HMPREF0424_0222"
FT                   /product="phosphate ABC transporter, permease protein PstC"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR02138"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13838"
FT                   /db_xref="GOA:D2R9J8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9J8"
FT                   /protein_id="ADB13838.1"
FT                   /translation="MSSTKNAKAVANSANETAQISESNSKNYVGTHLVDRLFKGVAAGC
FT                   GMLILLVLTAVAVFLLFRALPLLSGNHNQVSHVFADFTGGKAHDFISYVAPLIFGTVLM
FT                   SALALLFAFFVAIGIALFISYYAPKKIVPLLSGVIDLLAAIPSVIYGLWGGLVLVPAMY
FT                   PFWDWVSKLFGWIPLFSGPAANPSRSAATVALVLAVMILPIITSMARDIFQQAPRLQQE
FT                   GALALGATKWEMIKLAVLPFAKSGIVSASMLGLGRALGETMAVLMILSPGFTFGINIFK
FT                   ASQNQTIAANIAAQYPEANGLGVSALIATGLVLFVISFAVNFIARKITGKAGA"
FT   gene            249358..250395
FT                   /gene="pstA"
FT                   /locus_tag="HMPREF0424_0223"
FT   CDS_pept        249358..250395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="HMPREF0424_0223"
FT                   /product="phosphate ABC transporter, permease protein PstA"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00974"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13733"
FT                   /db_xref="GOA:D2R9J9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9J9"
FT                   /protein_id="ADB13733.1"
FT                   /translation="MEHQINKSNEGAEVFAENCVENRAENSAAPVIDFNKFRPTRSHIA
FT                   ARKRKDMLMRVLIFLSFVVALIPLISLLLTTIINGIKRLNFDFLTHNMTYVVGGNATGT
FT                   GGYGGILHAIIGTLEITLGAMVISIPIGLMCAVYLVEYARGNKISRIINLLVDVMSGIP
FT                   SIVAGLFAFSMFALLAGPGTINGFEGSVALSLLMIPTVVKSSQEMLKIVPNDLREASLA
FT                   LGVTQQRTITKIVLRTALPGIVSGCILAVARVIGETAPLLMASGFIASTNLNLFDGQMT
FT                   TLPVYVYQEYSKLSANCPANAPASCVTSIPMERSWAAALTLIVLVLLLNILGRVVARVF
FT                   SVKAK"
FT   gene            250464..251243
FT                   /gene="pstB"
FT                   /locus_tag="HMPREF0424_0224"
FT   CDS_pept        250464..251243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="HMPREF0424_0224"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00972"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14126"
FT                   /db_xref="GOA:D2R9K0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9K0"
FT                   /protein_id="ADB14126.1"
FT                   /translation="MGQRIDVKHLNIYYGDFLAVEDVNINIEPNKVTAFIGPSGCGKST
FT                   VLRTLDRMHEITPGARVEGQVLLEGRDLYGKDVDPVAVRRDVGMVFQRPNPFPTMSIRE
FT                   NVLAGVRLNNRKIAKSDADDLVEWALRGANLWNEVKDRLDKPGIGLSGGQQQRLCIARA
FT                   VAVHPQVLLMDEPCSALDPISTLAVEDLINELKRDYTIVIVTHNMQQAARVADYTAFFN
FT                   LKAVGQPGHLEYFADTTTMFNNPRNAEAERYISGRFG"
FT   gene            251497..252891
FT                   /locus_tag="HMPREF0424_0225"
FT   CDS_pept        251497..252891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0225"
FT                   /product="putative permease"
FT                   /note="identified by match to protein family HMM PF00860"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14505"
FT                   /db_xref="GOA:D2R9K1"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9K1"
FT                   /protein_id="ADB14505.1"
FT                   /translation="MEKFFHLKENGTNVSTEITAGLTTFFAMSYIIVVNPMILSQTGMP
FT                   KGGVFLATIIAAIIGTLVMGLFANVPYAQAAGMGLNAFFTYTVCFGLHFTWQEAMCMVF
FT                   LCGLINIIITVTKIRKMIIRAIPTSLQQAIGGGIGLFVAYVGMMSVGLITFTSKDPAAA
FT                   AKSKPTAAIPGLAVMNNPVLWLFLIGLLFAIVLTVLKVRASLLITIIATSLIGIPLGLT
FT                   SLNNAVSVTDAFAQLPTTFGAIFSDKGFASLFADPARLPLVLVTIFAFSMSDTFDTLGT
FT                   FIGTGRRTGIFSEADEKALENGSGFSSKMDRALFADSIATSVGAICGTSNTTTYVESAA
FT                   GIGAGGRTGLTSVVVSICFALSIVLAPFASAVPAAATAGVLVVVGCMMASSLKEIAWDD
FT                   ISEAIPAFFAAVFMAFSYSISYGIAAGFIMYCLVMTCKKRAKEVHPMLWIVSLLFLLDF
FT                   VANAVL"
FT   gene            253283..253804
FT                   /gene="rplJ"
FT                   /locus_tag="HMPREF0424_0226"
FT   CDS_pept        253283..253804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="HMPREF0424_0226"
FT                   /product="ribosomal protein L10"
FT                   /note="identified by match to protein family HMM PF00466"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14137"
FT                   /db_xref="GOA:D2R9K2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9K2"
FT                   /protein_id="ADB14137.1"
FT                   /translation="MKRPEKEAVVAELTELFRNADAIYLTEYRGLTVPQISTLREKLGR
FT                   DTSYSVAKNTLARIAAKEAGIEGLDELLAGPTAVTFVKGDFIEAAKTLRDFAKENKALV
FT                   IKGGFADGTVYDAEGAKQLADLKSRPQLLSEMAGALKGTMSKAAYLFNALPTKAVRTID
FT                   ALREKQEKAA"
FT   gene            253902..254282
FT                   /gene="rplL"
FT                   /locus_tag="HMPREF0424_0227"
FT   CDS_pept        253902..254282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="HMPREF0424_0227"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="identified by match to protein family HMM PF00542;
FT                   match to protein family HMM TIGR00855"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14066"
FT                   /db_xref="GOA:D2R9K3"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9K3"
FT                   /protein_id="ADB14066.1"
FT                   /translation="MAKLTNEELLEAFGEMTLVELSEFVKAFEDKFDVEAAAPVAAVAA
FT                   APAAAGAAEEEKDEFDVVLTAAGDKKIAVIKAVRALTSLGLAEAKALVDGAPKAVLEKA
FT                   KKEDAEKAKAALEEAGASVELK"
FT   gene            255160..256491
FT                   /locus_tag="HMPREF0424_0228"
FT   CDS_pept        255160..256491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0228"
FT                   /product="FHA domain protein"
FT                   /note="identified by match to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13848"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9K4"
FT                   /protein_id="ADB13848.1"
FT                   /translation="MSERQTVQRWMITVGGVEQARVGAGQSVEIGRKPIRPLREDGFAR
FT                   VDIVDNKRSMSKRHALLIVDMRGVATIRDLHSTNGTYLVSANGDLLRLEPDVDFQLPDN
FT                   LMRMQFGDVPVDFVRVEEESAEVEKDNAVRNLFSYATDESHDEPAASDLSVDQILDLRA
FT                   GEPTGVFHAQSVSHPGLSWKQGMQNHTQLNDDSQTDVAPINHDVTLPVMREQQEVPVEP
FT                   RNLFADAQAIQQESSTKEEPSQQDSVISSVSAVDQADSVAQASPVTPVNPETNILQNES
FT                   SQEFLVSPLNSTETFAENIANTSAFNGANTGSNNLDINSFGSTNLGTTNLDSNNLDINN
FT                   SDAEYTPAFEPGSVFEKVSKGEFDSQENVVEAGGFTSKEAEESSDFSKQFEMAQYSQLL
FT                   PFLAANTGLYDDLYAWLAAQGNSEVDAALARNSGYSAYRKAIEQ"
FT   gene            256512..260270
FT                   /locus_tag="HMPREF0424_0229"
FT   CDS_pept        256512..260270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14414"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9K5"
FT                   /protein_id="ADB14414.1"
FT                   /translation="MSDTNNVEQDSSEQVFTDTVVENTTSEGDSLEKSGSNNTNSARTN
FT                   ALQHIVGWKQQYQAQLSPSPLEDITQLAAQLELTHAHPSGIAQLFASGKVTLKSLFRDA
FT                   GMLRAAGRRLDRVFEDRDAKAHESGVSELSLIVGVASWNGNHVPVLTYPVKVVRDTNQD
FT                   ETSATIYFSGSVGLNNSLVSRLSERGVQLREDVLFDGSQYESGTPETSVVFDAICKQAR
FT                   SAFTDFDIERDIILGCFTDAGSRFVAESEQIIDALQSGNVGNAMIDAMAGDDRAIHKLQ
FT                   SANKLEYSPFDADPHSECEVGEVDNVVRYAAELVASGNSLFVDIDSGSDSAAIAAAIAS
FT                   RSVIAGHSVLYVPNVVEQQRRFRYTLNTHEISSLALDVADGHIAKHVDAQLIAAVGARH
FT                   SIATSRFEQVADELVGVRSRLTRYLGDLHGINETWGVSAYQTIQNLAAIAMFPTHPSTH
FT                   VRLDVSAAHAMTGHIEEWSKKFHQADELGEFRINPEDTPWFGASIFDENEAISVYQRVV
FT                   DVLLKLLPATREQVKSTVQSCGFPVPTTAREWSRQVTVLKNLRRVLDVFQPEIFERDLD
FT                   AMIEASKPKVQRKAEGTIMGFWERRHHVREARSLLRVGAKVDDLHEALKIVAQQAAQWR
FT                   TFVPHGGWPVLPPKLDDIVNTQELLARHLVALDAVLATTLKGADLENIEFAQLEARLQD
FT                   LHDDRASLDTLPGRCNLEREFSKAGLSDLVSDLRRRNVTGNAIDGELQLAWWTTVFEDI
FT                   VNSSAIISHQDGSAMQDVSDRFVQVDTEHVRSIGPMVQQEAMRHLCDLLFSHTQEANQL
FT                   HTMLAGNRSGITFNKLLRNYAELVLAAKPILVAMPSTLTMMTPLRPIADTVIIDSASHI
FT                   SNIELLSILSRARQVVVLAHKQTVSSESLRSLISLLPSVTVVSRATRRSLRLARFLEEH
FT                   GYGKLRHDVPVERLQGKVRLHQIEATGVPVMSSGLIESSQREIDEVVELIRQRANTFTV
FT                   VPSSYVLVVVTLTNVFRSRLGAELKSLSIKDENMARFLRHVRLLGVNEASGAIATDVIM
FT                   SLCYAKTSHGRLLQQFGLLEEEGGSSMLLDALALARRHLDIVSAFTSKDMEDERLHQDG
FT                   PKLLKNLLQWAEKLSDKPLRPEDANDVEAQIAAEAAQRNVLFTDLAERIRSRGLKVAVN
FT                   YGFDNGVRIPLVVGLADKSFAVAVLTDDAQFMSVQSTRERHRMIIQDLESLGWSVMTVW
FT                   SVGAFVNPEKEVDRVVSRLGELYGDNE"
FT   gene            260267..260470
FT                   /locus_tag="HMPREF0424_0230"
FT   CDS_pept        260267..260470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14367"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9K6"
FT                   /protein_id="ADB14367.1"
FT                   /translation="MSKYDPNRRSPRRSVRVVREGSELFDADGVKLEPSDELTLQQRNQ
FT                   DDDNRILSELPPHWAVFSERIS"
FT   gene            complement(260602..261456)
FT                   /locus_tag="HMPREF0424_0231"
FT   CDS_pept        complement(260602..261456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0231"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13589"
FT                   /db_xref="GOA:D2R9K7"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9K7"
FT                   /protein_id="ADB13589.1"
FT                   /translation="MRANRFYPQRAIFLALAFFIFQNAGMSINFSLFKSQNNAKNSALL
FT                   QRRQRAFVRKIIIVLCAGMMALLVVSTIIDSQETQVIAVAKHNIQKGSRVSVNDIAYVR
FT                   VPKHKVFNQALSNNISANASIIATCEIRKGMPILQTLLSKIPRIPEGFTSITIHLASAD
FT                   HTLLPGEKIDLAFSKPVQDEEISNSKNAESHNNEKSKSSTIENNDKNKNQDIEENNIAE
FT                   IDERYVSVVHNVTVMQITQSTQVSQNQQNTTTLAMPAADALRLLQAQSANPSLAIVAMK
FT                   LSQ"
FT   gene            complement(261494..261670)
FT                   /locus_tag="HMPREF0424_0232"
FT   CDS_pept        complement(261494..261670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0232"
FT                   /product="putative regulatory protein (CxxC_CxxC_SSSS)"
FT                   /note="identified by match to protein family HMM PF09723;
FT                   match to protein family HMM TIGR02605"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14251"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9K8"
FT                   /protein_id="ADB14251.1"
FT                   /translation="MPTYHYRCKQCGYDFSEHQSFSDDPITICPQCGKDAVHKVYSAPP
FT                   INFKGKGFYRTDK"
FT   gene            261980..263062
FT                   /locus_tag="HMPREF0424_0233"
FT   CDS_pept        261980..263062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13671"
FT                   /db_xref="GOA:D2R9K9"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9K9"
FT                   /protein_id="ADB13671.1"
FT                   /translation="MKSMLEHREDRFSPTLHLVGEWSTARICDDTSMLAKGACMQPTQQ
FT                   KRTLTPEYIARIRAARRAAIRRRCVLVVALAALTFVVFLAGCSGIFSPVFALIPGAMLA
FT                   VVLYFGARASKHARAWEARIATMRAASKCKAEDELCERHNSAVIRQLKDYSSASDSDFN
FT                   GEINSSDAISQNDSAEYSVSQTVVPVRNDASRDNTETSVMEQSEIRVALHRAEQERNAA
FT                   LRERLYKEESESKESNIVEAENKDAYDSSNAFVASEQNYQSNQDLISFSLDSQTKSDSG
FT                   NANLASRTPESLEIKSTKQVVKAVPVANVDNANDAANFAATNSSQFHEKEKVSEVDAPE
FT                   SSEDSLGVANLHDVLARRNA"
FT   gene            263235..263528
FT                   /gene="groS"
FT                   /locus_tag="HMPREF0424_0234"
FT   CDS_pept        263235..263528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groS"
FT                   /locus_tag="HMPREF0424_0234"
FT                   /product="chaperonin GroS"
FT                   /note="identified by match to protein family HMM PF00166"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14187"
FT                   /db_xref="GOA:D2R9L0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9L0"
FT                   /protein_id="ADB14187.1"
FT                   /translation="MSIKLTPLEDKIIVKQAQAETQTASGLYIPDNAKEKPQQGEVLAV
FT                   GPGRRDDKGERIPMDVKVGDKVLYSKYGGTEVHYEGEDYLIVSSRDVLAILG"
FT   gene            263722..264819
FT                   /gene="hisC"
FT                   /locus_tag="HMPREF0424_0235"
FT   CDS_pept        263722..264819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="HMPREF0424_0235"
FT                   /product="histidinol-phosphate transaminase"
FT                   /EC_number="2.6.1.9"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM TIGR01141"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13713"
FT                   /db_xref="GOA:D2R9L1"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9L1"
FT                   /protein_id="ADB13713.1"
FT                   /translation="MTYKHRNIVDTIPSYKQGKPAPKLDGIRAYKISSNENPYEPLQSV
FT                   KEAISNRALNVINRYPNMRGTEVVEELAKRFGVTADEVVLGCGSTEVITQLVDLVAGPG
FT                   DEVIYPWRSFEAYPIIVTGAGATSVKIPNRADGSHDVDAMIAAISDRTRLVILNNPNNP
FT                   TSASLSEEEARKVLDAVPSDVLVLIDEAYVQFNTAKGTANGIKLYHEYPNVVVAQTFSK
FT                   AYGLAGLRIGYGIAPAEVVDGMRKVAVPFGVSQIAQVAALASLEDDASKEMSTRVASLV
FT                   AERERILEALREQGWNIEDAYANFFWMPFGADTERATEHFIAAGLSVRAFAGEGIRISI
FT                   GEREANDRVLTVCENLKNEGFSLNN"
FT   gene            264930..265011
FT                   /locus_tag="HMPREF0424_1360"
FT   tRNA            264930..265011
FT                   /locus_tag="HMPREF0424_1360"
FT                   /product="tRNA-Tyr"
FT   gene            265013..265084
FT                   /locus_tag="HMPREF0424_1361"
FT   tRNA            265013..265084
FT                   /locus_tag="HMPREF0424_1361"
FT                   /product="tRNA-Thr"
FT   gene            265089..265165
FT                   /locus_tag="HMPREF0424_1362"
FT   tRNA            265089..265165
FT                   /locus_tag="HMPREF0424_1362"
FT                   /product="tRNA-Met"
FT   gene            265216..265386
FT                   /gene="rpmG"
FT                   /locus_tag="HMPREF0424_0239"
FT   CDS_pept        265216..265386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="HMPREF0424_0239"
FT                   /product="ribosomal protein L33"
FT                   /note="identified by match to protein family HMM PF00471;
FT                   match to protein family HMM TIGR01023"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14084"
FT                   /db_xref="GOA:D2R9L2"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9L2"
FT                   /protein_id="ADB14084.1"
FT                   /translation="MASKSADIRPGITMACTECKERNYITTKNRRNTPDRLELNKFCPR
FT                   CGKHTLHRETR"
FT   gene            265511..266782
FT                   /locus_tag="HMPREF0424_0240"
FT   CDS_pept        265511..266782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0240"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02873"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14517"
FT                   /db_xref="GOA:D2R9L3"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9L3"
FT                   /protein_id="ADB14517.1"
FT                   /translation="MSMQASLVNNPSFADITTVGVGGKIARFIEPKSRVAVIEAVEDAD
FT                   ELGLPLCVIGGGSNMLVSDENFNGVVVRDARRDIHVLDEAAPSEDGIDLQSGAHLVHIN
FT                   AEAGCNWDDFVSHTISLGLEGVEGLSGIPGTVGASVVQNIGAYGQEVSQSVTSVEVWDR
FT                   KTKSTMELQKDALNFGYRTSLLKKSMYSSVGVPADSYFPTPRYVVLSVTFCLKHNSTGI
FT                   VSHSQLANALHVELGERMQTAAIRREVLRVRASKGMLEDASRYDKLWMRGTKCAEGVEF
FT                   ALRLQSEDYVTGEFLEGDNIYSDRHSCGSFFMNPILSTSEADTLPEDAPKFDAIMQDGS
FT                   HGIKTSAAWLIDHAGFHKGFRLIENGKPSPAGLSSLHTLALTNRNNASCDDIANLAKTI
FT                   IRGVQSKFGVTLIPEPVVINISIN"
FT   gene            267073..268704
FT                   /locus_tag="HMPREF0424_0241"
FT   CDS_pept        267073..268704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0241"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14279"
FT                   /db_xref="GOA:D2R9L4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9L4"
FT                   /protein_id="ADB14279.1"
FT                   /translation="MQIWRKKSVEQTIAETMDGERHLKRTLNAWDLAVMGVAVAVGAGI
FT                   FSVGAQAAAFHAGPAVIISFIIAGIVCGSAAMCYAEFASMIPVAGSAYTFTYTTVGELI
FT                   AWIIGWDMILEMLMAGSVIAKYWGVYLNDLMKLFGLNMTTSFNLGGFTIDVAPIIIVAF
FT                   FTTMLVLGTKLSARFDGALTILKIGIVLFVVVVGFFYIKASNFTPFVPPATDAASVKGI
FT                   EVSGVMAQPLWQWVTGMQPAVYGVPGILSGAALVFFAFIGFDVVATTAEETKDPHKNIP
FT                   RGIGLGLFIVTVLYILVAVVTTGMVSYKDLAKQAAPSLSTSFELVGATWAAKIISLGIV
FT                   IGLTTVVMVLLLGLTRIIFAVSRDGLLPRSFSKVSKRGIPARLQIVAGIVVAVVASTLD
FT                   IGILSDMVNIGTLSAFLLVSAGVPIMRMRRPDLHRSFSVPGNPWLPLFAALSTFWLMLN
FT                   LSVLTWIRFAVWLAIGFAVYFGYSYRNSLLGRQLRKAKQLGVPVETLFAQDAAAAEKVA
FT                   EGETEEQARAEAQAEVTAAASQDSQN"
FT   gene            268827..269159
FT                   /locus_tag="HMPREF0424_0242"
FT   CDS_pept        268827..269159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0242"
FT                   /product="4Fe-4S binding domain protein"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14670"
FT                   /db_xref="GOA:D2R9L5"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9L5"
FT                   /protein_id="ADB14670.1"
FT                   /translation="MPYVIAEPCVDVKDKACVDECPVDCIYEGDRTLYINPNECVDCGA
FT                   CEPACPVEAIFYEDDLPDGWEWYRDAAVDYFDKLGDLGGATDAGASGWDEARVAALPPR
FT                   SDKASN"
FT   gene            complement(269194..270423)
FT                   /locus_tag="HMPREF0424_0243"
FT   CDS_pept        complement(269194..270423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0243"
FT                   /product="ImpB/MucB/SamB family protein"
FT                   /note="identified by match to protein family HMM PF00817"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13816"
FT                   /db_xref="GOA:D2R9L6"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9L6"
FT                   /protein_id="ADB13816.1"
FT                   /translation="MDAFYASLEVARHPELKGKPLIIGTGNRAVVSAASYEARAYGVNS
FT                   AMPVVKARNLCPQGIFLPVDIPYYSSVSKSIFENIFLHITNQVEKVSVDECYMNVKSAL
FT                   LQWKSPVNIGTWVRKEVFEKYHITCSVGIASNKLIAKMASTNAKPNGMLLIPQKCNEDF
FT                   VSIMPLRAIPGIGSSLIHKLEDWGLSTVASLKNVDEATLTRITGSQILARMIYQSVRGI
FT                   DERTVTAHAPEKSIGTERTLDTDTTNENAVKQLLQQCCSEVTQQLRNRKLMARTITLKL
FT                   RFGDLHYVTRSSTLQNATDSTHEFYEHVVVLLSRANPTVHNYILGGNNTKLLSPVRLAG
FT                   VTANNLVPANKVSLQPSLNDILEENTRESKNPTQNIMSTMNKNTRLRHAEHALDAVRKK
FT                   YGNNAAHIGL"
FT   gene            270614..271546
FT                   /locus_tag="HMPREF0424_0244"
FT   CDS_pept        270614..271546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0244"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14344"
FT                   /db_xref="GOA:D2R9L7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9L7"
FT                   /protein_id="ADB14344.1"
FT                   /translation="MKQFVVNLLHRMPVLLIIVIEASMVYTATSVAKVAFSQLDPLYAV
FT                   WYRVGFMTLLLLAWRRPFSRSKRSLLPKTLREWGIVAAVGVSLVAMNTMFYVAISCMAV
FT                   GVAVTIEFIGPLLVAVITGHEWRERVGIVIAVCGIMLLASASMHSSVSPHFLIGLFAIL
FT                   VGGSMWGLYIVSGRMLAKSSHAIDRVSVAALIGWLLQSVVLAVPAVQHVISPKPEATWA
FT                   ARPGGSFALLALMLVIAICASFFPTLLDQVLLKRVTSAKYSVIQALYPAIAVIIGMGFG
FT                   EIPTLTDIAGIILVMFAVVVTFSGDHNPV"
FT   gene            271659..271748
FT                   /locus_tag="HMPREF0424_1363"
FT   tRNA            271659..271748
FT                   /locus_tag="HMPREF0424_1363"
FT                   /product="tRNA-Ser"
FT   gene            complement(271843..271965)
FT                   /locus_tag="HMPREF0424_0246"
FT   CDS_pept        complement(271843..271965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0246"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13718"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9L8"
FT                   /protein_id="ADB13718.1"
FT                   /translation="MASTMTLEKICVNIFLVLWLKGSIWIKVMHKSTILLKSLA"
FT   gene            272052..274901
FT                   /locus_tag="HMPREF0424_0247"
FT   CDS_pept        272052..274901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0247"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14054"
FT                   /db_xref="GOA:D2R9L9"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9L9"
FT                   /protein_id="ADB14054.1"
FT                   /translation="METYFGKHTSFSCANKLRNLMKQKNIRKMLALFTSAVLVPSVLCS
FT                   QIAMGSVDKLTGYYYKKSNTVEWLSEKIARLRLGPVTDKWEGRKNSIFCMESSVFIDYK
FT                   GNIKQMNGEDYRIAANIIKTHNNNDDDLTQAALAFMIHNHFDINQDRWKEAVENGFVDV
FT                   ETETLRNKADKLWQQGVKETPVKAVLKNDYTKGKRVGVMHISLQNSNGDSLGGVPIKVK
FT                   SSNNLIKFANGSESFEGKSKKEGLDITWNALDAGNARIEVSFNAPKAERLFSPDGQDVI
FT                   RSFENTWYPQDFSFGVEKTFQPLLKSKISKHELRAGEQVDSTVTSSVAGNDSWPENVRL
FT                   RAQGYYFVGSAEDILHIQQRNSGESAKEYLNRMRSMPNLRQVAAAKANFSNSGETITAV
FT                   AKRANGDITASDLDKAEAYKVNDLEAGLFGTWVWIISRDSQNKSDREFLKDDVVQLFGS
FT                   TDTTAVHQATVSSDIAAKQQTVGLNTEIVNEITVRGLPETYGSFKGNNSYGFNEDKKAH
FT                   IRVWWVGAGSENPTKKDNENYMPGSKGEPSYQEPKEDNHHRLIAKWDVPAVNGVYKIGN
FT                   GNITLRPIAGTDRSTTEPKVLENNVHIRANKNSESGWYVFVYDFPGSSRALAHKSAYDG
FT                   LWSRALVEPDVLTTPVSVTTRVSDEKVKAGEKFHDNARITGTLPKGSYVVFSAYEYEDG
FT                   KGNKSDSSGAKCSDAKNGDAKNGDAKNGSDSETKEIKKAKEAKETKETKETVISAEIEK
FT                   KMPQSRVNITNKQAEESKKSSISVSSADITLDHEGTVYWKAEVYDAQGNPLATHALGVE
FT                   GETVQVSGGEDRSKNDENEENNKENKENVEENHSKTGSDDSTDSKNDVNDNASNQHDST
FT                   NSNENANKNYVNRSNTIPTSLAVTGASSITVILLAVITLTFASGLSLGRFSSIVPKHGR
FT                   MSGGARHGGIPPMRRRLVK"
FT   gene            275085..275378
FT                   /locus_tag="HMPREF0424_0248"
FT   CDS_pept        275085..275378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0248"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02583"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14456"
FT                   /db_xref="GOA:D2R9M0"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9M0"
FT                   /protein_id="ADB14456.1"
FT                   /translation="MKNYDIDKEKLIVRMHRVQGQLAAVNTMIENDAKCQDVLMQLSAA
FT                   TAALHSLAVIVAREHVNKEIHESVKIGTEEGADAAMEDISGIIDRLLRYEKA"
FT   gene            275394..276062
FT                   /locus_tag="HMPREF0424_0249"
FT   CDS_pept        275394..276062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0249"
FT                   /product="YigZ family protein"
FT                   /note="identified by match to protein family HMM PF01205;
FT                   match to protein family HMM PF09186; match to protein
FT                   family HMM TIGR00257"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13642"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9M1"
FT                   /protein_id="ADB13642.1"
FT                   /translation="MTNSHNILHTVRQLQSQPFEASFVEKKSEFIGCICHIDNLDDAAE
FT                   FMQSVRFKNPKARHVAYAAICGSSKAQLHERMSDDGEPTGTAGKPILDVLRLSNLTDCV
FT                   VTVTRYFGGILLGAGGLTRAYVRAASMAVESAQIVDIITCTRFTCKLQYQQLRMLQHIV
FT                   SQMEGIIDNEIYGAEISLNIAIPTLKSQEFLDMVQNAFSGNVVPKADGTLSNKLIDTKR
FT                   "
FT   gene            276073..276699
FT                   /locus_tag="HMPREF0424_0250"
FT   CDS_pept        276073..276699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14491"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9M2"
FT                   /protein_id="ADB14491.1"
FT                   /translation="MEKTNEKTNTIDDSSYEPLTAVYEHLRHSEDSAELHEFARRELPD
FT                   RSDQAAFSRATSLLEAVAGNINTPEEDRIYLATEMPFPNILVKLSEDSADKVRLAVAEN
FT                   KNAKNWLVGRLTKDSCNAVRNAALCNPKASWKMRLEGAQSDGISAETLKYLASLGVSAE
FT                   ENAPIVLASMVRRAVALNPGVPQNVLQELCNDKSEDVSSAARSRC"
FT   gene            276717..278882
FT                   /gene="malQ"
FT                   /locus_tag="HMPREF0424_0251"
FT   CDS_pept        276717..278882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malQ"
FT                   /locus_tag="HMPREF0424_0251"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="identified by match to protein family HMM PF02446;
FT                   match to protein family HMM TIGR00217"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13521"
FT                   /db_xref="GOA:D2R9M3"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9M3"
FT                   /protein_id="ADB13521.1"
FT                   /translation="MDNTTDEEVAMKPLHRLAELMGVGVSFIGSDNQKHEIQDNVLVSV
FT                   LSALGVDASTNETIEKSTNDVLAYRHGRIVAPTVLHTVGKCDEVTVNTGILEYPVATLT
FT                   LENGEQYKGDLTIVPNENDVAYPVNGKFVATSLIKIPEDVPMGYHTLRVTVGERQEEAT
FT                   LISAPESIDTLNSLEPNGEQLWGWMAQLYSIRSSKSWGVGDFADLATLLTEAKQKTGAD
FT                   FVLINPMHAGEPITPLTPSPYLPVARGMVNVTYISPESIPEYETLNDKTRKEIEKLHGQ
FT                   VEPLNNDAQIIDRDSMWRVKMRALWLIFKAGMSEDRARIFNEFKHEMGDRLESYATWCL
FT                   CYDKWGAPKGDDCWEKTLTKDSDQVRELANRFPDTLEFYRWLEWVAFTQLHDAQVAARK
FT                   AGMKIGIMSDMAVGVHPAGSEVWWNPERFANGATVGAPPDYFNQQGQDWSQPPLHPFEL
FT                   ERTGFKTYRDMVHGMFASAGAVRIDHILGLFRLWWIPEGSAPSGGAYVYYDADIMLGIL
FT                   AIEAARAHGVVVGEDLGVLPANALEVLRKKAVLGCTVEWFEERDGEFRTPDKWREMTLA
FT                   SVNTHDLPPAAGYLRYEQVNIRERLHLLTGSVEEFRAGAEAEHRAMMRMLVKGGYLDAQ
FT                   LLEDEDAHTQEIVEALYRALKAAPSRLLAASLVDAVGECRVQNQPGTNDEYPNWRIPLA
FT                   DGEGNPVSLDNMFDLPRVQSLSAIMNA"
FT   gene            279143..279592
FT                   /gene="rplM"
FT                   /locus_tag="HMPREF0424_0252"
FT   CDS_pept        279143..279592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="HMPREF0424_0252"
FT                   /product="ribosomal protein L13"
FT                   /note="identified by match to protein family HMM PF00572;
FT                   match to protein family HMM TIGR01066"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14087"
FT                   /db_xref="GOA:D2R9M4"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9M4"
FT                   /protein_id="ADB14087.1"
FT                   /translation="MKTFTPKPADLTHDWYIIDATDVVLGRLASQVAILLRGKNKPTFA
FT                   PHADSGNHVIIINAEKIALTGNKLSKELYSHSGRPGGLRRDSYAELLERNPKRIIMAAV
FT                   KGMLPKNRLAKVQLDRLRVFTGAEHPHTSQKPQVFEIAQVSQQAK"
FT   gene            279610..280098
FT                   /gene="rpsI"
FT                   /locus_tag="HMPREF0424_0253"
FT   CDS_pept        279610..280098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="HMPREF0424_0253"
FT                   /product="ribosomal protein S9"
FT                   /note="identified by match to protein family HMM PF00380"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13906"
FT                   /db_xref="GOA:D2R9M5"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9M5"
FT                   /protein_id="ADB13906.1"
FT                   /translation="MAENNNSAVLENEEELTSYTTETNAGAGTGTSAIEPGYGTGRRKE
FT                   AVARVRLVPGSGKWTINGRTLEEYFPSRLLQREVNSPIVLLKLEGKFDVVVLVDGGGTT
FT                   GQAGAIRLGVARALNAIDRDANRVALKKAGFLTRDARVVERKKAGLHKARRAPQFSKR"
FT   gene            280455..283160
FT                   /locus_tag="HMPREF0424_0254"
FT   CDS_pept        280455..283160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0254"
FT                   /product="aldehyde dehydrogenase (NAD) family protein"
FT                   /EC_number="1.2.1.-"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14663"
FT                   /db_xref="GOA:D2R9M6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9M6"
FT                   /protein_id="ADB14663.1"
FT                   /translation="MVEAQHQAETGKTASADDIALAAQNEVDKLVEKATVALNEFEKLN
FT                   QQQIDHIVAKASVAALNKHLVLAKMAVDETGRGLVEDKATKNIFACEHITHYLAGQKTV
FT                   GIIREDDVLGIDEIAEPVGIVAGVTPVTNPTSTAIFKSLIALKTRCPIIFGFHPFAQKC
FT                   SSEAARIVRDAAVAAGAPKDCIQWIEHPSIEATGALMKHPKIATILATGGPGMVKAAYS
FT                   SGKPALGVGAGNAPAYVDSDVDIVRAANDLILSKHFDYGMICATEQAIIAHKDVYEPLL
FT                   RELKHRKAYFVNADEKAKLEQYMFGCTAYSGNTPKLNSLVPGKSPQYIAHEAGFEIPED
FT                   AVILVAECKEVGEMEPLTMEKLAPVHAMLRAENKEQGFKMCEQMLVHGAGHTAVIHTNN
FT                   QDLVREYGVRMHACRIVWNSPGSLGGVGDIYNAIAPSLTLGCGSYGGNSVSGNVQAINL
FT                   LNIKRIARRNNNMQWFKIPAKTYFEPNAIRYLRDMYGVERAVIVCDKVMEQLGVVDKIV
FT                   DQLRARDNRVSFRIIDYVEPEPSVETVERGAAMMRDEFQPDTIIAVGGGSPMDASKIMW
FT                   LMYEHPEISFADLREKFFDIRKRAFKIPPLGSKAKLICIPTSSGTGSEVTPYAVITDHK
FT                   TGYKYPITDYALTPTVAIVDPVLARTQPRRLACDSGFDALTHAMEAYVSVYANDFTDAM
FT                   ALHASKLIWENLNDSVNCEDSQRKIEAKEKMHNAATMAGMAFGSAFLGMCHAMAHTIGA
FT                   LCHVVHGHTNAILLPYVIRYNGQIPQEPTSWPKYNRYIALERYQEIAKNLGVDPGKTPE
FT                   EGVENLARAVEEYRNEKLGMDASFKACGVDEAYYWSILDNIGMRAYEDQCAPANPRIPQ
FT                   IEDMKDIAIAAYYGVSQEEGHRMRLEREAA"
FT   gene            283809..284459
FT                   /gene="rplC"
FT                   /locus_tag="HMPREF0424_0255"
FT   CDS_pept        283809..284459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="HMPREF0424_0255"
FT                   /product="50S ribosomal protein L3"
FT                   /note="identified by match to protein family HMM PF00297;
FT                   match to protein family HMM TIGR03625"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14610"
FT                   /db_xref="GOA:D2R9M7"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9M7"
FT                   /protein_id="ADB14610.1"
FT                   /translation="MSQNKNRTALLGRKLGMSQVWDENGFFVPVTLVEVATNVVTAVKT
FT                   VESDGYCAVQLGYGQIDPTKVTKPLAGHFAKAGVTPRRHLAEVRTENAADYQPGQELTA
FT                   ELFAEGSEVDVTGTTKGKGFAGTIKRWGFKSYRRTHGSHKNERRPGSVGACATPSRILK
FT                   GKRMAGRMGHVTSTALNLTIVSSDVENGILAIKGAVPGPKGAIVLVRSAVKGA"
FT   gene            284465..285130
FT                   /gene="rplD"
FT                   /locus_tag="HMPREF0424_0256"
FT   CDS_pept        284465..285130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="HMPREF0424_0256"
FT                   /product="50S ribosomal protein L4"
FT                   /note="identified by match to protein family HMM PF00573"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13441"
FT                   /db_xref="GOA:D2R9M8"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9M8"
FT                   /protein_id="ADB13441.1"
FT                   /translation="MANVTLNVTDTKGNANGTVEAPAEIFGISNEDVLAHGPLVHQVVI
FT                   AQLAAARQGTHAVKNRANVSGGGKKPWKQKGTGRARQGSIRAPQWVHGGVVHGPVPRKY
FT                   DQRTPKKMKAAALRYVLSDRANAGRIAVVDFGIKDVPSTKTAVAALTPVTNNQFTTVVL
FT                   SRENINEWMSVRNIPTVHVIFADQLNTYDVVTAQYVVFSKEGFEAFVAAKTEPVVKEA"
FT   gene            285136..285432
FT                   /gene="rplW"
FT                   /locus_tag="HMPREF0424_0257"
FT   CDS_pept        285136..285432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="HMPREF0424_0257"
FT                   /product="ribosomal protein L23"
FT                   /note="identified by match to protein family HMM PF00276"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14410"
FT                   /db_xref="GOA:D2R9M9"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9M9"
FT                   /protein_id="ADB14410.1"
FT                   /translation="MVAVHNPAHDVILKPVVSEKSYAASDRGQYTFVVAPDANKVQIKQ
FT                   AIEEIFKVKVTNVNTLNRAGKLKRSRTGFGRRVNQKRAIVTVAEGQTIDIFGN"
FT   gene            285467..286297
FT                   /gene="rplB"
FT                   /locus_tag="HMPREF0424_0258"
FT   CDS_pept        285467..286297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="HMPREF0424_0258"
FT                   /product="ribosomal protein L2"
FT                   /note="identified by match to protein family HMM PF00181;
FT                   match to protein family HMM PF03947; match to protein
FT                   family HMM TIGR01171"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13908"
FT                   /db_xref="GOA:D2R9N0"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9N0"
FT                   /protein_id="ADB13908.1"
FT                   /translation="MAIRVYKPTTAGRRNASVSDFAEITRSTPEKSLVRKLSKTGGRNS
FT                   YGRMTSRHRGGGHKRQYRLIDFKRWDKDGVPAKVAHIEYDPNRSARIALLHYADGEKRY
FT                   IIAPEGVAQGDVIETGAQADIKPGNNLPLKNIPTGTVVHAIELRPLGGAKIARSAGAAV
FT                   QLVAKDGAYAQLRMPSGEIRNVDARCRATVGEVGNSDHANIELGKAGRARWLGRRPITR
FT                   GESMNPVDHPHGGRTRGGKPPVSPWGKGEVRTRRPKKASNKMIVRRRPNGKNRK"
FT   gene            286608..286967
FT                   /gene="rplV"
FT                   /locus_tag="HMPREF0424_0259"
FT   CDS_pept        286608..286967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="HMPREF0424_0259"
FT                   /product="ribosomal protein L22"
FT                   /note="identified by match to protein family HMM PF00237;
FT                   match to protein family HMM TIGR01044"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14369"
FT                   /db_xref="GOA:D2R9N1"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9N1"
FT                   /protein_id="ADB14369.1"
FT                   /translation="MEAKAIARHVRVTPRKARRMVDLIRGKRASEAITILKFAPQDASL
FT                   PVRKVLESAIANARVKAEKAGEPFREQDLVIKETYVDEGVTLKRFRARAQGRAARINKR
FT                   TSHITVIVSLKEGAR"
FT   gene            286970..287788
FT                   /gene="rpsC"
FT                   /locus_tag="HMPREF0424_0260"
FT   CDS_pept        286970..287788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="HMPREF0424_0260"
FT                   /product="ribosomal protein S3"
FT                   /note="identified by match to protein family HMM PF00189;
FT                   match to protein family HMM PF00417; match to protein
FT                   family HMM PF07650; match to protein family HMM TIGR01009"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14418"
FT                   /db_xref="GOA:D2R9N2"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9N2"
FT                   /protein_id="ADB14418.1"
FT                   /translation="MGQKINPFGYRLGITENHRSKWFSDSNKAGERYRDFVLEDDKIRK
FT                   EMSHDLERAGVSRIVIERTRDRVRVDIHTARPGIIIGRRGAEAERVRAKLEKLTGKQVQ
FT                   LNIFEVKNAALDAQLVAQGIAEQLTNRVTFRRAMRKAQQDAMRAGAKGIRIKLSGRLGG
FT                   AEMSRSEFYREGRVPLQTLRALIDYGFFEAKTTYGRIGVKVWIYKGDMTEREFEEQQAQ
FT                   QGKREGRRGGDRRPRRGARPANQQKAAEAQAEKPAEAAAAEAPAATETKE"
FT   gene            287793..288212
FT                   /gene="rplP"
FT                   /locus_tag="HMPREF0424_0261"
FT   CDS_pept        287793..288212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="HMPREF0424_0261"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by match to protein family HMM PF00252;
FT                   match to protein family HMM TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14165"
FT                   /db_xref="GOA:D2R9N3"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9N3"
FT                   /protein_id="ADB14165.1"
FT                   /translation="MLIPKRTKYRKQHRPTRSGMSKGGTEIAFGDFGIQALAPAYITNR
FT                   QIEAARIAMTRYIKRGGRVWITIFPDRPLTKHPLGARMGSGKGAPEFWIANIHPGRVMF
FT                   EIGGVSEDIAREALRRAIDKLPMKCRVIAREGGDI"
FT   gene            288212..288463
FT                   /gene="rpmC"
FT                   /locus_tag="HMPREF0424_0262"
FT   CDS_pept        288212..288463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="HMPREF0424_0262"
FT                   /product="ribosomal protein L29"
FT                   /note="identified by match to protein family HMM PF00831;
FT                   match to protein family HMM TIGR00012"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13674"
FT                   /db_xref="GOA:D2R9N4"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9N4"
FT                   /protein_id="ADB13674.1"
FT                   /translation="MPVGTADYTIKNLNEKTNAEIEGFLKKSKEELFNLRFQAATGQLE
FT                   NSARLKAVKHDIARMYTILRERELGISQEPGATEVKEK"
FT   gene            289193..289528
FT                   /gene="rplX"
FT                   /locus_tag="HMPREF0424_0263"
FT   CDS_pept        289193..289528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="HMPREF0424_0263"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by match to protein family HMM PF00467;
FT                   match to protein family HMM TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13960"
FT                   /db_xref="GOA:D2R9N5"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9N5"
FT                   /protein_id="ADB13960.1"
FT                   /translation="MVAKIKSGDQVKVIRGKDRGKEGKVVRVLADDRLIVEGVQIVKKH
FT                   VRATQQGQQAGIVSVEAPIHRSNVMVIDPETKQPTRVGVIVKQEARDGKVKTVRVRVAK
FT                   KSGKELA"
FT   gene            289525..290097
FT                   /gene="rplE"
FT                   /locus_tag="HMPREF0424_0264"
FT   CDS_pept        289525..290097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="HMPREF0424_0264"
FT                   /product="ribosomal protein L5"
FT                   /note="identified by match to protein family HMM PF00281;
FT                   match to protein family HMM PF00673"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14480"
FT                   /db_xref="GOA:D2R9N6"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9N6"
FT                   /protein_id="ADB14480.1"
FT                   /translation="MTDTTVELPATPRLKQQYKDEIVPALEKEFGHTNPMQVARVQKVV
FT                   VSMGVGAAARDSKLIEGAIKDLTLIAGQKPKVTKAKKSVAQFHLREGQAIGAYVTLRGD
FT                   RMWEFLDRLLTLALPRIRDFRGINGNQFDGQGNYNFGLTEQSMFHEIDPDSIDHQRGMD
FT                   ITVVTTTKDDVEAKSLLKHLGFPFKEN"
FT   gene            290371..290769
FT                   /gene="rpsH"
FT                   /locus_tag="HMPREF0424_0265"
FT   CDS_pept        290371..290769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="HMPREF0424_0265"
FT                   /product="ribosomal protein S8"
FT                   /note="identified by match to protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13867"
FT                   /db_xref="GOA:D2R9N7"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9N7"
FT                   /protein_id="ADB13867.1"
FT                   /translation="MTMTDPIADMLTRLRNASAAKHDTVEMPYSKFKANIAEILKHEGY
FT                   IKDFAAKEAKVGQTLEITLKYGSNGQRSIQGIKRISKPGLRRYAKSDALPMPLGGLGIA
FT                   IISTSSGLLTQKECLDRGIGGEIVAYVW"
FT   gene            290786..291325
FT                   /gene="rplF"
FT                   /locus_tag="HMPREF0424_0266"
FT   CDS_pept        290786..291325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="HMPREF0424_0266"
FT                   /product="ribosomal protein L6"
FT                   /note="identified by match to protein family HMM PF00347;
FT                   match to protein family HMM TIGR03654"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14526"
FT                   /db_xref="GOA:D2R9N8"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9N8"
FT                   /protein_id="ADB14526.1"
FT                   /translation="MASHIGKLPVDIPAGVEVKIEGQSFSVKGAKGSDSYEIPEGITAA
FT                   VADNQIVLTPVDDLRPTRAKHGLARAIVASMVKGVHEGYTKTLDIVGTGYRAVMKGKGI
FT                   EFSLGYSHTITVQPPAGIEFELPNPNQVIVKGTDKQTVGQVAANIRKLRAPEPYKGKGI
FT                   KYTDERILRKAGKAGK"
FT   gene            291327..291698
FT                   /gene="rplR"
FT                   /locus_tag="HMPREF0424_0267"
FT   CDS_pept        291327..291698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="HMPREF0424_0267"
FT                   /product="ribosomal protein L18"
FT                   /note="identified by match to protein family HMM PF00861;
FT                   match to protein family HMM TIGR00060"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14026"
FT                   /db_xref="GOA:D2R9N9"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9N9"
FT                   /protein_id="ADB14026.1"
FT                   /translation="MSVKIFGKGTKVARLRRHARLRKHIAGTSERPRLVVSRSNRHMVA
FT                   QIVDDTKGITLVSASTLTADFAGFTGTKTEAATKVGELVAAKAKEAGITAVVFDRGGNK
FT                   YHGRVAAVAEGARQGGLAL"
FT   gene            291722..292423
FT                   /gene="rpsE"
FT                   /locus_tag="HMPREF0424_0268"
FT   CDS_pept        291722..292423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="HMPREF0424_0268"
FT                   /product="ribosomal protein S5"
FT                   /note="identified by match to protein family HMM PF00333;
FT                   match to protein family HMM PF03719; match to protein
FT                   family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14074"
FT                   /db_xref="GOA:D2R9P0"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9P0"
FT                   /protein_id="ADB14074.1"
FT                   /translation="MAEETQNTQASAEERNDDRRSRRNKGEGKRGERRNRREENRGEEL
FT                   LDRVVTINRVSKTHKGGRTFSFAALVVVGDGKGTVGVGYGKSREVPAAIAKGQLDAKKH
FT                   MFTVPRIRGTVTHPVLGHDAAGTVLLRPAAPGTGVIAGGAVRAVMECAGITDILTKSMG
FT                   SATAVNVVRATVDALKKLEEPEEISARRGLSLEEVAPDALLRERAAGIAEARKAREEAQ
FT                   AAKASEAKDGE"
FT   gene            292423..292605
FT                   /gene="rpmD"
FT                   /locus_tag="HMPREF0424_0269"
FT   CDS_pept        292423..292605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="HMPREF0424_0269"
FT                   /product="ribosomal protein L30"
FT                   /note="identified by match to protein family HMM PF00327;
FT                   match to protein family HMM TIGR01308"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14259"
FT                   /db_xref="GOA:D2R9P1"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9P1"
FT                   /protein_id="ADB14259.1"
FT                   /translation="MSNLKITLVHGLVHTTERQRANVHTLGLHKIGHSVVREDTPVNRG
FT                   LVMAVRHLVSVEEVD"
FT   gene            292608..293063
FT                   /gene="rplO"
FT                   /locus_tag="HMPREF0424_0270"
FT   CDS_pept        292608..293063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="HMPREF0424_0270"
FT                   /product="ribosomal protein L15"
FT                   /note="identified by match to protein family HMM PF00256;
FT                   match to protein family HMM PF01305; match to protein
FT                   family HMM TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13890"
FT                   /db_xref="GOA:D2R9P2"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9P2"
FT                   /protein_id="ADB13890.1"
FT                   /translation="MANEEPMLHMHTLRPAPGAKKDRIRVGRGEGSKGKTSGRGDKGTK
FT                   KRYQVRPGFEGGQLPLYMRLPKLRGFKSPFKKEFQVVNVADLADLFPKGGEVTVADLIT
FT                   KGAVRDGYPVKVLGDGELTVALTLKGMKASASAKAKVEAAGGSISEE"
FT   gene            293258..294601
FT                   /gene="secY"
FT                   /locus_tag="HMPREF0424_0271"
FT   CDS_pept        293258..294601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="HMPREF0424_0271"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="identified by match to protein family HMM PF00344;
FT                   match to protein family HMM TIGR00967"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14387"
FT                   /db_xref="GOA:D2R9P3"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9P3"
FT                   /protein_id="ADB14387.1"
FT                   /translation="MKTLIQAFRTKELRNKILFVFAMIIIYRIGSFIPIPGVDYKVVHA
FT                   CTVKLASSSENFIGLVNLFSGGSLLQLSIFALGVMPYITASIVIQLLRVVIPRFEALHK
FT                   EGQSGETKLTQYTRYLTIGLAILQSTTILVTARTGALFNYQCGNNIIPDGSMWSLIVMV
FT                   LIMTGGTGLIMWMAELITDKGIGQGMSVLIFMSICSGFLPKLWEIGWGTNGSNGDWNKF
FT                   AIVGGVLIVILIFVDFVELAQRRIPVQYTRRMIGRKMYGGSSTYLPLKVNMSGVIPPIF
FT                   ASSILAVPTLIAQFGDKSKAWVNWIEANLANSTSAWYIAFYTVMIVFFCFFYTEITFNP
FT                   DETADNMKEYGGFIPGIRAGSATSHYLSYVMNRLNTVGAIYLLFVALIPTVLIMALHLN
FT                   TKLPFGGTTILIIAGVGLDTLRQAKAQTEQFQYAGFLFKHDEQKQVSK"
FT   gene            294630..295190
FT                   /locus_tag="HMPREF0424_0272"
FT   CDS_pept        294630..295190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0272"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="identified by match to protein family HMM PF00406;
FT                   match to protein family HMM TIGR01351"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13935"
FT                   /db_xref="GOA:D2R9P4"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9P4"
FT                   /protein_id="ADB13935.1"
FT                   /translation="MRLLIMGPQGVGKGTQAALLSEHYGIPAISTGDIFRYNLKNHTEL
FT                   GKQVQGYLDKGELVPDELTNSIVKDRLAQDDAKSGWILDGYPRNASQVQALDRMLEELG
FT                   TPLDHVVALEAERDVLLERMQKRAVEQGRSDDTPEVIAKRLETYEKETAPLLDIYDSRG
FT                   QLVEVDGVGDIKEINNRIVESLN"
FT   gene            295333..295551
FT                   /pseudo
FT                   /gene="infA"
FT                   /locus_tag="HMPREF0424_0273"
FT                   /note="translation initiation factor IF-1; this gene
FT                   contains a nucleotide ambiguity which may be the result of
FT                   a sequencing error; identified by match to protein family
FT                   HMM PF00575; match to protein family HMM PF01176; match to
FT                   protein family HMM TIGR00008"
FT   gene            295572..295685
FT                   /gene="rpmJ"
FT                   /locus_tag="HMPREF0424_0274"
FT   CDS_pept        295572..295685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="HMPREF0424_0274"
FT                   /product="ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14472"
FT                   /db_xref="GOA:D2R9P5"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9P5"
FT                   /protein_id="ADB14472.1"
FT                   /translation="MKVSPSVKRICENCRVIRRHGRVMVICINPRHKQRQG"
FT   gene            295830..296207
FT                   /gene="rpsM"
FT                   /locus_tag="HMPREF0424_0275"
FT   CDS_pept        295830..296207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="HMPREF0424_0275"
FT                   /product="30S ribosomal protein S13"
FT                   /note="identified by match to protein family HMM PF00416;
FT                   match to protein family HMM TIGR03631"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14105"
FT                   /db_xref="GOA:D2R9P6"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9P6"
FT                   /protein_id="ADB14105.1"
FT                   /translation="MARLAGVDIPNEKRIEIALTYIFGVGRTRAKETLAATGVNPDTRV
FT                   KDLTDEQLITLRDYLEANYKIEGDLRREIDADIRRKIQINCYQGQRHRKGLPVRGQRTK
FT                   TNARTRKGPKRTVAGKKKATR"
FT   gene            296291..296689
FT                   /gene="rpsK"
FT                   /locus_tag="HMPREF0424_0276"
FT   CDS_pept        296291..296689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="HMPREF0424_0276"
FT                   /product="30S ribosomal protein S11"
FT                   /note="identified by match to protein family HMM PF00411;
FT                   match to protein family HMM TIGR03632"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14299"
FT                   /db_xref="GOA:D2R9P7"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9P7"
FT                   /protein_id="ADB14299.1"
FT                   /translation="MAAAKQASRKPRRRDRKSVPVGQAHIKSTFNNTIISITDPSGAVL
FT                   SWASGGDVGFKGSRKSTPYAAGMAAESAARKAMEHGLKKVDVFVKGPGSGRETAIRSLQ
FT                   SAGLEVGSITDVTPQAHNGVRPPKRRRV"
FT   gene            296769..297764
FT                   /gene="rpoA"
FT                   /locus_tag="HMPREF0424_0277"
FT   CDS_pept        296769..297764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="HMPREF0424_0277"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01000;
FT                   match to protein family HMM PF01193; match to protein
FT                   family HMM PF03118; match to protein family HMM TIGR02027"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13467"
FT                   /db_xref="GOA:D2R9P8"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9P8"
FT                   /protein_id="ADB13467.1"
FT                   /translation="MLIAQRPTLTEESLNPQRSRFTIEPLEPGFGYTLGNSLRRTLLSS
FT                   IPGAAVTSVRISGALHEFTTLPGVEEDVTEILLNIKGIVLTSEYDEPVVMYLRKNGKGE
FT                   ATAGDITPPAGVTIANPDLHIATLAEDGELEIEFTVERGRGYVPAQMNKQENSEIGRIP
FT                   VDSIYSPVLKVSYKVEATRVEQRTDFDKLILDVETKPAITPRDAVASAGSTLVELFGLC
FT                   RELNVDAEGVEVGPAPTHDEADSQLAIPIEDMNFTQRSYNCLKREGIHTVGELVVHTEQ
FT                   DLLDIRNFGMKSIDEVKEKLQAMGLSLKASPIGFDANNLEGGTFFSPEDE"
FT   gene            297842..298276
FT                   /gene="rplQ"
FT                   /locus_tag="HMPREF0424_0278"
FT   CDS_pept        297842..298276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="HMPREF0424_0278"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by match to protein family HMM PF01196;
FT                   match to protein family HMM TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14193"
FT                   /db_xref="GOA:D2R9P9"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9P9"
FT                   /protein_id="ADB14193.1"
FT                   /translation="MPTPKQGPRLASSPAHERLMLANMATSLFQHGRIVTTLPKAKRLR
FT                   PLAERLISFAKRGDLHSRRRVLRVIRNKSVVHVLFTQIAEQMKQREGGYTRIVKIAPRR
FT                   GDTAPQAIIELVTEPVSPKKAVVKEAEAATKVAAKEEAAE"
FT   gene            298404..299663
FT                   /locus_tag="HMPREF0424_0279"
FT   CDS_pept        298404..299663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13856"
FT                   /db_xref="InterPro:IPR024499"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Q0"
FT                   /protein_id="ADB13856.1"
FT                   /translation="MPNILDQVRSDFRTFAQRSFNSVDALILCELSYINMPKSIPLYNS
FT                   ESKVISTTPIYDLLRFEDFSSMFSSGVAKVDKFRQELLFAVAANPRYRGIKVGEILERF
FT                   DKSNAHESCEQQFAGVTFDLSSCEGIDNPNTIVVAFRGTDNTLVGWKEDFNMAFRCPIP
FT                   AQESAAEYLISVTQRYSKYIAKKASLLQKISSFFAKSTNSKRDNCDNNNKRDNNNKRNN
FT                   SPNIIVTGHSKGGNMASYATMRLDAENEKLGNLVSKIYSMDGPGFANDVVDTSVFSCVA
FT                   SRIEKVVPQSSIIGLLMDNGLPYKVARADSVGLMQHFGMYWHVEDGDFDYRDEVTARAA
FT                   AIAKAMNSWMFDLPVEERKRRIDSVYNVLSSLGYPTFDLLGSHWSELVPKLLGMATHLD
FT                   AKSYELIRGIIAAVAGVGVK"
FT   gene            299782..300699
FT                   /gene="truA"
FT                   /locus_tag="HMPREF0424_0280"
FT   CDS_pept        299782..300699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="HMPREF0424_0280"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="identified by match to protein family HMM PF01416;
FT                   match to protein family HMM TIGR00071"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14577"
FT                   /db_xref="GOA:D2R9Q1"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Q1"
FT                   /protein_id="ADB14577.1"
FT                   /translation="MRLRLDLAYDGGGFYGWAKQPTLRTVQGEIEGALHTVLRVPEGDS
FT                   AEPLRLTVAGRTDTGVHASHQVCHLDVCEETLLRCVGHTGLDGVCALEYRLKHVLPQDI
FT                   SLHKVSVAPIGFDARFSALERTYVYRICDASDYCDYDPRMRGFVLKLDDVLDVDAMNQA
FT                   ARLMIGLHDFGSFARPNPGGTTIRDVKSACWERVGTRANDVRVKLKTGCVPPVEQGLLE
FT                   FTIVADAFAHNMVRSLVQACVQIGCGKRTLDWFVEKINTPLREGSTGPIAPQGLTLEYV
FT                   AYPPDNELAERAEKIRARRDSAEL"
FT   gene            300790..300875
FT                   /locus_tag="HMPREF0424_1364"
FT   tRNA            300790..300875
FT                   /locus_tag="HMPREF0424_1364"
FT                   /product="tRNA-Ser"
FT   gene            300907..301035
FT                   /locus_tag="HMPREF0424_0282"
FT   CDS_pept        300907..301035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0282"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14114"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Q2"
FT                   /protein_id="ADB14114.1"
FT                   /translation="MKLFYSAELAQVGSTVCFQRKRGLSASIKTQKVWASVFNVVC"
FT   gene            complement(301658..302659)
FT                   /locus_tag="HMPREF0424_0283"
FT   CDS_pept        complement(301658..302659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0283"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13531"
FT                   /db_xref="GOA:D2R9Q3"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Q3"
FT                   /protein_id="ADB13531.1"
FT                   /translation="MQTLYVLLNDIYKQVKRSIARALVLLICVLISPLLTACGTLQNIH
FT                   VEHTVHTAAPENACAKAYRLAQKRQREIKKNQNNTSLKDFETAAKYWKTVAQQCPGRLS
FT                   ESIVYSTQAQWEMLSKKNSDENSNNVSNKSGNESSENTKTTTAQQMEHDSYANLIEVIN
FT                   HYKNFKWTHQPLAQAAEAEDKLAFILQTLAARKEQNIALEYSDMASTNAQTLMRAAGEG
FT                   TDLRKKVYDIPQETLESGKTHDSVSGKDLPITAIAYMDCAREELAAFNQIITITSKNNN
FT                   ASENNVTAKSDDNDSVMRAQQTLKNAIVQLITSRLLRAYELGYPTDTKLILK"
FT   gene            302831..303913
FT                   /gene="nusA"
FT                   /locus_tag="HMPREF0424_0284"
FT   CDS_pept        302831..303913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="HMPREF0424_0284"
FT                   /product="transcription termination factor NusA"
FT                   /note="identified by match to protein family HMM PF08529;
FT                   match to protein family HMM TIGR01953"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14300"
FT                   /db_xref="GOA:D2R9Q4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Q4"
FT                   /protein_id="ADB14300.1"
FT                   /translation="MELDLAGMHQLAAQQGINAEELDEALAEALRLAYMKTAHPAKHVR
FT                   VELDERAGSFTVWARDEIPGKPTEDNPYPAPTLGEEYDDTPRDFGRLAAATARQVISQI
FT                   FRKAEDDRVFGAFSGQKGKLINGIIQQDAKDNTNIHVAVGDVEAILPRREQVPGERYRH
FT                   GERIRVYVVNVARGLRGPEIVVSRSHPELVRRLFEREVPELVSGAVSIMSIAREAGART
FT                   KIAVRANTEGVNPKGALIGPGGSRVRAVMENLGQEKIDIVDWSSDPAKFVAAALSPATA
FT                   TQVQVVSEKNQTAVAFIHDAQLSLAIGKEGQNARLAAKLTGWKIGIESAEEHAKKVAAA
FT                   QAQNAQPASADLNNNASAAE"
FT   gene            304232..307096
FT                   /gene="infB"
FT                   /locus_tag="HMPREF0424_0285"
FT   CDS_pept        304232..307096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="HMPREF0424_0285"
FT                   /product="translation initiation factor IF-2"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00071; match to protein
FT                   family HMM PF03144; match to protein family HMM PF04760;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00487"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13638"
FT                   /db_xref="GOA:D2R9Q5"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Q5"
FT                   /protein_id="ADB13638.1"
FT                   /translation="MVKKRVYELAKEFGVDSKTVLERLKSMGEFVKSASSTVEAPVVRR
FT                   LQTALASDGNKSEKASSASKPAAPKAKPQAKPQAKPQAKDSSHSDSVAGSSANQPVHNT
FT                   ASHFVPKPGANHTRSNNPSRSNAAAGENRKNDRRNDNRDNRGESRQQAQGQSHSDRSQM
FT                   PPRPRPHQNAQGAGASAPRPGNNPFSRKQGMRAPTPGDIPRPHPMSRPGAENGRGGRPG
FT                   QAGSGPQGSRGERAERGGRSRGGRSGQGGARSSQWSGQRRGQGGAGAGSGASSRPSAES
FT                   RFASQGASFQAAAAGAPNGGPSRGGGRGRAGAAGAFGRQGGKSSKARKNRLAKRREYEE
FT                   LKAPVIGGVRIPSGNGATIRLRQGATLSDLAEKIDVNPAALVTVLFHLGEMATSTQSLD
FT                   ESTFQILGEEIGWNISIVSAEEEDKELLQQFDIDLDEEELQEDDDLQSRPPVVTVMGHV
FT                   DHGKTRLLDTIRKSNVIDREAGGITQRIGAYQVTVNLEGKPRKITFLDTPGHEAFTAMR
FT                   ARGAELTDVAILVVAADDGVMPQTVEAINHAQAAHVPIVVAVNKIDVEGANPEKVRGQL
FT                   TEYGLVAEEYGGDTMFVDISAKQGTNVNKLLEAVLLTADAELDPKANPNMDARGATIEA
FT                   RLDKGRGAVATVLVQQGTLHIGDSIVAGTSYGRVRAMLDENGKHLQDAAPSTPVQVLGL
FT                   TSVPTAGDLFLVTSDDRSARQIAEKRAATERAAQLAKRRKVVSLESLKEQFAKSEVDML
FT                   NIVIKGDSSGSVEALEDSLMKIEVSEEVGIQVIHRGVGAITQNDVNLATVDKAVIIGFN
FT                   VRPNRQVADLADREGVEVKYYSVIYKAIEDIEAALKGMLKPEFEEVVTSHSEIREIFRS
FT                   SKFGNIAGVMVQDGEVKRGTKCRILRDGVATVNDLEISSLRRFKDDVQSVSEGYEAGIN
FT                   LGSFNDIELGDIIETFEMKQIERK"
FT   gene            307099..307653
FT                   /gene="rbfA"
FT                   /locus_tag="HMPREF0424_0286"
FT   CDS_pept        307099..307653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="HMPREF0424_0286"
FT                   /product="ribosome-binding factor A"
FT                   /note="identified by match to protein family HMM PF02033;
FT                   match to protein family HMM TIGR00082"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14493"
FT                   /db_xref="GOA:D2R9Q6"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Q6"
FT                   /protein_id="ADB14493.1"
FT                   /translation="MAGTNPRAARIAALIQRVIASNMESHLHDKRLASVTITEVRVTND
FT                   LQIAKVYWTQLGHEGKEQGERQRAAQALQQAHGRLRSLVGAKAGLRLTPQLQFIYDEVP
FT                   SEAHEIEDILVAARHRDEELAKLRENAKYAGDVDPYKKPREVEESDDDFDDDNFDDDDF
FT                   DDDDDFESDDFEGTSESSDNN"
FT   gene            307702..308805
FT                   /gene="truB"
FT                   /locus_tag="HMPREF0424_0287"
FT   CDS_pept        307702..308805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="HMPREF0424_0287"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="5.4.99.-"
FT                   /note="identified by match to protein family HMM PF01509;
FT                   match to protein family HMM TIGR00431"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13513"
FT                   /db_xref="GOA:D2R9Q7"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Q7"
FT                   /protein_id="ADB13513.1"
FT                   /translation="MCIPDSGLLLVDKPQGVTSHDIVACARHLLHTKRVGHAGTLDPMA
FT                   TGLLIIGFGNATRLLNYMLGHNKTYEAVIRLGEATTTDDAEGEILPDDALNIGPGVHVA
FT                   NKDMSFEKSLSFERIKQVVSENLVGKIMQAPTAFSAIKINGQRAYDLAREGKSVEIAPR
FT                   EIFVSDFSVSNPRITRGVSGKLVCDISAKVSCSSGTYIRALARDLGRLLGVGGHLTQLR
FT                   RTSVGDFSVTDSRVLKLRSQMREFTDRNGVLQHRSKAVPSDDFDANNMLPKICLNMMDA
FT                   ASHSLPTLSIDENQAKDLRFGRWIELKSGINYENYPAIAYVPNANTEECDVVAVVELTK
FT                   NIKSNQIKPIVVFPASEKTGKLDKYLK"
FT   gene            308867..310111
FT                   /locus_tag="HMPREF0424_0288"
FT   CDS_pept        308867..310111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0288"
FT                   /product="riboflavin kinase"
FT                   /note="identified by match to protein family HMM PF01687;
FT                   match to protein family HMM PF06574"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14583"
FT                   /db_xref="GOA:D2R9Q8"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Q8"
FT                   /protein_id="ADB14583.1"
FT                   /translation="MKVIDIRPDANGMINWPTLSAERKAVVTIGVFDGMHKGHREVIRR
FT                   TVDLAHRHGAFSVVIMFDPRPSVVHANPDLYDDFGDVNSKLPDDPDALTSVRQRLRVMS
FT                   QLDVDHVVIVRYSLAFAAKSYRFFLGQLVGKLGMRALVLGSDAALGARRAGDIKAIREL
FT                   SQATGVFELIEVEDLGPDDVRVPDPIVREVPQEPGDPKDPSEGMNKAEYRAWSKSMPNK
FT                   KVRAWSSTNVRWMLATGRVKEAREILDQPHRVEGTVVHGDERGREIGFPTVNLGEKIEG
FT                   YVPVDGVYAGWVVDLDADNKNDVRPSKNAVPDVSVLRRDELHLGVHSPWRWPAAISIGT
FT                   KPTFNKDGEEDAERTVEAYGLFDDWKDLYGHRVCIEFASFLRPQQAFDSVDALKDMLKA
FT                   NVEQVREITDAEAEV"
FT   gene            310223..311266
FT                   /locus_tag="HMPREF0424_0289"
FT   CDS_pept        310223..311266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0289"
FT                   /product="ADP-ribosylglycohydrolase"
FT                   /note="identified by match to protein family HMM PF03747"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13753"
FT                   /db_xref="GOA:D2R9Q9"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Q9"
FT                   /protein_id="ADB13753.1"
FT                   /translation="MINASINLEQSETYNRAFGAIVGLAIGDALGMPTQSMSAQSIRRF
FT                   YGGPITRLMDAVSQQPIAPNMKAGSVTDDTEQAFLLAERIIADNGNIDNNKYAQNLLDW
FT                   EDAMREKGSLDLLGPSTKSALKALVNGVSPEETGKFGTTNGGAMRATPIGIAFKPGESL
FT                   ANAARKSCLITHNTTQGIESTTLIAAAVSLGIEGCENPLKEAIKFVKSLPKYGNWSAKA
FT                   SVISRVEFFTKKAEELSFASVSDEEFAEILQNDCGTSVEANESVAAAFAIATRFANEPT
FT                   KAACFAASIGGDTDTIAAMCSAMLGSQYGLQVFDEKIRERVLENLRIEHCYDVEKTVYD
FT                   LCLMRKN"
FT   gene            311321..312445
FT                   /locus_tag="HMPREF0424_0290"
FT   CDS_pept        311321..312445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0290"
FT                   /product="kinase, PfkB family"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14119"
FT                   /db_xref="GOA:D2R9R0"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9R0"
FT                   /protein_id="ADB14119.1"
FT                   /translation="MYKSNISLNEKASLVVPQVISLGQIIVDVTMKVSFVPKPGEDIFA
FT                   NSYSMSAGASYNMLFAASQMGAKAQWAGVLGEGYFANIISKALNEAHISHIGTKNSMLD
FT                   SGFCIALTDKSAERTFISTKGAETSGDEHAFDLVNPNPQDVVYISGYTFVSPIKRALLR
FT                   FMLRTCGSISSALSSALESSFDKHKRRFTAIFDASPMIANILDEDLKALIDYAPIWLCN
FT                   AREAEILAKRLNAWGNDEIEDDCSEDADESKDADSKNFTDETNNQLTKRKIERLQRALK
FT                   APLIVHAGSHGAWVCDLGKEAEHIKGFQVKAVDTNGAGDAHTGVLAACIGYKMTLKQAV
FT                   LCANAAAAIAVTKYGPATCPTKKEIEDFIKTNVY"
FT   gene            312525..314048
FT                   /locus_tag="HMPREF0424_0291"
FT   CDS_pept        312525..314048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0291"
FT                   /product="permease, cytosine/purine, uracil, thiamine,
FT                   allantoin family"
FT                   /note="identified by match to protein family HMM PF02133"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14310"
FT                   /db_xref="GOA:D2R9R1"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9R1"
FT                   /protein_id="ADB14310.1"
FT                   /translation="MSKSQVGESKTQQATDSSSQHSLSIEEQGIDTISESERKGTPSSL
FT                   FWPWFASNISVFAMSYGAWALGFAISFWQATLMTIIGVIVSFLLVGVISIAGKRGNAPT
FT                   MVLTRATFGVRGANIPAALSWIATLGWEISLAITAVLAMATAAEKIGWGSGTSVKIVST
FT                   IIVVGLIVIVGIYGYDLIMKCQQVITIVTGIITLGFFVLGWGHINFAAIGQIPNGSLPA
FT                   MLGCCFFVMTGFGVGWVNVAADYSRYLPRKSSNSGIVFWTTFGASIANVFLIFYGLLLA
FT                   ASNMELAQNVGNDPIGAIAAILPAWYLIPYTIVAVLGLMSGAIMDNYSNGLALLSFGIR
FT                   IPRTVAAIITAILTTLGVVYVTFFSDTFIGPFQGFLTTLGVPMAVWAGMFTTDVLVRKK
FT                   DYCTEDLYKPEGRYGAWNVKAFAILCVGTIVGWGLVVNSAAKWLTWQGYLLWFVGGKSS
FT                   SWAGANLGVIVALLIGLIGSLIFQRKDIAKQEADLPTSEVGLQTSEIAE"
FT   gene            314091..314648
FT                   /locus_tag="HMPREF0424_0292"
FT   CDS_pept        314091..314648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0292"
FT                   /product="isochorismatase family protein"
FT                   /EC_number="3.-.-.-"
FT                   /note="identified by match to protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13688"
FT                   /db_xref="GOA:D2R9R2"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9R2"
FT                   /protein_id="ADB13688.1"
FT                   /translation="MIKEDEWLVVIDRQRVFCESEWSTWACADHTYDSTTEAFTKLAKA
FT                   YGNRVIYTRYVAPLKPENAWVDYFKDWPQFLVKPDDPMYDFTPETAELAEGHTVVTCET
FT                   FGKWGRKLKAALGECRKITICGVATDCCVLTTALAAADNGVAVRIAEDACAGSTPENHK
FT                   LALKTMELFTPLITVCSTSEIL"
FT   gene            complement(314677..316164)
FT                   /gene="radA"
FT                   /locus_tag="HMPREF0424_0293"
FT   CDS_pept        complement(314677..316164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="HMPREF0424_0293"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by match to protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13887"
FT                   /db_xref="GOA:D2R9R3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9R3"
FT                   /protein_id="ADB13887.1"
FT                   /translation="MASKSTLHYLCSECGWSGSKWYGRCPECGEWGTVNEFREARVSGL
FT                   SRTTRTPRATTASRAYSPDSITTSNRNIAHSTLDSATSAQPISEIQADDAMRIHTGFSE
FT                   FDRVLGGGLVPGSVTLIAGEPGIGKSTLLLKAAAYVSKQSKESNTPPVLYISGEESAAQ
FT                   VKLRASRINAVNDYLLLATTGDLDTVLDLIETHHPTLAIVDSAQTISAQEVDGITGGST
FT                   QVREVASALIDVAKANNIPILLVGHVTKDGSIAGPRTLEHLVDTVCQFEGDTQTALRML
FT                   RAVKNRFGPTDEVGCFDMSGEGIEEVPDPSGLFLSSTENANQGKNAQDCTNDGTCVTFT
FT                   LEGHRSLPIEIQALVTQSALPTPRRAVSGVDSNRLAMLTAVLYRHGRVNLLAKDLYVST
FT                   IAGALAKEPSCDLAIVAALASTAAGKAVTPKTCAIGEMSLTGQVRPVPRIEPRLREAAR
FT                   IGYKRAIVCHMWKNVNIPGLEIIEVSTVREALKALGL"
FT   gene            316272..316928
FT                   /locus_tag="HMPREF0424_0294"
FT   CDS_pept        316272..316928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14415"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9R4"
FT                   /protein_id="ADB14415.1"
FT                   /translation="MSKSNASSMNASKMGALNMNSSSVNNSSHSKLLVVLTSAVVIVVL
FT                   ALISAFMWPGWALNHENVASKNHMVMPKTPSMPSKPLPASSTALLKAMPDSVLDFARVD
FT                   AIPSATWTESSPLEEYSVKYSTGQPDGEVSVTVAQWSNRDSANKQYEALVDGLKGSEIA
FT                   SGKIQVSGKAAGSYVLRNDENDKSQASALWQNDTAVFEVNGAKQAVERFYHRFPM"
FT   gene            317427..317711
FT                   /locus_tag="HMPREF0424_0295"
FT   CDS_pept        317427..317711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0295"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13722"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9R5"
FT                   /protein_id="ADB13722.1"
FT                   /translation="MPERLKRSARRHFNAETRLSWKSSGLPTRVSQASVIKRERIVKKR
FT                   LRIKRPKERSRGLGALATELALKAHRAFNLSKLTLRVAFARTMLRSSRS"
FT   gene            complement(317840..318538)
FT                   /gene="rpiA"
FT                   /locus_tag="HMPREF0424_0296"
FT   CDS_pept        complement(317840..318538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="HMPREF0424_0296"
FT                   /product="ribose 5-phosphate isomerase A"
FT                   /EC_number="5.3.1.6"
FT                   /note="identified by match to protein family HMM PF06026;
FT                   match to protein family HMM TIGR00021"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14073"
FT                   /db_xref="GOA:D2R9R6"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9R6"
FT                   /protein_id="ADB14073.1"
FT                   /translation="MDKAQQDALKKAAGIEAAKIVKNGMMVGLGTGSTVRFLVDELGRR
FT                   VKEEGLSFTGVTTSRRTQEQAEGYGIKILDINEVDHIDVTIDGSDEVDKNFNGIKGGGA
FT                   ALLWEKIVAINSDRIVWIVDASKVVDTIGKFPLPVEVIPFGSAQVIRKFEKRGYKPVLR
FT                   LDADGKEVRTDENNFVVDLHMERIEHPQELAKDLIETVGVVEHGLFLNMVDTVIVGDPN
FT                   GPRTLTNPNK"
FT   gene            complement(318885..319970)
FT                   /gene="rnhA"
FT                   /locus_tag="HMPREF0424_0297"
FT   CDS_pept        complement(318885..319970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="HMPREF0424_0297"
FT                   /product="ribonuclease HI"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by match to protein family HMM PF00075"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13568"
FT                   /db_xref="GOA:D2R9R7"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9R7"
FT                   /protein_id="ADB13568.1"
FT                   /translation="MRWLQSAAGAFLKGFVMIVVSTDGSALGNPNGSMGWAWADHIDES
FT                   GSSNEHHHTGNADAGGATNGTNQIGELCAVLEALRAHPGREPLTIESDSQYAINCATTW
FT                   IHGWKKNGWKNSKNEPVKNAELIRAIDAEITKREGAVKFVWVKGHAGNEGNEKVDTLAR
FT                   GYAEDCRNGLKDGYLPLEGWKSLLASEYAKGTNVPSDAKMLLDGKISHAKYHLERTVGE
FT                   DINPDFSAQNSKNTSDLTESANESAREQARETKRETLENSEKDALSIENEQDAHQQDAH
FT                   QQDAITIVQEVPKTKQNVTQTASKPVQGLSVSGVLQFTPPPNTSPSFNGEARFISGTIN
FT                   VNGYVEPDGTLHLSPTAFYLS"
FT   gene            complement(320006..321679)
FT                   /gene="pgm"
FT                   /locus_tag="HMPREF0424_0298"
FT   CDS_pept        complement(320006..321679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="HMPREF0424_0298"
FT                   /product="phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific"
FT                   /EC_number="5.4.2.2"
FT                   /note="identified by match to protein family HMM PF00408;
FT                   match to protein family HMM PF02878; match to protein
FT                   family HMM PF02879; match to protein family HMM PF02880;
FT                   match to protein family HMM TIGR01132"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13953"
FT                   /db_xref="GOA:D2R9R8"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9R8"
FT                   /protein_id="ADB13953.1"
FT                   /translation="MVAKNAGMPATPEDLVDVDALVGAYYDEVPNSNIPEQRVIFGTSG
FT                   HRGSALKTSFNEAHIVAITQAIAEYRKSAGVTGPLYIGRDTHALSEPAQKTAIEVLVAN
FT                   GVHVRVDSRGDFVPTPVVSQAILTHNRAADGTQRFSGDGLADGIVVTPSHNPPTDGGFK
FT                   YDPVTGGPAPADVTNAIANRANELLDNYKSVKRVPFEEAIKSDLVEGFDYREHYVSDLA
FT                   NVIDFDVIRSSGVRLGIDPLGGASVNYWPLMNEKYGLNIGVVRPEVDPTWRFMTIDHDG
FT                   KIRMDPSSPYAMKGLVDQLNAGAWDKYDLVGGTDPDADRHGIVCPNWGVMNPNHYIAVC
FT                   VEYLFGGARPDWPKNTAIGKTLVSSSLIDRVAASINAKLVEVPVGFKWFVDPLFSGEVA
FT                   FGGEESSGMSFLRKDGRVWTTDKDGLIPDLLAAEITAKTGKNPAQLHQDQVARFGESWY
FT                   KRVDTPTTLEQKQKFAALSGNDVEATKLAGEDITAKLTEAPGNGAKIGGLKVTTKNNWF
FT                   AARPSGTENIYKVYAESFVSPEALDKVLEEATAVVDKALA"
FT   gene            complement(321715..322830)
FT                   /locus_tag="HMPREF0424_0299"
FT   CDS_pept        complement(321715..322830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0299"
FT                   /product="diacylglycerol kinase catalytic domain protein"
FT                   /note="identified by match to protein family HMM PF00781"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13744"
FT                   /db_xref="GOA:D2R9R9"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9R9"
FT                   /protein_id="ADB13744.1"
FT                   /translation="MPIQATIALMMIVFALVLAPFVIMIVTRAMKRHHLAKKLAKRHGD
FT                   SVHYAFILNPSKPQAESYRESIQNYCDKRKLTYEIIDTQLDKDGRECAQEALSNGANVV
FT                   VAVGGDGTVRTVASAVSGKGHAMGIIPIGTGNLFARNMGIPVNDVEAALRVATSHGSRQ
FT                   VDVGRVTILDNPKEDHGHAFLIIAGIGFDALMIDDTDPKLKKNISWLAYFVAGVKHLFM
FT                   PKYRATVTLQRSNGDESVLKGLTFRTLMAGNCGQIPMFSLMPEAAYDDGVLDFEIIDTS
FT                   GGLIGWANLFRGVVHQTVTGHALQQESLSAGSRIDQTQGFSAEVQLEKAAPVQADGDIL
FT                   GYTKHLRFTVDKQALCVRVPASVKTSVTVSE"
FT   gene            323221..325038
FT                   /locus_tag="HMPREF0424_0300"
FT   CDS_pept        323221..325038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0300"
FT                   /product="ErfK/YbiS/YcfS/YnhG"
FT                   /note="identified by match to protein family HMM PF03734"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14117"
FT                   /db_xref="GOA:D2R9S0"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9S0"
FT                   /protein_id="ADB14117.1"
FT                   /translation="MAELQQNFEGDESLNITPSNMPDDASDDTVAFMQVPQSHVEDQIA
FT                   DNSVNYEGTLADNLGEVADEEDTSGDIVDDIVEDIAGNKKNVFGNNAASYGMYANATPA
FT                   DSTATDSFRVVEPKAKKHRTNRSALALMYSLLIFVILLAAAFFALHLYFNNRVAPGVDF
FT                   GDASITRNLTGYQEDSVSKTVQNAVDHSELEISDDQGNSIDADLSQLGVKIDKNATVKA
FT                   IMNAKRDNLFTRIMPWVHQTVSLKAVRDDSALDSYLLHKFIREKDRAVPYSAVFDKDSE
FT                   SYKVEDGIPGRTIETMSVREAVKKLIAYPGKTVKVSVTSRRTDAPIKLDAAQKLVNDLN
FT                   KLLEKKITFNNGDGKDFTVPKEAIASWISIKADTTRRKLSYTIDADKADYYLSQVLPKE
FT                   LNQQKINQEDAIDKEGRFIFTTLKGSNGVEINYSNSVAKKAVESLRNGNDFKMAVPAKI
FT                   TKFTVEKKLVEMRIVVDKTTQTASVYKNDELVKTFPVCTGKRGADDSASGTFFIYLRYA
FT                   SQDMRGRNGDGSPYFSPGVRWVSYYHGGEGFHTASWNYKGIATGDAANHGSHGCINMYE
FT                   QDARWIFENCPRGTIVQIVGTTPDGPVRE"
FT   gene            325047..326519
FT                   /locus_tag="HMPREF0424_0301"
FT   CDS_pept        325047..326519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13834"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9S1"
FT                   /protein_id="ADB13834.1"
FT                   /translation="MGNSLNKDERAEELLLSARSNLECVQSPQSTPKLAASRRISSAPI
FT                   PVHVTATLFDTPSKAECIDNKPLLVRFGRRLVTSIVGMWMRLAGRVARRLGWFPSVEPY
FT                   IGYGTHRYARLICRTVYAPKLGHHSALKRGIYAMLVVPAVRVRVALSIDGIPVETAQIG
FT                   DSEIYDKPEGSRDGSAEYCISDRAGYLDLITERALEPGRHVVSYSVSDREPVKASLFAI
FT                   DANVPVGVISDVDDTIMVTQAPSPIRAAYNLLIMNPAHRSPVTGMSEFFQSLERLRDDI
FT                   PFFYLSTSPWNVEASIRHFIDREKFPEGPLLLRDLDPRPKTFIPNGPQHKLEFATQLMD
FT                   DFPGMRFVLIGDDGQKDPLTYANIIRKHPGRVLAVGIRQLRKRATVEDFRRKLSRDFAV
FT                   ALSASKRAYVFSDALDTTCEAAQEIPTMAIEKLHNANEFSGDIDDFDDAQMRIIEAEGA
FT                   VGTLQGVPFFAAPQGKDLAKVMLPFIEEAIAK"
FT   gene            326633..329089
FT                   /locus_tag="HMPREF0424_0302"
FT   CDS_pept        326633..329089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0302"
FT                   /product="peptidase, S9A/B/C family, catalytic domain
FT                   protein"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF00326;
FT                   match to protein family HMM PF02897"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14465"
FT                   /db_xref="GOA:D2R9S2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9S2"
FT                   /protein_id="ADB14465.1"
FT                   /translation="MNNQDFAKPKAAERIPSTREFHGDTYIDEYAWMKDRNNPKLMEYI
FT                   NSQNAYTEQRVKHLENLRSTLFDELRSRVQETDMSVPVRMNNYWYYVRTEKGKQYAVQC
FT                   RMKVKNSDDWNPPTIDNSAKPGTTDGEEILFDANLESEHSGGKFFRVGGMDLSTDGLRM
FT                   LYGVDTQGDERFNYFIRDFSTKTCSWLQLEESWENLASASLSPDGKWVFYVKLDDAWRP
FT                   YQVWRHKVGTSVSNDVKVFEETDERFFVDVYESFDERYMMISSSSKTTSRVLMLPLSNP
FT                   EGEFRMVIEPVEGVEYDISFACFENAGENGEDIPIAIVCHNAKNPNFEIDIIDMRGNSG
FT                   KFDEHITYKLSDGVCVASGSPYGCEQGDAWQQGAGSEPITKPYNSPQNPEILQNAVGLS
FT                   ISGLSMYKNYVALAYRSQGLPHLAVMSKKRAVEDFLQAKPWRFCEVRPLSSQLANQFTD
FT                   QLSSQLVDQAQAESRAALANISQEEINNNRLLSISMTGNPSYEAPRMRYAFGSYATLGQ
FT                   LRELDPLTGEDVLLKQGKILGEFNERNYAEKRVWITARDGERVPVSLVWRPDKISQTDS
FT                   MFITGYGAYEVSSDPTFSVGRLSLLDRGVLYAQVHVRGGGEMGRAWYEQGRRVNKKHTF
FT                   EDFADATRALQNAGFASACHTVANGGSAGGLLMGAIANMAPECYAGIEADVPFVDALTS
FT                   MLDSSLPLTVTEWDEWGNPLDDPEAYAYMKSYTPYENVPCVKMEDGCKKLADFPKILIT
FT                   SSIHDTRVLVTEPLKWLAKLQASGVDAIARIETDGGHGGTSGRYRQWQELAYENAWCLH
FT                   VMGINS"
FT   gene            329259..329969
FT                   /locus_tag="HMPREF0424_0303"
FT   CDS_pept        329259..329969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0303"
FT                   /product="cyclic nucleotide-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00027;
FT                   match to protein family HMM PF00325"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13975"
FT                   /db_xref="GOA:D2R9S3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9S3"
FT                   /protein_id="ADB13975.1"
FT                   /translation="MATLNVDSDEFSLQHTALFKQVPADQVKELMQYLQESTFKKGSAI
FT                   FNEGDTDHRMYLLERGRVKLVRHSNDNRVQLLSIHTPGEILGEIPVFDPSGGPRTASAI
FT                   SITNNTRVLWLENDVLFHWLNNHPSVAVDMLQVLAARMRANNERISDLVFMDVPARLAK
FT                   TLLNLASRFGEPMSDGLLVPHDLTQEELAQLVGSSRETVNKALMDFANRGWIMRQGRSI
FT                   IIYKPGMLIRRAER"
FT   gene            330028..332349
FT                   /locus_tag="HMPREF0424_0304"
FT   CDS_pept        330028..332349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0304"
FT                   /product="transglycosylase"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF00912"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14656"
FT                   /db_xref="GOA:D2R9S4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9S4"
FT                   /protein_id="ADB14656.1"
FT                   /translation="MSKKNSLTVRRVLALFLTYITLCVAGGIAASIMFVPGVMSVNSVV
FT                   KTVVPSLRVDGIDFDVTALPQKSRLYASDGKTIIATFYAQNRTVVPLRRISQYMQRAMV
FT                   AREDRRFFEHSGVDMQGVIRAFVQTFVKKGDMQGGSSLTQQYVKNVLMIKARENNDPLA
FT                   EYHASEGTIARKLREMLIAIQMEKKYSKLEILQGYLNIAQFGSNNIYGVETAAHRYFNT
FT                   SAAKLNLVQSATIAAITKNPSRYDPSIETNQPEAQKQRNIVLDLMLRQGFITKSEHDSA
FT                   VAIPLKSTLNIQREVSKIGCQAAGDAAFFCDYVTKKILHSREFGKTAAMREKLLTEGGL
FT                   DIYTTMDLRASKAAMKAARDTIPVNDKSGFEVSIAAIKPGTGEVLAFGSNRIYDATDAA
FT                   KSDPTHTALNYAVDERDGGGLGWQIGSTWKPINMVAWMLAGKSINQPLRTSMLYNNADF
FT                   NCSKFRGVGSWSVQNSGGGTTNPETPLQGLVRSHNTTQASMAQQIKLCSIADAARILGY
FT                   HNSPLGQESVYSANSLNPPMTIGSVQASPLTVANVYATIGADGVACDPIAIKRVVDKNG
FT                   KRLKVPSAHCHQAIPKGIAQTAAYALNQGVVQPGGEASTTQLDGGRKTFAKTGTNEQYY
FT                   MTTAGFVPYQVASFVAVGNAESQKSFNGMTINGRTMAAWYGMYIATPAWKQFMNDYLKA
FT                   ANIPVDNDYGKPDPKYTAGGTLPGTPKNTVKTDQQKRDEDARKQAAQEQQEEAKTQKNT
FT                   QDQYGTARRDDYGDSETDNY"
FT   gene            complement(332493..333647)
FT                   /locus_tag="HMPREF0424_0305"
FT   CDS_pept        complement(332493..333647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0305"
FT                   /product="putative dihydroorotate oxidase"
FT                   /note="identified by match to protein family HMM PF01180"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13795"
FT                   /db_xref="GOA:D2R9S5"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9S5"
FT                   /protein_id="ADB13795.1"
FT                   /translation="MYYVSEHSLHNVVNKATTDLFTFSYKRIIKPHFVFNIPPDEAHDR
FT                   MINFCKFSERTPGLMWLLREMLNYTDPVLETNVMGVDFANPFGLSAGLDKNCQMATVLD
FT                   NAGFGFETVGSTTSRPCEGNQKPWYHRLPEYDSILVHAGLANDGSEAVVARAEKAWTHA
FT                   KSMNMSISIARTNDDLVGDLEEGIEDYHISMERAAGKSSIIEVNISCPNTRVGEPFSQP
FT                   EALDKLFTDLDTIKRPQPTLVKMPLNLHGGWEQFKSLLDVLAEHKVDGVSIANLQKNRA
FT                   GLDVPEDWQGALSGGPTYSASNELIRRTRKAFGERFAIAGIGGVFTPEQAYEKIRSGAD
FT                   LVMFITSLMYRGPQQITTLKRGLADLLKRDGFEHVADAVGADLN"
FT   gene            333851..334708
FT                   /pseudo
FT                   /locus_tag="HMPREF0424_0306"
FT                   /note="transcriptional regulator, DeoR family; this gene
FT                   contains a premature stop which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00455; match to protein family HMM PF08220; match to
FT                   protein family HMM PF08279"
FT   gene            335221..335784
FT                   /locus_tag="HMPREF0424_0307"
FT   CDS_pept        335221..335784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0307"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13672"
FT                   /db_xref="GOA:D2R9S6"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9S6"
FT                   /protein_id="ADB13672.1"
FT                   /translation="MLNKKTIAAFAAGATLLSGFAFAVPAMAEAPAAPAAPAAPAAPAA
FT                   PAAPAAPAAPAEPTYNKSFYKTETFEELDARLAKEKAEKEAKAKAEDENDKYEHSPFGN
FT                   KDMDYAKCVKLYGKDSLECKAVADYLKRHGQKVDDKANDKKSDKKSEAKKAAPLAKTGA
FT                   AVALAAVAASVLAGMGAALRKIRH"
FT   gene            336198..336494
FT                   /gene="rpsF"
FT                   /locus_tag="HMPREF0424_0308"
FT   CDS_pept        336198..336494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="HMPREF0424_0308"
FT                   /product="ribosomal protein S6"
FT                   /note="identified by match to protein family HMM PF01250;
FT                   match to protein family HMM TIGR00166"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13512"
FT                   /db_xref="GOA:D2R9S7"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9S7"
FT                   /protein_id="ADB13512.1"
FT                   /translation="MSAHKYELMFIANPELDEHGLKKLTEQYLELVTNEGGSVDGTDYW
FT                   GRRKFAYEIEGKTEGNYVVVNYTAEPSVSDELDRVLNLNESVIRTKILRKDAK"
FT   gene            336645..337226
FT                   /locus_tag="HMPREF0424_0309"
FT   CDS_pept        336645..337226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0309"
FT                   /product="single-strand binding family protein"
FT                   /note="identified by match to protein family HMM PF00436;
FT                   match to protein family HMM TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13966"
FT                   /db_xref="GOA:D2R9S8"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9S8"
FT                   /protein_id="ADB13966.1"
FT                   /translation="MAGETIITVVGNLTSDPELRALSNGASVASFTIASTPRTFNRNTN
FT                   QFEDGPALFMRCSAWRDLAEHCANSLSKGTRVIAQGRLSQRSYQAQDGSNRTVVELTVD
FT                   EIGPSLRYATAQVNRQSSSTGFAGGSRASNAAGAGYAGGANYAASQAASQHAANSSAAD
FT                   PWSAAAPTNDSFSTFGANSDFGGDSEEPEF"
FT   gene            337362..337610
FT                   /gene="rpsR"
FT                   /locus_tag="HMPREF0424_0310"
FT   CDS_pept        337362..337610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="HMPREF0424_0310"
FT                   /product="ribosomal protein S18"
FT                   /note="identified by match to protein family HMM PF01084;
FT                   match to protein family HMM TIGR00165"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13876"
FT                   /db_xref="GOA:D2R9S9"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9S9"
FT                   /protein_id="ADB13876.1"
FT                   /translation="MSRKRPQPPVKPFKKKPNPLKAAKITEIDYKDVALLRKFVSDRGK
FT                   IRSRRITGVTVQEQRKIAKAVKNAREMALLPYATTGR"
FT   gene            337627..338073
FT                   /gene="rplI"
FT                   /locus_tag="HMPREF0424_0311"
FT   CDS_pept        337627..338073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="HMPREF0424_0311"
FT                   /product="ribosomal protein L9"
FT                   /note="identified by match to protein family HMM PF01281;
FT                   match to protein family HMM PF03948; match to protein
FT                   family HMM TIGR00158"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13661"
FT                   /db_xref="GOA:D2R9T0"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9T0"
FT                   /protein_id="ADB13661.1"
FT                   /translation="MAETKVILTKTVANLGHSGDVVEVKAGYARNYLIPQGLAFAWNKG
FT                   AASQIEAMRRARLAKAVATREEAVAAKAQIEGTVVELSAKVSESGKLFGGISAEKIAAA
FT                   LASKAQVEARAIKVATIKTTGEFPATVTLHPEITASFTVKVVAE"
FT   gene            338353..339555
FT                   /gene="mvk"
FT                   /locus_tag="HMPREF0424_0312"
FT   CDS_pept        338353..339555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvk"
FT                   /locus_tag="HMPREF0424_0312"
FT                   /product="mevalonate kinase"
FT                   /EC_number="2.7.1.36"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM PF08544; match to protein
FT                   family HMM TIGR00549"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14354"
FT                   /db_xref="GOA:D2R9T1"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9T1"
FT                   /protein_id="ADB14354.1"
FT                   /translation="MLESKYELADEFSMNAKAQDASISAIRNDEEYACKNSAITPSAIT
FT                   NLENAIKYSNHKGYGETCAKVILFGEHSVVYGHSAIALPLKNLRMRAVVTNCNESLVPV
FT                   SCKSLSSASCESLASASRESLASTTNLDSHITLSCLDFTGKLSEIPTRFNSIRTAIRAS
FT                   LEFAGWSGENLHIFTESDFPAERGLGSSAAAAGAIIRAILDYYGVSASDDEIFKLTQTA
FT                   ECVAHGRSSGLDATATAASWPVRFSRGCFDRMEINMRAWLVLADSGCKGMTRETVEALH
FT                   SRLESNPVEVGAQLNKLGEIAAVAEDDLVFGRIENMGKQMTFAHRILADLGVSTAKLDT
FT                   LVDAACKHGALGAKLTGGGGGGCVIALADSEDAAKRVSEAFKNAGACDTWIVNIGDSAI
FT                   N"
FT   gene            339691..340788
FT                   /gene="mvaD"
FT                   /locus_tag="HMPREF0424_0313"
FT   CDS_pept        339691..340788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaD"
FT                   /locus_tag="HMPREF0424_0313"
FT                   /product="diphosphomevalonate decarboxylase"
FT                   /EC_number="4.1.1.33"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM TIGR01240"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13485"
FT                   /db_xref="GOA:D2R9T2"
FT                   /db_xref="InterPro:IPR005935"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR029765"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="InterPro:IPR041431"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9T2"
FT                   /protein_id="ADB13485.1"
FT                   /translation="MQNVEIQPKITFDASLSPNSAFAKANANIALIKYWGKRDEKLILP
FT                   YTSSLSLTLSDLSTTTSVSFVNNLEQDTFTLDNEKISSSAKTFRRVVAMLDLVREIARI
FT                   STKASVISHNIVPTAAGLASSASGFAALASAASYAAGLNLTPRELSRLARRGSGSACRS
FT                   IFGGLSIWHAGCDDETSYAEPIENAQVALKNLNLAMIVVTLDDSKKPISSREAMRRTVE
FT                   TSPTYMQWVEQSKDDLEIAKNAIKRADIEQLGEVVERNAFGMHETMHNAVPSVNYLTSS
FT                   THIVLEAVKNMRKDGWLVWSTMDAGPNVKVLTSGDDAYRAMCQLRSRVEDGLRNSSVFC
FT                   NTEYCEPKFAIALPGDAVTVSTSLK"
FT   gene            340798..343137
FT                   /gene="fni"
FT                   /locus_tag="HMPREF0424_0314"
FT   CDS_pept        340798..343137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fni"
FT                   /locus_tag="HMPREF0424_0314"
FT                   /product="isopentenyl-diphosphate delta-isomerase, type 2"
FT                   /EC_number="5.3.3.2"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM PF01070; match to protein
FT                   family HMM PF08544; match to protein family HMM TIGR01220;
FT                   match to protein family HMM TIGR02151"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13528"
FT                   /db_xref="GOA:D2R9T3"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR005917"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9T3"
FT                   /protein_id="ADB13528.1"
FT                   /translation="MTQVRSSAPGKLYIAGEYAVVDGCAAIVAAVSRYVTVSISDETLN
FT                   EELRENLQKNAPSSRNYCGAITSDAEKYKPLLWARASDGSIEIQNDGKYAYVLAAMGVV
FT                   DAYASEKCAPNINRKSYNVHISSELDDAKTGRKYGLGSSAAVTVAVIRALCKWYGLNLS
FT                   TPEICKLALIASSSVKKSGSGGDVAASSYGGWTMYRAYSREWLEAELTLVKSGCSDFGE
FT                   LLHKKWPRLEVKRLNVDKSLKLLVGWTGSPASSAKLVSSVESSVKTSAEGSTESSVETS
FT                   AFDNKNQLFTYEDFCKQSEICVQKLARAIEKFEISEISSGFAQNRALLQKLSALTGTVI
FT                   ETHELTKFIEIATCAGVPAKTSGAGGGDCAIALSTIYDNNVIETMKSTWEANGIKPLNI
FT                   DVTEIFGTGKPSENIVLDAFVKSREPNAQSAQSCTIQNRKDAHIALADKQYKTRADSDF
FT                   DKVRFVPNALPQVALEEIDDSVSVLGSEVCDSVHWCSPIYINAMTGGSDAAKKVNASLA
FT                   RVAAKNSVAMASGSLSAALRDETLLSTFSVIRSENPHGFVMANVSAGTSASDALRAVNM
FT                   IHANALQVHLNAAQELVMQEGDRDFRNWLCNIESIVSACEALSVPVIVKETGCGISAKD
FT                   VHRLKDVGVRTVDVSGRGGTNFVTIENARRNLGDCDYLADWGLTTVESLVDIRKCDSLK
FT                   NMEVFASGGVRTPLDVVRALALGASAVGVAGEFLHTLMHEGEDALSLQIDNWQKQIRVI
FT                   MALLGCKTVKDLQEKTEFVRADCLGK"
FT   gene            343266..343460
FT                   /gene="rpmB"
FT                   /locus_tag="HMPREF0424_0315"
FT   CDS_pept        343266..343460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="HMPREF0424_0315"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by match to protein family HMM PF00830;
FT                   match to protein family HMM TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14194"
FT                   /db_xref="GOA:D2R9T4"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9T4"
FT                   /protein_id="ADB14194.1"
FT                   /translation="MAARCAVCGKGPQTGFTVSHSHIRNKRTFRPNLQPVRTTIDGENV
FT                   RLRVCVKCIKAGKVQRVEA"
FT   gene            343612..345990
FT                   /locus_tag="HMPREF0424_0316"
FT   CDS_pept        343612..345990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0316"
FT                   /product="putative ATP-dependent DNA helicase RecG"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14214"
FT                   /db_xref="GOA:D2R9T5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9T5"
FT                   /protein_id="ADB14214.1"
FT                   /translation="MHTSLCAIISNKRRVSALKSLGIVTVEDALTYYPFRVTSPLRIAN
FT                   LKDVKIGEEVAFYAQVQSINVVPMNARRGFRIEINVLQDMQVVAQLIYFSKNRQYAQWL
FT                   SAKMHVGEMVVVGGMSSAFNGKLQFTHPQILTVSAAEESDSLHQSRDTVRSVEDGLVRM
FT                   SAPMPVYHANSRISSEHIHETILSMLSALSEDSASSAASASSAASASSAACATESLQIP
FT                   NITPESVLKKRNLMTRASAIYSIHNPQSVDEFYKAVDSLRYEEAFISQVAVLRSREDSK
FT                   DNQAKSCNNSLIRNEFVESLPFELTAGQKDVIDEIVRDMREHHPMRRLLQGEVGSGKTV
FT                   VALAAMLEAVGSGYQAVLVAPTQVLASQHAENLRQMITRANLKVPVIVVTGGMRLADRR
FT                   RALASVASGEPSLIVATHAAFSSTFKPTNLALVIIDEQHRFGVEQRDVLLRKMSVDSHN
FT                   SAEKSFTPHLLVMTATPIPRSAAMTWFGDLDASYLTELPGGRKPIRTFVVQESDANTMA
FT                   RMFAHIRARIDAGERAYVVCAHIDDDFNEDSGSASASNFGRDFDSDESEAFEDVSQSVQ
FT                   SNQSEENNADSLRKLHTVNGILKRLSALPQFKGVTFAKLTGRDDDATKRETMERFARGD
FT                   VQVLVATTVIEVGVDVPQASCIVIFDADRFGLAQLHQLRGRVGRGGTNSWAFLVAQTED
FT                   GSLAQERLQVVENSLDGAVIAKKDLELRNVGDVLGDKQSGGRSSLKILRVVKDVKIIAM
FT                   AREDALETLQKDTHLVLLPYLAGAVLDFTRGGSTQIVSN"
FT   gene            346280..347428
FT                   /locus_tag="HMPREF0424_0317"
FT   CDS_pept        346280..347428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0317"
FT                   /product="HTH domain protein"
FT                   /note="identified by match to protein family HMM PF00294;
FT                   match to protein family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14306"
FT                   /db_xref="GOA:D2R9T6"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9T6"
FT                   /protein_id="ADB14306.1"
FT                   /translation="MTEREQQILTWIQQNPMISQQELANLAGITRSGVAAHISNLIRKG
FT                   YLRGKGYIVTPPSYVTVVGGISMDVLGIACGDLMDYTSNASCVRYMLGGVGRNIAVALE
FT                   RLNIRTSMVSVYGGDHNGELFRIDAAANGLDIGYAKQLPESMTASYMYVGDASGQRLLA
FT                   LDDMSIYDHMTPDFLRERMSIIENADILVLDTNIPQKSIEWLCDRYRRPIIVRAITDAK
FT                   APRVLSRLSRIDTLILDTAESQALTGVNAVDERSAIRCANVLLKRGVKRVFVNAGRAGV
FT                   AYGVADEGVSFYPVPVKRVQRMMLTRGNSNVGVEAVGNDNGSSDAATAALIYARYNEFD
FT                   SSKTGRFAVAAAALNTESMQPVHELFNPELISQRMTNIHERI"
FT   gene            347569..347694
FT                   /locus_tag="HMPREF0424_0318"
FT   CDS_pept        347569..347694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13774"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9T7"
FT                   /protein_id="ADB13774.1"
FT                   /translation="MLYDAMKRMCSEMRSGVRAWIIEQFTHKLTAVSSKRNSKNN"
FT   gene            347749..348687
FT                   /locus_tag="HMPREF0424_0319"
FT   CDS_pept        347749..348687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0319"
FT                   /product="Inosine-uridine preferring nucleoside hydrolase"
FT                   /note="identified by match to protein family HMM PF01156"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14604"
FT                   /db_xref="GOA:D2R9T8"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9T8"
FT                   /protein_id="ADB14604.1"
FT                   /translation="MTSIILDCDPGHDDAMAILLALGNPNIELLGVTTVGGNQSLEKVT
FT                   YNARATLEMARATHIPVHAGCDRPMVRPLEVAASVHGESGLDGVTLPEPTRPLDEGHAV
FT                   NWIIDTIMSNEPGTITLVPTGPLTNIAMAVRLEPRIVRRVKEVVLMGGGYHVGNWSAVA
FT                   EFNIKVDPESAHVVFNEDWPITMVGLDLTHQALCTPEVQAKINAIGTSLSAFASGLMDF
FT                   FRKAYKDNQDFIDPPVHDPCTIAYLIDHSVVATRRCPVDVEIKGELTVGMTVADLRGPE
FT                   PSAEECHTQVATKLDFDKFWDLIIDALKRIG"
FT   gene            348806..350230
FT                   /locus_tag="HMPREF0424_0320"
FT   CDS_pept        348806..350230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0320"
FT                   /product="transporter, major facilitator family protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14060"
FT                   /db_xref="GOA:D2R9T9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9T9"
FT                   /protein_id="ADB14060.1"
FT                   /translation="MTEVSSPTPSMLDKGGRSIVALMTALLVAIFAFQLNASMLSPALA
FT                   TMTKELHATDTQIGLTQTVFFTAAALFSLFLPRLSDLVGRKKVLIGILISTIAGCVVSA
FT                   LAPDVNILMLGRILQGASGPVVPMCLIMLRVRVTEEKRYAKLMAILTSVNGGIAGVDAL
FT                   LGGWLAGKFGFRSVFWTMAGIAVAAVIMVIVAAEESYAEETSKMDWLGVVTLGIAFLAA
FT                   YLAINEIDKLANANLTMVAGLVVVAVIFFAIFWRIEGKIAAPLVSTHYMKQRRTWGLLS
FT                   CTLLTMTGVFALMNGVVPQLAQDAKFGAGLGADVVSFATLTPYAIIGFLFGPVAGMLAA
FT                   KFGYRLVLRAGIIVSVIGVVFGMYVANNPSVWSLVALSLALGVSYAGVANIMLNGLGIV
FT                   LSPKDNPGYLPGMNAGAFNLGAGLSFAILYAVMTNVAGTNGATGGYMASMVAGIVLLAL
FT                   AFACSFLIPNPEEVNK"
FT   gene            350485..351069
FT                   /locus_tag="HMPREF0424_0321"
FT   CDS_pept        350485..351069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0321"
FT                   /product="RNA methyltransferase, RsmD family"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF03602;
FT                   match to protein family HMM TIGR00095"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14049"
FT                   /db_xref="GOA:D2R9U0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9U0"
FT                   /protein_id="ADB14049.1"
FT                   /translation="MHIIAGRFKSLPLTSAQSCTRPTTDRTKEAIFSRLDSWDVMHNAR
FT                   VLDLFAGTGALGVEALSRGARELVSVEANSQAAALILRTSKALQSSKVWDSALSMRVLR
FT                   KRAEQFVADYSGEAFDLIFIDPPYAYETADCESLLTSMIASGVASVSADTLIVLERSAR
FT                   SVLPTMPEGWELFDTRNYGETSVLFIQPKRD"
FT   gene            complement(351149..351367)
FT                   /locus_tag="HMPREF0424_0322"
FT   CDS_pept        complement(351149..351367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0322"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13501"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9U1"
FT                   /protein_id="ADB13501.1"
FT                   /translation="MDFQLKRVSQASVIKRERIVKKRLRIKRPKERSRGLGALATELAL
FT                   KAHRAFNLSKLTLRVAFTRAMLCESRS"
FT   gene            complement(351785..352651)
FT                   /gene="trmD"
FT                   /locus_tag="HMPREF0424_0323"
FT   CDS_pept        complement(351785..352651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="HMPREF0424_0323"
FT                   /product="tRNA (guanine-N(1)-)-methyltransferase"
FT                   /note="identified by match to protein family HMM PF01746"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14151"
FT                   /db_xref="GOA:D2R9U2"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9U2"
FT                   /protein_id="ADB14151.1"
FT                   /translation="MDIDIISVFPEYFRMLDLSLLGKAQNNGLLQIRAYNLRKWTHDVH
FT                   QSVDDTPVGGGAGMVMKPEVWAECLDELLNLPKSEVKNTCDTCDSCEEAKIATNKIDST
FT                   KPILIFPNPSAPLFTQKDATELSNANHLVFGCGRYEGYDARIPEYYRAQGIDVREYSIG
FT                   DYVLNGGEVAVSVMLEAITRLIPGFMGNPESIVEESYTGSDALLEHHQYTRPTTWRGIS
FT                   VPEILTSGNHAKVDRFRRDEAISRTSEIRPDLIEKLDCHKIDKADRKTLMSLGWEVSGD
FT                   HPRKNSR"
FT   gene            complement(352693..353292)
FT                   /gene="rimM"
FT                   /locus_tag="HMPREF0424_0324"
FT   CDS_pept        complement(352693..353292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="HMPREF0424_0324"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="identified by match to protein family HMM PF01782;
FT                   match to protein family HMM PF05239; match to protein
FT                   family HMM TIGR02273"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13624"
FT                   /db_xref="GOA:D2R9U3"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9U3"
FT                   /protein_id="ADB13624.1"
FT                   /translation="MNVALDQQSFDNPQQSRNDLLRVCRIGKAQGLKGEVTVQIFTDEP
FT                   YERFEPGNVLCTADGEREFVIENARTFKNRWILLFEESQNRNDAEALNGTELYVHAEDA
FT                   QELAAENAWYIKDLVGLQARLCEENQLGLPACTIGKVVDVLDGAQSLLKIRLNNPIDDD
FT                   NKTALVPFVEALVPEVDVANGYLTIDPPGGLIPGLS"
FT   gene            complement(353294..353527)
FT                   /locus_tag="HMPREF0424_0325"
FT   CDS_pept        complement(353294..353527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13625"
FT                   /db_xref="GOA:D2R9U4"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9U4"
FT                   /protein_id="ADB13625.1"
FT                   /translation="MLAQAVEHLIKNIVDFPDDVSVRSHENARGELLRVRVNPEDIGRV
FT                   IGRNGRTANAIRIVVQALSNHNVRVDIMDVRK"
FT   gene            complement(353530..354000)
FT                   /gene="rpsP"
FT                   /locus_tag="HMPREF0424_0326"
FT   CDS_pept        complement(353530..354000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="HMPREF0424_0326"
FT                   /product="ribosomal protein S16"
FT                   /note="identified by match to protein family HMM PF00886;
FT                   match to protein family HMM TIGR00002"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14271"
FT                   /db_xref="GOA:D2R9U5"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9U5"
FT                   /protein_id="ADB14271.1"
FT                   /translation="MATKIRLKRLGKKFYAFYRVVISDSRNKRNGQSIEEIGVYDPNKQ
FT                   PSMIQIDSERAQYWLGVGAQPTEPVLKLLKITGDWQKFKGLDGAEGTLKTSEAGPDAQA
FT                   RVEAVEAEAQKLKAAKSEAAAKAQAAAEAAANEAEEVPAEAAEAAEAEEKAE"
FT   gene            complement(354117..355292)
FT                   /locus_tag="HMPREF0424_0327"
FT   CDS_pept        complement(354117..355292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0327"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13730"
FT                   /db_xref="GOA:D2R9U6"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9U6"
FT                   /protein_id="ADB13730.1"
FT                   /translation="MILVLAFLWVIFVPLLLWQLMRWLPAGADKYNPLPYVIALLPLAT
FT                   YVVGALFLCNFGAFLLYTCCAEKVTKSLNLAQSYAKSYGYLCVAYAALFLISLKSHTPY
FT                   WFERLRRLHESKSSRKSCKERHQEIRVMTLNCRYGKASASEIIEITKKYHVNTLLLQEL
FT                   SKSLVKNLEKLGIYEIFPTSCVGAQSEHNNGGFNAIFTQYSAISTCTNSVKIEAASVPS
FT                   VTTCLDFGANEKVLVKFASAHPKSPMRGCAAWSNGIRALATIDSTTDSFADCTNECADE
FT                   STSKTCDLATLTIVTGDLNSTVDHPSFRSLLKYGFTDVALSLGKRLRTWPTWLKWPNLT
FT                   LDHVLFCAKNCKSNTLWQKNVVVDSTDHLAYIAAIDLQSLDKNVQARRHNR"
FT   gene            complement(355289..356959)
FT                   /gene="ffh"
FT                   /locus_tag="HMPREF0424_0328"
FT   CDS_pept        complement(355289..356959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="HMPREF0424_0328"
FT                   /product="signal recognition particle protein"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM PF02881; match to protein
FT                   family HMM PF02978; match to protein family HMM TIGR00959"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14412"
FT                   /db_xref="GOA:D2R9U7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9U7"
FT                   /protein_id="ADB14412.1"
FT                   /translation="MAAFSSLTDRLSNAFKHLRSKGKLSESDIDGTIREIRRALLDADV
FT                   ALEVVRSFTARIRERALGEEVSHALNPAQQVVKIVNDELTQVLGAGVDRQLNFAKYPPT
FT                   VIMLAGLQGAGKTTLAGKLGYWLKDAGHTPLLVAADLQRPNAVTQLQVVGERAGVPVFA
FT                   PEKGVQTGGSAISLPWFTKGDPVKVARDSINYAREKMYDTVIIDTAGRLGVDEELMKQA
FT                   RNIRDAVQPQEVLFVIDAMIGQDAVRTAQAFNDGVNFTGVVLSKLDGDARGGAALSVAS
FT                   VTGKPILFASTGEGLKDFEIFHPDRMASRILDMGDILTLIEHAQKQFDEEESRKAAAKI
FT                   AEGSFGLDDFLEQLQQVRKLGSMKKLLGMMPGMAAHRQELEQFDDKEIDRTEAIIRSMT
FT                   PQERRNTKIIDGSRRARIAAGSGVSVSQVNALLQRFEQAAKMMKRMSGGAGMPGMGGIP
FT                   GFGGAGSKSKRKDKKGKKKGGKSGNPMRREAEERALRERLSGESTSDDVAGSAFAKPQQ
FT                   PNLQNLPEGLKELMNSEDANQDNQLPPNFGGGLAGLFGR"
FT   gene            complement(357067..358833)
FT                   /gene="cysS"
FT                   /locus_tag="HMPREF0424_0329"
FT   CDS_pept        complement(357067..358833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="HMPREF0424_0329"
FT                   /product="cysteine--tRNA ligase"
FT                   /EC_number="6.1.1.16"
FT                   /note="identified by match to protein family HMM PF01406;
FT                   match to protein family HMM PF09190; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13880"
FT                   /db_xref="GOA:D2R9U8"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9U8"
FT                   /protein_id="ADB13880.1"
FT                   /translation="MLSRALCYAQAGRRANARKVAHVWSNKQSNAKSQYKEAFIIAIML
FT                   NKSLNEETAKVTKAAENLHLYNTASHSTNTFVPKKHGQVGMYVCGATVQSSPHIGHIRA
FT                   AIAFDIIRRWMLRLGYKVTFVRNVTDIDDKIMKKANESGQNWWERAYIYEREFTKSYNT
FT                   LGVLAPTVEPRATGHITDMVELIERLIERGHAYVIKDNDGNPTGNVYFDVPSWEHYGEL
FT                   THQNQNQNETCADEAAAIADAKGPSVDAAENDIYNPTDPADASPDKHDPRDFALWKAPC
FT                   DFDQPDARWKTPFGEGRPGWHIECSAMSHRYLGNDFDIHGGGLDLRFPHHENEMAQTRA
FT                   AGWESANVWMHSAWVTAKGEKMSKSLGNGLSVPVVLANNSAWVVRYALGAVQYRAMLEW
FT                   SDQALVESKSAYDRIMNFLERADRLLDKKPTCEEVRSVNADELPEDFTRAMNDDINVSG
FT                   AIAEIFTTIRQGNTLIDDCSKDSSQAQSESIQKLIYLAVLQVRAMLDTLGLDPYAKTWA
FT                   SNNNQSPAEGSNGKESKEHSALDSLITLQLKARADARKAKDFATADAIRDALNNAGIVI
FT                   VDTSQGSSWHLQ"
FT   gene            359229..360566
FT                   /gene="pncB"
FT                   /locus_tag="HMPREF0424_0330"
FT   CDS_pept        359229..360566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="HMPREF0424_0330"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /note="identified by match to protein family HMM PF04095;
FT                   match to protein family HMM TIGR01513"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14559"
FT                   /db_xref="GOA:D2R9U9"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9U9"
FT                   /protein_id="ADB14559.1"
FT                   /translation="MAEISSALMTDMYEYTMLDAALKDGTANRKCVFEIFTRHLPQGRR
FT                   YGVVAGMGRILEELQKFHLSEDDLCFLSDRKIVSAETIEWLENFRFHGKISGYREGEMF
FT                   FPNSPILQVEGTFGECTLLETVLLSVLNYDCAVASAAARMVSASAGRPCMDMGGRRTNE
FT                   YSAVAASRAAVIGGFKGTANLLAAKLYGLKAIGTAAHCFTLVHDTERDAFTSQIAALGK
FT                   GTTLLVDTYNIEEAVKTAVEVAGPDLGGIRIDSGDLCALARRVRNQLDELGAKNTKITV
FT                   TNDLDEYALASLQNAPVDSYGIGTMLVTGSGAPTCAMVYKLTEREGADGVMQPVAKRSK
FT                   NKATVPGRKLAYRSYDYSNDSCGVADCERVISGSEVALAQFKPKDSWENLLVDYMVDGE
FT                   ADEQFMGHDAIIRAQDYCASALRRLPLAAQSLMRGDPAIPTEIQVL"
FT   gene            360801..361130
FT                   /locus_tag="HMPREF0424_0331"
FT   CDS_pept        360801..361130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13851"
FT                   /db_xref="InterPro:IPR021400"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9V0"
FT                   /protein_id="ADB13851.1"
FT                   /translation="MFSSLEADNALDAVMESGSQSANPDSGSGTSTSVLERPEVDEDAR
FT                   LDDGGNADRFAHYVSKDKIDESRLTGRPVVALCGKVWIPRHEANDYPVCPECKRIYEEL
FT                   GKFNF"
FT   gene            361257..361805
FT                   /gene="coaD"
FT                   /locus_tag="HMPREF0424_0332"
FT   CDS_pept        361257..361805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="HMPREF0424_0332"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125; match to protein
FT                   family HMM TIGR01510"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14576"
FT                   /db_xref="GOA:D2R9V1"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9V1"
FT                   /protein_id="ADB14576.1"
FT                   /translation="MTIAVCPGSYDPVTAGHLDVIQRCTHLFDEVHVLVAVNAAKTPLF
FT                   SESERVKIIQEAINNLPQSQNSFNRDCKIVVTSTAGLITDYCTKVGATVIVKGLRQNGD
FT                   YEAELGMALVNRKLAGIETLFLPADPVLEHVSSSVVKDVARHGGNVTGMVPDNVIPLLK
FT                   KLFSEQSLGVDNNSSMLNN"
FT   gene            361821..362858
FT                   /locus_tag="HMPREF0424_0333"
FT   CDS_pept        361821..362858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14025"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9V2"
FT                   /protein_id="ADB14025.1"
FT                   /translation="MTNKNELTDATSGLSSEGDDTMEREVQVDRNQKLPLHPVLADEED
FT                   AQDGVVNTTQSDVRSAHEGDLLVDTDADNTETSSVAAVGSVSAAEDVQDNGADGANKNK
FT                   KNSKAASSPASFSPFPLPDLREREDGGVIDFEENESETSKVAAEAISDEARSKSRAEFT
FT                   TVYDIIDAMEATLSEAKNVLFAAGMVKIDRDEFVDQLARLKDMLPVQLERASALMREAE
FT                   RRLRTAQAQASSIVSSAQSQSAEIIEEAQERAQFLAGQENVTALAKQKARDILATAQAK
FT                   SDKLTQGADQYCATVMEGLKQQLDKLEQDVQAGQRVLEDRRRAAAHVQNDISSSLYDDD
FT                   EEERN"
FT   gene            362861..363490
FT                   /locus_tag="HMPREF0424_0334"
FT   CDS_pept        362861..363490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0334"
FT                   /product="putative ACR, COG1399"
FT                   /note="identified by match to protein family HMM PF02620"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13483"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9V3"
FT                   /protein_id="ADB13483.1"
FT                   /translation="MASHPSQSPWAVPVAQMAARAGSSMSLHRVFPAPEGIGDYVIGVK
FT                   PDSDVMVDGDFDAVADGLMFQGSITAPVHAECTRCLMPLRRDWKVDVCVFFPYADSRSN
FT                   RSDNRNTRGDADEAESQIWDENDESGNVYPLVAGGDFADIEALIRDTMVSELPLQPLCE
FT                   PDCRGLCSQCGENLNEHPDHHHDVTDIRFAALEDLKAQLEQNEKRH"
FT   gene            363615..363809
FT                   /gene="rpmF"
FT                   /locus_tag="HMPREF0424_0335"
FT   CDS_pept        363615..363809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="HMPREF0424_0335"
FT                   /product="ribosomal protein L32"
FT                   /note="identified by match to protein family HMM PF01783;
FT                   match to protein family HMM TIGR01031"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14163"
FT                   /db_xref="GOA:D2R9V4"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9V4"
FT                   /protein_id="ADB14163.1"
FT                   /translation="MALPKYKTSRANTHSRRANWKASAVQTVTCPNCGSQAFPHMACPS
FT                   CGTFRGRVYREAIRSEHTK"
FT   gene            complement(363859..364587)
FT                   /gene="rnc"
FT                   /locus_tag="HMPREF0424_0336"
FT   CDS_pept        complement(363859..364587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="HMPREF0424_0336"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="identified by match to protein family HMM PF00035;
FT                   match to protein family HMM PF00636; match to protein
FT                   family HMM TIGR02191"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14500"
FT                   /db_xref="GOA:D2R9V5"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9V5"
FT                   /protein_id="ADB14500.1"
FT                   /translation="MRLDGNETRPGDPTQELLNALGTTISPDLLVEALTHRSFSHEHPG
FT                   TRNYERLEFLGDAVLELVSTETLFSAHPDMTEGQLAKMRAKAVSEWALSAVAREKLHVG
FT                   AYILLGRGEMEQGGNNKDSILCDIVEALIGATFVEHGIDEARRVVHRLIDDTLAEVLTE
FT                   GPALDWKTSLTVKAHDMGLEDPEYRMAVSGPEYAPVFEARAVLAHKDGDEVLGVGSGSS
FT                   KRKAQLAAAEIAWHALDARK"
FT   gene            complement(364628..364768)
FT                   /locus_tag="HMPREF0424_0337"
FT   CDS_pept        complement(364628..364768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0337"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13974"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9V6"
FT                   /protein_id="ADB13974.1"
FT                   /translation="MRSQMRTRSLKVLVLVVDYNNTCYENSEQSTESTKSTEYAEQTQS
FT                   K"
FT   gene            364825..366939
FT                   /locus_tag="HMPREF0424_0338"
FT   CDS_pept        364825..366939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0338"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14690"
FT                   /db_xref="GOA:D2R9V7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9V7"
FT                   /protein_id="ADB14690.1"
FT                   /translation="MPTYDLGLERVSLEFATKTIFTDVTQGVFEGDRIGIVGKNGDGKS
FT                   TLLRLLAGKMQPDSGRVTKRGGLTFGMLDQRDPLDDNATVREAALENREDYEWAADQRS
FT                   REIVEALLGGINLEAKVGTLSGGQRRRADLARLLLRDWDILALDEPTNHLDVVTIHWLA
FT                   EHLLHRWQDGQGALLIVTHDRWFLDEVCTSMWEVHDGVIDPFEGGYSAYMMQRVERERQ
FT                   ADVREERRRNLARKELAWLSRGARARSTKQKFHVKQARELIADVPPLRDTLELKKMATS
FT                   RLGKQVVDLIDVTQIFDNAQQLKNIDPDIAESASSSESNAEKSNKVDIVESAFAQPTHV
FT                   GSVTIAVDENQENSLENSAENTSESTATSAENIAETSAASRKTITGRMILDDATWLIGP
FT                   GDRFGIVGANGAGKSTLLSIIDGSLKPTLGHVNIGKTVKFAVLSQRLEELEKLGKYKVK
FT                   EVLSRYKPSYIIDGKEVTPGQLMERLGFKPEQLMTPIANLSGGQKRRMQLLLILLNEPN
FT                   VLIMDEPGNDLDTDMLAVMEDLLDTWPGTLIVVSHDRYLLERVTDQQFALIDGKIRHLP
FT                   GGVDEYLQIVEKLQRDHENSSGTTGTVGASSTANASSAANSTTKESSESTVIEPKLTGK
FT                   AYHDAARRVSAIERKLTKLEEEKSQIEAQMAAHNPSDFVGLQSLNEDLQKNEQEASALE
FT                   DEWMELSEQL"
FT   gene            367006..367767
FT                   /gene="rph"
FT                   /locus_tag="HMPREF0424_0339"
FT   CDS_pept        367006..367767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="HMPREF0424_0339"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /EC_number="2.7.7.56"
FT                   /note="identified by match to protein family HMM PF01138;
FT                   match to protein family HMM PF03725; match to protein
FT                   family HMM TIGR01966"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13566"
FT                   /db_xref="GOA:D2R9V8"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9V8"
FT                   /protein_id="ADB13566.1"
FT                   /translation="MTQIKDMLESVKPIRVDGRDVDELRPVHITRKFTDVPEGSVLIEC
FT                   GNTRVMCTATFTVGVPRWRRDSGLGWVTAEYSMLPRATAERTDRESVRGKIGGRTHEIS
FT                   RLIGRCLRGVVDMKAMGECQIQIDCDVLQADGGTRTASVTGAYVALVDALHWAEKNGHI
FT                   RSAANVIKDSISAVSVGVINGTPMLDLPYVEDSQAMTDMNVAMTGSGTFIEIQGTAEHR
FT                   PFNRDELNTLLDLATKGNRELQAAQKAALAK"
FT   gene            367790..368476
FT                   /locus_tag="HMPREF0424_0340"
FT   CDS_pept        367790..368476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0340"
FT                   /product="Ham1 family protein"
FT                   /note="identified by match to protein family HMM PF01725"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14240"
FT                   /db_xref="GOA:D2R9V9"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9V9"
FT                   /protein_id="ADB14240.1"
FT                   /translation="MKLIVATHNEGKLVEIKQILEEQLSKLADSFELVTAGSLGLPDPV
FT                   ETGVTFEQNALLKARDVAARTGYPAIADDSGLIVDVLGAAPGILSARWSGVHGDDKANN
FT                   ELLLRQLSDIPDQCRTARFRCAAALAIPDGCSEVPEGSVMSHSHGFETVRVGEMVGHLL
FT                   REAHGINGFGYDPLFVPDFQPIRDGVQMKGLTSAELTQEEKNAISHRGNALRALLPELQ
FT                   ALFITE"
FT   gene            complement(368487..368570)
FT                   /locus_tag="HMPREF0424_1365"
FT   tRNA            complement(368487..368570)
FT                   /locus_tag="HMPREF0424_1365"
FT                   /product="tRNA-Leu"
FT   gene            complement(368641..368713)
FT                   /locus_tag="HMPREF0424_1366"
FT   tRNA            complement(368641..368713)
FT                   /locus_tag="HMPREF0424_1366"
FT                   /product="tRNA-Thr"
FT   gene            369067..370761
FT                   /gene="pgi"
FT                   /locus_tag="HMPREF0424_0343"
FT   CDS_pept        369067..370761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="HMPREF0424_0343"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="identified by match to protein family HMM PF00342"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14257"
FT                   /db_xref="GOA:D2R9W0"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9W0"
FT                   /protein_id="ADB14257.1"
FT                   /translation="MAINPPVDAVKTPEWAALQKHYDELQSEGVCLKKWFAEDANRVDK
FT                   LSFEAGDLHFDLSKNLIKPETLKLFANLAKAVKLDERTKAMYTGVHINNTEDRAVLHTA
FT                   LRRPAEDAGKFIVDGQDTVADVREVLGRIYDFANEVRSGAWKGVTGKNIKTVVNIGIGG
FT                   SDLGPVMVYEALKPYADAGISARYVSNIDPNDMAEKTKDLDPETTLFIIVSKTFTTLET
FT                   LTNARTARTWLLNKLQECGAIDGSDAKKAEAVAKHFVAVSTNLEKVEEFGINPTNAFGF
FT                   WSWVGGRYSVDSAVGTSLAVVLGPERFEEFLKGFHAIDTYFAETPFEKNVVVLLGMLNV
FT                   WYRNFYKVASHAVLPYDQYLHRFPAYLQQLTMESNGKSVRWDGTPVTSETGEIFWGEPG
FT                   TNGQHAFYQLIHQGTQLIPADFIAFVNTPNPTKDGDQDVHELFLGNYLAQTKALAFGKT
FT                   ADEVRAEGTPEEIVPARVFKGNRPTTSIFGDALTPFSLGELIALYEHITFVEGTVWGLD
FT                   SYDQWGVELGKQLAKQITPAISKDDEALAAQDASTQSLIRFYRAHRK"
FT   misc_feature    370933..371093
FT                   /note="ykoK leader"
FT   gene            371198..371344
FT                   /locus_tag="HMPREF0424_0345"
FT   CDS_pept        371198..371344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0345"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13587"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9W1"
FT                   /protein_id="ADB13587.1"
FT                   /translation="MKHDSKSHNSSTRTDEGSDTIGSSSSDVPPEYMKPAIIEFRLQNL
FT                   RNI"
FT   gene            371604..373352
FT                   /locus_tag="HMPREF0424_0346"
FT   CDS_pept        371604..373352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0346"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14636"
FT                   /db_xref="GOA:D2R9W2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9W2"
FT                   /protein_id="ADB14636.1"
FT                   /translation="MTVFTTSRKESAGVQVDENTRFWSDIIVCVGIIAVFGVTAFLIQR
FT                   INQPIGPSGIPSKVSTDLINLPYYTLRSVFRMLIALVASLIFTIVYGSLAARSRRLGKV
FT                   LIPLLDILQSVPILGFLSATVTIWLVIFPGSMLGVEAASIFAIFTSQAWNMTFSFHRSL
FT                   LSEPKELDEAVRSLQLTHWQRFWVLDMPNAMIPLLWNCMMSVGGGWFFLTASEMISVNN
FT                   HTYALPGIGSFVAQAAAENKLGLIWWAIVSMVIVVLALDFFLWKPLTAWAERFRITQSA
FT                   SDNERHSAILTLIRHSHADEVISKLFLPIREWLEKVTRPFGRTGSKWPHKAAQHKLGDW
FT                   VFNVIMLIIVAAGAAHMLYFVYTTAGLHEFITAGMLGGITFMRVAALILISSLIWVPVG
FT                   VVIGMNPKISRIMQPIVQILASFPANFIFPFAMAWFMSWHIDLGWGSIILMALGTQWYI
FT                   LFNVIAGASAIPDDLREMTRSFRLDRTLRWKTLILPSIFGSWCTGGITAAGGAWNASIV
FT                   SEIVEYGKNHMETQGLGAYITNATTLGDSARTLVGVTVMSLIVVLSNRLFWSPMQRISE
FT                   KRYVLN"
FT   gene            373412..374947
FT                   /locus_tag="HMPREF0424_0347"
FT   CDS_pept        373412..374947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0347"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13957"
FT                   /db_xref="GOA:D2R9W3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018632"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9W3"
FT                   /protein_id="ADB13957.1"
FT                   /translation="MEKIGKIMNTLKSNAKKVQSSITSDIIDAKHISQSFTSDSGTTQH
FT                   VLHDISFTLREGEIVAILGRSGAGKSTFLRTMAGLVQPTEGTVTYRGRELTGPNPGVAI
FT                   VFQTFALMPWLTVQDNVELGLRARGVSKEKRTELALAAIDAIGLDGFETAYPKELSGGM
FT                   RQRVGIARALVLRPDALFMDEPFSALDVLTAENLRQEVLKLWSSEERDIKSVLIVTHNI
FT                   EEAVQMADRVVVLGSHPGHLIADVNVDLPRPRDKHSAEFEAMVDNLYAILTGSAPESTA
FT                   EQDASEDADSQDQANNATNEDAEDNEAAAIADMLIQRHHDDEDEDKQSEDEAEAGETKA
FT                   EPVAVRLLPNATPGGMAGLLDVISESPDGIDLADLAADLSFEIDDLFPLVDAGTMLNLL
FT                   TAENGHITITSEGEEWHNADILHSKQVFARLAIEHASLVHAIDQALSRNRNGKLRGELI
FT                   LDLLRSKHTDALARQQFDIAISWGRYGELFDYDADDDELTRTVETAPLDGVVR"
FT   gene            375195..375560
FT                   /gene="rplS"
FT                   /locus_tag="HMPREF0424_0348"
FT   CDS_pept        375195..375560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="HMPREF0424_0348"
FT                   /product="ribosomal protein L19"
FT                   /note="identified by match to protein family HMM PF01245;
FT                   match to protein family HMM TIGR01024"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14492"
FT                   /db_xref="GOA:D2R9W4"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9W4"
FT                   /protein_id="ADB14492.1"
FT                   /translation="MVNAVEAFDAKHLKAAEEIPAFRPGDTVDVNVKIQEGNNTRIQTF
FT                   TGVVIARKGAGVRETFVVRKVSFGTGVERRFPLHSPAIDSIKLVRSGRVRRAKLYYLRA
FT                   LRGKAARIAERRDNSAK"
FT   gene            375590..376378
FT                   /gene="lepB"
FT                   /locus_tag="HMPREF0424_0349"
FT   CDS_pept        375590..376378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="HMPREF0424_0349"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="identified by match to protein family HMM PF00717;
FT                   match to protein family HMM TIGR02227"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13585"
FT                   /db_xref="GOA:D2R9W5"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9W5"
FT                   /protein_id="ADB13585.1"
FT                   /translation="MTDDTQISDTHIVSVAGHGIDPSPVPPEPEGDLPSGSRMFKRKNR
FT                   KGKHFAHSKRAKNDRLTLRDAITWFGIPVLVVILIRVFLFGAYTIPSGSMLDTIHIGDY
FT                   VITTKLTPRLFPLKRGDIVVFEDPAHWLSGENSSGVVGKDLIKRLIGLPGDTVECKGAG
FT                   QPIVVNGVPIRESSYIRPGVDPSAFPFKVKVKAGHVFVLGDNRSNSADSRYHRNDGDDG
FT                   LVPISKIEGVAVFRSWPLDRIGLLDEHHDDFKDVPDRPAK"
FT   gene            376513..377256
FT                   /gene="rnhB"
FT                   /locus_tag="HMPREF0424_0350"
FT   CDS_pept        376513..377256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="HMPREF0424_0350"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by match to protein family HMM PF01351"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14471"
FT                   /db_xref="GOA:D2R9W6"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9W6"
FT                   /protein_id="ADB14471.1"
FT                   /translation="MSNKSSNIPLVPSFKYEQDLLCEGYDWVIGLDEVGRGSLAGPVMV
FT                   GAAVIGIKQVKENYMPEGLADSKLLSEKRREELYEPLQKWCTTWAVGSCTNTEIDEWGI
FT                   SYALGVAALKAISKVEEDIKKLSFSVNANTRENTRENSNFRIAAILDGPCDYIDKVANT
FT                   FDAPYIPEPVKVHTLVKADRQCASVAAAAVLAKVTRDNLMVSLAKNPKYAAYDWASNKG
FT                   YGSLAHRNAIKKVGPSDLHRLSWHL"
FT   gene            377270..378373
FT                   /locus_tag="HMPREF0424_0351"
FT   CDS_pept        377270..378373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0351"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00356"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13921"
FT                   /db_xref="GOA:D2R9W7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9W7"
FT                   /protein_id="ADB13921.1"
FT                   /translation="MAENEAKRVSMIDVAHAAGVSHQTVSRVINNSPDVSANTRIKVLR
FT                   VIEQLGYYPSNSARALATKRSRTLGLIVGAENRTSRNIIAPIEAQAKSRGLFLSISMVN
FT                   ETLCEQSDIQDLCESFEEQNVDGLIIDAPTDAIFTSLCRTRILKPCVCVTATHGAISAH
FT                   EGMNMLRSHSNVEYSMIGINQSRAMNDIVSLIAHYGHRNAIYIAGPSQWRGAATRLIAW
FT                   RSLSTAQGIHSHIVQCTSWKSSESYARMNHMIEKFGIDGIALPTVIVASSDEQAVGVVR
FT                   SLYEHGLKIPSDISVVGFGDIPAISDFFPPLTTVSLDMQQLGSLAVREALRLMNHGPEP
FT                   AFPDMSHGVGQIPASLKLRSSIGAVLR"
FT   gene            378643..381198
FT                   /locus_tag="HMPREF0424_0352"
FT   CDS_pept        378643..381198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13736"
FT                   /db_xref="GOA:D2R9W8"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9W8"
FT                   /protein_id="ADB13736.1"
FT                   /translation="MINRCFAFVPGIKHLVVLRSACLAISYLVNIAFVYVCVGMLSPVL
FT                   RPVRSTGTSLMSSVEFTSYIIVLTAIILLKYAVFYWSCTVCAEIESRIAMRLRPKMLRA
FT                   MLSLRSVDIEDSHDITSLRVNEDIFAIQSFVASLVPQIIASIPVPVVVSAALFTVNPAI
FT                   AGICALAALFNVASLIFSLALSPVSWRCVSALFAYVIAGLAIVATVWLSSVKGVGLAAA
FT                   LLTMPLLMLSVQPLRIVGKNMHVVKHAVHGLNHVEALLQMVTDSPAPIAFSDDGSTLSL
FT                   PDGSTNIALRMRCNISGNNANTNEAQRLSIIAKSGELQVIPSKYHHVMREKILSGTGFN
FT                   KSADILLSYSDRYDIHEDDVSPFVVSEVFDANDSASYLSLNDASSAALADIVTIVSERS
FT                   HLFSTTLRENLLLAAPTATTTAMWDALRAVRIDGVVYADYDGLDMPIDRLFNNPEASYN
FT                   SEDLKRRVILARAILRHTKVYVFDYSQCDISNHEAEEIVKILRRIARYANVIVLMPNDD
FT                   GISSTDEIATVESYRHVANDSSKNITQLNQLNESQNSQNSHNVEQAQQDSNKNKHISSI
FT                   ASIAYTYEVRTISKFKRAIFAFISMFSTALNLVSAVCIPVAIVSAMFAVAGRPIFGFVM
FT                   QQCVLVAVACMAVRALTLVTTFAGVDMHHEHWHKAHISMNVGMIFAVVPLMVVLYYFDA
FT                   NLSYVAIVSCVFIMFIVPRYLLIRFKHIANKVRIEQHEVENEVSDIELGIDEVLAFRQG
FT                   EHCVNRMVTSMHKVSQQRMRLARKSGGMSALVLAISLISISVAALVVSHTIHPVPANIP
FT                   AWSTVYAVMAMVLLVIMIQQVVDVVLQRIPSVMRVKSSN"
FT   gene            381250..381960
FT                   /locus_tag="HMPREF0424_0353"
FT   CDS_pept        381250..381960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0353"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF09352"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13808"
FT                   /db_xref="GOA:D2R9W9"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9W9"
FT                   /protein_id="ADB13808.1"
FT                   /translation="MRNRCNKRQFLALFWMLLFAVLCGIVIGLLLPKINSSVGKITGEY
FT                   EASGEAAQALEKLRISKPYRYGYERQVFGYRTTDDDSNGCDVREDVLARDLQNVKYKYA
FT                   GSCQVRFGLLHDPYTGKDIHFVRGRKTSALVQIDHVVALQNAWESGAWKWNRAKRLKFG
FT                   NDMMNLLAVEGAANQEKGSASAAYWLPSNKTFRCEYVARQIAVKYKYGLTVTREEKQSM
FT                   ESVLHNCSAQKLPK"
FT   gene            complement(382036..383664)
FT                   /locus_tag="HMPREF0424_0354"
FT   CDS_pept        complement(382036..383664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0354"
FT                   /product="drug resistance MFS transporter, drug:H+
FT                   antiporter-2 family"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13450"
FT                   /db_xref="GOA:D2R9X0"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9X0"
FT                   /protein_id="ADB13450.1"
FT                   /translation="MFKNKKGCFILTHSTWLSNKSQDLSHALTGEEAYNNNRLTRPALI
FT                   SLAILTFITFIGNFAQLQLTAALPTIVQEFGISVTTGQWLTSIFQLIMAIMVPLTAFLT
FT                   RRFSTRQIVITSMSLFTFGSVLAWLSNDFMMALVGRTLEAIGTGVMWPVLQITVFSVYP
FT                   VTRRGMAMGSVGMAMSIAPAIGPTIGGLQTDINGWRSIFCSLTIIGAISVVLAVFFLHN
FT                   FGEHDLNAHADFFSVGLSVIGFGGLMFGFTNIEGCGISHPLSWAPMIIGACGIAWFVTR
FT                   QLRAQKRGHTPLLGLNVLKNRYFMVGTICACLTFFAFSSIMVLIPLYIQSDRGFSATMS
FT                   GLILLPGAFGMAISQYFGGRMLDRFGVRPVAMAGSIILFFGTVMMSLIDMDTWIWWISI
FT                   WQFTRQIGMGFLLMPITTWSLNCLRKEELGDGSAVTNTMRQLWGAIGAPVLVVTMTVLT
FT                   TLHHSGTGHAADVAASIFGVQWTLRISAIITGIMALIVIFGVKGEGTGSAHNLARRAID
FT                   RMRVLHIPHSAEHHDVMHDHTHNHY"
FT   gene            complement(383828..384814)
FT                   /locus_tag="HMPREF0424_0355"
FT   CDS_pept        complement(383828..384814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0355"
FT                   /product="G5 domain protein"
FT                   /note="identified by match to protein family HMM PF07501"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14142"
FT                   /db_xref="GOA:D2R9X1"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9X1"
FT                   /protein_id="ADB14142.1"
FT                   /translation="MTSHRKHTVTLGSLSLRQWARVSAVILGFVALVILGFTSRDFYAS
FT                   SKGHAVQVTSYSATDSSQVSRSASRSMLHNGATSYINVVINGHHRTILGTNFTDVKSVL
FT                   DAGDITLEPHDVVTPSLTTKVSESTVITINRAGAKLENSDDPIAFNVVKKETAALPKGT
FT                   EKVQSEGANGVMETAKIVTRTKGKIVSSNIFASYVKKAPKDKVILVGTGGSSAAIGLAA
FT                   SIGTTVPAGEMQQWAHDWLISNGYSEADFTATVFIISHESGWRVNAMNPSGAYGLPQAL
FT                   PGGKMASAGADWATNYQTQLRWFWNYCNGRYGSIQGAYNHWLSYHSY"
FT   gene            complement(384963..385304)
FT                   /gene="trxA"
FT                   /locus_tag="HMPREF0424_0356"
FT   CDS_pept        complement(384963..385304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="HMPREF0424_0356"
FT                   /product="thioredoxin"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13964"
FT                   /db_xref="GOA:D2R9X2"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9X2"
FT                   /protein_id="ADB13964.1"
FT                   /translation="MAAIHATTENFEKIASTNEIVVVDFWATWCGPCRSFGPIFEKVSE
FT                   KYPEIPFVKVDIDKSNEIAAAAQIQAVPTVMVIKRGEVIYRQAGALLASDLEDLVEQAK
FT                   SYESDDSES"
FT   gene            385411..386697
FT                   /gene="serS"
FT                   /locus_tag="HMPREF0424_0357"
FT   CDS_pept        385411..386697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="HMPREF0424_0357"
FT                   /product="serine--tRNA ligase"
FT                   /EC_number="6.1.1.11"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02403; match to protein
FT                   family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14659"
FT                   /db_xref="GOA:D2R9X3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9X3"
FT                   /protein_id="ADB14659.1"
FT                   /translation="MLDIQFIREHADVVKESQRKRGESVELVDEVLRSDDLRRTALKAF
FT                   EEARAEQKAIGKKVATASAEEKAALIAETKELASKVAEYKAESEKATADYTTAMWKLSN
FT                   IVEDEAPEGGEDDYVVVKKVGTPRDFAAEGFEPKDHLTLGTGVAGIDMRRGVKVAGSRF
FT                   YFLRGAVARLQIAMLTMAVDQAEEHGFTLAITPTLVRPEVMRGTGFLNSHADEIYRLRE
FT                   PDDQYLVGTSEVALAGMHEDEILDLSNGALRYCGWSSCYRREAGAAGKDTSGIIRVHQF
FT                   DKVEMFVYCKQEDSRAEHQKLLGMEQEMLAKVEVPYRIIDTAAGDLGSSAARKFDCEAW
FT                   VPTQGRYRELTSTSNCTEYQARRLNVRERMEDGGTRSVSTLNGTLATTRWLVAILENHQ
FT                   HEDGSIDIPKAMQAYMGGKEVIEPTKWEA"
FT   gene            386894..386981
FT                   /locus_tag="HMPREF0424_1368"
FT   tRNA            386894..386981
FT                   /locus_tag="HMPREF0424_1368"
FT                   /product="tRNA-Ser"
FT   gene            complement(387350..388663)
FT                   /locus_tag="HMPREF0424_0359"
FT   CDS_pept        complement(387350..388663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0359"
FT                   /product="hydroxymethylglutaryl-CoA synthase"
FT                   /EC_number="2.3.3.10"
FT                   /note="identified by match to protein family HMM PF08540"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13843"
FT                   /db_xref="GOA:D2R9X4"
FT                   /db_xref="InterPro:IPR011554"
FT                   /db_xref="InterPro:IPR013528"
FT                   /db_xref="InterPro:IPR013746"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9X4"
FT                   /protein_id="ADB13843.1"
FT                   /translation="MSTQNIKISATAAANTTTTSATTPLTVGIDRISFATPHYYLNLEE
FT                   LAEHRGIDPNKFTIGIGQSEQSVPPNHQDIVTLAAQAAFPLLPYIDSNRLKMLIVGTES
FT                   GVDASKSSALYVQNLLKLTPWVRSIEVKEACYGGTAALMMACDYVRAHAEKNPQVLVIA
FT                   ADIARYGLATPGEVTQGAGAVAMLVSANPHVLKINDDSVVKSADIQDFWRPVYQDTALA
FT                   RGQFSTEQYIQFFCEVWQKYCAQNDCNFSDFAGLCFHLPYTKMGLKALKAAMDSCANSC
FT                   SDSCDNSNLSESSRNRLLSRYETSTKYSRRVGNIYTGSLYLGLLSLLELDEFTCENSDL
FT                   TALKSGDKIGLFSYGSGAVGEFFSGTIAPGFRDALFAREHADMLDSRVHLSVADYEEMF
FT                   ESVAPYAPEDFESSTSCREGASFFLDDITSQERHYSAR"
FT   gene            388578..388730
FT                   /locus_tag="HMPREF0424_0361"
FT   CDS_pept        388578..388730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0361"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13776"
FT                   /db_xref="GOA:D2R9X5"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9X5"
FT                   /protein_id="ADB13776.1"
FT                   /translation="MPTVRGVVAEVVVVLAAAVADILIFCVLICPKPLNFLNFYLILVT
FT                   FEVIA"
FT   gene            complement(388687..390021)
FT                   /locus_tag="HMPREF0424_0360"
FT   CDS_pept        complement(388687..390021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0360"
FT                   /product="hydroxymethylglutaryl-CoA reductase, degradative"
FT                   /EC_number="1.1.1.88"
FT                   /note="identified by match to protein family HMM TIGR00532"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13958"
FT                   /db_xref="GOA:D2R9X6"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004553"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9X6"
FT                   /protein_id="ADB13958.1"
FT                   /translation="MAAFRELSVENRIKTLQNEGAINETEAAFLLKQFAESSDTTIPAD
FT                   VANHMIEHQIGKYTLPVGVVRGLIVNGEVCDVLVATEEPSVIAAACNGARIAAATDVGY
FT                   GIIARSPQYVTTAQIAFEDADGSVAARLSRIVEDKEKVAELLRIANASHPSISKRGGGA
FT                   RKCRASALHGFAKLEIDVDTCDAMGANTVNTMGEAVKAQLESWLGVQALVAILTNTSRV
FT                   ASTAEVHIPVEALASRRLEDSEREREGKCLARRIAALSALAASDPARAATHNKGILNGI
FT                   AGAALASGNDTRALESAAHAWAARSGRYLPLSKWNTETLNGKTILHGRIEIPLQIGIVG
FT                   GSISSLPMAKLAIKIGKYKNANDFRNTLAALGLVQNLAALRALAGPGIQAGHMALQSSN
FT                   LAIAAGAKGAEIAEITHNILQLSPAERTTEKVTQLLQKLRESSKN"
FT   gene            complement(390108..391370)
FT                   /locus_tag="HMPREF0424_0362"
FT   CDS_pept        complement(390108..391370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0362"
FT                   /product="acetyl-CoA C-acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14634"
FT                   /db_xref="GOA:D2R9X7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9X7"
FT                   /protein_id="ADB14634.1"
FT                   /translation="MTEVVIASAVRTPIGKFGGSLSSLSSVDLGTIAAKAAIERARISS
FT                   HDVDQAIFGNVLQAGSGQNVARQIALKAGLDTSSCAMTINEVCGSGLKAVRLAQSAIVM
FT                   GDAQVVVAGGTESMSNVPFYATNSRFSGHKYGNFALIDGLQRDGLNDAFTGDAMGVTAE
FT                   NVAAKFGITREAQDIFALKSHQKAVAAIKRGDLASEIVPVTLANGTVITQDEHPREDTS
FT                   LEQLSKLRTLFKASGETADATCEVDKREVGENEVCKHESTVTAGNASGINDGAAALVLM
FT                   SKDYAQAHGIEYLAQIVGFAEGGIDPDLMGYAPKHVMERMLNATGSNVDNIDLFEINEA
FT                   FAAQSIAVSEQLHIDESKLNVRGGAIALGHPLGASGARILTTLIYALRDRNKLNGVAAL
FT                   CVGGGIGVSMQIRMRNNKVRM"
FT   gene            392005..392142
FT                   /locus_tag="HMPREF0424_0363"
FT   CDS_pept        392005..392142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0363"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13696"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9X8"
FT                   /protein_id="ADB13696.1"
FT                   /translation="MVGTNIRAVRFEIFRTERGERQSRRLLIRQAKKKNRKISAIKRGY
FT                   "
FT   gene            complement(392431..393012)
FT                   /gene="xpt"
FT                   /locus_tag="HMPREF0424_0364"
FT   CDS_pept        complement(392431..393012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xpt"
FT                   /locus_tag="HMPREF0424_0364"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01744"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14528"
FT                   /db_xref="GOA:D2R9X9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010079"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9X9"
FT                   /protein_id="ADB14528.1"
FT                   /translation="MQELEERILQDGIVKPGNVLKVDAFLNHQCDVNLFDHMGAAWAEH
FT                   FRDANITKILTIEASGIGIACVAARHFGGVPVVFAKKAQSINLDGDQYVSTVFSFTKQR
FT                   EFPVIVSRKYLSAEDRVLILDDFLANGKALQGLIDICNHAGASVAGIGIAIEKGFQGGG
FT                   DALREAGYDLDSLAIVDAMDPVDGSISFRK"
FT   gene            393202..396273
FT                   /locus_tag="HMPREF0424_0365"
FT   CDS_pept        393202..396273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0365"
FT                   /product="putative ATP-dependent DNA helicase PcrA"
FT                   /note="identified by match to protein family HMM PF00580"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14304"
FT                   /db_xref="GOA:D2R9Y0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Y0"
FT                   /protein_id="ADB14304.1"
FT                   /translation="MSVSMGASMNANMSAKDSDYGYVSDLLGNPVDSFDSDDRFYENVA
FT                   DANDYANYSYDEYADAYAKEPDFTQQEYASDQESVPPQESVPPQESVPPQESVPSQESV
FT                   PSQQEALAQQELLPQESQEYSQNFAHSRVAVDAQKLLDGLNPQQSQAVQYDGPALLIGA
FT                   GAGSGKTRVLTRRIAWILSQKGAWPSQILAITFTNKAAAEMRERLSKLIGSEANTMWVS
FT                   TFHSACVKILRRSGQYIGLKSGFSIYDTSDCERLVKIIATELNVDIKRFTPRSILGKIS
FT                   DCKNSLITWREQLDMYANDYKPGVAGQQIAHAGNSEAVYATIYAEYQHRLSQANAVDFD
FT                   DLIMRTVQLMREVPEAAQYYRHKFRYILVDEYQDTNHAQYELIRELAGVDVKQNSANPS
FT                   QQNNTPASITVVGDSDQSIYAFRGADIRNIQDFEKDFPNATTIMLEQNYRSTQTILDAA
FT                   NAVISHNQGRKPKKLWTALGKGTPITGYAADSAQQEAAWVAQEIARLAGEEGVAYSDMA
FT                   IMYRANAQSRSLEDALVKAGLPYQLVGGTKFYERREVKDALAYLQSMANPDDDVNMRRI
FT                   LNVPKRGLGARAEALLTLYAQTQGVSFWQALEHLESIEGMPTRTATKLKEFRELMHNLI
FT                   TCMQNDDSKPSKVIDSILNDSGLLEDLQRSEDPQDAARVDNLSQLQSVAAEYEQNTPDA
FT                   SVAGFLETTALVADSDQLPDENEDTGKVTLMTLHTAKGLEYPVVFLTGMEQGTFPHSRA
FT                   LEDDGELCEERRLAYVGITRAKQRLYVTRAAVRAQWGQAQDMLPSQFLDEIPDNLIDWK
FT                   RRESDVERWGASSRRGDDFDSDFDSDFGGDFDSDFGGWDDDYSDAFSEKTTYGGSSYSS
FT                   EKSHGSKSYGRNKSYGSSSYGRNKSYGSSSYGSSYGKSYSKSYGSSYGSSYGSSYSKSN
FT                   WSKSSAVKTRKVTAKTAASTNATKVGSTSAVMNKDNHLNIQDFQVGDKITHDTYGLGTV
FT                   LATQDKGRNSIITVDFGSDGVKRLMLRVAPIEKL"
FT   gene            396416..396829
FT                   /locus_tag="HMPREF0424_0366"
FT   CDS_pept        396416..396829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13693"
FT                   /db_xref="GOA:D2R9Y1"
FT                   /db_xref="InterPro:IPR025531"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Y1"
FT                   /protein_id="ADB13693.1"
FT                   /translation="MKNKLFASIPAIIFGLLIAIAPLTFAKPCSTGGMHKMHMMMQPMA
FT                   CYYTGRAAVGIGLVIAVLGIIALFVKENVRIGLNIAVVVNALLMLAVTTFLIGVCKSPM
FT                   MHCASVMRPTLIVLSVLALVFAAVSVYLDNKED"
FT   gene            396868..398079
FT                   /locus_tag="HMPREF0424_0367"
FT   CDS_pept        396868..398079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0367"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14146"
FT                   /db_xref="GOA:D2R9Y2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Y2"
FT                   /protein_id="ADB14146.1"
FT                   /translation="MRTITLKRLPLENLKRKPLRTAALIIVSACLSAIFFGGSLISMNL
FT                   ERGLNSMRERMGADIMVIPQGTHTKAEALLTNSGSSTFYFTNDIENLVRRSPGVQKASA
FT                   QTYISSLSAGCCAEKLQIIGFDPDSDFVIGPWIYSQHKQKLQKGEMIAGANVIVSYMNT
FT                   VRLFGHQWPVAAQLAKTGTSIDNSVFVRRESVPQVVEYSTKVGHTAIPKEYAKKAVSAV
FT                   LVKVQKGYSAQEVAKNIRKTTGLSSIGIVFPGGITATTQANLGVFTRTLTFIIAACWLV
FT                   GLLVLVAVFSTSVNERKKEFASLRILGTTRNMLLGVVVRESAILGLVGGVLGVASASLI
FT                   LFPYSSLISEQLQLPYLEVTALPVAVLMLASVLLALVAVVVASALTTLRIAMRETYLTL
FT                   RSGE"
FT   gene            398082..398864
FT                   /locus_tag="HMPREF0424_0368"
FT   CDS_pept        398082..398864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0368"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13451"
FT                   /db_xref="GOA:D2R9Y3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Y3"
FT                   /protein_id="ADB13451.1"
FT                   /translation="MEDKSQKLPSNEFDILPVVELTRVTREFMRRKHKFFAVNNVSFAL
FT                   NSGDFVAIVGKSGNGKSTLLNLIAGLLKPTHGSVKVCGEEISERTFSDAKMSRLRACDI
FT                   GFVTQSQTLLQNLTVHDNILLPVQIAASACEVSKSGISKAEVSKSEVSEDLNETRALEL
FT                   CKQLHIEDLLWCYPNELSGGEMRRVMIVRALINNPKLLILDEPTGDLDVEHTRIVVKML
FT                   REAAKNGVAVLMVTHDVEAARCADRTYTMDCGLTCRSA"
FT   gene            399301..399927
FT                   /gene="rpsD"
FT                   /locus_tag="HMPREF0424_0369"
FT   CDS_pept        399301..399927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="HMPREF0424_0369"
FT                   /product="ribosomal protein S4"
FT                   /note="identified by match to protein family HMM PF00163;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR01017"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14475"
FT                   /db_xref="GOA:D2R9Y4"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Y4"
FT                   /protein_id="ADB14475.1"
FT                   /translation="MTNIQRSRRQVRLSRALGIALTPKAQRIFEKRPYAPGEHGRTRRR
FT                   TESDYAVRLREKQRLRAQYGISEKQLRAAYEKGTHTAGQTGDAMLTDLETRLDALVLRA
FT                   GFARTTAQARQFVVHRHILVDGNLVDRPSYRVKPGQTIQVRAKSQTMVPFQMAAEGVHR
FT                   DVLPAVPGYLDVNLASLKATLTRKPEVDQIPVEVNIQYVVEYYAR"
FT   gene            399959..400072
FT                   /locus_tag="HMPREF0424_0370"
FT   CDS_pept        399959..400072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0370"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14258"
FT                   /db_xref="GOA:D2R9Y5"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Y5"
FT                   /protein_id="ADB14258.1"
FT                   /translation="MTPVAHSRGRGQCVFVDFIGWFGVFDSFVANFVYFTK"
FT   gene            400120..400794
FT                   /locus_tag="HMPREF0424_0371"
FT   CDS_pept        400120..400794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0371"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14255"
FT                   /db_xref="GOA:D2R9Y6"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Y6"
FT                   /protein_id="ADB14255.1"
FT                   /translation="MLLHLYLVRHGQTLFNRYNRLQGWSNSPLTEKGLKDADTAAKKLE
FT                   NIAFAAAYCSDTTRAQITAQRILDANEAAGNARPKLVSDMHFREQCYGYFEGQDMQMAW
FT                   WAAGAPHGAHTYNEIVEKFGLAATRDMLKEADPFHDAESDIEYWTRVEEGFALIASNSL
FT                   LNDGDNVLQISHGNTLLSLMHRFAPAGYDLSERPANGSVTRLDFDTTKPIDNAITIQGY
FT                   NE"
FT   gene            400945..401391
FT                   /locus_tag="HMPREF0424_0372"
FT   CDS_pept        400945..401391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13706"
FT                   /db_xref="GOA:D2R9Y7"
FT                   /db_xref="InterPro:IPR009293"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Y7"
FT                   /protein_id="ADB13706.1"
FT                   /translation="MSVGDIAALIAAIAFTVLSGFLIYPLIRLGKLFDQIAKTVKESGE
FT                   HAMPAIDESVTTIKQVNKTLDDVNAVSGATRTTVTNIGALTDLYGAFLGKPLVKIAAAG
FT                   YALKDTVSSFFNKPTVPTDKNSANRNASKESSDKNATKNASRGE"
FT   gene            401391..401636
FT                   /locus_tag="HMPREF0424_0373"
FT   CDS_pept        401391..401636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13792"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Y8"
FT                   /protein_id="ADB13792.1"
FT                   /translation="MFKRLFWMFVGIVIGVLTVTKARAYVKAKMPSSASRFIFDEEPKN
FT                   ITLRTVMGLFKDFNTSRKEHEAELNSRYANRRNREF"
FT   gene            complement(401653..401766)
FT                   /locus_tag="HMPREF0424_0374"
FT   CDS_pept        complement(401653..401766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0374"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14470"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Y9"
FT                   /protein_id="ADB14470.1"
FT                   /translation="MQRPHEIVPHDARRNHANIQYSTSILNLTKLSKVTKL"
FT   gene            401843..404527
FT                   /gene="alaS"
FT                   /locus_tag="HMPREF0424_0375"
FT   CDS_pept        401843..404527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="HMPREF0424_0375"
FT                   /product="alanine--tRNA ligase"
FT                   /EC_number="6.1.1.7"
FT                   /note="identified by match to protein family HMM PF01411;
FT                   match to protein family HMM PF02272; match to protein
FT                   family HMM PF07973; match to protein family HMM TIGR00344"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14464"
FT                   /db_xref="GOA:D2R9Z0"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Z0"
FT                   /protein_id="ADB14464.1"
FT                   /translation="MRTAEIAKRYLDYFAKNGHMVVPSASLISPNPTTLFTIAGMVPFI
FT                   PYLLGEQTPPSRRMASNQKCVRTLDIDEVGKTTRHGTFFQMVGNFSFGDYFKEEAIHYA
FT                   WELLTTPQDKGGYGFDPEKLWVTTYTDDDEARAIWKNEGFDPEHMQVFGMEDNFWTTGG
FT                   PGPGGPCSEIYVDRGPKYGRDGGPAADESRFIEIWDLVFENYQVDNVKSKTDLHIAGEL
FT                   DQKNIDTGAGLERLAYLMQGKENIYETDEVYPVIEAAEKLSGVKYGDNNDADVRFRVVA
FT                   DHVRSALMIMSDGVRPSNVGRGYVLRRLLRRTVRAMRMLGVQDPVLPTLFPVSKTAMEP
FT                   SYPELNDTFHEVSEAAYGEEDAFRRTLEKGTTILDLAVEKAKKEHKDDPMVGGSDAFTL
FT                   HDTYGFPIELTLEMAAEQGVKVDEAKFRELMSEQKGRARADALKKRHNVDVSVYDDIKK
FT                   ALEKPIDFLGYTDFSSRSNVLAIVEAGKGSVKSVTAPANVEIILDRTPFYAERGGQIAD
FT                   QGEIISDDGAILEVDDVQRPIKDLIVHSCRLTEGTLSVGAPVNTNIDQVRRAALARSHT
FT                   ATHTLHKALREELGPQATQRGSVVDPDRLRFDFQWPKAVDKDALSRVEARVNERIRDDL
FT                   QVVPKEMPIDDAFKLGAMHLFGEKYGDVVRVVEIGDGWSRELCGGTHAKSTGKIGMVTI
FT                   LSESSIGSGVRRIDALCGEAAYEYGAREHTLVAQLADMVNARPDELVERLESLLNKMKD
FT                   SDRKLASVYEAQLNEAVPTLVDEVKNSNEKVKLALKNVGNFGSFDALRKTVLDIRARLG
FT                   EDAPVVVALAGVNEDDRPMIAVATNEAARGLGAKAGDLVRTASKVLGGGGGGKPDFAQG
FT                   GGTDASKLDEALEAAKSEVAKLA"
FT   gene            404582..405040
FT                   /locus_tag="HMPREF0424_0376"
FT   CDS_pept        404582..405040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0376"
FT                   /product="RNAse H domain protein, YqgF family"
FT                   /note="identified by match to protein family HMM PF03652;
FT                   match to protein family HMM TIGR00250"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13915"
FT                   /db_xref="GOA:D2R9Z1"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Z1"
FT                   /protein_id="ADB13915.1"
FT                   /translation="MVWLGIDLGDARVGLALSDPGLTFAHPIGNVQVFGDSFHAIDEVL
FT                   EVIEDNNVEKVVIGLPLQLDGTEGKSAKKALRWGKNLIKRMQILHDEKDWALDYMPEVV
FT                   WKDERLTTVSAHRQLLQADLSTKKHRPMVDQQSAVLILQSALDANNAE"
FT   gene            405086..406276
FT                   /locus_tag="HMPREF0424_0377"
FT   CDS_pept        405086..406276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0377"
FT                   /product="YceG family protein"
FT                   /note="identified by match to protein family HMM PF02618;
FT                   match to protein family HMM TIGR00247"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14139"
FT                   /db_xref="GOA:D2R9Z2"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Z2"
FT                   /protein_id="ADB14139.1"
FT                   /translation="MSDNFDEFFDKHAKWTEHDGEPSSESSNSSKYKSSTVSSRKRAKA
FT                   RLEAKKRRRRAKVVLSILLVFVLAVVGYFGYSAVRAWKLSQNSESVADWPGPGFGTVEF
FT                   TIDTGEGAISVANKLVKANVVKSQSAFTSAVSANNKILYPGVYSLKKHMAAIDVVDILS
FT                   DQTKAGGFLEVRAGDHAADVLQKASTLSGISLDKFKAALADGAAGILPAEANGSVEGWL
FT                   EPGVYNVKAMKSADAILSAMVKKRIEKLDSLGIPKGKDREKALIMASIAEAEVNNREYY
FT                   GKVIRVILNRLAKDMSLGMDSTVGYGAGVKPIKLTQAMLDDANNPYNTRIHKGLTPTPI
FT                   GIAGDNALLATIKPQDGPWLYFVTTNLKTGETKFADNKDDFLKFRDEYKRNNPEGN"
FT   gene            406449..406865
FT                   /locus_tag="HMPREF0424_0378"
FT   CDS_pept        406449..406865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0378"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13443"
FT                   /db_xref="GOA:D2R9Z3"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Z3"
FT                   /protein_id="ADB13443.1"
FT                   /translation="MPRLWVVIAGIFQSFANLIYSVILFRNISVLIFGWISCVIIFVIY
FT                   WSMRKISAKNAIGFGDVTSASMIAQALVLFGFYCLIYWFALVGAVGLLWLLLWKIYCKI
FT                   CSPINASIPFVPVEAISAILAALLSITTQSILGS"
FT   gene            406915..408102
FT                   /gene="aroC"
FT                   /locus_tag="HMPREF0424_0379"
FT   CDS_pept        406915..408102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="HMPREF0424_0379"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="identified by match to protein family HMM PF01264;
FT                   match to protein family HMM TIGR00033"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13459"
FT                   /db_xref="GOA:D2R9Z4"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Z4"
FT                   /protein_id="ADB13459.1"
FT                   /translation="MLRWQTAGESHGEALVAMIEGLPAGVHITSNDVVSALARRRLGYG
FT                   RGARMKFEQDKVRLLTGVRHGVTLGSPIAVEIANTEWPKWTEVMSADPLDHEVEQVGRN
FT                   APLSRPRPGHADLTGMRKYGFNDAREVLERSSARETASRVALGAIADAFLQQALGVRTV
FT                   AHVIGIGGEYTNKSLALPTPDDVAALDASPVRTLDKDAQARMMARIDEAKANADTLGGV
FT                   VEVLAYGMPAGVGTYVESDRRLDAALASAIMGIQAIKGVEIGDGFAEADRPGSAAHDEM
FT                   VTDENGKIKRLTNRAGGIEGGMSNGEIIRVRAAMKPIPSIPRALRTVDVLTGEAAQAIN
FT                   QRSDFTAVPAASVVAEAMVRLTLAKYALEKFGGDSLQETRRNVESYVASWPENMK"
FT   gene            408099..409781
FT                   /gene="aroB"
FT                   /locus_tag="HMPREF0424_0380"
FT   CDS_pept        408099..409781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="HMPREF0424_0380"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="identified by match to protein family HMM PF01202;
FT                   match to protein family HMM PF01761; match to protein
FT                   family HMM TIGR01357"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13493"
FT                   /db_xref="GOA:D2R9Z5"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Z5"
FT                   /protein_id="ADB13493.1"
FT                   /translation="MSNTKLPLAVIIGMPAAGKTRVGREVAHLMNLPFYDTDDMIECDI
FT                   DMSIPQYFEEYGQDAFRKIEARIVREAILGDTPTEDSTKGIVSLGGGAPMREETQKVLR
FT                   EYMRCGGRVVYLQANAKEAIERASWNNNRPMFSGEDAQKRWMELFEQRDPVFRAVSNIH
FT                   MQTKGSTPYMAAEKLRSMIMQRIVHVTGEGIEPYDVRIGDGAMQLLPQMLGTKPVKVAL
FT                   VHTQPVQRHSDKARTILRQSGYEVFDMLIPDAEAGKTIKVASGLWANLAEAGFTRSDAI
FT                   VGLGGGAATDVAGFVAATWMRGIRYVNCPTSLLAMVDASTGGKTGINTDAGKNLVGSFY
FT                   TPAGVLADTSTLATLPNDILIEGLGEVAKSGFIRDGEILKILSDANNARLLREFNGDDL
FT                   ENNNELHELLVELIERTVKVKAYHVSSDLKEQGLREFLNYGHTLGHAIEQIEHFRWRHG
FT                   NAVAVGMVFAAELAQILGYLDAGDVAYHRSLLDSLGLPTSWQCAKDADAAFECVLNLMH
FT                   RDKKARGNMLRFVILDGISNPMHLDNPPIEAVREAFERVYKQK"
FT   gene            409801..410256
FT                   /gene="aroQ"
FT                   /locus_tag="HMPREF0424_0381"
FT   CDS_pept        409801..410256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="HMPREF0424_0381"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="identified by match to protein family HMM PF01220;
FT                   match to protein family HMM TIGR01088"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13458"
FT                   /db_xref="GOA:D2R9Z6"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Z6"
FT                   /protein_id="ADB13458.1"
FT                   /translation="MENQHTKKVLVVSGPNLGRLGVRQPDVYGSENFETLREKCEKWGA
FT                   ELGFEVEVRQSDDEAQMVHWMHEAADTHTPVVMNPAAFTHYSYALADAAHMVLDAGVPL
FT                   MEVHISNPAARDAFRKISVISPVATGTITGMGLYGYKLALEAVAHLV"
FT   gene            410319..412001
FT                   /gene="pyrG"
FT                   /locus_tag="HMPREF0424_0382"
FT   CDS_pept        410319..412001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="HMPREF0424_0382"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF06418; match to protein
FT                   family HMM TIGR00337"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14009"
FT                   /db_xref="GOA:D2R9Z7"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Z7"
FT                   /protein_id="ADB14009.1"
FT                   /translation="MVRRQHGNSQEHITKHIFVTGGVVSSLGKGLTASSLGRLLRSRGL
FT                   HVLQQKLDPYINVDPGTMNPFQHGEVYVTEDGAETDLDIGHYERFLDVFLSQKANVTTG
FT                   QIYQSVLRKERAGEYLGQCVQVIPHITGEIKSRMRAQASDDVDVIITEIGGTVGDIESQ
FT                   PFLEAAREVRRDLGPENCMFVHVSLVPYIAAAHELKTKPTQHSVMMLRQLGISPDALVL
FT                   RSDRPLNQAIKDKISLMCDVDAEGVVNCVDAPSIYDVPKILFNEGLDAYVVRELELPFH
FT                   DVDWNEWEDLLERVHHPKHELNIAIVGKYIDLPDAYLSVTEAIKAGGFANWAKVNVRWV
FT                   AADKCETQEGAAAALDQMDGMVIPGGFGIRGIEGKIGALRYAREHGLPTLGLCLGLQSM
FT                   VIEYARHVLGLEDANSTEFEKDCGDPVIATMEEQKDIVAGKGDMGHTMRLGSYPAMLEE
FT                   GSIVAELYGTTHVTERHRHRYEVNVAYKDRLREAGLRISGQSPDGNLTEFVELPKEAHP
FT                   FYVATQAHPEFKSRPTKPHPLFAGLVAAALEHQEAAASSKADK"
FT   gene            412214..413872
FT                   /gene="sufB"
FT                   /locus_tag="HMPREF0424_0383"
FT   CDS_pept        412214..413872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufB"
FT                   /locus_tag="HMPREF0424_0383"
FT                   /product="FeS assembly protein SufB"
FT                   /note="identified by match to protein family HMM PF01458;
FT                   match to protein family HMM TIGR01980"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14555"
FT                   /db_xref="GOA:D2R9Z8"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Z8"
FT                   /protein_id="ADB14555.1"
FT                   /translation="MSGESAKVALGEQLLPIDTYRAQVCVKYGGVTGFMSDTGNMNDTG
FT                   VTGDTSVAASDGNLAKNKAADVEMSQYVADRARVNEEKIRQDEQIVAEFGDYNYGWHDS
FT                   DAAGEAAKKGIDESVVRAISADKNEPEWMLDLRLQGYRAFLQKPMPDWGVDLSGFDADD
FT                   FKYYVRPVHDQAKTWDDLPEDIRKTYDRLGIPEAEKKRLVSGVAAQYESEVIYNSIRED
FT                   LAAQGVIFVDTDTAVQKYPELVKKYFATVIPVDDNKFAALNTAAWSGGSFVYVPKGVHV
FT                   DIPLQAYFRINTPNMGQFERTLIIADEGSYVHYVEGCTAPIYSTDSLHAANVEIVVEKH
FT                   ARVRYTTVQNWSNNVYNLVTQRAYVREGGTMEWVDGNIGSKATMKYPACILAEPYAKAE
FT                   TMSLSFAGRGQYQDTGAKMIHLAPHTSSTIVAKSISRGGGRSAYRGLVKIIKGAKGSSS
FT                   SVVCDALLVDDFSRSDTYPHVDVREDDVSMAHEATVSKVSEDQLFYLMSRGLEEKEAMG
FT                   MIVRGFVEPISRELPMEYALELNRLVELQMEGSVG"
FT   gene            413872..415119
FT                   /gene="sufD"
FT                   /locus_tag="HMPREF0424_0384"
FT   CDS_pept        413872..415119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufD"
FT                   /locus_tag="HMPREF0424_0384"
FT                   /product="FeS assembly protein SufD"
FT                   /note="identified by match to protein family HMM PF01458;
FT                   match to protein family HMM TIGR01981"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13825"
FT                   /db_xref="GOA:D2R9Z9"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:D2R9Z9"
FT                   /protein_id="ADB13825.1"
FT                   /translation="MSEDLKENLGNKMTEKEINIPIADPNDPYAVPAAMPSSADKSVRS
FT                   FNVEDFAIPTRKQEDWRYTPVERISEFFERFEPSNSIQVTLEGVGGAALDDSYVGSDGS
FT                   VSLQVKPKNEAPHTDMKPSDRVAAVAWNTAKSAYVLHVSGEIKKPIVLKIQGDNVNTLD
FT                   ALHLVIEADSRSNADIIIEHTGCAKLAEGVEIILGKHAHVSTTFIQEWDSGSKHVGNQR
FT                   IHVGEGASLRHTMVTLGGNVVRIRMDQDFGGEQGDLNMLGMYFVDPGEHVEHRTMVVHN
FT                   YPECKSRVVYKGALEGKGAHSTWVGNALIKPEAPGTDSYELNRNLVLTPGAIADSEPNL
FT                   EIENGNIIGAGHASSVGRFDDEELFYLQSRGVSEVEARKLVVRGFFNELIEEIGVPEIV
FT                   DHLMKAIERRLARTEE"
FT   gene            415129..415905
FT                   /gene="sufC"
FT                   /locus_tag="HMPREF0424_0385"
FT   CDS_pept        415129..415905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufC"
FT                   /locus_tag="HMPREF0424_0385"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01978"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13891"
FT                   /db_xref="GOA:D2RA00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA00"
FT                   /protein_id="ADB13891.1"
FT                   /translation="MSTLEIKDLYASVETKEGRKQILKGVNLTVNSGETHAIMGPNGSG
FT                   KSTLAYTLAGHPKYEVDSGQVLLDGEDILKMTPDERAKAGLFLAMQYPVEVPGVSMTNF
FT                   LRTAKTEVEGKAPSLRSWVKELSEAMKKLRMDPKFASRSVNEGFSGGEKKRAEVLQLEL
FT                   LKPKFAILDETDSGLDVDALRIVSEGVNRAKENTGLGIMMVTHYTRILKYIKPDIVHVF
FT                   AQGHFVKTAGPELADELEEEGYDKYLPEGATESALA"
FT   gene            415982..417340
FT                   /gene="sufS"
FT                   /locus_tag="HMPREF0424_0386"
FT   CDS_pept        415982..417340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufS"
FT                   /locus_tag="HMPREF0424_0386"
FT                   /product="cysteine desulfurase, SufS subfamily"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM TIGR01979"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14579"
FT                   /db_xref="GOA:D2RA01"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA01"
FT                   /protein_id="ADB14579.1"
FT                   /translation="MTTVTTENIMREFSDLRSQFPILSRTVHGTSLHDTVHGKPLIYLD
FT                   SAATSQKPQVVIDAEKEFYETINAGVHRGAHELAALSTVAFEEARAKVARLVGACADAG
FT                   SEEIIVTPGATGAFNLFATAIGNASAKARICKKDSDDSADFRQNFVLREGDVIVVSRAD
FT                   HHSVLLPFQELALRTGAELRWIDVTEDGRVRTDADYLRTIIDERTKIVAVTHISNVTGA
FT                   ITDVSSICKRAHEVGAIFVLDACQSVPHIPVDFHTLNVDFAAFSAHKMYGPTGVGFLYG
FT                   RRELLNALPPANFGGSMVELAWLNKPAQYMDAPYRFEAGTQPVAQMVAAGVAADWLRAV
FT                   GMNKVAEHEREIAAELLKLQDVPGVRILGPADLENRIGTVAFEVEGVHPHDVGQFLDAQ
FT                   GIAIRVGHHCAQPIHRHFGVYASNRASVGVYNTVDEARAFVEAVSHVRAYFGA"
FT   gene            417427..418128
FT                   /locus_tag="HMPREF0424_0387"
FT   CDS_pept        417427..418128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0387"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /note="identified by match to protein family HMM PF01592;
FT                   match to protein family HMM TIGR01994"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14045"
FT                   /db_xref="GOA:D2RA02"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA02"
FT                   /protein_id="ADB14045.1"
FT                   /translation="MFDMGFGAGAGFSDAAGDGLENMYQEVILDAARNPHGKTHFESTD
FT                   ALAKAELQEESQESAESAESAENTESSENKESAENTKSAEITLNNTHESCAVTSDENSA
FT                   LGQSHQFNPTCGDEVTMRVELSRSANNDETPIVSSIKWDGHGCSISQASLSMMVDLVEG
FT                   KSVDEALQLDALFHKLMESRGEGLQSEEDEDALEDAMVLQGVSRYPMRIKCALLAWEGL
FT                   KDSIAKAMKEL"
FT   gene            418161..418634
FT                   /locus_tag="HMPREF0424_0388"
FT   CDS_pept        418161..418634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0388"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01883"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13509"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA03"
FT                   /protein_id="ADB13509.1"
FT                   /translation="MAENQSASEVMYETHPANLSANDIGRVTEDDILDALHDVVDPELG
FT                   IDVVDLGLVYGIEIDELGRAIITMTLTTPACPLTELIEDECANALAGLVEEFRIDWTWK
FT                   PRWSVENINEDGRAQLEALGYNLNSLQANFAAGMYGSGVVGDASMSAGIPPTV"
FT   gene            418683..419378
FT                   /locus_tag="HMPREF0424_0390"
FT   CDS_pept        418683..419378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0390"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13707"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA04"
FT                   /protein_id="ADB13707.1"
FT                   /translation="MGIMGAEIKAVSASGICDIREISDVRNDVRNDVHENSDVRKNSIR
FT                   EYALRGITDVVFDLQLLVDWDARRTLAADYPDFIGEVLFSFEPEWGFEFHESLREAGWS
FT                   CKQALDSFDEHHGPAVTWLYRLYFERFERGFAGERADVSAVARELIASGVRVWALGNAS
FT                   CDWVNCARKTCPILGELNGVCASYESHLRKPDVMLYRTFLQQTGLSAAFALFLESDSRA
FT                   ASAASLLYS"
FT   gene            complement(419375..420040)
FT                   /locus_tag="HMPREF0424_0389"
FT   CDS_pept        complement(419375..420040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13543"
FT                   /db_xref="InterPro:IPR025191"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA05"
FT                   /protein_id="ADB13543.1"
FT                   /translation="MCDLSVNTKAQKLAKAENLAEEITKLEWDQFQLTENEGGRANCQG
FT                   NWPTFRIMRISQFLAWPLDLQESYKQDLELANSDGGNLITEKYARMMESTAPEIFERTI
FT                   KPYIKPILEPRKSAQEQIILTQVEWAVGFRNRYPNLGFAMRVLKTSEDTAENTSFETYL
FT                   RGELSTYSDATFAKYQRFVHNLRAENLNLTQMIIANTVHMYGYDSLEAAERAQIRNAA"
FT   gene            complement(420040..422046)
FT                   /locus_tag="HMPREF0424_0391"
FT   CDS_pept        complement(420040..422046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0391"
FT                   /product="tetratricopeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13801"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025117"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA06"
FT                   /protein_id="ADB13801.1"
FT                   /translation="MEDAAQFYNELDEMFANHASADAIETYLLRKLTEANPLQLSILNE
FT                   LMGFYRSRGEHTKNQPIINRALNLANKMQLAGTEAGTTTLINAATSLRAAGDYDRAEKI
FT                   YTQALNESAMTLGAKNRKLAALHNNLSMLYSETGRTHDAIEELNQALEILQNTSTDPER
FT                   DIDIAATHTNLALAMLQECTKECSHPNTSTNSKSATLESAFEHASTSVRMYIAGNNENQ
FT                   PHYASALAGFAQVQCARGEYAQAEESYSKALDLIARCYGKDSESYAITTENLRQTRELA
FT                   EKVTEESIEIQESANQDITEQHSTNSHAANQNAATQNAANNNIKTGMQLAQSYWQTYGK
FT                   PLLDQPKFARYKNRIAAGLVGHGSECYGFDDEISRDHDFGPGFCLWLTDEDYAEIGADL
FT                   QNAYNALPQKYAGFESRNETQRAKSCESSKRVGIFRISEFFENITGFPTAPAANEPHLW
FT                   LSLSESTLAAATNGKIFADPLGEFSKARQSFKLMPNDVRISLISRRLGMISQAGQYNFP
FT                   RMIARKDASAAWLSINEFVRATASLVFLLNNPVTAGYLPYYKWQFAALRKLSNRMASRL
FT                   PEVCSKLESVMRLSSAACFGGDGSGGDGFGEGGKGAGLAQKQVTQIIDSICEDIVRELQ
FT                   YQGLSDCSETFLEWQRPYVEAHIHSRAACLKSL"
FT   gene            complement(422256..422329)
FT                   /locus_tag="HMPREF0424_1369"
FT   tRNA            complement(422256..422329)
FT                   /locus_tag="HMPREF0424_1369"
FT                   /product="tRNA-Pro"
FT   gene            422568..424265
FT                   /gene="lysS"
FT                   /locus_tag="HMPREF0424_0393"
FT   CDS_pept        422568..424265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="HMPREF0424_0393"
FT                   /product="lysine--tRNA ligase"
FT                   /EC_number="6.1.1.6"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00499"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13561"
FT                   /db_xref="GOA:D2RA07"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA07"
FT                   /protein_id="ADB13561.1"
FT                   /translation="MTDTNTAMSAAQSAAESAAKNAAENEATDTVNEIDTVEHAEMLLA
FT                   QDEAIAKRVNEGATLDEAIDPSNKEFGPQAHPEQVQMRVAKRAMMLKEGVQPYPVHLNV
FT                   TDTIEKVRADFDGKLEAGEETDTEVGIAGRVLFLRNAGGLCFVKLSAGDGTTIQAMVSK
FT                   KEIGEESIKSFKQMVDLGDHLYVRGRVISSKTGELSVFATEWAIAAKALQPLPALHKEL
FT                   SDDTRTRKPYIGMIADEKIRDMVRRRSRAVASLRRTFDSHDFLEVETPMLQTVHGGAAA
FT                   RPFTTHMNAFDIDLYLRIAPELFLKRCLVGGIERVFEINRDFRNEGVDATHAPEFTMLE
FT                   AYQAYGTYDTIAALTKELIQKAALDAFGSTKVTLLNGEEYDFGGEWKQITMYGSLSEAL
FT                   GEEITPETSVEHLGAIADKLGVERDDVENHGKLVEHLWEHFYEDKLYEPTFVRDFPVET
FT                   SPLVKGHRTKPGMVEKWDLYVRGFELATGYSELNDPVVQRERFVAQAKDALAGDVEAMD
FT                   IDEDFIEALGVGMPPAGGMGMGIDRLLIALTGATIRETITFPLVKPLR"
FT   gene            424421..425161
FT                   /locus_tag="HMPREF0424_0394"
FT   CDS_pept        424421..425161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0394"
FT                   /product="phosphoglycerate mutase 1 family"
FT                   /note="identified by match to protein family HMM PF00300;
FT                   match to protein family HMM TIGR01258"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14262"
FT                   /db_xref="GOA:D2RA08"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA08"
FT                   /protein_id="ADB14262.1"
FT                   /translation="MTYKLVLLRHGQSAWNKTNQFTGWVDVPLTEQGVEEAKHGGELLK
FT                   EKNVLPDIVFTSLLRRAINTANYALDAADRLWIPVRRSWRLNERHYGALQGKNKSEIRQ
FT                   EYGDEKFMIWRRSYATPPPEIDPNDEYSQTNDPRYAGDPVPETEALANVVTRVTPYWES
FT                   DIIPELKSGKTVMIAAHGNSLRAIVKMLDNLSEEEISKVNIPTAIPLLYELDENFKPIK
FT                   PRGEYLDPEAAAAGAAAVAAQGQK"
FT   gene            complement(425317..425997)
FT                   /gene="phoU"
FT                   /locus_tag="HMPREF0424_0395"
FT   CDS_pept        complement(425317..425997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="HMPREF0424_0395"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU"
FT                   /note="identified by match to protein family HMM PF01895;
FT                   match to protein family HMM TIGR02135"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14115"
FT                   /db_xref="GOA:D2RA09"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA09"
FT                   /protein_id="ADB14115.1"
FT                   /translation="MRVIFNEEMKAIASNIERMAELVAKAMNDAGSALLNADLEAAQTV
FT                   IDKDADLDALEANTIDQCLTLLARQNPVATDLREVVATMRLAATFERMGDLTSHIAQIT
FT                   RRTWPESAIAQEGRETIVAMVDFLRELSGHLTTMVANRDVQIAETIIAGDDALDKLHEK
FT                   IFELVEGENWKGTRRQLIDVVLLSRFIERIGDHCVAVARQIVFIVSGFDPSKKPEPDKD
FT                   TVVA"
FT   gene            426187..427455
FT                   /locus_tag="HMPREF0424_0396"
FT   CDS_pept        426187..427455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0396"
FT                   /product="ATPase/histidine kinase/DNA gyrase B/HSP90 domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13567"
FT                   /db_xref="GOA:D2RA10"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA10"
FT                   /protein_id="ADB13567.1"
FT                   /translation="MPQGSSAVVIVVFVAFGVLALCVVLSLCVLMSDWFSTVLRLFKRA
FT                   FNYIRGARYGAKYDESDDITDDISDNASDDISDDASQVLAMLDMPTVVIDANNDVIRAS
FT                   SEAYLLGVVSDDSLCQPRVLQAVNSVRASGGFERFSLVTSTPERYVSITANPQESTTVS
FT                   RPNWLTVTAGSIGGGIVVVIIEDTSAAHRFAQTRDDFISNVSEQLMRSTRNLTQLTKVL
FT                   QNEQVSAQKIKDIAQIAGKSSKKLEHMLEDLLWLVRAQNPIDLDSAQVFSLNDVLSYVQ
FT                   NQVAAFAKDCCVRVVSKVDSHLCVRGEISQIQAAVRKLVENAITYSPKNSTVSLSVSLS
FT                   TDGQYAVIRVVDRGVGIDLQDQSRIFERFYRANNQNSQSQDGVGLGLAIAKHVALTHHG
FT                   NITLWSMPGQGTTVSFALPIVNK"
FT   gene            complement(427514..427780)
FT                   /locus_tag="HMPREF0424_0397"
FT   CDS_pept        complement(427514..427780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14596"
FT                   /db_xref="GOA:D2RA11"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA11"
FT                   /protein_id="ADB14596.1"
FT                   /translation="MVGSMKFAPIVNPDARKAAPKPLQVDLRKVFSIGTIAWLVATIIA
FT                   LIVALLHITTWFPVLFCASGTIIGVLLLIWEHFDRWDYRRLGK"
FT   gene            427966..429111
FT                   /locus_tag="HMPREF0424_0398"
FT   CDS_pept        427966..429111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0398"
FT                   /product="CHAP domain protein"
FT                   /note="identified by match to protein family HMM PF05257"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14029"
FT                   /db_xref="GOA:D2RA12"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA12"
FT                   /protein_id="ADB14029.1"
FT                   /translation="MRHAAHGATKAKRRGDSPLSLFVAQHGAHGAHSVRGMRSVQTNRV
FT                   SERLAAVATSNGAVVELPEAVSERLQELVPQSRRALRLSKLANERRRNVILSASLVAMV
FT                   GTVAATMALTKVNSFASRASEFEPSMTAEGDASSTVSRSSQRESLDPMATINNTVDSIE
FT                   NAAKKLHNADSADAANSANENSSARSDSKHKNLASKVANSVQPGTFSTISSKSDSWNLG
FT                   SDSGFNIAEMSRSAANNPKVALLIDKDFDVLPKGFNPNHATGDTGNAYEFSQCTWWVYI
FT                   RRHQLGLPVGSHFGNGNMWADSARSLGYWVDNSARHVGDIMVFRSGQAGSDPFYGHVAV
FT                   VEKINSDGSIETSECGASYQGRTFSRKFDAKEVSQYQFIHY"
FT   gene            429225..429947
FT                   /locus_tag="HMPREF0424_0399"
FT   CDS_pept        429225..429947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0399"
FT                   /product="NlpC/P60 family protein"
FT                   /note="identified by match to protein family HMM PF00877"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13793"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA13"
FT                   /protein_id="ADB13793.1"
FT                   /translation="MLKQSRIFSVFVSAAAAASMLTVMAPFAMAESSHELSESAVTSTR
FT                   AFPKVTNVPRDILTESTSTDVDTNSHWGGIESLNVPQTKTPSEQAAEVARRAFAGNAAA
FT                   SRSGFRSGVEQVPLASVVPPDDKSVASLLNFATQFLGKVPYRSGGNTPAGWDCSGFVQY
FT                   VFASVGVSLPRTSGAQATVGTPIPSLAQAQPGDIIANAQHASIYVGNGMVINSQLAGTK
FT                   YDPIRCVFPGGYSIRRVL"
FT   gene            430089..431114
FT                   /locus_tag="HMPREF0424_0400"
FT   CDS_pept        430089..431114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0400"
FT                   /product="universal stress family protein"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14587"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA14"
FT                   /protein_id="ADB14587.1"
FT                   /translation="MIPEKAVLVGVDGSHASYKAVWWAANYAKHAGLQLQIVCAYSLPS
FT                   YAAVSFDATYTAIGDDNAAHHDAQEILSKAKAVALEQGVDATTLIVTGDPSSVFVELSR
FT                   NYQLIVIGNRGKGGLAERLLGTTSSSLPAYAYCPIVVVPYTDDDGQRIHLNNTITRVAV
FT                   GSDESKWGLKALEIAADLADSWHAELDVISAVPRVQGAEGDTAVMGSYMEDLEERVKPI
FT                   LQRLPDLQIHRTVVPGSAVEALTQASLNHDLVVVGSRGRGGFTGLLLGSISQGLLQHSS
FT                   RPVYVVPRKYVEFSAAQVAAAQKQHSEASIDDISGVHEVDVPKAGKEAAKEIEQTIDPL
FT                   R"
FT   gene            431536..431688
FT                   /locus_tag="HMPREF0424_0401"
FT   CDS_pept        431536..431688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0401"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13651"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA15"
FT                   /protein_id="ADB13651.1"
FT                   /translation="MQIALALITLARETRVGSPLDFQLKRVSAPNCLRALKSQRESRSS
FT                   RCARV"
FT   gene            complement(431803..433134)
FT                   /locus_tag="HMPREF0424_0402"
FT   CDS_pept        complement(431803..433134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0402"
FT                   /product="glycosyltransferase, group 1 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14455"
FT                   /db_xref="GOA:D2RA16"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA16"
FT                   /protein_id="ADB14455.1"
FT                   /translation="MRNNDATHACMQPEETLKIAIFTETYPPYINGVATQSYMLKKMYE
FT                   ELGHEVLVVTVGSEKQRKTKLEDGVVYVPGILLKKLYKYRVALPIGHMRKQLPLKFKPD
FT                   VIHIQNEFGIGEIGLEVAKKEHIPVIYTLHTEYDKFLFYIGLKHFTEFSRNISAKYFMR
FT                   FSKNATIITSMSPKAQAYIDRQKVDKKVIVLNNAVEYKKFLPTPERLAFRKAFREKYGV
FT                   SDSTKLFVFVGRIGAEKNISELIDNFMYCDFPREKARLFVIGGGPDLESLRKRVADNGF
FT                   DDRICLLGPIAHTEIPKYLHAMDYYTTASLSEMHSLSMLEAMASGLFALVKHDVPNEKQ
FT                   IISGQNGYQWDTKEDFKTVFSKVLNMSETEQAQLKANVLEYSKNNDFKSQALELLKIYK
FT                   RAIEMNKEKLAEKKAKRDARRARFMLKKRENTEAESQEPQKPQD"
FT   gene            complement(433227..433646)
FT                   /locus_tag="HMPREF0424_0403"
FT   CDS_pept        complement(433227..433646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0403"
FT                   /product="OsmC-like protein"
FT                   /note="identified by match to protein family HMM PF02566"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13731"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA17"
FT                   /protein_id="ADB13731.1"
FT                   /translation="MSRRLWVERNEDGTWEAHSDDGVSLKFGHGEGMFNPVELMQIALA
FT                   GCTALSSQYAAEHAIGEGAGARVVVNGTYDAEEGTYLRFQEDVTLDATCAKPALSQEDA
FT                   AALKERMERHISRGCTVKHTLENGAKVSVNVTVRR"
FT   gene            433798..434670
FT                   /gene="thyA"
FT                   /locus_tag="HMPREF0424_0404"
FT   CDS_pept        433798..434670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="HMPREF0424_0404"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="identified by match to protein family HMM PF00303;
FT                   match to protein family HMM TIGR03284"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14246"
FT                   /db_xref="GOA:D2RA18"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA18"
FT                   /protein_id="ADB14246.1"
FT                   /translation="MALTEEELVAIRARVPQKPLSSIPTPYEDLVRNILTEGTLKSDRT
FT                   GTGTISLFGQQIRFDISKYFPLITTKTVFFKGLAYELLWFLKGSSNVRWLQENGVHIWD
FT                   EWADENGDLGPVYGVQWRSWPAPTAENPNRTIDQIANVLDLMKNHPDSRRMIVSAWNPA
FT                   EVEHMALPPCHSLFQFYVADGKLSCQLYQRSCDMFLGVPFNIASYSLLTMMMAQQAGLE
FT                   PGEFVWTGGDCHIYDNHVEQVLEQLSREPYPYPQLEIRKADSIFDYDYSDFKVVEYKHH
FT                   PTIKAPVAV"
FT   gene            434731..435390
FT                   /gene="folA"
FT                   /locus_tag="HMPREF0424_0405"
FT   CDS_pept        434731..435390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="HMPREF0424_0405"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="identified by match to protein family HMM PF00186"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13600"
FT                   /db_xref="GOA:D2RA19"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA19"
FT                   /protein_id="ADB13600.1"
FT                   /translation="MANSVSHNFPVRLIWGEAFGLDGKPGAMGVNGGMPWRLSPDLRYF
FT                   KAMTIGCPVIMGRGTWDATPPKFRPLPGRENIVVTHNPDFVADGARSFTSIDAALNYAR
FT                   EWLENRETLRSQGSVSQDASQDFPQDSPQDGRAIWVIGGAAILREMLANYHADAAYVTQ
FT                   IDAKVAADTFAPNIHALVDAGKWHVAREGEFEEALLKVGSESNPTRYRFMVYEPAQ"
FT   gene            435437..435991
FT                   /locus_tag="HMPREF0424_0406"
FT   CDS_pept        435437..435991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0406"
FT                   /product="low molecular weight phosphotyrosine protein
FT                   phosphatase"
FT                   /note="identified by match to protein family HMM PF01451"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14109"
FT                   /db_xref="GOA:D2RA20"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA20"
FT                   /protein_id="ADB14109.1"
FT                   /translation="MTEESSKIKVDARHPYTVMTVCTGNICRSPMAEIVLRNEFQLRGL
FT                   GDVVAVRSSGVSDEEYGNPIDRRAQRELTKRGYRLPASHFAHRIEADEIAETNLFLPMT
FT                   ASHMHSLLRLLPPQKRELVHMYRAFDPSIPKPQPGREMLLDLADPWYGGPREFEVAMDQ
FT                   VEQCAPYIVDWVAARIERADR"
FT   gene            436006..436194
FT                   /locus_tag="HMPREF0424_0407"
FT   CDS_pept        436006..436194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0407"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14016"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA21"
FT                   /protein_id="ADB14016.1"
FT                   /translation="MLGNARTISARLRNSRWKSTGFPTRASFRSELLSRALCCARACRR
FT                   ARVWSAQAGRHVYEYSL"
FT   gene            436260..437627
FT                   /locus_tag="HMPREF0424_0408"
FT   CDS_pept        436260..437627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0408"
FT                   /product="peptidase dimerization domain protein"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14578"
FT                   /db_xref="GOA:D2RA22"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA22"
FT                   /protein_id="ADB14578.1"
FT                   /translation="MAGLAVEDVRARVQDAWNDVVSVLNKKISLAAVSAKGIAGEHMQK
FT                   SAQYVAGVLREVGIDARVEQSTNPDGTPGAFEVVGSRIVNPSAPTVLLYAHHDVQPVPD
FT                   PSEWETNPFEGTERDGRLYGRGSADDGGGIAIHYGALRALSDDLRVNIKVFIEGEEEMG
FT                   SPSFIPFIESHKDEFESDVIIVADSGNWSAEIPSLTTSLRGNTDVDVRVKVLGHQVHSG
FT                   QFGGPILDAYTLASMLIASLYNEAGDLAVPGIEAQEPVGGLQRDLDEAQVRADASVVDS
FT                   YKLAGTGSLAARMWTKPSLTVIGMDAHPVEGSFNVIAHETKLRLSLRTAPSQRPEEAQK
FT                   ALCDFLVSHAPFGAEVTAEPIDNGMGWAMDPDAVATKDALASMRDAFGVEPVNKGEGGS
FT                   IPFIPELQRIFPKAQVLVTGPEDPKSNAHSPNESISLSGLRGNIVTEALLLDRLGE"
FT   gene            437836..438474
FT                   /locus_tag="HMPREF0424_0409"
FT   CDS_pept        437836..438474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14277"
FT                   /db_xref="GOA:D2RA23"
FT                   /db_xref="InterPro:IPR021403"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA23"
FT                   /protein_id="ADB14277.1"
FT                   /translation="MTWNPFAKKTANNEGASTPSLQKKVADAESSVATKSREKNAPTPK
FT                   RNAAQAQKLRPLVPADRKESAKRARARLRESENLQYNAMRTGDLAHMPKIEQLPWRVYI
FT                   RDYVDARINIGEFFIPVAVLIMICLFALSKFVIVYFVFAVFLYAYLFASVIDMFVMWRK
FT                   LRKELIRRFGDVAVSRKSRSGMYAFSRAMQLRRWRLPKPSSAKRGNWPK"
FT   gene            438604..439437
FT                   /locus_tag="HMPREF0424_0410"
FT   CDS_pept        438604..439437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13737"
FT                   /db_xref="GOA:D2RA24"
FT                   /db_xref="InterPro:IPR025445"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA24"
FT                   /protein_id="ADB13737.1"
FT                   /translation="MAQDKAQSKSQGASQSATQGMKKPKKKQGMFSQIIRIYKYTHSDD
FT                   KQLPLWLSCAFAAPILVAVILGIVSRWSILMWIMMLITAVMLGLLLFTVVLTKRADKVG
FT                   YAKLEGRPGAAAGIISAINKGGFTFPQQPVWVDARTKDALWRGTGFNGIFLVGEGNYER
FT                   LMHAMDRQEHAIKSVTAGSNIPVYRIAVGNGENQVKLKELRGKVLRSKTLQPVKHKFAL
FT                   FDKIHPNRRFFLTKTELAILNERLRTLQSKSGFGIPKGIDPTRPQRISRRAMRGK"
FT   misc_binding    439591..439714
FT                   /bound_moiety="thiamine/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element); Rfam score 46.53"
FT                   /inference="nucleotide motif:RFAM:RF00059"
FT   gene            439880..440488
FT                   /locus_tag="HMPREF0424_0412"
FT   CDS_pept        439880..440488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14476"
FT                   /db_xref="GOA:D2RA25"
FT                   /db_xref="InterPro:IPR017195"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA25"
FT                   /protein_id="ADB14476.1"
FT                   /translation="MSEENYQSNMQWRVADIAVASVIGVVSAFIYWVVAIFSEVPWTAL
FT                   NSILPGFAGLINGLWLFAAPLAAVIVRKPGAAIYAEVVAGVLEALMGNQWGGAETFAIA
FT                   VVQGLFAEIAFIIFAYKKWNLNTMILSGALTGIGCWGYTFLGKLQAVSVFGKYGLPYFA
FT                   STVVSGIVFAGVLMWFLYVGIAKTGALDQFASGREIREK"
FT   gene            440543..443230
FT                   /locus_tag="HMPREF0424_0414"
FT   CDS_pept        440543..443230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0414"
FT                   /product="cobalt transport protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14138"
FT                   /db_xref="GOA:D2RA26"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA26"
FT                   /protein_id="ADB14138.1"
FT                   /translation="MPDATQSQESETFLPTDLSDRKSISNASDASRASDNASNASNAEL
FT                   RFENWGYRHASRRAFAVRGLDLTIKAGQRVLLLGASGIGKSTILSGAAGLIGNDFVAKN
FT                   SAKSQQTTLVEDADGGVSEGCVLVDGVPVRRARGRVGLVLQDPDAQAIFQRLGDNVAFG
FT                   PENMNVPRNEIWDRVRKSLKEVGLDGLQLHRSTSHLSGGQMQRLALAGALAMQPSVLLL
FT                   DEPTANLDPDGTQQIVGAVRAVLDLTHATMVLVEHHAEPWIDMIDRVVVLGLENDEAAN
FT                   GKAANNETVHDDDIARVASSRTVIVADGTPDEVFNRTDLDFEDLGIWLPERYKKNVKSS
FT                   ANESSVSNSSANAESSEKYYENCDPAEGYGEVLLFTKDLAISHNSEPIARHINLEFKAG
FT                   QITALVGANGAGKSTLSLTLAGLLPAVSGEVVASDALAQGANGTDPMKWKSPDLAKRIS
FT                   YVFQNPEHQFACGSVLDEVMLGPLRTGVSADEARAKAQELLKRFRLARYAKANPYTLSG
FT                   GEKRRLTVAASLAAAPRVLILDEPTFGQDRKTWLQIIRLIASLRSEGVSIIVVTHDREL
FT                   VEALGARLVELVPDAKAEAAEMSAAEVSASEVKSSEALSATTGATDISRIKVSAVNNRD
FT                   EEAKLSSKSPLLASINPVFRIFGAFAASIPLFFTLDCVSASVALLLEFVIFACIKLPPW
FT                   RVIRLSWPVWVGAPTSALTVLLYGKSGGNTWFQWWLMHATDRSAMLAVATSLRILAIGV
FT                   PSIVMVIGLDATDLADAFSQVLHLPDRFVYGGLAGIRLFGVLQDDWAALTASRRSRGLG
FT                   DEHRVRAFFPQSFALLVLSIRRSTTLATAMEARGFGGIGARSHARVSRVRARDWWIFAV
FT                   CAIVPSVAVVTALYFGTFAFLGGA"
FT   gene            complement(443194..443343)
FT                   /locus_tag="HMPREF0424_0413"
FT   CDS_pept        complement(443194..443343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0413"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13925"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA27"
FT                   /protein_id="ADB13925.1"
FT                   /translation="MTGDAKQKAAETLQRRKGNNAPLAKAAIKSSHRAHRKTHAPPRKA
FT                   KVPK"
FT   gene            443903..443975
FT                   /locus_tag="HMPREF0424_1371"
FT   tRNA            443903..443975
FT                   /locus_tag="HMPREF0424_1371"
FT                   /product="tRNA-Arg"
FT   gene            444149..445162
FT                   /locus_tag="HMPREF0424_0416"
FT   CDS_pept        444149..445162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0416"
FT                   /product="Abi-like protein"
FT                   /note="identified by match to protein family HMM PF07751"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13455"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA28"
FT                   /protein_id="ADB13455.1"
FT                   /translation="MDNQCDSDIKKTCAISKLPVKLSSIDQIKHLKKQGITFNKQSKDS
FT                   AISYLSIFSYYFETCSYKKLFSKRVGGSRDGQYIDLDFDQLCKIEQLNRMFQILLLLIT
FT                   LAIEHEAKVKLMKMFTENPEEDGYSIVEDYMSSLYNDDRKILIAELERLKDGKYSRESA
FT                   AKYTGGMPIWVFVEGITFGTLLRFYRFCAKRWGSREMQKEHHLLCRVKSVRNACAHSNS
FT                   ILDGITEKSFDNVLLLEEVSKAIEAVGFNKRARRSNMCNAKMKEIVITAYMYKRFLSRN
FT                   YQCDECVNDQKSIIRYIAGGFIKKASEYTKEYDKASKFNSLLAFICTVIDSWICER"
FT   gene            445334..445468
FT                   /locus_tag="HMPREF0424_0417"
FT   CDS_pept        445334..445468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14327"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA29"
FT                   /protein_id="ADB14327.1"
FT                   /translation="MAYSDESHTVYSDEAHRIQQRSTQHTQHIPAQHIAVRCMRYNNM"
FT   gene            445896..451943
FT                   /locus_tag="HMPREF0424_0418"
FT   CDS_pept        445896..451943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0418"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13673"
FT                   /db_xref="GOA:D2RA30"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA30"
FT                   /protein_id="ADB13673.1"
FT                   /translation="MLPAKFRGFASRVGRLASRALVWRKTSADGAVRTSSTAVISSSNA
FT                   NTFGTANTSFDNAVTSSSAATSGSVTIARAACPAHTLRRALFAMFVAAATIVTMLIVPP
FT                   VKEANAANVSWDYIGNGYISPNSVASWDVYRDFDVQPPDINTITVNGKKKTTITWNVLF
FT                   NANGCRIKKIENPNVDCDENTALHAYDGRPDFYLILPKNIKDNSIRITRYRTKFVGYSG
FT                   RNKKFVWEERGKDQIPSDFNGYTNATRLPGDSDYENFWKASIEKCGLGTDATCEVDTWR
FT                   RAGNFGRLFKSWEQDNAVDSIRWIVTAEVEEGSDPYKLPFMAGWISYYGDKHKFTVFGP
FT                   YDHDGDGIPDLEEFKYGLNPKNDDDIRFPKRSKEDAVYGEVTSVKPYINTGEWVGDSYN
FT                   GDFKYYKDMPNHGGRTTSEMIPTDAGIEFTFKKNEIGNSEILPPGVTKTYNPNNMQPGQ
FT                   AYINPRTGEVKYSPKASDRNKTIHFDVQINYPDPKPNNCKMNNSIVKVKGVDIHVVSQA
FT                   SRYNPYYDDTTVKAGEEKNSPNPKDRGGKKFPSGTKFKSEIYNKYQNPPTWAKINNEST
FT                   GVVTFHPNKWVPASKTGQPEKRPVVVHYPDGSTSKDKDSGNHGDPVNAPVYVTRDNPGT
FT                   GDLQLHIHKNQNGQEIDYNDGFVFRKNREVKPQPWIDSWSVQEPGDITIRSVCADTTNP
FT                   LNLKFYLNGINGITINGEKPWPHATDEEQEKCRNGQGCAANKLFDSTGRTMERTRGSIT
FT                   GKPLKVGNYQCTVYALKPKALKKFEDAAKKNKDIEKQTGSPTNIINPDTFKGLREDIDY
FT                   TSRTVPIKVHSDAHYYNPQYDKVYVQAGGKSKESAAPVSHSGANGVKGNDKSQQELVQN
FT                   GTRLPKGTWFELRTYPKDNEHVLTWYKFVNKQSNKKSGKDEPEDSTTDARYGKVTFSPE
FT                   KTVMLGEYFAPVIVHYPDGSTSEDPDSGNLGKPVYAPVEVTSQPIQKNDLKLNVYSQYG
FT                   RRRIENNDKNGMRFRKDEVLGDATGNTKPMFFDSWSSAKQGKIYQRMLCYKKNPQTGKP
FT                   ESYEIDGINGLTLAGRKGNTTSGEFIDKQPSQWTRATEKNKYECTVHGKNCNRNLYLYG
FT                   DEHDTVERTWGWLHGKVKENGDFVCTVYAIKDLENKDGKHGDLQNKFDKAVNDFVKKPA
FT                   DRKFEEVIKSVLTDKPGSEDSPQEATQRHIDWDSVTFPIHVHSDAHYYNPEYKTISMEA
FT                   GTKQATEVPKSKKNANDANTLQDDVREGDLPDGTWFKFKKSLSYTFFEDDQDNKADSGD
FT                   SAKNGTGQFGKVTFRPHKWFPVGSDKVQVIVHYPDGSTSEDKDSGNLGKPIYAKVDITR
FT                   SHDEDAGNLRLNVGDREGSGDWNDTTIKLTKGEELSTSKKTTRWLDSWSKYKPGKINLR
FT                   TICNKINSDGTKSHYQSGGIAGIKMQDVKIWDHTEDASAQKACEKDASQCHPDRQLYDD
FT                   YIANGNSKDTTERTRGWIKGKANESGDYECVVYAIKAKQFSKDNNDLLTRFDAAVGALN
FT                   KDASKNNTDPLKDFKWKLDGNNGNKNAVKGVDYAYRAIPIHIHNDNHFYNPKYVDVSVT
FT                   AGQKVENAVPQSVKSANGADKYQDAVKAGALPDGTWFEFKDATHGFEVNNDGTAGNKVS
FT                   LDWSYWASGNAADKTGEQSNKPDNPSKQKKGKHSSKDDGTRYGKVTFHPDQSVAPKAYL
FT                   KEIVIHYPDGSTSDDSDSGNNGKPVYAKVTVGDLSGAEKDLKMTLLRSQDADPVHDTLG
FT                   SGNSLTVMSGTSLTKNPYVLAWSLKDRSNISLRMMCAKQGEQKWSRGLDDTLNMHLNQN
FT                   YGESVKPWAFANADQRKSCSQDSKNCMANLLYGFTKDKDPNSIESAVSRSEDDIAGVPQ
FT                   KAGNYTCAVFALKPNALTVFNNTVNGSLIEGNKYSSTNMQTTQLAGVTVGKDWNRIAVN
FT                   VTVIDPPKFALPKTGGMNWNVLLGAFAVIGTGVMAAGFFLEQTKWGRAMLEALLRKTLL
FT                   KDFICKTAKKLRALRRRSERWRC"
FT   gene            451986..452141
FT                   /locus_tag="HMPREF0424_0419"
FT   CDS_pept        451986..452141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0419"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14335"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA31"
FT                   /protein_id="ADB14335.1"
FT                   /translation="MCWQWHYALRSDGTYFGAWFGFNLAARGANRSRRQSSCGFAMTPP
FT                   TVRNTK"
FT   gene            452203..453861
FT                   /locus_tag="HMPREF0424_0420"
FT   CDS_pept        452203..453861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0420"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="identified by match to protein family HMM PF05738;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14312"
FT                   /db_xref="GOA:D2RA32"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA32"
FT                   /protein_id="ADB14312.1"
FT                   /translation="MNKFTKQCVAAFASLAMAGTLCVAGAVVANNVAFATGATAAEKAP
FT                   WDLGNEATTKKGSITIHKQDDTTKAGVPGAVFSAKKVKTIDGTAINLTSRDDWETLAQK
FT                   VDKLNKSATVADNTIAYETPLPDQTTNSNGEAKFADLSIGIYRIEEKNPPKGYTSDVIP
FT                   FFMTVPEITRDKSSTNNKYTYDVSVTPKNHNVKDAISKTADTKNMVGVGDVLPYTINAT
FT                   PNKTKATNLDRDGNAKNLTKEDLSQYAIFDDALTTAYENANENAVAEVKLDGETDALIK
FT                   GTDYEVTKAATPDDNTRTRISVVFKDAGLEKIITKLNAVTNAQQQPQIHVTFNFKIAST
FT                   VTTGSDHKLSNKYGFIPGGKTGENHEPVVPDTTTDTEFRKFHILKYDAKKGETTKLDAA
FT                   KFKVFAGANGDSTTDSNALKVAQKCADDPTNADNCKTSLSGFGEKSTKNGVTEDYSAKV
FT                   GQKFYIVETSAPENFTRSTKVYEVTLTSAPSKDGAQVVKIANVPTKDGDHNWFNLPKTG
FT                   AAGVIIFALAGMCLVAVGMFIFLRNRKKDEEQQAA"
FT   gene            453907..454029
FT                   /locus_tag="HMPREF0424_0421"
FT   CDS_pept        453907..454029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0421"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13473"
FT                   /db_xref="GOA:D2RA33"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA33"
FT                   /protein_id="ADB13473.1"
FT                   /translation="MNVNICLHGINIGAGCDLLLPALYLYALIELTSERKINKS"
FT   gene            454072..455217
FT                   /locus_tag="HMPREF0424_0422"
FT   CDS_pept        454072..455217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0422"
FT                   /product="sortase family protein"
FT                   /note="identified by match to protein family HMM PF04203;
FT                   match to protein family HMM TIGR01076"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14620"
FT                   /db_xref="GOA:D2RA34"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA34"
FT                   /protein_id="ADB14620.1"
FT                   /translation="MKLNDAVAKVYAFLNKISQNKLFKNQTNATQTNETNLTETNLTET
FT                   NLTESNATENNATQAHATEAKSAESNQKSKQKTNRKSKLRRIVEPIAFVLAGILCFSYP
FT                   VVSTLWNNRVSKEISNAYDKYNHDQAGDVRRAHIRAAKLYNKSRKNMLTTDPYGPDGQK
FT                   DVTNTPEYKRYLKALEEPMGIIGIVKIPKIGVKLPIYHGSSQEVLAHGAGHLYGTDLPV
FT                   GGKNRHTVITAHTGLADATMFDDLVNLKKGDYFYLDVQGETLRYKVFRISVVEPHDISL
FT                   LQREKGRDLATLLTCTPYGVNSHRLLVTGYRVLPDPVKPPDDHVQWPLWMTLFVIAMAF
FT                   SLIVLSMMIAAATSKRGRQLDIRGKHLLILSRKMLRKLRRE"
FT   gene            456120..462248
FT                   /locus_tag="HMPREF0424_0423"
FT   CDS_pept        456120..462248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0423"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00082;
FT                   match to protein family HMM PF02225; match to protein
FT                   family HMM PF06280"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13917"
FT                   /db_xref="GOA:D2RA35"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034216"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA35"
FT                   /protein_id="ADB13917.1"
FT                   /translation="MKFKRTSYLTRLAALGVAAATLMVPLGQVPAAFAKNDNETKKDGN
FT                   ALVSKMLDSSLKANSEIKSIEDLRHVNPTLAKAFENYSKKDQFNKNSNAQVTVVVTLKN
FT                   YRSQLTDADEKANIHEQNVLINRVKSKYNMTVRRQVGYLMSAFEATLPEKHVQDLKREP
FT                   GVVSVAKERLYHPMENYARDLQGVQTVFKKHHLDGTGMLVSIIDTGIDPNHQDMKLDAS
FT                   AKKNIRLKPTGKGNTTDKVPAGFNYADENTNFTDANGEQHGMHVAGIVAANGDENGAPA
FT                   SENHRVDGIAPNAQLLAMKVFSNVPGSHGARDVDIVAAIEDSVKLGADVINMSLGSDNG
FT                   FGGTSSATSVALKKAREAGVLPVISAGNSGLNFSESGGIDDSLGKWDDATLGSPSSYPS
FT                   AFSVASVENSNITQQSANWVGKDGKSHTLPYSYSIGSLTDALSQHELVDAKKATKADVK
FT                   DLDLTGKYALVERGGISFTEKFNNAISKGAKGVIVYNHDKDSSLFIGMGGLEKIKNCFG
FT                   ASIPRSYALEIKAALDKGEKVKIAFTEQFVTIANPDDGKPSSFTSWGPTPEFDFKPQIA
FT                   GIGGNVWSTQNGNKYTSMSGTSMAAPNVSGLSALVMESYKNRFPELNKSEMATRVSQAL
FT                   MNTASIIGHKDSADSKKIPYAPRQIGAGLAQVDKAVATDVIATVNGNSYVALKNVNSNR
FT                   EFTVTLHNYGKKPVKFAVPDQEVVNESNEVNKDTVTSISNTETLQSETRNVTVKPGKTA
FT                   DVKFTLSPNRSKGNHYIEGWVRFESLTDTQPDVSVPYLGFVGDWNDEPIMVKPGESYSA
FT                   KHSDLTTSLLSVAGFMGKLPVNNETKPYVLGEFSPANQDGWMDYVVPSMAIFRGASDIK
FT                   YSVLDSHNKTKIVLGTEHNVHRSTIANAGTTDGLAGNFDGSVWNPKTSRFDILPDGWYT
FT                   YRIQARLGDKFDWQTYDMKVAIDNHGPKVTVSDRDDKGNVKIVISDELSPDPGVPTIHL
FT                   PGVKDALNYGDEDTQCPLNEATRTRVCKSIHIGNEAQYIDVLVRDNAMNPTEVKKVFDT
FT                   YVPNGSGKAEKNKKFIIPNEQKLISHQIKANQLEESKTNPDINGKFYLEGYLTKDVASI
FT                   KAYVTPKDGKKQEVKLAKKRKGENTFYAFVPLKNGKNTVMLKAFNSNGGRIGNKKLELT
FT                   FNAQTPKITVNGLDDKGNLPVGADGKVTVAGKVTDTPGDTVKLKLTYQKAADNTTPANA
FT                   VAGSVNNHASGSASGSTIKAVSGANTTSATSIDANVKKADTAAASKETEEVVTVGKDGS
FT                   FKTVITPAAKAVMVTLVATDSAENTTTIGLALAGRSTPTPKPAAATKDFVLTNAGSMGA
FT                   YAWLIHKKNYGPDVIGSDYFVAQGDVSSKVTSVVFTPASRFDATTKNLVTPNPLRAEIK
FT                   NGKFSVKLPMHPGINDFRLQVNTKADDEDADEDDETNVIDTPAAFYFDITPPTAHFDTP
FT                   KLYGHTLFTNRDTVTFSGNVSDDAFGQSLRINNDSVGDFYTLDTNGKETTRRQFSTDIP
FT                   VDNGDKLLLHLSDQVESHLLSVIPVVLDETDPTVEAGLVEGEEIDDGHEITVKATDDNL
FT                   KSLRVMVDGRPVAYTENYLPTTAVENTLVDVSKVNDNPTPDKPGSTTLTLKIPTKKLTD
FT                   GSHTITIEATDFAGNTASATSDNAKGATAYTFKVKHGVKPGEDPSKPGQDPKKPGEDPK
FT                   KPGEDPAKPKNPGTKDESTQTDSAPIPPASTEKISKTIAGLDTKNVTAGKEVKIYISGK
FT                   PAALKNAKANARMYAFIYSDPKDLKGEDGHEYVTVRTGENGKYYFKVLIPSGYSGKHTI
FT                   LLMDANGNQIASGEVSVSSSASSDSGSQTDSDTKNNQNNQNQSGSGNTGNAGNTGNTGN
FT                   SEGGSSGHGKDSGNNGGSTSGNASGDTNNDSRGGNHGGSHSSNHGGSHSSNHGGNHGGK
FT                   SFTTGGNSSNNSESSSKDDADSTNAGASAASGDAAANGNASSSNGNASAANGNAAAKQK
FT                   AAAKAAAKKMTSDLAMTGSSVIGMVVTFMVLLASGAVTFKTRRRHVHANK"
FT   gene            complement(462305..462430)
FT                   /locus_tag="HMPREF0424_0424"
FT   CDS_pept        complement(462305..462430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0424"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14490"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA36"
FT                   /protein_id="ADB14490.1"
FT                   /translation="MEQLEYSQYITYNKIWVIQVIQVIRIIPQNILHTKRALPPY"
FT   gene            462642..465593
FT                   /locus_tag="HMPREF0424_0425"
FT   CDS_pept        462642..465593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0425"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13804"
FT                   /db_xref="GOA:D2RA37"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA37"
FT                   /protein_id="ADB13804.1"
FT                   /translation="MFPQRRRNSLSKIMRVICGFTSCVLTLATLAIVPITPSSASTEET
FT                   TPKTSKSAEINGNQELKNKDEHKSDKKAEQQPVNNLEQHTSATANTNPKNEVSNKDKEA
FT                   DQNSKNKKAKNAAEAAQTGSNGDRSSTNTTENGAQFYNPEYLRTLNIVAGNLSTSANNK
FT                   SGAPRSKPIHGNRKIKRGYLPVGTRFEIKPDANDKEDAYEWANFEGEQCAVANDASANN
FT                   KQCKETKAIPSDNSKSYGVITFRPNRWTKAGRYKVHVIVHYPDGKSTSDDANAGNSKGG
FT                   KPSPVYANVVVTRFDPHDSDLQLSIISKDKEDLKYGQSDNSDLVLLAGQEVKKTTFDAS
FT                   AHFGIGNINQRVICYKKDKNGNPVDGKYESGGINGLELKQDANVTVWKHASYDQQKKCF
FT                   DDPANGCSVDDLLYDDYVYNEYVKTHPNFEPKRVNERTVGQFKGTVKKTGDFVCKVYAL
FT                   RNSVKDDGAQDKQDDALVKKFDQIAAEKHNKIDEIDSALKSENLFKSSKGITWEAKTLN
FT                   ITVRKMSYYYQPNYGDGINTLPGQYATSIVPLNQCGVGENCSKKLARTRNLPDGTWFEI
FT                   KPYKNDSEHPVPDWASFIDEDNIDQSNKPTKAGSEVGDDSSDASGAVYGKITVRMSTWI
FT                   KTGHYNVPVVAHYPDGSSSEDEDSSNEGKPIYLKVSVNNSPRINNDDLKLRVTTEKASA
FT                   DGESDSQNDDYGDVDPDQGITMMRGMRFLNPYIDAWSLREVGKKISLKVLCTKVSKDSK
FT                   ASKDGSVNANSSSGVGVWSSSINGLTAPTENQIHNWDHIKTVAELEKCKNNSASCDASR
FT                   TLFRRDVEASDWDEENPFYAVERTDSIIGGAPKETGDYQCVVYALKPTALAAYTNKVGS
FT                   ATSVQNGDTLLNGVAGLEKGKDWTMTAVKIHVVEPFKLPKTGFAGWNMILSVATTIFTS
FT                   LMVLAFALDQTQWGRAFMKNFVYQNSAQKVSEIAVQKGTEVSARKGTEIKEKK"
FT   gene            465590..467326
FT                   /locus_tag="HMPREF0424_0426"
FT   CDS_pept        465590..467326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0426"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13765"
FT                   /db_xref="GOA:D2RA38"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA38"
FT                   /protein_id="ADB13765.1"
FT                   /translation="MNNFTKRCVAAFASLAMAGTLCAAGAVTVSGVAWASKPAVNTADD
FT                   NTGDNPSQAVQKGDAPWALNDTDKAKTYSLTIFKWQDELDKSGKQKKSTPVPGAEFTVK
FT                   KVTQIDGKDIDLTKYADWVKVASKIDGLNKGTATGITTENGNGTKKNTSGTDQGTKKGV
FT                   AKFDLGIGLYQVQETTVPKGFSAAESKPFYMTIPRIEKGSDGNVVYNYAPYADPKNKDL
FT                   SESVKKTADTSKTVGAGDKISYTISAELDKMKEKAEGTETTANLSADDFNGYSVVDLAP
FT                   DKAFVYPTDITSVVTKVQLGTGDAPATSDTTLPTADYTVAKAKDQIAATTTDVARDKII
FT                   ISFTKTGRDALATAANNNAGNVVKVFVTLEFTLAGSDVLGNNTVINKGGLIPSHEKGNP
FT                   DVVTGKKYKEVKFSKFKIKKVSSTDQSALEGGKFVIFANKTDAQACVTELNKANGDVAN
FT                   KCGEKSPRSAFGEKASAKGTGLTEEYSVKRDEDFYIVETAAPAGYIRNPDVVTTKATDG
FT                   DVTYKFQNLPTKDKGFWFNLPKTGAAGVIIFAVIGMCFVGSGFFVYMRRRKKEEEQAKL
FT                   RA"
FT   gene            467417..468514
FT                   /locus_tag="HMPREF0424_0427"
FT   CDS_pept        467417..468514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0427"
FT                   /product="sortase family protein"
FT                   /note="identified by match to protein family HMM PF04203;
FT                   match to protein family HMM TIGR01076"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14297"
FT                   /db_xref="GOA:D2RA39"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA39"
FT                   /protein_id="ADB14297.1"
FT                   /translation="MKLADFAESARALFKRLTRMRANKSSKSARDSASSQDYASSEIAA
FT                   SSENTESAQSPSSQEQSSLKPMSTLRKLAEPIALVAIGILCFSYPVVSTLVNNHAAKEL
FT                   SIEYDKLNKEKPKENRAEILRKAREYNARHKAIISADPYNGNNDYMDTPEYKEYEKVLS
FT                   EPMGIMGIVKIPKIGVRLPIYHGTTQDTLAMGAGHLYGTDLPVGGKSRHTVVTAHTGMP
FT                   DATMFDDLNTLKKGDYFYFDVQGKTLRYKVFRINVVEPNDIRLLRREKGRDLATLITCT
FT                   PYGINTHRLLVTGYRVLPDPANVPGDHMQWPLWMTLFVISMVMSAVLMAMMLVASLRKK
FT                   NGVSSLQGRHLLAVSRKMLRKLRRK"
FT   gene            469288..469364
FT                   /locus_tag="HMPREF0424_1372"
FT   tRNA            469288..469364
FT                   /locus_tag="HMPREF0424_1372"
FT                   /product="tRNA-Lys"
FT   gene            469422..470897
FT                   /gene="xseA"
FT                   /locus_tag="HMPREF0424_0429"
FT   CDS_pept        469422..470897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="HMPREF0424_0429"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="identified by match to protein family HMM PF01336;
FT                   match to protein family HMM PF02601; match to protein
FT                   family HMM TIGR00237"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14172"
FT                   /db_xref="GOA:D2RA40"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA40"
FT                   /protein_id="ADB14172.1"
FT                   /translation="MQQRAFVLLCGQAGNMTSSNMMPQLFQDDAQLEQPQPSQQPLLNL
FT                   AQSQSQQVQSQLQSLTPQQAQPRQLPLKAADTTAENPWPVAVLSQKFHSAVERWPAAWI
FT                   EGQIVEINMRRASSGYITLRDSNEEVSISVMGFSNFVQQARELRQGDRVVVHGKADIWV
FT                   KATRLSFVADEIRRVGAGDLKAQIDELRKKLKGEGLFDAENKVPLPEFPKCVGLVCAPQ
FT                   ARAEGDVITNVNLRWPVTRFKVIHAHVQGVQCPADIIAAIKQLDADPEVDVIIVARGGG
FT                   SFEDLIGFSDEGVVRATAACVTPIVSAIGHEDDWTLIDLAADMRASTPTDAAKRVVPDV
FT                   REQWQLIDNALQTMRMRISARVDNEIRLVEGYANRPSLTRPSTMLEPHERLVEQAVERM
FT                   RHGLVRLLDDASLTVEKAHASLTALSPQSTLNRGYAVVQLSGGRVLDDAALAKVGDDMT
FT                   VTLKSGVVLGKVTGTKSAVTKSAFIKPSKKSSK"
FT   gene            470946..471266
FT                   /gene="xseB"
FT                   /locus_tag="HMPREF0424_0430"
FT   CDS_pept        470946..471266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="HMPREF0424_0430"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="identified by match to protein family HMM PF02609"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13583"
FT                   /db_xref="GOA:D2RA41"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA41"
FT                   /protein_id="ADB13583.1"
FT                   /translation="MSEKVTKKAEESAENTEFASTLTKEERAAIETMPYEEAREKLVQA
FT                   VQALEAGGLTLDQSMRQWEIGEALAKRAQGLLATVRAKLDAAQAEQSATAATAGTQSNL
FT                   ED"
FT   gene            471310..471382
FT                   /locus_tag="HMPREF0424_1373"
FT   tRNA            471310..471382
FT                   /locus_tag="HMPREF0424_1373"
FT                   /product="tRNA-Arg"
FT   gene            471585..472667
FT                   /locus_tag="HMPREF0424_0432"
FT   CDS_pept        471585..472667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0432"
FT                   /product="Abi-like protein"
FT                   /note="identified by match to protein family HMM PF07751"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13990"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA42"
FT                   /protein_id="ADB13990.1"
FT                   /translation="MVIYKPFTTIRQQIELLKSRGVVFPDEIKAMEILEREGYYSVVNG
FT                   YKNPFLESKNSNKYVQGTKFEHIYYLFKFDRELRSVIFAATTRAEALLRSSCSYCFSQM
FT                   HGNEVNAYLNETNYEDPKESGGLIKAFNRIIENNKSNNQKLNIGKEYIRHCINNHDGQV
FT                   PLWVLSNDLTFGQMFWFYKAQTKCVRGLVAKKYTELYNSSHCSQKDITSIKIDSIYRRI
FT                   KEFRNICAHDERLYCARPHSDNATVFQLIKDFDILLETSYYLEFLEKIEKLLVALCDKV
FT                   PNCSKNVIECIGMSSIDEFYDWKNKIKENIILNSNLSVPNEATLKAMNHANQIMNGKIS
FT                   DDGIAFSNANEAKAFLDNMS"
FT   gene            473014..476424
FT                   /gene="ileS"
FT                   /locus_tag="HMPREF0424_0433"
FT   CDS_pept        473014..476424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="HMPREF0424_0433"
FT                   /product="isoleucine--tRNA ligase"
FT                   /EC_number="6.1.1.5"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF08264; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00392"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14188"
FT                   /db_xref="GOA:D2RA43"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA43"
FT                   /protein_id="ADB14188.1"
FT                   /translation="MSESTNPAANASENTSANHVYPKVSVSASTQENSGAQVAPNPSFP
FT                   KLEESVLQYWDANNTFRKSIEYRPSGKGSQNEFVFFDGPPFANGLPHYGHLLTGYAKDV
FT                   VPRYQTMRGRKVNRVFGWDTHGLPAELEAQKELGIESVEQIEKMGIAKFNDACRASVLK
FT                   YTNEWQNYVHRQARWVDFERGYKTLNIPYMESVMWAFKQLYDKGLAYKGYRVLPYCPKD
FT                   QTPLSAHELRMDADVYQNRQDTTVSVAVKLRDEADAYAVFWTTTPWTVPTNFAIVVGAD
FT                   IDYVEVRPTEGKFAGKKFYIGKPLLGSYTKELGENYEVVRELKGAEMAGWRYYPVFPYF
FT                   ASDSALSEGGTPGPNAFTIFTADYVDTAEGTGLVHQAPYGEDDMNTLNAHEIRSVDVLD
FT                   AGCKFTSDCPDYEGLYVFDANLPILRNLRAGDGPLAQMPEDQRALLFQEKSYVHSYPHC
FT                   WRCATPLIYKPVSSWFVSVTKIKKRLLELNQEINWIPGNVKDGQFGKWLSNARDWSISR
FT                   NRFWGSPIPVWVSDDPKYPRVDVYGSLEELKADFGDYPRDDDGNVNMHRPYIDRLTRPN
FT                   PDDPTGKSQMHRITDVLDCWFESGSMPFAQFHYPFENKEFFEEHFPCDYIVEYIGQTRG
FT                   WFYTLHIMATALFDRPAYKNVICHGIVLGSDGQKMSKHLRNYPDVNGVFNEYGSDAMRW
FT                   FLMSSPILRGGNLIVTADGIRDTVRQVMLPVWSSYYFFTLYANAANGGKGYDARRLRAD
FT                   EVAGLCNMDRYLLARTRLLVERVEKCLNAFAISDACAAVGDFIDVLTNWYIRGSRDRFW
FT                   NEDETAFNTLYTVLEVFMRTIAPLAPMEAEAVWRGLTGGESVHLADWPYLVEPETLSDG
FT                   EKNPKAGTVTELGAVLAHDDALVAAMDKVREVVSSALSLRKAEQLRVRQPLANLTVVAE
FT                   NTAAVEPYEQVLERELNVKNVTFCTLEDASNHGLKIVHELKVNARAAGPRLGKQVQFAI
FT                   KSSKSGDWRVDESGAPVVQTPNGEVALVEGEYELVNRVESSDAQAAANTASAAMPTGGF
FT                   VMLDTALTSDLLAEGYARDAIRAVQDARKENGLDISDRIALTLSVPASDVVKVEQFRDL
FT                   IAEETLATSFEVVEADSSATELSVTLKRA"
FT   gene            complement(476500..476763)
FT                   /locus_tag="HMPREF0424_0434"
FT   CDS_pept        complement(476500..476763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0434"
FT                   /product="toxin-antitoxin system, antitoxin component,
FT                   ribbon-helix-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13488"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA44"
FT                   /protein_id="ADB13488.1"
FT                   /translation="MKSTTTNKEISDKELDKKFDNGEDVLEYFDLEHPTIEHNSNVQKR
FT                   VTFTMPEWIIEKLDKRAKILAISRNAVVNTLIAEKLESSKQN"
FT   gene            complement(476741..477016)
FT                   /locus_tag="HMPREF0424_0435"
FT   CDS_pept        complement(476741..477016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0435"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04365"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14309"
FT                   /db_xref="InterPro:IPR007460"
FT                   /db_xref="InterPro:IPR038573"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA45"
FT                   /protein_id="ADB14309.1"
FT                   /translation="MDFEHDPAKSLKNFAKHGISFKKAQLLWENTTITLESKNSGNDNS
FT                   RYLVFGKINNKHWTAIITKRNNRIRIISVRKSRKNEEQYYEEHYNE"
FT   gene            477356..478285
FT                   /locus_tag="HMPREF0424_0436"
FT   CDS_pept        477356..478285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0436"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13682"
FT                   /db_xref="GOA:D2RA46"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA46"
FT                   /protein_id="ADB13682.1"
FT                   /translation="MRRVGVFRSRYKRDSSSVTVPTGNNSGIIIGSIIIAIFVILAIFA
FT                   DAFTAITGNNPYDEHPEYLDFNSVPTGFGGINFQHWFGLTPLRGLDIFAIVAHGARVSL
FT                   GIGVASTIISLFLGIVIGMIAGYFSGFADALLSRTMDVFFGFPFLIFAIALSAVVPQDF
FT                   PRPLLLILVLGFFGWPSIARLVRAQTLTLKSRNFAVASRVMGAGTWHVLREQIMPNMMP
FT                   LLLVNVTFLIPGRIGAEAALSFLGVGMNPPSPSWGRAIAEAVQWVLVDPWYLLFPGTAL
FT                   FLLTFGFNLVGDGLASALQPRAKKAATA"
FT   gene            478282..479478
FT                   /locus_tag="HMPREF0424_0437"
FT   CDS_pept        478282..479478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0437"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13782"
FT                   /db_xref="GOA:D2RA47"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA47"
FT                   /protein_id="ADB13782.1"
FT                   /translation="MRYKENISNSDTKNSNSSTKNISNKQNVNNTQKKNMQQNISNNSN
FT                   NESAKNSRIISKTVDFLTFLIKRSASAVLVLTLIAVVLFLIFFMLPANPAQLACGKPCT
FT                   PERLARVSAFMGTDAPWYEQLGNYIRGIFFGREFGTNSASSGISAAGAAIICSSPCLGW
FT                   SFTLNEPVTDLIMSRFAVTASLAIGAALLWVIIGVVTGVISASKEGSLFDRAFRALSSV
FT                   GISSPAYLIGMLAILAFAVYLPIFPTGGYVNFSDDPLGWLQHLLLPWIVLALLNAAYYT
FT                   RLTRAHMLDELQQDYMRTALAKGMPRTKVITRHALPNVMLPVLTMFGLDLGGLLGGAVI
FT                   TERVFSMQGLGSLLLDSVKNLDLQVLVGVTLFAAALVIVANLIVDICYRFIDPRAAVC"
FT   gene            479652..481361
FT                   /locus_tag="HMPREF0424_0438"
FT   CDS_pept        479652..481361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0438"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   family 5"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14363"
FT                   /db_xref="GOA:D2RA48"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA48"
FT                   /protein_id="ADB14363.1"
FT                   /translation="MFIFKNNTASKKILASTAAFSLLTISLLSLSACTNYNSGKTSITN
FT                   TSVLNSNPKKGGTFTIFTSNTNMNFDPARSQGLPITSNNFIFRALTTWKVNPDLSKQTR
FT                   VVPDLATDTGTTSDGGKTWKYTLKKGVKYEDGTEITSHDIKFGIERSFADSLSGGFGYH
FT                   KTLLVGAENYRGPFDRKSLDSIETPDNQTIIFHLKAPFADWPWVTSLAAFVPVPTSSGD
FT                   AQTYSKRPKSSGPYRIVQNEVGKQVVMQRNKYWDSKLDSTRTASADEIVWKLGSDTTVS
FT                   AQSMIQGNTDTKTAFLADFVPPAQLAQAQAHPQSRKLLTTSSDGALEYLAINTRRITDI
FT                   NVRKAIQYAVDKQSYRTAKGGEIAGGFATTLITPGISGRKQFNLYSEDPRGNVEKAKQL
FT                   LKKSGKTDIKLILIARPDQTQVASSVQSSLKRAGIKVTIKTVDAVNFTDAITSNSGDYD
FT                   LALASWQPDFPSAFANLGPLFDSSQIGGGNWNISRYSNPKVDALIREAVQTVDENSAHK
FT                   LWQKADHAIMEDSPVVPLIYSHNTFIHGSGVENFYIGSFPAYPNYAAVSLNR"
FT   gene            481368..483029
FT                   /locus_tag="HMPREF0424_0439"
FT   CDS_pept        481368..483029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0439"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13946"
FT                   /db_xref="GOA:D2RA49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA49"
FT                   /protein_id="ADB13946.1"
FT                   /translation="MTNLDAQALNNKDLDARKRIVISVEDLSVSIDGRQITRNVSMRLR
FT                   AGIVSALVGESGSGKSLTALALMGLLDNNARVEGNAALLNASDTNESFINLLSEDASYE
FT                   HIRGGMIGMIFQEPSSAFNPVKTIGKQIEEALIYHPEKAGKLSQRDRKKRVISQLLEVE
FT                   LSDAERVYRSYPHELSGGQLQRAMIAMALINRPQVLIADEPTTALDITTQRDILRLIRN
FT                   LSEKLQLAVLIITHDMSVVRALADEMYVMQGGNIVEFGEVQHIFANPKHEYTRTLLDSV
FT                   PKFDMQYASSGDSYESIEEVAKAIAKNIAKNISESPGSESPVVEVQGVSVKYSHARFSK
FT                   NSNKLALANANLRINSGSTLALVGESGAGKTTIAKLISGQIKPNSGLVLLNGENLNRLN
FT                   NKARRQALSRIGYVFQDSGSALNPRKTIGWSIAEPLLLHTNLDANERLERVEEMLNQVQ
FT                   LPVEFASRFPHELSGGQRQRVGIARALILQPSLLIVDEPTSALDVTVQRCVLNLLHDLQ
FT                   QKYRYACLFITHDVGVVQEVASEVAIIRNGSVQYIS"
FT   gene            483092..483862
FT                   /gene="murI"
FT                   /locus_tag="HMPREF0424_0440"
FT   CDS_pept        483092..483862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="HMPREF0424_0440"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="identified by match to protein family HMM PF01177;
FT                   match to protein family HMM TIGR00067"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14462"
FT                   /db_xref="GOA:D2RA50"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA50"
FT                   /protein_id="ADB14462.1"
FT                   /translation="MASSAAIGVFDSGLGGISVARQLHAALPHERIIYFGDSANAPYGI
FT                   KTPEEVKKLSFAIVEHFVRLNVKAVVIACNTATSAAVNDLRAHYNIPIIGMEPALKLAC
FT                   DLGKGEPQRVIVAATPLTLRERKFADLLQRFSQNNTIFSQPCPDLVRIVERGELNNRDV
FT                   VFAALHKYFDEYDLDSIDSVVLGCTHFVFYRDYFREFLPARTNIVDGNEGTINHLRKIL
FT                   ELNNELASDSQEGSITLTNSDTSLRMQQLAKSLC"
FT   gene            complement(483903..484553)
FT                   /locus_tag="HMPREF0424_0441"
FT   CDS_pept        complement(483903..484553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0441"
FT                   /product="vitamin K epoxide reductase family"
FT                   /note="identified by match to protein family HMM PF07884"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13489"
FT                   /db_xref="GOA:D2RA51"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="InterPro:IPR041714"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA51"
FT                   /protein_id="ADB13489.1"
FT                   /translation="MKQTNAAKEDYETTLSGWRHSAVWTYGIMLFFSAVALITSLILSA
FT                   ETLALAREPNKLLSCDFNSVVSCSRVAQTWQAEIVKFGELSFPNAFFGIAAESVFVTLA
FT                   VIGMIRVRVPRWFAICTWLGGLCALAYAYWLFSQSMFVIHALCPWCIVLMFSTTMQFIS
FT                   LTHASVSSQKLLVKRFSLLESYYRLRYDLLIDVLWIAALLTLILCQYSKVFFG"
FT   gene            484621..485586
FT                   /locus_tag="HMPREF0424_0442"
FT   CDS_pept        484621..485586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0442"
FT                   /product="PHP domain protein"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by match to protein family HMM PF02811"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14683"
FT                   /db_xref="GOA:D2RA52"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA52"
FT                   /protein_id="ADB14683.1"
FT                   /translation="MHIHFSLHGTVYDDYMTAISNNQRDASNHASDSNSSMMNFARERW
FT                   DLHCHTVYSDGTATPEDLITQAKIVGLQGVAITDHDTTAGWHDFQEAAKASNVPVLFGS
FT                   EITAQDSGVFVHMLAYQYNPKNSMIVSMFELTRKRRFDRTKRMVECMSRDFPITWDDVL
FT                   AQAKLGDLTTIGRPHIADALVKAGVYKTRSEAFAGPISPCSPYYIPTPSPNVREVIEAV
FT                   KDAGGVVVIAHPADPTRNRVLLSDNQIISFAKAGLDGLEVYHRGNSKAQRERLLSLASK
FT                   CDLLVTGGSDWHGYGKPNRLGEETTSCEVVSEILLRGYKL"
FT   gene            complement(485648..485866)
FT                   /locus_tag="HMPREF0424_0443"
FT   CDS_pept        complement(485648..485866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14467"
FT                   /db_xref="InterPro:IPR021456"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA53"
FT                   /protein_id="ADB14467.1"
FT                   /translation="MRVVLGVKNVSDSIDFETNQSAEEVRKVINDSKDMLEFTDVNGRT
FT                   IMVSASSLSYALIGDTPKHSVGFGALN"
FT   gene            complement(485930..487726)
FT                   /locus_tag="HMPREF0424_0444"
FT   CDS_pept        complement(485930..487726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13773"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA54"
FT                   /protein_id="ADB13773.1"
FT                   /translation="MYYCGSVTQLSRFKLAALASAAMPEVQFAGTRQSEQVNATDTAAG
FT                   ISHAVVQDISGKLYDVFISADSKGRKRLHDRARAAWTLEHSKDLAALGFAYDTMLTFMP
FT                   GKREDANNNAGNVANNVTDENSTVAGTQQYVQQQSTQQQSIRMSSIIANNNDEDTVLIC
FT                   EHLEGSARDLRLLTTDDCANVGTAIGAIHRLRPTFVTRGKYSAFTTGQIRAQLTGWIKR
FT                   LRQAGHIPTEITDSWSRVLETEGLWSFETCPVHGGFMDGDILFAGSTITAVTNWQRMQI
FT                   NDPARDLAWIFAKLNEQRRNAVLSAYGRIMGSRLDSLIMLRANLWLQMEQVGDFVQALQ
FT                   RADNTSIMRFKAQVERLAHELSRISNAQTAKTGRAAGNPVSTITVGTLLENDNTQSRQI
FT                   SKNNSTENQLNTGNSDETHERDITSERNTELNNTQDETYDSNKTISDDTHERKVQYAGT
FT                   HAANAEEAEKAAQLADDTATQVITHVKTQTVHETAETIVQTAMSKSADSNASAEHENVS
FT                   NAGSNEEAKDAKNNNDSEVKDEVIVERDSKVDSANETSSDSKLSEDTERNTQKNDDKPE
FT                   TVIIPLLEREERAMRDAQADLD"
FT   gene            487816..489363
FT                   /locus_tag="HMPREF0424_0445"
FT   CDS_pept        487816..489363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0445"
FT                   /product="UvrD/REP helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00580"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13748"
FT                   /db_xref="GOA:D2RA55"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA55"
FT                   /protein_id="ADB13748.1"
FT                   /translation="MNSSPEPSQVTSKTSQVTSPEALLDGLDNSQREAATALEGPVRII
FT                   ACAGAGKTRTITRRIAYACATGKWDPERVLAVTFSVKAAAEMRSRIEALGVSNVGCVST
FT                   FHSAALQQIRSVWNDVCSAQFPSIMNDSQQIIASALKRYPDFADMTLLQTRDILAEINW
FT                   AKVSLIAPDDYLRVCASTHRLPPAGLEPQQFVDIYEAYETEKNAHNCIDFNDILLLCCH
FT                   ILRNFPEAANRIKQSIGWITVDEYQDVSPLQHELLRLWMGQNRDICVVGDPAQTIYSFA
FT                   GANSYYLLSFPQEFAPLGADISLNTDYRSTERIVGLANRVLAASAHKKDYVKVKAATKG
FT                   GVRVSQQVFATDVEEALGVVEQIAKLVKSGVAHLGECAILTRTNAQQQVVCKALKAAKL
FT                   PYRVRKDVGWQRNVLEDAQSYGSQGISDIFASSNISTVTVSTIHAVKGLEFAHVYVIGC
FT                   SEGLIPFGSTTDDSALEEERRLMYVAITRAEKTLHLSYASRKDSGTGMNRVPSRFLA"
FT   gene            complement(489518..491296)
FT                   /locus_tag="HMPREF0424_0446"
FT   CDS_pept        complement(489518..491296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0446"
FT                   /product="putative hydrolase"
FT                   /note="identified by match to protein family HMM TIGR03624"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14295"
FT                   /db_xref="GOA:D2RA56"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA56"
FT                   /protein_id="ADB14295.1"
FT                   /translation="MNDDAIHQWLIECFGPIQGEEAWKQLDQLPFELREQLLNQNPDKL
FT                   PKPDEVRGMMQAFSAGGLNNPYEMEATLEEGPINRKLAQSIALQHANGDQGNVNADVAD
FT                   ATRRALSQANLWLDITCNFNPAPGTPEVLSRADWVEKTLEAWVKFANPVAKSVNEALTS
FT                   VIEERFRDVDDAEVKGLFAGVVPIPLPEGMNNPAQLMKLLGNTSFAMQLGQAAGALSHE
FT                   VHGSFDQGLALLQNPAGGLIPYNCIEYAKVWELDITEVMNYLALREAAHARLFASVPWL
FT                   MPRFEALIIKYANGISIDLEAMEEQLRDVETMNPEAISGAVNLQNIGSNDSEEQRQALH
FT                   SLETLLALVEGWVDCVTWQSGMAHIVHIEQLREMMRRERAAGGPAEVTFESLLGLHLRP
FT                   RRMREASQLWEKLTRERGIEERDSLWSHPDLLPTLPEASEVTKDASNEGKAGNESKAGD
FT                   AGNAGDEVTKKSDAEDATKTAAKNAIETQSNQTNEATEKTSESHESADSYESNKNTDNA
FT                   IENAPIEKSFEKLTEDDLGTNDWDAELSKLLEEDARQKKQNSETGNETDDESGDESGNE
FT                   AGNESGNSDETDADGE"
FT   gene            491557..492444
FT                   /locus_tag="HMPREF0424_0447"
FT   CDS_pept        491557..492444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14096"
FT                   /db_xref="GOA:D2RA57"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA57"
FT                   /protein_id="ADB14096.1"
FT                   /translation="MFRFSTGASVFRACFRSLRSLSHALVLYITSHSLRYFAGFFTVIV
FT                   AIFALSLPSAYVVEEPGPTQDVLGSLSNTPVIDMSGSRVKENHDTGKLLLITVNVSGVP
FT                   GYEVSTFYSLISWMDPHKSLLPREAIVPVGQSADEYEKESTNEMNDSQSLAQNVALQYA
FT                   SKHLGIKKEDVKVRLHIEDIGGPSAGMMYTLGILDKLTPEQETGGKTIAGTGTIEKSQK
FT                   IGAIGGIRLKMIAAKRDGATWFLAPYDNCNEVVGHVPQGLRVVSVKTLDDAYKALKAIG
FT                   SGRGANKLPSCNVK"
FT   gene            complement(492489..492562)
FT                   /locus_tag="HMPREF0424_1374"
FT   tRNA            complement(492489..492562)
FT                   /locus_tag="HMPREF0424_1374"
FT                   /product="tRNA-Val"
FT   gene            492681..494192
FT                   /locus_tag="HMPREF0424_0449"
FT   CDS_pept        492681..494192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0449"
FT                   /product="DivIVA domain repeat protein"
FT                   /note="identified by match to protein family HMM TIGR03543;
FT                   match to protein family HMM TIGR03544"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13763"
FT                   /db_xref="InterPro:IPR019932"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA58"
FT                   /protein_id="ADB13763.1"
FT                   /translation="MAQKPDTARNASAMERVGKRKLGYNVAQVNAFLERAHTLYESDEA
FT                   RLTQKDIQEVSFDLERNGYIIGQVDAALSRLERAVVDKCTEQELAQCGRVAWKARVEAL
FT                   YRKLLQHAQRDYRDRFDRGSSHHPSYARKQVDIMVDQALDKIALMLGHELEWETDKETL
FT                   QDIDSAYVSNVIFTQKNGKHGYDERQVDYYLNACVRLLSSLESFERVEQYVDADNSSSS
FT                   YSRAASESYSAPASVPASVPPSVIPVTKAEEPAKSSESTESYNHSEEPVPSFAPSIKPA
FT                   SDFSAASAASSASATAPSASSIFKPVEDAVDDEDTADRLSKIAPRSIPSVPNHDKQSIF
FT                   APVDYANQDSNDSFEALNKSERAIFTPHAAASKPSNVLNDTDSNDELLQSATVMRNSSE
FT                   SSVLPPSFTPAARNRNNSSAPKPVAAPAPDESIPSFAPQDSAQHSSQHSSLNIPELHVS
FT                   NLQPSKPLSLDIPDLSFPIIGHIDESTNFGSSSQGDDDSENNDRN"
FT   gene            494224..494970
FT                   /gene="recO"
FT                   /locus_tag="HMPREF0424_0450"
FT   CDS_pept        494224..494970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="HMPREF0424_0450"
FT                   /product="DNA repair protein RecO"
FT                   /note="identified by match to protein family HMM PF02565;
FT                   match to protein family HMM TIGR00613"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14640"
FT                   /db_xref="GOA:D2RA59"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA59"
FT                   /protein_id="ADB14640.1"
FT                   /translation="MPLYRDEAVVLRTFPLGEADRIVVLLTKRHGKVRAVAKGVRRLKS
FT                   RFGGRLEPLMRVDLLLAQGKSLDVVSQAVSIAAYAGEICADYTSYEYANVMLEVVDLLV
FT                   SNEYTDEYRREYQDTLGQYRLLTAALLSLSKHKHSPDAIGVSYILRALSLAGWSPRLQA
FT                   CVVCGKNEDLCYFSPCAGGMMCASDHTPDSIVCANSTRLQLCALAQGNWSVLDGVSVDS
FT                   STMRCVQQWAEYYLERPIRSMGLLHS"
FT   gene            494973..495767
FT                   /gene="uppS"
FT                   /locus_tag="HMPREF0424_0451"
FT   CDS_pept        494973..495767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="HMPREF0424_0451"
FT                   /product="di-trans,poly-cis-decaprenylcistransferase"
FT                   /EC_number="2.5.1.31"
FT                   /note="identified by match to protein family HMM PF01255;
FT                   match to protein family HMM TIGR00055"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13572"
FT                   /db_xref="GOA:D2RA60"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA60"
FT                   /protein_id="ADB13572.1"
FT                   /translation="MAFENVDYKSLDIPAAPFSDPSHIPDFPKGKVPRHVGVIMDGNGR
FT                   WAKERGMIRTEGHKAAEPVVFDVIAGAIEAGVRYLSLYTFSTENWKRSPQEVRFLMGFS
FT                   REIIHRRVAQMNEWGVRVRWAGRRPRLWKSVIDELEKAQEITKNNKTIDVVFCINYGGR
FT                   AEIADACAQIAKEIQNGKIKGDRVSEKMIAEHLYNPDIPDCDLVIRTSGEQRTSNFLPW
FT                   QASYAELDFVPELFPDYGREALWRSIDRYAHRDRRFGGVKNA"
FT   gene            complement(495785..497017)
FT                   /locus_tag="HMPREF0424_0452"
FT   CDS_pept        complement(495785..497017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0452"
FT                   /product="amidohydrolase"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01891"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13858"
FT                   /db_xref="GOA:D2RA61"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA61"
FT                   /protein_id="ADB13858.1"
FT                   /translation="MLQLTAVQKILSDLDETQREREKQYKYFHQHPELSMKEDHTAQTI
FT                   IDILSEAGIETKRVGKTGVVAEIKNGEGPVVAMRADIDALPIKENSGKDYTSTVSAQDE
FT                   NGKTVGVSHACGHDFHISSLLGALKAFNEHKDAWKGTYIGVFQPGEETAQGAKDLVEND
FT                   IMSMIAKPDVYLGQHVLGAIPAGTVGIRSGAFLTTAASIRVHIFGKGSHGSMPELSVDP
FT                   VVVALSIVLKLQTIVSRELAAKDYAIVTVGALNAGSKSNIIPDDAELLINTRTYSEDTQ
FT                   KFVHNAIERIVRGECELARCPKEPEFTYYDCYPLTNNDQNASLRVRKAFDEYFGEDSVD
FT                   ISRASASEDFSIVANAFKTPYAYWGLGGFADMQNAPGNHNPAFAPDLQPTLNRGLEAAV
FT                   VAACAWLTSEK"
FT   gene            complement(497092..497457)
FT                   /locus_tag="HMPREF0424_0453"
FT   CDS_pept        complement(497092..497457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0453"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01910;
FT                   match to protein family HMM TIGR00106"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14426"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA62"
FT                   /protein_id="ADB14426.1"
FT                   /translation="MSENNNENTNDHMNEHRTNTVAALCIAPSGVGDELSEYVADAVQV
FT                   IRDSGLKNETNAMFTNIEGEFDDVMRVVKDATMTLVSKGYRTGVILKLDIRPGFSNQID
FT                   AKSALVDKILDERNKEE"
FT   gene            497638..499158
FT                   /gene="glyS"
FT                   /locus_tag="HMPREF0424_0454"
FT   CDS_pept        497638..499158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="HMPREF0424_0454"
FT                   /product="glycine--tRNA ligase"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM TIGR00389"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13892"
FT                   /db_xref="GOA:D2RA63"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA63"
FT                   /protein_id="ADB13892.1"
FT                   /translation="MAVSKLDEVVSLAKRRGFVFPAGEIYGGTRSAWDYGPLGVALKDN
FT                   IKREWWRYMVTTRGDVVGVDTSVILPSQVWVASGHVSVFNDPLIECLNCHKRHRADKLE
FT                   ESYAEKHGDKMPENGLKDIACPDCGTRGNWTEPRDFNMMLRTHLGPVEDENSLHYLRPE
FT                   TAQGIFVDFKNVMTSTRQKPPFGIANIGKSFRNEITPGNFIFRTREFEQMEMEFFVEPG
FT                   TDEAWHQYWIDTRVRWYVDLGVKPENLRMYEHPKEKLSHYSKRTVDIEYKFGFQGSDWG
FT                   ELEGIANRTDYDLSAHAKHSGEDLSYFNQATGEKYVPYVIEPAAGLTRSLMAFLVDAYD
FT                   VDEAPNTKGGVDKRTVLRLDPRLAPVKAAVLPLSKKPELQAVAQDLAADLRQHDWVIDY
FT                   DEAGAIGRRYRREDEIGTPLCVTVDFDTLEDHAVTIRERDTMQQERVSLDKVADYVASR
FT                   INEKRVKYPQGPVEIVGTRAADGATDIAKEAGEDESKPVQIATAGGLY"
FT   gene            499243..500397
FT                   /locus_tag="HMPREF0424_0455"
FT   CDS_pept        499243..500397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0455"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="identified by match to protein family HMM PF01207;
FT                   match to protein family HMM TIGR00737"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14395"
FT                   /db_xref="GOA:D2RA64"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA64"
FT                   /protein_id="ADB14395.1"
FT                   /translation="MNFSIKPVDLGKVHIATPVVLSPMAGITNWPFRVICREFGPDGLY
FT                   VAEMITARALVARNPKALRLCRFAPSEKVRSLQLYGVNPSIVEQATRIVVDENMADHVD
FT                   LNFGCPVPKVTRRGGGSALPWKTDLLQEILHRVVSVCEPAGIPVTAKFRVGIDENHETF
FT                   IQAGHIAQEEGCAAVTLHARTTAEYYGGHSDWQRIGELVETLDIPVFGNGDIWGAEDAL
FT                   AMFKETGCAGVAIGRGCQGRPWLFADIRNACEGSDNRVNPTLAEVGSVILRHLNLLVEF
FT                   YDGDERMAVHDLRKHIAWYLKGFPVGGGTRKAFMECESIEDVQRNLDMLDGSLCLPKKV
FT                   LDTPRGRVRFAKKVHLPYGWLDSRTTSHEEREALFGDDPMDASY"
FT   gene            500600..501814
FT                   /gene="ftsZ"
FT                   /locus_tag="HMPREF0424_0456"
FT   CDS_pept        500600..501814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="HMPREF0424_0456"
FT                   /product="cell division protein FtsZ"
FT                   /note="identified by match to protein family HMM PF00091;
FT                   match to protein family HMM PF03953; match to protein
FT                   family HMM TIGR00065"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14030"
FT                   /db_xref="GOA:D2RA65"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA65"
FT                   /protein_id="ADB14030.1"
FT                   /translation="MSEIAQTDNFNDKTIIKVVGVGGAGGNAVNRMISEGLQNVEFVAI
FT                   NTDAKDLLRSDADVKISLSDASSRGLGAGADPEKGAKAAQDHQSDIEEALKGADMVFVT
FT                   CGEGGGTGTGASPIVARAAHQQGALTIAVVTRPFGFEGPQRAASAKLGIENLRKEVDAL
FT                   IVIPNDRLLEISDRTIGIIEAFKTADTALLAGVQGITDLITMNSYIHVDFSDVTAVLRG
FT                   AGTALFGIGAAKGEDRATQAAEIAISSPLLEESIEGAHGALINIAGPSDLKLQEASAAT
FT                   ELVRKAIHPEAQIIWGLSLDDSYGDEVRVTVIAAGFDAHPKAEESSAKAGQFVDMQADV
FT                   KPVAPAQSTSSFKEEAQAAPQVEQPASMPSMFEPAMNHQQYSPAAAPVQQPAEPDELDI
FT                   PDFLR"
FT   gene            501839..502297
FT                   /locus_tag="HMPREF0424_0457"
FT   CDS_pept        501839..502297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0457"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04472"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14546"
FT                   /db_xref="GOA:D2RA66"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA66"
FT                   /protein_id="ADB14546.1"
FT                   /translation="MAGFMKNVMSYVGMADVPEDDDYAESDVQETSFDNDRSVTPAVSQ
FT                   HGNDLRGGSARANASRMSRITTIHPKSYDDAQMVGRALRDGVPVVLNLTGVTESVAYRI
FT                   VDFSAGVVFGVRGSIERVTPRVFLLSPAQVNIKVEDAPNDNTARDLFS"
FT   gene            502456..503274
FT                   /gene="trmB"
FT                   /locus_tag="HMPREF0424_0458"
FT   CDS_pept        502456..503274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="HMPREF0424_0458"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="identified by match to protein family HMM PF02390;
FT                   match to protein family HMM TIGR00091"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14154"
FT                   /db_xref="GOA:D2RA67"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA67"
FT                   /protein_id="ADB14154.1"
FT                   /translation="MSTENENENTMQAKQRTVLSFVRRSGRLDARLQHAQERYASQYLL
FT                   DVTEAPGSFRLRENLNITHDWISDKWGNDNPLIVEIGSGQGENIVAAAERLPETNFLAL
FT                   EVYDPGVAHTMLLAGKQGLTNLRIAQINAPDFFAACDCGVLEEVWTFFPDPWPKMRHHK
FT                   RRIVQPELVSTIHQALRRGGAWRIATDIEDYALHVHEIMDSREDFANIGELSASLPIEH
FT                   VGKGTADTAAALPHADFSESERFAGRVLTNFERKGLEAGRTIHDFTYIAQ"
FT   gene            503382..503456
FT                   /locus_tag="HMPREF0424_1375"
FT   tRNA            503382..503456
FT                   /locus_tag="HMPREF0424_1375"
FT                   /product="tRNA-Glu"
FT   gene            503637..504431
FT                   /locus_tag="HMPREF0424_0460"
FT   CDS_pept        503637..504431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13464"
FT                   /db_xref="GOA:D2RA68"
FT                   /db_xref="InterPro:IPR017195"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA68"
FT                   /protein_id="ADB13464.1"
FT                   /translation="MLFRGDTLSHWYFCPGCVGQEVFNSVIYNAQQLKKGFPMSDIFNT
FT                   NNNGLESSNCVTDQVDSNAASSINRVVSMRWRVADIALGAALAAVFGVILYGYGLVFIP
FT                   LIRTLNAAVLPGFASITHGVWYLSGTLAVLLIRKPGSAVYVNVVAAFVQVLLGTPFNMR
FT                   DTLISALLQGVFAEIPFLIFRLRKFNLTLSALSGLLVAFEYGVFLSFTKYQAKASTYIT
FT                   IHMITELISGLLLSGVLVWFVYLALRKTGALDNFASGRSDRA"
FT   gene            504545..504621
FT                   /locus_tag="HMPREF0424_1376"
FT   tRNA            504545..504621
FT                   /locus_tag="HMPREF0424_1376"
FT                   /product="tRNA-Met"
FT   gene            complement(504699..505601)
FT                   /locus_tag="HMPREF0424_0462"
FT   CDS_pept        complement(504699..505601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0462"
FT                   /product="kinase, PfkB family"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14273"
FT                   /db_xref="GOA:D2RA69"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA69"
FT                   /protein_id="ADB14273.1"
FT                   /translation="MTKPIVLSLGELLWDLLPHGKRVGGAPANFAYHAQCHGAQSCMIS
FT                   AVGQDQLGDELIDKVNKAGIASIIQRNAWPTSTVEVTLKNGIPEYTILRNIAWDHILYT
FT                   RELIDLVERADAVCFGTLSLRSQETHDTILQLLKHTKPGAMKFFDINIRSDHYSKDLID
FT                   TLLQEATVFKLNDSELFLLRDMFNIRDTSDEEACKWFQARYGLDYVILTGGSTFSTITT
FT                   STGESSTIPTPHVEVLDTVGAGDSFSGTFAAHILKGESLQEAHRAAVNTAAFVCTQEGA
FT                   WPKYPKQIPDYLSMAENNK"
FT   gene            complement(505887..507482)
FT                   /locus_tag="HMPREF0424_0463"
FT   CDS_pept        complement(505887..507482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0463"
FT                   /product="peptidase, M24 family"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF00557"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13653"
FT                   /db_xref="GOA:D2RA70"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA70"
FT                   /protein_id="ADB13653.1"
FT                   /translation="MAEYTPTEHGEELKADGTQKAEDRVNNRSLRPNSDSFKDFMTNNW
FT                   DNQEPEVKALESSKYIPARLEALSKRFPGERLVIPAGQPKVRNNDCDYAFRPDTTFAYY
FT                   TGLGQDYEAGAVLVMEPVSEDSEEAKAGKTHVPELFVAPRADNSTSAFYKDPHYGEYWV
FT                   GPRAGLKELKAMTGIETRDIAELDDAIAKNVSDDANGEGIRVRIVRETDPELTAKVETM
FT                   REASGFTDEDANTCADDKLHEFAAEARMLKDDYEIREMRKAIAATKLGFDRMLTRLPNA
FT                   LGHEHSERMIEGAFNSVAREEGNEVGYDTIVASGKHAPILHWMRNTGVVSSGELLLIDA
FT                   GVEVNSLYTADITRTFPTNGKFTDLQKKLYQCVLDAQQAGFEAAKPGATYSDIHHACMR
FT                   VLAEHLHEWGILKVSVEESLSPEGQQHRRWHACGVAHHLGLDVHDCAQARYESYQGAKI
FT                   TPGMIFTIEPGLYFAANDLILPEEMRGIGIRIEDDVLMTENGPEWLSIDIPKQIDDVEA
FT                   WMAEQAHKSDIFQH"
FT   gene            507761..509218
FT                   /gene="folC"
FT                   /locus_tag="HMPREF0424_0464"
FT   CDS_pept        507761..509218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="HMPREF0424_0464"
FT                   /product="bifunctional protein FolC"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM PF08245; match to protein
FT                   family HMM TIGR01499"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14353"
FT                   /db_xref="GOA:D2RA71"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA71"
FT                   /protein_id="ADB14353.1"
FT                   /translation="MSIENPNRNNERIVDIERNIMSRAPEHNKTNLDLDRMRLILDILG
FT                   HPEQSMRVIHITGTNGKGSTARMAESICRAYGLRTGLYTSPHLERVNERIMIDGQEISD
FT                   NQFVDVWDQMKDIIDMVDARMEADGKPKMSFFEVLTAMAIWAFADAPVDVAVMEVGMGG
FT                   EWDATNVMNADAAIIGPVDMDHMQWLGNTVEEIARTKAGIIKPNCTVILGPQPHEAKVL
FT                   PIIKEVAERNHATLLRDSSYGDGELEVVSRTPAVGGQVVTLRTPLGTYEDVPVDKFGKH
FT                   QAHNALAALAAAEVVLPVSGALDGDLVAEALSQVKVPGRIEQVRTSPTIIIDGGHNVNA
FT                   AESLRETIEENYHFEQLIGVVAMMADKQVEEYLGVLEPILTKIIVTRNSWRDRVMDPEE
FT                   LEKIAVGVFGEDRVIRVDELPDAIQTAVDLVDEDDELGVGYGHGVLICGSFVTAGDART
FT                   MLVEHVNPDLKKPKDQRVAIHPNIDES"
FT   gene            complement(509236..509964)
FT                   /locus_tag="HMPREF0424_0465"
FT   CDS_pept        complement(509236..509964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0465"
FT                   /product="aspartate racemase"
FT                   /EC_number="5.1.1.13"
FT                   /note="identified by match to protein family HMM PF01177;
FT                   match to protein family HMM TIGR00035"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13839"
FT                   /db_xref="GOA:D2RA72"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA72"
FT                   /protein_id="ADB13839.1"
FT                   /translation="MKRPFFAVLGGMGTLATESYIRLLNKETHAHNDQEFLDYVVFNDA
FT                   SVPDRTAYIVGESSESPFPTLADDIAKATAMGASFIVLTCNTAHYFYDKFQALTDVPII
FT                   HMPRGAVAEVSKRYPKSKCNRIGFLGTAGSRKAGVYQRAIEEAGYTFVAPDDDLQKRIT
FT                   SLIYDDVKGTGNLNLRRYESVLSDMLDPAGTCRCDALILGCTELSVLNEAFPLPQIPLV
FT                   DAQAVLVKNTVEKAKSLRMK"
FT   gene            complement(510000..511241)
FT                   /locus_tag="HMPREF0424_0466"
FT   CDS_pept        complement(510000..511241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13830"
FT                   /db_xref="GOA:D2RA73"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA73"
FT                   /protein_id="ADB13830.1"
FT                   /translation="MKNQRFQPVLLGSDINAYGMARAFHEEYGITSIAFAHFQLSPTKF
FT                   SKIVDVRIVPGFGELPTFRNTMLNFAKSWHQEHPNTKLLLIPCGDVYANLLSQCGDELH
FT                   EYFAFHTLPNSLNRQLSLKSSFYKTCEKYNLPHPKTKVVNAQEVAAHAYEDLPFSFPIA
FT                   MKAANSTKWLDIDFEGRKKAFIINTPQELDTLIQRSYKAGYDDEMILQDFIPGDDSRMR
FT                   VLNAYVDSNHHVRMMFLGHPLLEDPTPEAIGNYAAIIPDYNEEVFQNIKAFLEDIHYVG
FT                   VANFDMKYDERDGKYKLFEINLRQGRSSYFVTLNGFNIAKYFVEDLIDHKPFDGNTVFG
FT                   RGEKLWMEIPRSIFCNYVAEGDEKKRGLNMIRRGDWGTTLEYKKDMNLLRWLMIRHMFS
FT                   IYTRRYAEFFRNKA"
FT   gene            complement(511376..513175)
FT                   /gene="murE"
FT                   /locus_tag="HMPREF0424_0467"
FT   CDS_pept        complement(511376..513175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="HMPREF0424_0467"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.-"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM PF08245"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14355"
FT                   /db_xref="GOA:D2RA74"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA74"
FT                   /protein_id="ADB14355.1"
FT                   /translation="MHNTLSLANASEILQHYGLLREMIQYGKAEDTNTANGANTKEKTI
FT                   DSTHSRNEIWSLNPYYFPNIDADEYFTNATYDTRDIKSGTLLFIKGNFKSEYLLDADNK
FT                   GLAAYVAEQSYAQYTKAVGLIVTDAKKAMSVLAAAFFGNPQEKLTIVGITGTKGKTTTA
FT                   YFTHAILNSHSHGKAALFSSVDNCVDGKNYVESNLTTPESFDAFKMMREAVDNDMKYLV
FT                   MEVSSQAYKVNRVYGLKFDVAAFLNISPDHISPIEHPTFEDYLYCKRQIIANTKRLVLN
FT                   SDTDHADLLLQDAERNNVLVTTFARIKKDEIEGDACENNNFDDLDDDCINYCAPANDDD
FT                   YTELLTPDYIAMPVENSESHCIAMRDSSEDDDYEDNDYEEDVHYCPIDEFALSIAGDFN
FT                   YENALAAIAIAGELGINQDTDLHALHAIENVKISGRMEVFKDTHSNMIAVVDYAHNYIS
FT                   TKSVLDFVEERYGKFNPRITLITGSTGDKAVDRRKEIVEAAQNRIEQFIFTTEDTDTED
FT                   VMHICEDMQSYVTNPNVSSRIIIDRAEAIECAYNDAASSEQKNGRLNILLAIGKGDERW
FT                   IKNKRKHVPYEGDSFVIKRLFGL"
FT   gene            complement(513207..513986)
FT                   /locus_tag="HMPREF0424_0468"
FT   CDS_pept        complement(513207..513986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0468"
FT                   /product="exonuclease"
FT                   /note="identified by match to protein family HMM PF00929"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13689"
FT                   /db_xref="GOA:D2RA75"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA75"
FT                   /protein_id="ADB13689.1"
FT                   /translation="MPTHIQELLNALDLAPKQDENTLLAESWLLGFDTETTGANIGKDA
FT                   IVSATLVLRNPELAHTGDVVSTWLINPHQPMNPKASEVNGFTDEYLKEHGGEPEEELEF
FT                   LARAVSMAQAKNIPLLAYNAPFDIAMLRHDLKHWHLTALEERATCPIHALNANDILTVD
FT                   PLVIDRAVSRRSGKRTLTITSQFYGVEPIGDFHDATADTVAALDLIAPMSKLYESVSCM
FT                   RLNTMMDWQREAYINWRDSFNQWLQSHGREPITGTWL"
FT   gene            514136..514813
FT                   /locus_tag="HMPREF0424_0469"
FT   CDS_pept        514136..514813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0469"
FT                   /product="Sigma-70 region 2"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF08281; match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14175"
FT                   /db_xref="GOA:D2RA76"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA76"
FT                   /protein_id="ADB14175.1"
FT                   /translation="MSEQIEKTNVMCSKSVRAKKQSAKNCNARLFSDRLVNTKQSSAME
FT                   SRRKRFEQLVSTCVDSLYTQAMRLTQNAQDAQDLVQDTFERALKSFETFQPDTNFAAWI
FT                   NRIERNLYFNQYAKAKRSPKRANDETGDYNDWDIYEASNHCAKGMLSAEQEYLEGFAPQ
FT                   EIIAALSKLPPERRKVFIEVAIRGKSYKQIAQEEGVKIGTVMSRLNRARMQLKRELSDY
FT                   SSE"
FT   gene            complement(515094..515594)
FT                   /locus_tag="HMPREF0424_0470"
FT   CDS_pept        complement(515094..515594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0470"
FT                   /product="YbaK/EbsC protein"
FT                   /note="identified by match to protein family HMM PF04073;
FT                   match to protein family HMM TIGR00011"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14223"
FT                   /db_xref="GOA:D2RA77"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA77"
FT                   /protein_id="ADB14223.1"
FT                   /translation="MSKKHAETGKATPAIAQLENAGITFRIAQYEHDADHMDDGYGIEA
FT                   AEKLGVSAAQVCKTLMVDTGEKRVVGIVPVNGRLNMKAIAGAVHAKKASMTSPEVAQRE
FT                   SGYVVGGISPFGQKTHHETVLDSSVMQFDEILVSGGKRGLDVVLNPQDIVTLLNATVAD
FT                   IAA"
FT   gene            complement(515773..516861)
FT                   /gene="gap"
FT                   /locus_tag="HMPREF0424_0471"
FT   CDS_pept        complement(515773..516861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap"
FT                   /locus_tag="HMPREF0424_0471"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.-"
FT                   /note="identified by match to protein family HMM PF02800"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13530"
FT                   /db_xref="GOA:D2RA78"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA78"
FT                   /protein_id="ADB13530.1"
FT                   /translation="MRTRSHSRENHMTVKIGINGFGRIGRLAFRRIFELQARGGQAGDI
FT                   EVAAINDLTTPSMLAYLLKYDSTHGTFRHDDGTPVEVTSTEDAIVVDGKTYKVYAEKDA
FT                   NNIPWVKNDGVEFVLECTGFYTSAEKSQAHLNAGAKKVLISAPAKDETTPTVVFGVNHE
FT                   ILKASDNIVSAGSCTTNSMAAMVKLLQDNWGIKSGFMTTIHAYTGTQMILDGPRGSKPR
FT                   NNRSAACNTIEHSTGAAKAIGKVVPEVNGKLQGHAQRIQVPDGSVTELTTVLEKPATTE
FT                   EINDAFKKAFENCEYFGYNADSIVSSDIIGDTHGGVFDPTQTDVNTVDGVTLARTVTFY
FT                   DNEYGFTSNMIRTLLYFAEISE"
FT   gene            complement(517199..518017)
FT                   /locus_tag="HMPREF0424_0473"
FT   CDS_pept        complement(517199..518017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0473"
FT                   /product="thiamine diphosphokinase"
FT                   /EC_number="2.7.6.2"
FT                   /note="identified by match to protein family HMM PF04263;
FT                   match to protein family HMM TIGR01378"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14285"
FT                   /db_xref="GOA:D2RA79"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="InterPro:IPR036371"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA79"
FT                   /protein_id="ADB14285.1"
FT                   /translation="MQRYYVAMEPLQRCVVLAAGDYYDHTREHVPDRALTIAADGGWDH
FT                   ACKLGLHVDALIGDFDSVRLKLPTDAVITRLPAEKDDPDLLSALKVGWAKGSREFHIFG
FT                   GLGGRVDHTISNIQLMVRLARRGGIGFLYGDGQIVTAIHDGSLDFPASSGNDLRIVSVF
FT                   SHTPVSNDVNEVGLKYQLKHATMHGDAVQGLSNELLNDTPAHIDVHEGTLIVTFPINAP
FT                   LPQVSWFKRPIGDLGEVDASISEALAVPLESETTPTYSTTAAAEAMTYNE"
FT   gene            518296..520182
FT                   /gene="asnB"
FT                   /locus_tag="HMPREF0424_0474"
FT   CDS_pept        518296..520182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="HMPREF0424_0474"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF00733; match to protein
FT                   family HMM TIGR01536"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13759"
FT                   /db_xref="GOA:D2RA80"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA80"
FT                   /protein_id="ADB13759.1"
FT                   /translation="MCGIAGFINDTPINVKSQIVKDMTDVIVHRGPDEYGTMIDEHAAL
FT                   GFRRLSIIDLHGGSQPMYNEDGNLAVTFNGEIYNYKPLREELIKAGHTFHTDCDTEVLV
FT                   HGYEEWGKGLLNRLRGMFAFVIWNKSTQELFGARDHFGIKPFYYAQMNGTFMYGSEIKS
FT                   LLRHPDFKKKLNENALKPFMTFQYPAINETFFKGVFKLREGNCFTYKNGEMKIEQYYDP
FT                   NFKETKQRLNELVDSIDKTVCDSVQAHQIADVEVGSFLSSGVDSSYVAAVARPEHTYSI
FT                   GFAGGRYNESKQASELAKIIGLNNKSEIIDAADAFRYFPQIQWYLDEPDSNFSCVPLFF
FT                   LAKLASQDLRVVLSGEGADELFAGYIDYGVHTRSKLIKVVTRMLAKLPKKLRYAIGRAA
FT                   KGKHFHGAWHLYANLAPAEEHFIGQSKVFNEEDAVKLLKPEYRKGPSVRSIVDAIYSRI
FT                   AGKGLSEVKKKQYLDMHQWMPGDILLKADKMTMAHSLELRVPLLDRVLMDVAEKVPTKY
FT                   LITDENTKFAFRQAASRHLPKAWYDREKLGFPVPVKDWLREERFYKIVRKTFESDDAAK
FT                   FFDRDALLRMIDDNYAKKNDDRRKIWTVYTFLTWYDVYFNHDGLKPEPMQLA"
FT   gene            520413..521174
FT                   /gene="infC"
FT                   /locus_tag="HMPREF0424_0475"
FT   CDS_pept        520413..521174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="HMPREF0424_0475"
FT                   /product="translation initiation factor IF-3"
FT                   /note="identified by match to protein family HMM PF00707;
FT                   match to protein family HMM PF05198; match to protein
FT                   family HMM TIGR00168"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13778"
FT                   /db_xref="GOA:D2RA81"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA81"
FT                   /protein_id="ADB13778.1"
FT                   /translation="MNLKLLDFLVYYILQVFRRIGVIISDEPRINEEIRVPQVRLIGPK
FT                   GEQVGVIATSVALNLAREANLDLVEVAPTAKPPVAKLIDYGKYKYNEKIKAREARRNQT
FT                   VAEVKEIRFRLKIDDHDFDVKKGHVLRFLNGGDKVKVTIMLRGREQSRPVGGVELLRRL
FT                   ADEVSESGTVEFAPKQEGRNIIMTLAPKGKKIHTQSEQRRRGAESRAERQARQAARLAA
FT                   KQEVQSQAAAAVNAMQSDQHHKEGSNAEDEN"
FT   gene            521155..521349
FT                   /gene="rpmI"
FT                   /locus_tag="HMPREF0424_0476"
FT   CDS_pept        521155..521349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="HMPREF0424_0476"
FT                   /product="ribosomal protein L35"
FT                   /note="identified by match to protein family HMM PF01632;
FT                   match to protein family HMM TIGR00001"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13840"
FT                   /db_xref="GOA:D2RA82"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA82"
FT                   /protein_id="ADB13840.1"
FT                   /translation="MPKMKTNSAASKRVRLTGTGKVMHDGSAMRHNLEHKSARKRRALS
FT                   EDKVLATAQSKKLKGLLVK"
FT   gene            521417..521800
FT                   /gene="rplT"
FT                   /locus_tag="HMPREF0424_0477"
FT   CDS_pept        521417..521800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="HMPREF0424_0477"
FT                   /product="ribosomal protein L20"
FT                   /note="identified by match to protein family HMM PF00453;
FT                   match to protein family HMM TIGR01032"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14532"
FT                   /db_xref="GOA:D2RA83"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA83"
FT                   /protein_id="ADB14532.1"
FT                   /translation="MARVKRAVNAHKKRRVVLERASGYRGQRSRLYRKAKEQLLHSFTY
FT                   NFRDRKARKGDFRKLWIQRINAAVRAEGITYNRFIQGLHLAGIELDRRALAELAVSDIE
FT                   AFKAVVEAAKAALPADVNAPVEA"
FT   gene            521895..522854
FT                   /gene="xerD"
FT                   /locus_tag="HMPREF0424_0478"
FT   CDS_pept        521895..522854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="HMPREF0424_0478"
FT                   /product="tyrosine recombinase XerD"
FT                   /note="identified by match to protein family HMM PF00589;
FT                   match to protein family HMM PF02899; match to protein
FT                   family HMM TIGR02225"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13508"
FT                   /db_xref="GOA:D2RA84"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA84"
FT                   /protein_id="ADB13508.1"
FT                   /translation="MHSNPDSDNRKNNIPEEFALHIQRFIAHIDIERGLSKKTVSAYAS
FT                   DLQDYTCWLYNERKIKDITTISQLDIESYIRTLNELGLGTRTVARRLASIHEWHRFMLA
FT                   HGDIQADVSAQVKAPKQADYLPDVLSIEEVNRVIEAAGNFGSSDAISIRDTALLEFLYA
FT                   TGARISEAVGVKFEDIDLNESVVKLTGKGSKQRLVPIGGCAVRALRNYMEKSRPELALK
FT                   GKRELHTIFLNKRGSALSRQSAWEIVTQAGERAKLDKPLHPHTLRHSLATHLIAGGADV
FT                   RTVQELLGHASVTTTQIYTHISPDALVEAYVMSHPRAK"
FT   gene            522903..523742
FT                   /locus_tag="HMPREF0424_0479"
FT   CDS_pept        522903..523742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0479"
FT                   /product="CobQ/CobB/MinD/ParA nucleotide binding domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14691"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA85"
FT                   /protein_id="ADB14691.1"
FT                   /translation="MPTDLLGREYETFHAPEPLTSHGPARIIAMCNQKGGVGKTTSSIN
FT                   IAGALSQYGRRVLIVDFDPQGAATVGLGINANALDNTVYTALFDSSVDVHDVIRHTETE
FT                   NIDIIPANIDLSAAEVQLVTEVGREQILAGVLRKVRDEYDVIIVDCQPSLGLLTVNALT
FT                   AADGVIIPLAAEFFALRGVALLMQSIEKVQSRINPNLKVFGVLVTMYTRTLHSEEVLQR
FT                   IYEAFQDRVLHSVISRSIKLPDSTVAAVPITIFAPEHKTAKEYREVARELIAKGVVA"
FT   gene            523933..525858
FT                   /gene="typA"
FT                   /locus_tag="HMPREF0424_0480"
FT   CDS_pept        523933..525858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="HMPREF0424_0480"
FT                   /product="GTP-binding protein TypA"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF01926; match to protein family HMM PF03144;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR01394"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14190"
FT                   /db_xref="GOA:D2RA86"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA86"
FT                   /protein_id="ADB14190.1"
FT                   /translation="MTVRGDIRNVAIVAHVDHGKTTLVNAMLQQSHVFSEREEVPDRVM
FT                   DSNDLEREKGITILAKNTAVQYTGPLAEKYGHPEGITINVIDTPGHADFGGEVERGISM
FT                   VDGVVLLVDASEGPLPQTRFVLRKALEAKLPVILCVNKVDRPDARIEEVVGESTDLLLG
FT                   LAQDVVEEGIDLDLDALLDLPVIYCAAKAGYASVNQPENGGLPDNDNLEPLFDSIISNI
FT                   PAPEYEEGAPLQAHVANIDSSDFLGRLGLVRIYNGTLEKGKTYGLSRVDGSIENFRVSE
FT                   LLRTQGLERTPVASAGPGDIVAVAGVNDIMIGETIVDQNDPKPLPLIHVDDPAISMTFG
FT                   VNDSPLAGTEGKDHKLTARMIKDRLDRELIGNVSIKVIPTERPDAWEVQGRGELALAVL
FT                   AEQMRREGYELTVGRPQVVTKTIDGQINEPMESTTIDVPEEYMGTVTQLMADRKGRMDS
FT                   MSNHGSGWVRLQFTVPSRGLIGFRTALLSATRGTGIASSISAGYAPWAGQIVTRQNGSM
FT                   VCDRKGVATPYAMQRLQARGVFFVDPQSPVYEGQIVGINNKPDELDVNITLAKHMTNMR
FT                   SSTADVLETLTPPITMSLEESLDFANEDECVEVTPEAIRVRKIILSRDEWYKWRAKQRR
FT                   QNNNAA"
FT   gene            525983..526309
FT                   /locus_tag="HMPREF0424_0481"
FT   CDS_pept        525983..526309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13484"
FT                   /db_xref="GOA:D2RA87"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA87"
FT                   /protein_id="ADB13484.1"
FT                   /translation="MIGTFAHRCGAMDNIPYGFVLSMLLLFLSAWCARSRSGWSGLLIH
FT                   AIVFSAFAWILALDFIGSAILVPVGFTIPLPWCSQYVGYFWLYGVLVAHLVLLCMPQRW
FT                   FVIE"
FT   gene            526447..527442
FT                   /locus_tag="HMPREF0424_0482"
FT   CDS_pept        526447..527442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0482"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="identified by match to protein family HMM PF00800"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13788"
FT                   /db_xref="GOA:D2RA88"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA88"
FT                   /protein_id="ADB13788.1"
FT                   /translation="MNSSNSKFSRKLCYLGPEGSFTHQAALKVQQQLQSFENLRLIPIA
FT                   CENVLSIASEIEEHHHWGVIAWENNIEGVVIPNLDLLIDAKNMVGITRIGVDISFDAVI
FT                   CKSDSIDNCSTIVAHPHALAQCRKFAQERGLKEKTASSNAAACRDLVPGEVALCPKICA
FT                   DLYNRQIVSEAVEDFSGARTEFLVLAPRDQALDFVNVQRENFSSFSSIIAFIPRCTGAG
FT                   VLANLLDVVRDHGLNMTSFMSRPIKGRGGLYSFIATVDAAPWDSTCKAMIQEVVEHGDW
FT                   IRVLAVYSSDKRKNPVMDDWMLPHGGVCVEPSVDALRNLNVMRAERELLW"
FT   gene            527436..528521
FT                   /locus_tag="HMPREF0424_0483"
FT   CDS_pept        527436..528521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0483"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /note="identified by match to protein family HMM PF02153;
FT                   match to protein family HMM PF03446"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13786"
FT                   /db_xref="GOA:D2RA89"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA89"
FT                   /protein_id="ADB13786.1"
FT                   /translation="MVEDAEFSQKFSVGIVGLGLIGGSLAKRLAKLANCNVYAWNRHNE
FT                   PYDEAKSLGITCVEKVQDLAKLRPNVLILCNALAAMPSILHEVAPYIDKSCTTISDVGS
FT                   VKTLVREQVKDAGLQDCYVGAHPMAGSEFTGWKASSGELLNGALWALTVDDSTEFWRVR
FT                   NILQMIVSLCKNRAIVLDDATHDNSAALISHMPHVVATALANVLCEQSNRAIALQLSAG
FT                   SWRDMTRVALTDPQRTRAMVSENRHNTAKLLRSVISELTFAANMLDNDVETADALEQEF
FT                   FAKAQSWREYKYLQRNSSKTSMQQSDAANSRLWKYDSQINWQQELLESARLGESIVELS
FT                   GFNINESSQLLLRSDASLRNV"
FT   gene            complement(528545..528838)
FT                   /locus_tag="HMPREF0424_0484"
FT   CDS_pept        complement(528545..528838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14219"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA90"
FT                   /protein_id="ADB14219.1"
FT                   /translation="MNTQTRNLTTLPQQIPAGSRIVVRTYKIIEDNNNGTQKIEYHDAI
FT                   GHVLEWDGVMLHLLRDPAANGTRAAEEMFIDAKTIYRLKPIPERKFQKPLSL"
FT   gene            528924..529892
FT                   /locus_tag="HMPREF0424_0485"
FT   CDS_pept        528924..529892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0485"
FT                   /product="phage integrase SAM-like domain protein"
FT                   /note="identified by match to protein family HMM PF00589;
FT                   match to protein family HMM PF02899"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13628"
FT                   /db_xref="GOA:D2RA91"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA91"
FT                   /protein_id="ADB13628.1"
FT                   /translation="MSNNKFVSENFLGLPSKYMSLIDDYIDYVRANKGLGERTQKAYAS
FT                   DILQCLAWCNRHGFNNISELTTDDLRSWMADESRSHARSSLARKVVAVRGFFAWCQHVE
FT                   YISGNPAEILMTSKIKNMLPSVLDEYQAESLMNNVDSKANVSTSCPKNQKAVGLRNAAI
FT                   LELLYATGIRVGELTSLNIQDINFSSHTIKVTGKGNKQRVVPFGVPAYKALSAWISKDG
FT                   REILLRNSVEEAVFLGTRGKRIDQRLVRQIVHDEAKSAHVPDISPHALRHSAATHMLNG
FT                   GADLREVQELLGHSSLNTTQRYTHVSIESLKRKYSQAFPRA"
FT   gene            530279..531907
FT                   /locus_tag="HMPREF0424_0486"
FT   CDS_pept        530279..531907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0486"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   family 5"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13518"
FT                   /db_xref="GOA:D2RA92"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA92"
FT                   /protein_id="ADB13518.1"
FT                   /translation="MKNKALAFVAAACSLAMLLGGCGSSAKNAQTNGGKVIITVSNSEP
FT                   QNELVPGNINENAGARPAMLVNSTLVTFDEKGNPVNEDAESITPNADATQYTVKVKKGK
FT                   KFSDGTPITAESFVKAWSFVANAKNAQKCASFFQTIKGYADLQKDGTKGDEQLSGLKVV
FT                   DENTFTVDLEQPDSVFPIKVGYLAFAPLPESFYKDPKAYGEKPVSSGPYLFKSWDHNKQ
FT                   IEVVKNPDYDGPRKAQNDGVTFKVYTDGNAAYRDVQAGNLDMTDNIPDTQTKTFQKDTT
FT                   VKAYNRPGSVIQQFTIPSSLPHFDVKTEEGKLRRQAISMAIDRKVIINKILNGTASPAN
FT                   EFTSPLTPGYKADLKGHENVEFNAKKAKELWAKADKISKYDGSLTFSYNADGNAKSVFD
FT                   AVVNSLKNNLGIKAETTPIPTFQEFRNACAKRQIKGAWRAGWIPDYPSAENYLTQEFAS
FT                   VAADGNGSNEGDYKNPKFDDLLKKAASAKPGEAIKLYQQANEILLEDLPSVPLFYSNAK
FT                   AVMVPTLKGFTMDWQNMPLYYQLHK"
FT   gene            532109..533035
FT                   /locus_tag="HMPREF0424_0487"
FT   CDS_pept        532109..533035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0487"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14202"
FT                   /db_xref="GOA:D2RA93"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA93"
FT                   /protein_id="ADB14202.1"
FT                   /translation="MGKYILRRILQMIPVVLGTTLLVYALVFALPGDPVKAMFGEKPVN
FT                   PAVAAQIRAEYNLDKPFIIQYLLFLKNALTLDFGHTFAGQPVIDEIGRAFPVTVQLAIM
FT                   AFAFEAIFGVIFGIISGLKKGKWYDSVILVVSLLLISVPTFVTGFVGQYLFGVKWRILP
FT                   VTASNDPGFFDLLLPAMVLGSVSMAYIIRLTRSEISSNISLDYVRTARAKGLKEGSVIV
FT                   RHVLRNSLIPVVTFLGQDLGALMGGAMISETIFNIHGVGFLTYQGILKGEGNLVVSIVT
FT                   LLTLIFVFSNFLVDMLYAALDPRIRYA"
FT   gene            533048..534040
FT                   /locus_tag="HMPREF0424_0488"
FT   CDS_pept        533048..534040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0488"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13505"
FT                   /db_xref="GOA:D2RA94"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA94"
FT                   /protein_id="ADB13505.1"
FT                   /translation="MEDNLMKNDLIANNASNCNILPGQERYVAPLDDTPIQEVDSVDES
FT                   AAATSMWADTWRTLRRNPLFIVSAILIIAIIFVAFFPSILTKHNPNYCVLEHSLEPASA
FT                   AHPFGFDMQGCDIYARVVYGTRTSLSVGLLATILVVLVGSLIGALAGFFGGWVDTILSR
FT                   ITDIFLALPMLLGAIVVLQMFRTSKSIWKIVLVMVLFGWVSVARIARSAVMESKNLEFN
FT                   TASTALGSTPIRNLFKHIIPNSLAPIIVVGTTSLGTYIVLEATLSFLGIGLPSTTVSWG
FT                   GDISTARNVLTTNPEVLFYPSIALAITVLAFIMMGDAVKDALDPKSRKA"
FT   gene            534065..536089
FT                   /locus_tag="HMPREF0424_0489"
FT   CDS_pept        534065..536089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0489"
FT                   /product="putative phosphonate C-P lyase system protein
FT                   PhnK"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14044"
FT                   /db_xref="GOA:D2RA95"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA95"
FT                   /protein_id="ADB14044.1"
FT                   /translation="MNTTRKDIDIRAMQLEQGPLLEVKNLQVDFTTDSKKAVHAVRDAS
FT                   FCVYPGQWVAIVGESGSGKSTSAMAVLGLLPGTGHVTGGSIKLKGKEISSLKPKEIAAL
FT                   RGTAMGLVPQDPMSNLNPVWRIGEQVKEALIANGVDVDHEKRSSLAEALAGDSVQVKSN
FT                   EDETFLGSKELPELIEVAKKALKEVGLDEHNDAEKFNEAIDYYKKEWVPGSETRWRVAD
FT                   DLIKYGVNDDKAWEIAKKYVVGASVEDRIAGLLDEAGLPDAATRARQFPHEFSGGMRQR
FT                   ALIAIGLACRPDLLIADEPTSALDVTVQKRILDHLHTLTDSLGTSVLFITHDLGLAASR
FT                   AQHVVVMYKGRVVESGPSLEVLQHPQHPYTKRLVAAAPSLASQRIISVKEHGGNADNLL
FT                   EHHVVGEQTLEKSEHIITVDHLTREFKLPRKKELFKAVDDVSFSIKRGTTLAIVGESGS
FT                   GKSTVANMVLRLLKPTSGTVTYEGKNISDLKGADLLDFRRHVQPVFQNPYGSLDPMYSI
FT                   YRSIEEPLRIHKIGDKKSRKNRVVELLDMVRMPASVMTRFPNELSGGQRQRIAIARAMA
FT                   LDPDVIVCDEAVSALDVLVQDQVLHLLNDLQAERGLSYLFITHDLAVVRQIADEVVVMQ
FT                   HGKLVEHATTDEVFNHPQMEYTRDLLDAIPGGNLELGLD"
FT   gene            536269..537135
FT                   /locus_tag="HMPREF0424_0490"
FT   CDS_pept        536269..537135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0490"
FT                   /product="putative exodeoxyribonuclease III"
FT                   /note="identified by match to protein family HMM PF03372;
FT                   match to protein family HMM TIGR00633"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13614"
FT                   /db_xref="GOA:D2RA96"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA96"
FT                   /protein_id="ADB13614.1"
FT                   /translation="MITITTSNLNGIRAAERKGMLNWSDAHTPDVWCMQEVRAPQDAID
FT                   PIMTKIEMGYRTSENIVNSIKNDNFTYTNEVCRVKGRAGVALVTSLPVVEKRYGLPGLN
FT                   EDVDSGRWVETDVRTPEGYEITIASVYVHAGNVDDPQKMQQKFRFLDTMLIRLGELRNI
FT                   AASGGNQAILCGDFNIAHTSLDIKNAKANEKSAGFLPEERAYIDRWINEYEFVDVMRML
FT                   AGDIQGPYTWWSQRGKAFDNNVGWRLDYQFATPEIAESARGFVIDRAESYDARWSDHAP
FT                   LSIKYDV"
FT   gene            537315..538079
FT                   /locus_tag="HMPREF0424_0491"
FT   CDS_pept        537315..538079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14148"
FT                   /db_xref="InterPro:IPR022183"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA97"
FT                   /protein_id="ADB14148.1"
FT                   /translation="MGWLFGRHEEEKSSKVEDKIVEVKTGPWDFNDEDAPDFSDYLDFG
FT                   SIYIPYFQGIELRVKKQHETSQVLGMTVTYGSSSVEVEAFAAPKTSGIWLEVCKDLLDG
FT                   NSQACTVQGEFGTELLLPVKVGEKTITTRIVGVDGPRWMLRGVFSGPAATELADNNNET
FT                   KQLDEWFKGIVVNRGEEPLAPRDFIPMHDPITREEKEAALNAENSGKDGENNTSDEDAN
FT                   NALKKDDKPLGYDQQVEVKTTLTRGPMFAEIR"
FT   gene            538104..538925
FT                   /locus_tag="HMPREF0424_0492"
FT   CDS_pept        538104..538925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13909"
FT                   /db_xref="GOA:D2RA98"
FT                   /db_xref="InterPro:IPR016566"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA98"
FT                   /protein_id="ADB13909.1"
FT                   /translation="MDSQESLQKVEEEFSSQEFSNEVKLDDYAQTNNFVQTKKRSGLAT
FT                   LASIGAEGSTFSVIDSLGGIRGVIESMLPGLLFVICFVVTRNVQTTVIVAAVIAVLQVV
FT                   VRLIQRQSLMGAISGLVSIAICLIWVWTSHQARDYYMMGFITNAVYGVLLAISLIVRMP
FT                   ALGLVIESIRKMPTENFGAWLHEWLDYKPLKRAYMYVTGLWIAVFVLRLVLQVPLYLTN
FT                   HVVWLGTVRLIMGLPFWALAIWVSYLIIATPFMRLHHKNHEEKQSEENQLN"
FT   gene            538963..540378
FT                   /locus_tag="HMPREF0424_0493"
FT   CDS_pept        538963..540378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0493"
FT                   /product="TRAM domain protein"
FT                   /note="identified by match to protein family HMM PF05958"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13994"
FT                   /db_xref="GOA:D2RA99"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RA99"
FT                   /protein_id="ADB13994.1"
FT                   /translation="MQVTMRIERYADQGRCVGHLDGRVVFVRFALPGELVIVRMDEPMR
FT                   AKAHFFTGEVVEVLEPSADRVEPQWKLAGPLAQGGGVGGADLIHVSLPGQIRWKASVIA
FT                   NQFQRLAHMDVADNDVSVERMPGDEELNGFNWRTRMELVADDEGRLSMRKRESHDRIAI
FT                   DTMPLASRAVLAVADSLDLWNREFEPNSQIRLAVPEPRVEGLDFNDKAALLDAIGENYA
FT                   LIVNDELVAGSALLRERVRVAVDGDSSRMRTFDYDVDARGFWQIHRAAPEHLVNYVLGL
FT                   VRSALGGRSKNTVLWDLYSGSGLFTIPLATLANVGGDSYGAYDAVGAFGAAEPARVLSI
FT                   EGAPIAVKNARRNIGRAGLSRDVVEALEGDVAQTLESQVFKASKSSKIVRRFAHPDVVV
FT                   LDPPRAGAKAQVCKQIAKSGARSVVYVACDPTSLARDVGTFSELGYSVQSLRVFDIYPN
FT                   THHTESVALLYKS"
FT   gene            540703..541668
FT                   /locus_tag="HMPREF0424_0494"
FT   CDS_pept        540703..541668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0494"
FT                   /product="resolvase, N-terminal domain protein"
FT                   /note="identified by match to protein family HMM PF00239;
FT                   match to protein family HMM PF07508"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14303"
FT                   /db_xref="GOA:D2RAA0"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAA0"
FT                   /protein_id="ADB14303.1"
FT                   /translation="MDKIDELNKDVIVIHPQRVIKDYAVGVYARVSTNRKEQLDSLAVQ
FT                   VSGLTRLAAAHMTWFVADIFLDVASAKVGSSRNEFNRMIEECEKGNLDIILTKSVSRFG
FT                   RDTKEGLEAIRKIRSCGTRIIFETDKIDTETVDDELLISVVQACSQAENDWRSENIVWG
FT                   LRRRAEDGTSGLYSRACYGYKKDKHGMLIIDEDQAQVVRDIFDWYLKGLSIGGIIKRLK
FT                   SRGVKSPKGKDVWSKRAVESTLTRCKYTGDVAIAVPGNADCQYLYSDHHSGIISKETFE
FT                   AVELEMAARSNMEVGEDGTVRRKNKKYSAKTSRKDNLNEL"
FT   gene            541658..542302
FT                   /locus_tag="HMPREF0424_0495"
FT   CDS_pept        541658..542302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13481"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAA1"
FT                   /protein_id="ADB13481.1"
FT                   /translation="MNCRGHETRQRIVRDYEVQPEAHIKLLANQQKHSDAGATIEDEYY
FT                   VFSAKRKTDGKKEVIQCGVDAAKDFLELINHKGLPLFNPLVGDPHVNNRQEYDNSGSGN
FT                   LQPKKWNETAKQLYNAIMWLIILWDAKPNTPLFDFKDEVIEYKTYEPFDSKIKRVNTTI
FT                   KNGSKGKTLTEMINVYRADNDIRDEICNFDILKNKIRDMKDQQGNTIESYF"
FT   gene            542843..543121
FT                   /locus_tag="HMPREF0424_0496"
FT   CDS_pept        542843..543121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0496"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13823"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAA2"
FT                   /protein_id="ADB13823.1"
FT                   /translation="MDNKKFIAETKDVRLTVKRADTFGVSFVNCEQDILRVEEVQNVIR
FT                   LIQTKKVSASNWLRWFTQGMPEIVVSLPHDVEVCEVESDSNQVLARG"
FT   gene            543193..544764
FT                   /locus_tag="HMPREF0424_0497"
FT   CDS_pept        543193..544764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0497"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14525"
FT                   /db_xref="GOA:D2RAA3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAA3"
FT                   /protein_id="ADB14525.1"
FT                   /translation="MITVVIQEKLNVKRCTHFAPRVVNDNLGRRFMSVIKIENLTFSYY
FT                   GYVKPIFKNVSFSFDTNWKTGLIGRNGIGKSTLFKLLLNQETYQGKISKDVEFIKFPPN
FT                   ISDTSKLGIELYKELISDDEEWKLFRELSLLNVDENLVYREFETLSKGEQTKILLAILF
FT                   TREDGFLLIDEPTNHLDMDGRKIVSEYLKSKKGFLLISHDRDFLDGCINHVISINRNSI
FT                   DVQSGNFTSWYENKVMKDQFEISQNERLRKDIKRLKESARQSQIWSDKIENTKNGVKVS
FT                   GVKPDKGHIGHQSAKMMKKSKNLENRQNKAIEEKQSLLKDIETKESLLLHPLHHHKNPL
FT                   ISVSNLSSCYGERQILNNVSFEIKQGDIVAIYGGNGSGKSTLIKILLGINHEYTGEIKL
FT                   AGNLKISYIPQDTSNLTGSLNEYIHKQDVDETLCKTILRKLDFSRELFEMDMKNYSDGQ
FT                   KKKVLIAVSFSKPAHIFVWDEPLNYIDVISRIQIEEIIKEAKPTLIFVEHDKRFVEDIA
FT                   NKIIQF"
FT   gene            545245..545679
FT                   /locus_tag="HMPREF0424_0498"
FT   CDS_pept        545245..545679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0498"
FT                   /product="cytidine/deoxycytidylate deaminase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13969"
FT                   /db_xref="GOA:D2RAA4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAA4"
FT                   /protein_id="ADB13969.1"
FT                   /translation="MDIWDTMYEKAKPQFHPEEVSPFIYAHHVVCAIEAENGEIFTGFC
FT                   IESCSGVLNLCAERVAALNMYVNSGQTKVKRFIAFRDKAPYGAGSGMPCGACREFFYQL
FT                   NEENEKMEIMEDFEQRKTVTLKELLPNWWGKDRYAEAKAK"
FT   gene            545778..546722
FT                   /locus_tag="HMPREF0424_0499"
FT   CDS_pept        545778..546722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14661"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAA5"
FT                   /protein_id="ADB14661.1"
FT                   /translation="MNTEHHPWIDMTDEEMLRSCGLILEDPETNQEGITLAAVLLFGTN
FT                   NRIMSVLPQHKTDAIFRVFNVDRYDDRDVVITNLIESYDRLMEFGKKHLNDVFTLDGVQ
FT                   RISARDKILREIISNLLMHRDFSSGYVPKLVIERDKITTENANLAHGHGNLNLKTFKPF
FT                   AKNPPIAKVFREIGLADELGSGMRNSYKYTKMYSGGEPVFTEADVFTTVIPLSEAATAT
FT                   VGPITQGTPQVVPQDTHQVTPQDLEQRLLRLIDFCSTPRSKREMMDYLGLTDSKNFRER
FT                   YLVPLLSSGKIEMTIPDKPNSRNQKYKKVNIED"
FT   gene            547461..547754
FT                   /locus_tag="HMPREF0424_0500"
FT   CDS_pept        547461..547754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13944"
FT                   /db_xref="InterPro:IPR018658"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAA6"
FT                   /protein_id="ADB13944.1"
FT                   /translation="MDHIPKWMANLTDEDMSFIKNFVLSSGSLKEMSQMYQVSYPTMRI
FT                   RLNRLIEKLRISDNEPEDPFVLLVKSLAIDDKYDVDTARTLINEYRKRKDES"
FT   gene            547751..547924
FT                   /locus_tag="HMPREF0424_0501"
FT   CDS_pept        547751..547924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0501"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14152"
FT                   /db_xref="GOA:D2RAA7"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAA7"
FT                   /protein_id="ADB14152.1"
FT                   /translation="MSYALFGPIIDILIALAICALVFFIARSLIRYAHSLKKDDKSSKQ
FT                   SAEDKRIALQDL"
FT   gene            548204..548665
FT                   /locus_tag="HMPREF0424_0502"
FT   CDS_pept        548204..548665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0502"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13440"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAA8"
FT                   /protein_id="ADB13440.1"
FT                   /translation="MTNPLRGIREEDIVKYFKDHNLSVDKTYVFTMKYDPWWKDLIKLF
FT                   LLPKLFYVAQGVDARIVAATNNEFIVVNPNAILGSGNLAKLDDKHLRRIPWNQLTNFEV
FT                   INKPTTQIIRFTVNSKTEEWSVPTESASVWHFNVYNLDNLRKTIQSHIK"
FT   gene            548678..549229
FT                   /locus_tag="HMPREF0424_0503"
FT   CDS_pept        548678..549229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0503"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14614"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAA9"
FT                   /protein_id="ADB14614.1"
FT                   /translation="MLKVKKIVTSLIVTVLSFGFLSTTISAAEATENKSTAIVQQDVKK
FT                   IEQEVRFIFEEASSYKNGVVSVKDELLKMKYGKVMAAYIAEGIRQVYTNDNLLDAIRAN
FT                   SQDKDFWSCMGGELIGLIPGMDIAQLLSSGDFKAYIEGHAWDKLAKFLAKQIAKFGLKV
FT                   NVAGIVASIAIGAGKCLIFG"
FT   gene            549417..550070
FT                   /locus_tag="HMPREF0424_0504"
FT   CDS_pept        549417..550070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0504"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196; match to protein
FT                   family HMM PF04545; match to protein family HMM PF04967;
FT                   match to protein family HMM PF08281"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14061"
FT                   /db_xref="GOA:D2RAB0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAB0"
FT                   /protein_id="ADB14061.1"
FT                   /translation="MNTTYAIVDNDTFVLRYMQLLLKSRLPENFVCAWMCSSAKQAIHR
FT                   CVTENTPDVLLVDMSMREMSGVDVIKAIRERNSNIVLIGITSYMLDEYVLQVAKSGGQA
FT                   LVHKDNLADVVAAIQSRATSYGCPELPQYIDYFHTPQESFNMISQLPKTSVLSPQESEI
FT                   MRLCKQGYSSKEIADQLNVKVSTVNTHLRRIYGKLQVKSRMQALAVLAKYSHDI"
FT   gene            550105..551277
FT                   /locus_tag="HMPREF0424_0505"
FT   CDS_pept        550105..551277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0505"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14383"
FT                   /db_xref="GOA:D2RAB1"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAB1"
FT                   /protein_id="ADB14383.1"
FT                   /translation="MKLLTRMINFLPHDAWQKIGIGVIISCTLILEICSYNNLHYYSNW
FT                   HAITVEIVWIVICLCIAIWPRKASFIVLIWMPLVIIAPNINYSSMMLTILICLAIAVIT
FT                   QPWYTVLSSCGVSSWFFIICDFQNAYVLAWWLLITLISSAIVKYYISTIHQQQEQLFAQ
FT                   RYNVFQKYATIAAIRMHDEVTNELSSIMMMAQQSIEPQTTHEQEHENSREILQRATTTV
FT                   HRARNIISLLDNATTASTGDVMQSTTCYKDFCTGLRVLFDCEQKSFEKLGYIGSIDLSS
FT                   DLATEDSQSIHLPFEECAQIEYICRELLANVKKHAAKPKEYAMNVMLNDHECHITCINS
FT                   AQRGILANLQLGYGLRFHKMLAECVGGTFKVIEDDDSWIINVHVPLHAEK"
FT   gene            551368..551583
FT                   /locus_tag="HMPREF0424_0506"
FT   CDS_pept        551368..551583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0506"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14256"
FT                   /db_xref="GOA:D2RAB2"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAB2"
FT                   /protein_id="ADB14256.1"
FT                   /translation="MQCRMLLRCYVIPVIVAVFANFAIFATITRDLVIIVCTMVLLWYY
FT                   VGCCRSVIIKQSMNNKFMILSLKETT"
FT   gene            551580..551849
FT                   /locus_tag="HMPREF0424_0507"
FT   CDS_pept        551580..551849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0507"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /note="identified by match to protein family HMM PF04221;
FT                   match to protein family HMM TIGR02384"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13719"
FT                   /db_xref="GOA:D2RAB3"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAB3"
FT                   /protein_id="ADB13719.1"
FT                   /translation="MTSTKTARTGRLSVRVNPEIRDSASQVLEHYGLDMSSAVNLFLYQ
FT                   IVNTQRFPFSLESSPYEHAIDEAMKEKPIAAGTVDDFAELMRNA"
FT   gene            551842..552117
FT                   /locus_tag="HMPREF0424_0508"
FT   CDS_pept        551842..552117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0508"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="identified by match to protein family HMM TIGR02385"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14400"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAB4"
FT                   /protein_id="ADB14400.1"
FT                   /translation="MPKPPFYSPIYLRDVKKYKQKHYDIEQVINIVRLICNGADSRELA
FT                   TYRDHILKGSYKGVHELHVSADVLLLYQVKEDCIIFLRLGSHDDLF"
FT   gene            complement(552238..552972)
FT                   /locus_tag="HMPREF0424_0509"
FT   CDS_pept        complement(552238..552972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0509"
FT                   /product="integrase core domain protein"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13861"
FT                   /db_xref="GOA:D2RAB5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAB5"
FT                   /protein_id="ADB13861.1"
FT                   /translation="MRTKGIKVSEKVVRRLMKEELIEVRYARRKRRYSSYIGEITPACS
FT                   NIVNNNFHADSPNKIWLTDITEFSAKESKLYLSPMIDCFDSKVASYALSNHPDQCLVDE
FT                   MLEGALTTLDTTECKSLVIHTDRGGHYRDGRWIERLEGLGITRSMLRKGNSGDNAACEG
FT                   FFGQMKTEMYYPLNWDSTEELRQAIHTYIDFYNNHRIKMGIKRQLWNIVLWLHKMSKNC
FT                   TKPQATFLCRQNCRFVANGYKI"
FT   gene            553742..554134
FT                   /locus_tag="HMPREF0424_0510"
FT   CDS_pept        553742..554134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13702"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAB6"
FT                   /protein_id="ADB13702.1"
FT                   /translation="MKTRKTNSNDRATYKYTSCVRNEDGSYSEGTIEIKPGENGVTEAD
FT                   IKMLHSMDDSEVYYNNKNLRPTRTVEEKAEIEAWKEEYIQHFNLKHGYEPNKDDVEYAT
FT                   EEHFPRNYNLSLDFDARRECRIDVKS"
FT   gene            555423..556055
FT                   /locus_tag="HMPREF0424_0511"
FT   CDS_pept        555423..556055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0511"
FT                   /product="DNA-binding helix-turn-helix protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13611"
FT                   /db_xref="GOA:D2RAB7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAB7"
FT                   /protein_id="ADB13611.1"
FT                   /translation="MLLGEKIRNARVEAGLTQEELAEMIMVSRAAVAKWEGGRGLPDVA
FT                   NLKVIADALGVTVDHLLDKDNAIDLSIIKKPIDLAKYGLNEKLSVRKKIKMKEQIIRDE
FT                   YADAEIIMLTVTKFIPNSSEKFMDNFIGCITTLFGDIPLFDTFAFGKAVESIGSEQYYL
FT                   VNKKEKQFFVLITDEYIISRMMRVKFTDKKMCVGDKEFTQVGKLRDK"
FT   gene            complement(556792..557046)
FT                   /locus_tag="HMPREF0424_0512"
FT   CDS_pept        complement(556792..557046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0512"
FT                   /product="prevent-host-death family protein"
FT                   /note="identified by match to protein family HMM TIGR01552"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14056"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAB8"
FT                   /protein_id="ADB14056.1"
FT                   /translation="MINIRPVSDLRNKFPEVEETVINSNTPVFLTKNGYGTMVLMSIKQ
FT                   YSALTDDIERKLDEADTFAANTSTRLSKDDVFDSVRRRD"
FT   gene            557174..557320
FT                   /locus_tag="HMPREF0424_0513"
FT   CDS_pept        557174..557320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0513"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14586"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAB9"
FT                   /protein_id="ADB14586.1"
FT                   /translation="MIGKCGANMRENELVVGCAHLSAEIALLTVIVNRTCYYATAVSAI
FT                   ISP"
FT   gene            557357..558343
FT                   /locus_tag="HMPREF0424_0514"
FT   CDS_pept        557357..558343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0514"
FT                   /product="DNA-binding helix-turn-helix protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13896"
FT                   /db_xref="GOA:D2RAC0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAC0"
FT                   /protein_id="ADB13896.1"
FT                   /translation="MILADKILELRKQNGWSQEELADKLGVSRQAVSKWEGAQSIPDME
FT                   RIIALSRLFGVSTDLLVKDEIDVMGKNVNAGENACQEEAGVRMRVIELEEASAYIAHRI
FT                   SFAAYVALGVLLCILAAIPLVGSDLLLSHTVNAQVGKTMGLAFSVAIITVAVAIFIIQS
FT                   FHGKRYQYLEKEDFETAYGVDSVLKERLERFMPSYVLRTVSGVVLCMVAFIFLIISDIA
FT                   PKFYQLSSGFFVVIAIALVAAAVYLFVQANIVRSSYCRLLQPKKKTVYPAKISLFLQAY
FT                   WLIIICIYLAYSFITSDWGKSWIVWPLAALTYGVIEVVLKAWRLGKK"
FT   gene            558365..558601
FT                   /locus_tag="HMPREF0424_0515"
FT   CDS_pept        558365..558601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14213"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAC1"
FT                   /protein_id="ADB14213.1"
FT                   /translation="MANNVKAVASCMVDTLNGTSVLEGEIPKDVCLEVVCENGISEVSD
FT                   KNKVNLSCNNFGRKTDGCAHYAVHCLNGKAVVK"
FT   gene            complement(558850..559251)
FT                   /locus_tag="HMPREF0424_0516"
FT   CDS_pept        complement(558850..559251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13694"
FT                   /db_xref="GOA:D2RAC2"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAC2"
FT                   /protein_id="ADB13694.1"
FT                   /translation="MKKQKTQNFWYIGYVIGICGLILALTLKLNESVGIVLSVVFVAII
FT                   SLSHVKIMHYKMIEKDHNYKINVNDERNEKIKDKVNATMAFILMHLMGIIAIIAFITKA
FT                   YLPAALLAISIAFSPLIMFFINKYYEKKY"
FT   gene            complement(559248..559451)
FT                   /locus_tag="HMPREF0424_0517"
FT   CDS_pept        complement(559248..559451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0517"
FT                   /product="DNA-binding helix-turn-helix protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14358"
FT                   /db_xref="GOA:D2RAC3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAC3"
FT                   /protein_id="ADB14358.1"
FT                   /translation="MKNRLEQIRREKGITQEELADALEVSRQTVGSLENGRYNPSIILA
FT                   YKIAKYFNLTIEEIFIYEEDKK"
FT   gene            559651..559947
FT                   /locus_tag="HMPREF0424_0518"
FT   CDS_pept        559651..559947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0518"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /note="identified by match to protein family HMM PF04221;
FT                   match to protein family HMM TIGR02384"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14431"
FT                   /db_xref="GOA:D2RAC4"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAC4"
FT                   /protein_id="ADB14431.1"
FT                   /translation="MAKTANLYTRIDPELKEQAEYILNSLGLPPSSAITMFYKQVVLQQ
FT                   GLPFDVKLGYREPRDVSSMTQGELNDELEKGYKSVLSGDVKPADKVFESLHKA"
FT   gene            559953..560069
FT                   /locus_tag="HMPREF0424_0519"
FT   CDS_pept        559953..560069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0519"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13847"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAC5"
FT                   /protein_id="ADB13847.1"
FT                   /translation="MSCDNFLIFYFVFEEKYEVVVSRVLYGKRDIEKVINGN"
FT   gene            560371..560943
FT                   /locus_tag="HMPREF0424_0520"
FT   CDS_pept        560371..560943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14611"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAC6"
FT                   /protein_id="ADB14611.1"
FT                   /translation="MKNIKHYAFLTMVVCLMSLISGCKSQNNFSDNNREVKTENQKSAR
FT                   NERHSENNEDVDWKEVSKNGVDETLLIKNIDEKVLTYVAKQLQNLCDEIGEKGVKDKYY
FT                   RLTGWYNDVVYSKQYKSVVSLGKKAMKPLFLIIYKSKEAGMYEWVCSKALDEISGFDFS
FT                   GLNNGAGWSNSREFLKAFTDKIIEQKN"
FT   gene            561247..561378
FT                   /locus_tag="HMPREF0424_0521"
FT   CDS_pept        561247..561378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0521"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14123"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAC7"
FT                   /protein_id="ADB14123.1"
FT                   /translation="MEALNAHNYVGSSGSANLAVYKNYSLLVNEEISVNNLDKLIKK"
FT   gene            561644..561946
FT                   /locus_tag="HMPREF0424_0522"
FT   CDS_pept        561644..561946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0522"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13751"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAC8"
FT                   /protein_id="ADB13751.1"
FT                   /translation="MSQEEFRIPENYINKDELYLFVSRDILDSHYDLSKVTLGDKRIKL
FT                   VDSSFNLPGPGLKALFLVGKFDLKDKPGSCKSSSCVLKVPGLNKAGNVAIGYKKK"
FT   gene            562361..563467
FT                   /locus_tag="HMPREF0424_0523"
FT   CDS_pept        562361..563467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0523"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13755"
FT                   /db_xref="GOA:D2RAC9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAC9"
FT                   /protein_id="ADB13755.1"
FT                   /translation="MNNNIENATDSRDNNNKQSASNLILRIDNITRSYSRGFGRKKTTR
FT                   QVLHNVSFDIHSGEIFCLLGPNGAGKTTTVKIVGTLLAPDSGSVRIANIDAVSNPREAR
FT                   KHVSLLLGGERGFYQKLSALDNLRYFADLSAVPYREQGKRIHDALEQVDLLDKAHDAVQ
FT                   TFSRGMWQRLHIARSLVARTDLMLLDEPTTGLDPENARKVREIIHALRDQGIAILLTTH
FT                   EMSEAEKLADTVAVINHGNIIAQGSVQQLASLQHIDHVTMYAYEGETSSGTPSVKEELQ
FT                   KLDGVLWCDVFESHGVLNITIAWSKALSQERNVKIPVDGITRLGDRAASLEETYLAIVQ
FT                   NDNISASNTSTSSAATSSSSSSSLSLSK"
FT   gene            563478..564257
FT                   /locus_tag="HMPREF0424_0524"
FT   CDS_pept        563478..564257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14129"
FT                   /db_xref="GOA:D2RAD0"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAD0"
FT                   /protein_id="ADB14129.1"
FT                   /translation="MNTSTRSCASVIRGMWFQLKSLAKTTFFLQNAILAPVCFALMKIV
FT                   AYYGFSHNCANFLNNIWVDSSIAGLWSATTTAVGIIGYQRYLGTLQYLTLSVISPSEVF
FT                   LPIVGSAALLGCIGMPLAIITVAVFCHGFFMITFTQLVGYLLSMLACVASAALLSGIFV
FT                   LCRKATVYEGLILIPVWMLCGIVIPVESMPLPARIIAFIHPLTSAVWVVHAQSFNTTTV
FT                   LAIVLCVVLSSVLLVIAGFMLRHAIRLATLNGSLNII"
FT   gene            564254..565192
FT                   /locus_tag="HMPREF0424_0525"
FT   CDS_pept        564254..565192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0525"
FT                   /product="ABC-2 type transporter"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13602"
FT                   /db_xref="GOA:D2RAD1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAD1"
FT                   /protein_id="ADB13602.1"
FT                   /translation="MIRNNNQVETMQNKIIKNSKYAELHQYNQYSQYGHVSVLSSIRTG
FT                   ARVSIQSIPSLNSWNTAVIRMIIEPLLSTFLYVFLAGAVSGGFNGAASAATSAGFNHSL
FT                   IASTLAAVMCACSISTSMTVSEALAWDRFEGTTPFVLTSAKVALPLWFGRIVALVTISL
FT                   VSDAVTLFITMLVVSPSAFWMINMSALMLLFLIVPVASTGFGIAVAAISMMMNDVYTIS
FT                   NALSAILPIVCGVIAPISVFPKMMQYVLYAIPVTHVTQASRSIVDGSVNVGVSLLVILV
FT                   VGMLWAIVGVIIWNVGVAVQQRKGTLTNIGF"
FT   gene            565361..565489
FT                   /locus_tag="HMPREF0424_0526"
FT   CDS_pept        565361..565489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14582"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAD2"
FT                   /protein_id="ADB14582.1"
FT                   /translation="MFVYLAVSYIIFLVEAVLYGKEKFYGFEKLALIERKNKKIFL"
FT   gene            566219..566431
FT                   /locus_tag="HMPREF0424_0527"
FT   CDS_pept        566219..566431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14613"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAD3"
FT                   /protein_id="ADB14613.1"
FT                   /translation="MAIDMFYRQIILNNGILFSLTIPKSLTAQDAMDEKTFNALMVKGY
FT                   DQAVRGDSYLIDDVFLKSLNADWQS"
FT   gene            566505..566996
FT                   /locus_tag="HMPREF0424_0528"
FT   CDS_pept        566505..566996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0528"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14065"
FT                   /db_xref="GOA:D2RAD4"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAD4"
FT                   /protein_id="ADB14065.1"
FT                   /translation="MKVGSSRSEFNRMIDECEKGNLDIILTKSVSRFGRDTKEGLEAIR
FT                   KIRSCGTRIIFETDKIDTETVDDELLISVVQACCQAENDWRSENIVWGLRRRAEDGTSG
FT                   LYSRACYGYKKDKHGMLNAGIISKEKFEAVELEMAVRSNVEVGEDGTVKRKSKKYSSKR
FT                   "
FT   gene            567016..567645
FT                   /locus_tag="HMPREF0424_0529"
FT   CDS_pept        567016..567645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0529"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14452"
FT                   /db_xref="GOA:D2RAD5"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAD5"
FT                   /protein_id="ADB14452.1"
FT                   /translation="MKDKFSKSNINTVSGNVFNGPTNIVSGNNTDFNGNSSGKTATYTP
FT                   EPVWRSPITMAILSWMGIFISLIGIFPFYKLFEPLINLFTNKSIQINANNNIIYWGILA
FT                   IVIIILLAIIVWLRDITKRETRHPLFFNYAISGLGRKLTIEKIHIEKCPICGGTMKYFN
FT                   KAVEWRDTTYPNGKTKREVTKKVPALQCKRNPDHFCEVDPAADKIN"
FT   gene            568193..569491
FT                   /locus_tag="HMPREF0424_0530"
FT   CDS_pept        568193..569491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0530"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13911"
FT                   /db_xref="GOA:D2RAD6"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAD6"
FT                   /protein_id="ADB13911.1"
FT                   /translation="MNIEYVVVGICIVAVVMIAAFLINRLKKTNIPEDENSSDLNNSAM
FT                   IVKKTSKLSQPNQKLDELVIQMEMLPVEAISDDSKLVEITDSKILGRVNNLFSGLVQAS
FT                   IAGSNAVQTAKAGSEVLYRAIIPAGAKLTNSKAMKGAVRGLYFGANGIKGHANLVAVKA
FT                   KNVVANNVGVAMGLASIVVGQYYMTQINAELGSIRDGISKISDFQDNEFRSRVFSLVAH
FT                   VKKIADFQVEILENDELRLSKIAQLDNIEEECTQLLGQVNLTLAGFTKKNDLDYASYEK
FT                   ELKEAQNWYTYQKALLDVLYKISDLRYTLHLGAVSRKQCLALLPTYTKQVEDTQALLTG
FT                   WHQTSVNRLSIDTDEIKRKRDGIDRVIHFIPGLFDDDLNFRAINKKTVDMITAQASVKS
FT                   IKHPQDTSDLYAEDVQLISKDGKIYYLPMGKAE"
FT   gene            569761..569940
FT                   /locus_tag="HMPREF0424_0531"
FT   CDS_pept        569761..569940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14286"
FT                   /db_xref="GOA:D2RAD7"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAD7"
FT                   /protein_id="ADB14286.1"
FT                   /translation="MSKCSNCRKQMQLVSILISVMVPVIAAFAIMELYHLLGVAIAMEL
FT                   ILIAWTVVLIKSSK"
FT   gene            570370..570492
FT                   /pseudo
FT                   /locus_tag="HMPREF0424_0532"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            570996..571181
FT                   /locus_tag="HMPREF0424_0533"
FT   CDS_pept        570996..571181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0533"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="identified by match to protein family HMM TIGR01764"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13606"
FT                   /db_xref="GOA:D2RAD8"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAD8"
FT                   /protein_id="ADB13606.1"
FT                   /translation="MKNEEGYISIDEAAEYLGIKTVTLRTWIRKKPDMPVYKIGKLWKF
FT                   KRSELDKWIASGESAE"
FT   gene            571208..571927
FT                   /locus_tag="HMPREF0424_0534"
FT   CDS_pept        571208..571927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0534"
FT                   /product="DNA (cytosine-5-)-methyltransferase"
FT                   /note="identified by match to protein family HMM PF01555"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14515"
FT                   /db_xref="GOA:D2RAD9"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAD9"
FT                   /protein_id="ADB14515.1"
FT                   /translation="MSKIELYNDDCIVAMDNLRAKSIDLIVTDPPYNLGSFMKTRDTNL
FT                   KKMRDNFFAAAGWDDMGFEEWKKSMESFFELSSRVMKKGGSMIVFMAIIKVETIIKLAE
FT                   EYGFYYKTTGIWHKTNPMPRNMNLHFVNSTEAWVYFTYKTKTGTFNNGGAMFHDFIETS
FT                   VTPNSERKYGKHPTQKPESLMQHFVEILSNPGDNILDPFMGSGTTGVVSKRAGRNFIGI
FT                   ELNSEYYNIAKSRIEGK"
FT   gene            571928..573001
FT                   /gene="dcm"
FT                   /locus_tag="HMPREF0424_0535"
FT   CDS_pept        571928..573001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcm"
FT                   /locus_tag="HMPREF0424_0535"
FT                   /product="DNA (cytosine-5-)-methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /note="identified by match to protein family HMM PF00145;
FT                   match to protein family HMM TIGR00675"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14000"
FT                   /db_xref="GOA:D2RAE0"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAE0"
FT                   /protein_id="ADB14000.1"
FT                   /translation="MQPTVIDLFSGVGGLSLGFEEEGFSVLLANEYDESIANAYMKNHK
FT                   TTKMVVGDITSLDLDAVFGTYKNKIDVIIGGPPCQGFSQKGQRKTIYDKRNFLFEYYVK
FT                   VVELVKPKYFVMENVPNLLTAEKGYFFNEIETLFNAMGYFLQHGVLNAADFGVPQNRKR
FT                   AVIIGKMNGVAPSLPSSLNEKVTIWDAISDLAFLESGEGDEVQEYRYAPQSEYEKKLRG
FT                   HANLLYNHKATKHSPLSLKRLRMIPPNAGKEVLPKEHLTKSIYSGTWTRMKKDDISVTI
FT                   TTRFDTPSSGKFTHPFLNRAITVREAARIQSFPDEFIFIGSKSSQMRQVGNAVPPLLAS
FT                   AIARVIKNDIMEGNIDE"
FT   gene            572994..574955
FT                   /locus_tag="HMPREF0424_0536"
FT   CDS_pept        572994..574955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0536"
FT                   /product="ATPase family associated with various cellular
FT                   activities (AAA)"
FT                   /note="identified by match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13817"
FT                   /db_xref="GOA:D2RAE1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAE1"
FT                   /protein_id="ADB13817.1"
FT                   /translation="MNRPDNMSAYSALDLKLGIKSSLPHVKSAVALILLFWECSIKSAE
FT                   LQYSVQSEDKIVINPNLKTAIKNKLAQICKQDGINIDTVIDAINNNSLFKSQMESLIVA
FT                   FELIWKLAKISFIDEDKTTSAERTGGIRYPKKLIYTVNADIIDTLIDNDWDAYVRILIL
FT                   WIGVDINYDKQIETRLSRLLTAISEGAIFKLVDGTNDVIFNQNDVYKKLMQTKNNVDLN
FT                   GDEEAKGSLRILKSLLSDGLNPYLECRNGDVQILKGQFNNLEEYQKRVETFLQLSTTKI
FT                   IDSEDVNIDKETDRQDSLENNRVVSGRNILLYGVPGSGKSWTIEHEYCKPGSVVERLVF
FT                   HPDYTYSDFIGQILPAVSDDGQVSYKFTPGPFTNILRESYNNPSKEYILIIEEINRGNA
FT                   PAIFGEVFQLLDRKVEIRDIDDNGYPIGTSEYGITNMNIAEEMYGKDRKTEKVRIPSNL
FT                   SIIGTMNTSDQNVFTLDTAFQRRWDMRLIENDFASVDSSLADAEILDTGITWKNFCVEI
FT                   NKIVVENSARMTSAEDKRLGAYFVHVHDLKYDDTMGALKEYDALRMKETSGSLTDDEKS
FT                   RIAVIRDAMRQNRKFPEKVIKYLWDDAFKFNREIIFDVDKYQSLEQVIHAFMYANGTER
FT                   FKVFKDNVRDAFANVEED"
FT   gene            574969..576345
FT                   /locus_tag="HMPREF0424_0537"
FT   CDS_pept        574969..576345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0537"
FT                   /product="LlaJI restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14499"
FT                   /db_xref="GOA:D2RAE2"
FT                   /db_xref="InterPro:IPR018579"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAE2"
FT                   /protein_id="ADB14499.1"
FT                   /translation="MDLDSASKSIKEFDIKKHCHVNTNEDGDRFVGIKADSDNAMVYFP
FT                   IGYELPKTDAEIRTDIKHLIQVLSEFTTKDDRLLAINKFTAPQLVGFPINAYKNVIEYY
FT                   FSIGGAYYVEKEQVYTTASTGKQDWARTARKQMPLVQSRNGVSSFVFTQFEVRSSTPND
FT                   TKEITQINRFCVYEAFKRLGWLYVPYMPEESGSHPDIKTSIRIVQNKLATTNDDRKKSL
FT                   FRSMNDMLEYMYEKTSDKQFYFGTDDFDHVWEKLIDRAFGEKDKNKYFPRSRWLLDCGK
FT                   YKEKKPLIPDTIMIYNDKYYVLDAKYYKYGLTGIPDHLPNGSSINKQITYGEYLEKNKN
FT                   VDAKSLFNAFIMPYNMAKNYFSLTSFVGNIGEAIGDWRCNKKYYERIQGIVIDTRYLMY
FT                   HYSGKPIKEKAALAESIESVRWRKEIKFTKESSLPKTVSYARKPTDSMVAEDRGTYDID
FT                   "
FT   gene            complement(576484..576861)
FT                   /pseudo
FT                   /locus_tag="HMPREF0424_0538"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            577204..577344
FT                   /locus_tag="HMPREF0424_0539"
FT   CDS_pept        577204..577344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0539"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14356"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAE3"
FT                   /protein_id="ADB14356.1"
FT                   /translation="MRMMVLSAFAVVAAATSVYEKYSFTATLSCVVSRTLEASPQHRSK
FT                   L"
FT   gene            577846..578583
FT                   /locus_tag="HMPREF0424_0540"
FT   CDS_pept        577846..578583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0540"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14615"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAE4"
FT                   /protein_id="ADB14615.1"
FT                   /translation="MRTLVKKTMGLLMATLVAFGVMAGTTQAFAAENNVPSEYVKGGKL
FT                   ITGTIDLSKTVNNVGKDVIKDGKLYYEGVASGVVEASDLFEGAYNKYIADIKGHTDGGN
FT                   EWDHLVMFDKGQNFPTAKYTVTFSKNFKFNLDEITCSANTAMISGVEKSYNEDTNSVTF
FT                   TFKLGNWNDYKEFFELYEKEKGTTGHPISVSIPYSVEIKDSSVKNLGDIKAEGKCELYK
FT                   KFVFWEIKIVDITAKEIGFTVSR"
FT   gene            578596..580161
FT                   /locus_tag="HMPREF0424_0541"
FT   CDS_pept        578596..580161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0541"
FT                   /product="repeat protein"
FT                   /note="identified by match to protein family HMM PF09479;
FT                   match to protein family HMM TIGR01167; match to protein
FT                   family HMM TIGR02543"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13550"
FT                   /db_xref="GOA:D2RAE5"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAE5"
FT                   /protein_id="ADB13550.1"
FT                   /translation="MKKFLSTILAILFLTAFSSGVAHAEVPEDFNSMKSGNTWIELEEA
FT                   NTAIFGDSTIVAVPKGVLKPEDTAIGKKYKNEIKDTPVYFSYSTGIYSDDGKPALSPFL
FT                   KMLKEYKPENPTVYDHAVPMTDNPMFYGDLSYNNETISKDVKISAGDSLSSLKLTLSNM
FT                   NWLSQPIFSELSAHDMYIHEKNDGTLRFLTDSQLVYTIKFPKGFDISKATTTSDASPDL
FT                   LTLSTSVSGDVKTGMTLIVTLRRNGAGEKLLTEEQFKNELDSLNTISVSMKDIAITKDA
FT                   VEGKNVVTGSIGGFLEYMNIGYDNANKKINAYTWTYVHYFAAPQEASGKDSNLAANDSQ
FT                   YKIQYTFNVVKPAQSTVTFKDGDKTHATVKVETGKAIDTDALTNESMPKKPTKAGYTFK
FT                   EWNTKEDGKGETFTGASIVNGDMTVYAIYTKDPVPNPDPTPNPPAPTPTPSPNPEPNPT
FT                   PNQPASELKLQPQTPAPQPQPEKHIGMIPKTGESASFAGLLAVLGFSIAGLALLLKKKM
FT                   MKKQ"
FT   gene            580385..580726
FT                   /pseudo
FT                   /locus_tag="HMPREF0424_0542"
FT                   /note="conserved domain protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            581409..582671
FT                   /locus_tag="HMPREF0424_0543"
FT   CDS_pept        581409..582671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0543"
FT                   /product="putative YcaO-like family"
FT                   /note="identified by match to protein family HMM PF02624"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14605"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAE6"
FT                   /protein_id="ADB14605.1"
FT                   /translation="MVNFVSPEREFTLMDSLSSIIEVFALKKWQWSVEVSQWSVEVSAL
FT                   DTTCILDSCVYLDEADCADIVLESARGKGLGLESLTSGLYELLEHIVYSNQSVLYSCSS
FT                   SLRIKGDAILNLSNSASKNTDYTFYSMSDNAIASLPPEYCGGKSTGEFSSIDENLIRCY
FT                   YTNNGWAAGTSIQEATLHALNELIERDATSNILLSNIFDDVCVEFLIPNCELLKEIKQA
FT                   IESATGNKVYIVSIPALSGSVVLSICYKTDREEIPTFGCGASQFLGYATYRSLLELWQE
FT                   LCADKDYSNPEERDRSKRLNHLVHSYPNIKKALFLEKIRQDSRKFSQKLVSYDICDTLS
FT                   IPNIGIQINNIVNDLHKYGIDIWKRDAFHYERKSMKCNPSVVQIVAPGLERFHVIRHGF
FT                   PAELIGRLRKRKSIMLIRQHN"
FT   gene            582694..584007
FT                   /locus_tag="HMPREF0424_0544"
FT   CDS_pept        582694..584007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14047"
FT                   /db_xref="GOA:D2RAE7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAE7"
FT                   /protein_id="ADB14047.1"
FT                   /translation="MKAIGKRNNIFIRMRSISPALRWALVGFCFSMLGNQAYEGSVLPS
FT                   IIIVGLPAWVIGFRKTFMTVADFLSPCSGWIVDKLGGFRALAMTEGVEGVLSLLPLLML
FT                   GSPAWKWSLVALSCALLITGQVIDIASEVFEVDAAGGDDGMIVNYSGIVSVLASVTGTL
FT                   LGSPLGSWIASWSIPAVLIFSSVTSFAACATRFIMKQDIAQASCAEEEALQDVENESQA
FT                   ISEEGEVSQVSQVSQENDVANKSAAKQSANPLLKSKIMLLLGSLLVAFIPACSVSYILL
FT                   GLGKQYGSNSLTILYIFTGVGSVLASVLYAHSSQKLGLRKVAILGIAVSLLAYCFMFIN
FT                   LLPMMCFAFFLQAIGGMLLVEPIIVARQILFKGSALAKFSGWARLAFAIGATTGSWIGF
FT                   AFSSTCQWQLLPILALIFTAGLIVVLPQLPNTSYAALA"
FT   gene            584190..590279
FT                   /locus_tag="HMPREF0424_0545"
FT   CDS_pept        584190..590279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0545"
FT                   /product="GA module"
FT                   /note="identified by match to protein family HMM PF01468;
FT                   match to protein family HMM PF07554"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14419"
FT                   /db_xref="GOA:D2RAE8"
FT                   /db_xref="InterPro:IPR002988"
FT                   /db_xref="InterPro:IPR009063"
FT                   /db_xref="InterPro:IPR020840"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAE8"
FT                   /protein_id="ADB14419.1"
FT                   /translation="MVKKTQAAKNALHVSKNYAYLKPSTLRSMAKEISGTRLEACKSYA
FT                   VSRLPKIAVTATLASLLACGAGLPTHQAWANGFNLPDGSYRYANRDSSTKAQRYVDIKL
FT                   VPCDEKQNDNKETADRKTYGQYYKVVYQFNSQGEWWGGRPFWWASVPKGVDIVDNKITL
FT                   YKDEQLTGDSSSQQTGATYTKESWNQSASRFWFDNNKEQGTEFKNNWERMTGEAGGYDE
FT                   SGNTLGTSREYKDATSALIINWESRGNRKSKISFVIKLNDKTKPLKFAAGVYQVMGNWH
FT                   YTAGKVALAPTLPKYSQELELTYPTDKVEVDSSTYGNNLSEDEKKAVLTKLWNANKSNT
FT                   DVLKKLKGMEQTQTEEAFKKAVKVNNDGSATVTYKDNSTDTISKENLTKRYIPFADKVK
FT                   INYPTNLTPVKNISQLSKEEKQAVKNAILAANTGKHIKDLTVDASGNATITFTDKIGAP
FT                   STKKLEGKYLVKKQRSLADKFTPYYPVPMAVGNPQGLTVNEQTELVKKVYEANKNKSDF
FT                   IDAIGKPNNLEEAKKSITVDNKGNVTITYKDNTADFPSTDKLDGNKLVYQAKKLNETTY
FT                   ITLPARTAVKDAKAIQTNEQSTIRQAILTANSGLQSKLKGSNENTAITFDDAKHTMTVK
FT                   FNDDSTSTFDYSELVYTKGNPEKPKTETKNSNGYKYNITKIVIKDKNKPVTADWNSFAR
FT                   QFIRDNWKSKDVSNPITDQFINSNPDLMGMFHSSDPKSSGGMKLYNFSNKWENNNSNLT
FT                   LSDGSWNNYNIVSIYEGGSGFEIKKNDNYGPKTIITLSADDCFVSNAAAPNPEALKKEA
FT                   EDLIDKILQKHGLSKDEIDKFKKDHQNDINKITKPEDVDKIIKSADEHGKDEKKKKDAQ
FT                   KQIENATSGLAEKTKKELEKKIGNETDPEKIREKINEFQKDQDQKKQKEADQKQQQADQ
FT                   QAEQEKQQQQQKDDAKVDGEVTKQNQQEQQDTGKAEEAKKKAELEKQKQAAINEINGND
FT                   KLKPDWKEQFIQQVNEAQDTDGVNKAKDAAKLKGTQNQTAADNSNNDGLNNAKTDAKKK
FT                   IGELTNLSEQDKQKYQGDIDNAKDLDKVAEILNNAEFEDAKADAKKKIADLKQKGDITE
FT                   QEANGLTGRIENAKDLREVEGILEEAELKKAKKDAESEVDKLTNLNKAQKDALKAEIDD
FT                   IETDPTNENMKTIEKVKTAITAVVTKAKELDGKMKSLKDLVTLVNGQKSTLTAKPDYKD
FT                   NKKTAFDSALKAAEDLVKTDSAENKTADEVDNIKNALEKAVKDLGGKTVDKSALQELIN
FT                   GDTGFKKTIVYINADKSKQTTYDKAITDGKSVLTDANATVERVTQAVNAINSAKAALDG
FT                   KVNTTELEQKVSEAKKLKKSTNPQSAGDAKYENASEAKKSAFDTALQQAESALTEAKSD
FT                   QSQKSPEQKQQAVNDALTALTKAVQNLDGNDVSKLQTAIANAKAKQQEVVYKNGTAVKK
FT                   KALDDALKTAEDLVKTPHGHTDSEISTALNNLNTAISGLDGMVNTAELQTAVDNAKKLT
FT                   GVTTPKSQDAYKYENASEAKKSAFDKALQQAESAITEAKNAKSTKTPEQKQQAVNTALT
FT                   ALTKAVNELDGNDKSQLVAKLAEAKGKKNDASYKNASAAKQAALDNAITSAEGIVKKAG
FT                   ATAGEITNAITALTNAVTGLDGHDISTLQTVVTAAESKKKTIAYMNAPDTTKTAFDQAL
FT                   QAAQDILKNPQGKTEQEINDAKTKLETASSALNGTVDTSKLQAEVDKADSLKKSVQYTN
FT                   AVQDKKSAYDTALAAAESTLADAKDAQSTNNPEQKQTAVNDALQQLQTAAAALNGVDIA
FT                   DLQAEIALENSVKESVKYVYDTAEKQQAYNKALQDAKELISKLADPAGQGVEVAAKSQA
FT                   DRQALVNTALKSLKNAKDALNGVNKTVLQAEVDDDSHFSKSFAYLLGEAPDLDVYKKAL
FT                   AEAKKVAADPNATQAQVDAAAKKLSAARKALASAKAHAAEVRASVRAQVLKSGSVAQLS
FT                   KTGSDVSVFGLFAATLSAAGAALFSAKRRGTSRHSNK"
FT   gene            590404..590550
FT                   /locus_tag="HMPREF0424_0546"
FT   CDS_pept        590404..590550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13532"
FT                   /db_xref="GOA:D2RAE9"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAE9"
FT                   /protein_id="ADB13532.1"
FT                   /translation="MCLTLRLSLLRKVRHFAILICDYMGSYCCLLYFKSYLAYKALIEA
FT                   FSH"
FT   gene            590708..591964
FT                   /locus_tag="HMPREF0424_0547"
FT   CDS_pept        590708..591964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0547"
FT                   /product="transporter, dicarboxylate/amino acid:cation
FT                   Na+/H+ symporter family protein"
FT                   /note="identified by match to protein family HMM PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14549"
FT                   /db_xref="GOA:D2RAF0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAF0"
FT                   /protein_id="ADB14549.1"
FT                   /translation="MHKIVQKWNNIDLILRIVIGLFLGAVLGIFVPAHVYVLDLMGKLF
FT                   VSALKSVAPILVFCLVIGALAQAKSVGNMKVVIGLYALSTFTASLVAVCAAMIFPVDFT
FT                   FAHVAAASSPSPQGIGEVLNSLVLNIVVNPVDALVKGNFIGILFWAIAFGVALRLAEPS
FT                   TKAFFDNVSSAIGKIVHWIINAAPFGIMGLVYTTVASNGLRIFSEYGFVIALLVGTMAV
FT                   VALILNPILVFVLTRKNPYPLVFRTLRDSGVTAFFMRSSAANIPVNMNLCEKLGFNKDN
FT                   YSVSIPLGSTINMSGAAITISIMSLCAAHTLGIRVDIPTAVILSVLSAVSAAGASGVAG
FT                   GSLLLIPLACSSFGISNDIAMQVVAIGLIIGVIQDSCETALNSSTDVLFTAVGEYRMWQ
FT                   RAGIEFKMGKDHETVQLKK"
FT   gene            complement(592284..592970)
FT                   /pseudo
FT                   /locus_tag="HMPREF0424_0548"
FT                   /note="conserved domain protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            complement(593098..594030)
FT                   /gene="cysK"
FT                   /locus_tag="HMPREF0424_0549"
FT   CDS_pept        complement(593098..594030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="HMPREF0424_0549"
FT                   /product="cysteine synthase A"
FT                   /EC_number="2.5.1.47"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR01136; match to protein
FT                   family HMM TIGR01139"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14352"
FT                   /db_xref="GOA:D2RAF1"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAF1"
FT                   /protein_id="ADB14352.1"
FT                   /translation="MSNIYKSVQELVGHTPLLELTHIEKEYNLQAKILVKLEYFNPAGS
FT                   VKDRIAKQMIEEAEAAGTIKQGSVIVEPTSGNTGIGLSMIAQTKGYKSIIVMPESMSIE
FT                   RRKLMKAYGSELVLTPAAEGMKGAIAKAKEIVESTPNAWTPGQFTNQANVHAHYNTTGP
FT                   EIWQDTDGNVDMLIAGVGTGGTITGTGTYLKEQNPHLEVIAVEPADSPVLAGGKPGAHK
FT                   IQGIGAGFVPDVLNKNIYNRIVHVTNEDAIENGKLISKKEGVLVGISSGAAIWTAIQEA
FT                   KREENSGKTIVAILPDSGDRYLSTALFED"
FT   gene            594686..595108
FT                   /locus_tag="HMPREF0424_0550"
FT   CDS_pept        594686..595108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0550"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13914"
FT                   /db_xref="GOA:D2RAF2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAF2"
FT                   /protein_id="ADB13914.1"
FT                   /translation="MNLTDVQIKEYKKYNSEDIPKLYDSVGWSAYTDDLAALENGFNNS
FT                   LKILAAYKNDELVGIIRAVGDGYTVVFIQDILVLPEYQRQGIGSALLKAIVDCYPNVRQ
FT                   IQLTTDCTEKTIAFYKSVGFIEFSEIDCCGFIKDRT"
FT   gene            595255..596064
FT                   /locus_tag="HMPREF0424_0551"
FT   CDS_pept        595255..596064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0551"
FT                   /product="phosphorylase, Pnp/Udp family"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13657"
FT                   /db_xref="GOA:D2RAF3"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAF3"
FT                   /protein_id="ADB13657.1"
FT                   /translation="MAEYDLPILEYDSDKSAVIIPNHDNISVQLPSKAVFAFLGDEIDQ
FT                   YALSRKATIVANFESATKVYPIYVLEEKVEKKVKEDANSEVEEETQKICLVQAPVGAPA
FT                   AVQILDWLISYGVREVVSAGSCGSLVDYAENVFLVPYKALRDEGTSYHYLPPSRYVDVS
FT                   ERSRRAILQTLQAHNLPYHEVKTWTTDGFFRETKTKVANRKQEGCAVVEMECSALAACA
FT                   QMREIVWGEILYTADTLHDVENYDERNWGGDSKAYALELCVEAVLRI"
FT   gene            596307..598073
FT                   /locus_tag="HMPREF0424_0552"
FT   CDS_pept        596307..598073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0552"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13928"
FT                   /db_xref="GOA:D2RAF4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAF4"
FT                   /protein_id="ADB13928.1"
FT                   /translation="MNKTDNTANQQSLANQQSSKLHPDVKNYVKLFFKENKLVAFLSMI
FT                   VFISLSMIYTAISWILQIIFDYMAGKGAFSLTTILLLVVSFMLAISLIFALKRSSYPRF
FT                   LEKAMNQYKESVIKKLLQKSYSDFSLANSGTYLSVLTNDCERIQEKYLKKIFDFVQDVL
FT                   MLVSSLALMIYYSPLLTVIALIISVLPMACSILTANGIATREEQVSKSNESYTALTKDV
FT                   LNGVSVIKSFKAEQEVINRYQNQSMELEHTKNLREKTMTTVSALGTISSLGTQLGVMLV
FT                   GAWMVNAHVGVITAGMVLAFTNLMNGVLQPIASLPQMLGEMKGAKKLISKMADYMSNVK
FT                   EDSGEIIDDSIKSVVLRDVSYAYDLDHKVLKNVNLTLQAGKSYAIVGSSGAGKSSLINL
FT                   LMGYYKDYEGSVKLNNHELSNVSKSSLYDKTTLMQQSVFMFDASILDNITLFKPFPNAE
FT                   VNRVIHLAGLDDLIAAKGKDYQCGENGSHLSGGEKQRIAVARSLLKKSEILLVDEATSA
FT                   LDNETSANVTQSILDLQGILRLVVTHRLDANSLKQYDEILVMKSGELIERGSFEELMNQ
FT                   KAYFYSLYTVSM"
FT   gene            598344..598487
FT                   /locus_tag="HMPREF0424_0553"
FT   CDS_pept        598344..598487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0553"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14628"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAF5"
FT                   /protein_id="ADB14628.1"
FT                   /translation="MEQFNQHDSNDIDNYESNEQNQTNLNNDTVNSNPTTLCIVIRKIC
FT                   QK"
FT   gene            598514..599500
FT                   /locus_tag="HMPREF0424_0554"
FT   CDS_pept        598514..599500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0554"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13475"
FT                   /db_xref="GOA:D2RAF6"
FT                   /db_xref="InterPro:IPR021484"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAF6"
FT                   /protein_id="ADB13475.1"
FT                   /translation="MNVKYGSVFTNPEVLDKLARIEQSPQIQGKLNELKEGIKNNSFDP
FT                   IRLIPFIPVVMVLGVLYNYFPNIDYSRYKYYLLIVGVFVVYFAGKFFVNNKVDVDALYS
FT                   DNILTPILNAILPGTVLENSEGIDSSIFDNLLPISSRYYSSKHIIFGDEFKTEFSNMQA
FT                   IHFSRSESGKSVKKTDFIGQVLLINSKTNINGHIRIVPVTGKNFMGQKLNGYYGKKTKE
FT                   ESEVQTESIEFNDSYSIFSTDDFYTKLVLDPSFIELMNNLQKRMRVCIYLDSERIVAAF
FT                   DSGRYLFGAPGKSGVENLSLTREYARFRDVLAEYYEIINVIREKLQK"
FT   gene            599581..600159
FT                   /locus_tag="HMPREF0424_0555"
FT   CDS_pept        599581..600159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0555"
FT                   /product="LemA family protein"
FT                   /note="identified by match to protein family HMM PF04011"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14166"
FT                   /db_xref="GOA:D2RAF7"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAF7"
FT                   /protein_id="ADB14166.1"
FT                   /translation="MGDIMGDVMDKNTVLICVAIVLVVLIVWFIGMLNRLRKYRVIIEE
FT                   SRKNVDIALAKRYDTICQMLKVAQSFAKYEKTTLVDLVSLREGLGSADSSSVIKNQNHA
FT                   IGKIFALAEAYPELKSSEQFLNLQEEINDENEQLAAAKRIVNSNISTLNQNIVTFPVSL
FT                   IASLSGIKQMAFLDEDNLINKKNIDSILS"
FT   gene            600350..600940
FT                   /locus_tag="HMPREF0424_0556"
FT   CDS_pept        600350..600940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13504"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAF8"
FT                   /protein_id="ADB13504.1"
FT                   /translation="MLKDQLRNYIEKKQVLSIDSVIKELGISPSSVYRFIKDESLERVS
FT                   KGVYVNSSLWNDEMNLLSKRTSVAVFSHESALLLHNLTDREPSSLTVTVPSTYNASSLI
FT                   KTGVRVFYIRPDFLGIGKTNLMSLEGNLVPSYDLERTICDILRSRSQIDAQVVFGALKA
FT                   YVKRKDKRLDILSDYAKKFRISKLISQYLGVLL"
FT   gene            600937..601794
FT                   /locus_tag="HMPREF0424_0557"
FT   CDS_pept        600937..601794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0557"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08843"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14359"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAF9"
FT                   /protein_id="ADB14359.1"
FT                   /translation="MRMKDANQLKAKIKNVALQKGVDPRVLMRVYMMERFLDRVSRSRY
FT                   KDNFVLKGGMLISYLVGVNLRTTMDIDTTMQNISLSEDDVRIFISDVISINIDDGVKFT
FT                   LQTLDSIMQESDYPGVRASLIADFDGTKTPVKIDISTGHAITPSAMEAELPLMFSKSIS
FT                   LLTYPIATILAEKLQTILVREEFNTRMRDFYDLHALRVSQGDNVFKKEEIAKAFYATSQ
FT                   TRNTFYLLSNVNEIFDRIKDSEVMRIKWKDYQRKAPWAKSLSWEEIMQDMNFFLMFFHN
FT                   EVVA"
FT   gene            complement(602024..603364)
FT                   /locus_tag="HMPREF0424_0558"
FT   CDS_pept        complement(602024..603364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0558"
FT                   /product="Na+/H+ antiporter family protein"
FT                   /note="identified by match to protein family HMM PF03553;
FT                   match to protein family HMM PF03600; match to protein
FT                   family HMM PF06808"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14451"
FT                   /db_xref="GOA:D2RAG0"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="InterPro:IPR032813"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAG0"
FT                   /protein_id="ADB14451.1"
FT                   /translation="MLSLQILNIIFNPVIVSVVVLCALSLAKLNVLLSMIVACIAGGIA
FT                   GHLPLFGDGNHTIMALLCDGFSTNSQTALAYILLGTFAEAITATGLAQIISKKISKIIG
FT                   MKKYALLAVLTLIACMSQNIVPVHIAYIPILIPPILRVMNKMKLDRRAAACCTAFGLEV
FT                   PYIAIPFGFGLIFQTVIATNLSKNGMKVSVADVSAVNWYLGLAMFASLLFAVFVLYRKP
FT                   REYKTTETDTRAADAVVGPLKKRHYVTILAIIVVVVVQIISKDLSLSSLAGLATMIIFG
FT                   AIKWNDIDKQLTGGVKLMGLIAFVMLIAGGYANVIQATGGVEELVNFGVASMGQNKLVA
FT                   AFVITLIGLLVTMGIGTSFGTVPILAVLFVPLCQSIGFSTPATILLMSSAAALGDAGSP
FT                   ASDTTLGPTAGLNADGQHSHIWDTCVPTFLIFNIPLMVAGIVISQFI"
FT   gene            603898..604674
FT                   /locus_tag="HMPREF0424_0559"
FT   CDS_pept        603898..604674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0559"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13905"
FT                   /db_xref="GOA:D2RAG1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAG1"
FT                   /protein_id="ADB13905.1"
FT                   /translation="MQIMKDSKTLLEAKELGLQIFRRTPFWDVSLKVEPHQIVAISGEH
FT                   GSGKSALLLALSGYMKFTNGTLTIADSTLPNDFKKSRKYVGLGLFNGINEFYKMQTIEE
FT                   ALMSELKLASSSPLFREQYKNDVKNREALRQYAYNLLAQWKVFSPHKTAIGELTPCERM
FT                   RLAIALALLKQPWLLFVDGIETELTSEQRECLLSDIREYVSKNYCSCLVGVLQSELEKQ
FT                   ADQVLRLMPNNEKTENSHTDSQLATSEANGGENNAR"
FT   gene            604664..606742
FT                   /locus_tag="HMPREF0424_0560"
FT   CDS_pept        604664..606742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0560"
FT                   /product="YhgE/Pip domain protein"
FT                   /note="identified by match to protein family HMM PF01061;
FT                   match to protein family HMM TIGR03061; match to protein
FT                   family HMM TIGR03062"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13539"
FT                   /db_xref="GOA:D2RAG2"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAG2"
FT                   /protein_id="ADB13539.1"
FT                   /translation="MHVSTIALAFREINNTMKGKARKLVIGTVALIPLLYGSLYLWAFT
FT                   NPYKTLDTVPVAVVVEDNGAMINGKMRNIGNEIKTRLKNQKDGSEGFQWNFVNSAEANK
FT                   GLKNGNYFMVATIPASFSKCIASAQYDTPTKAKLHVKYDQASNMLASQIGKTAFRTMRT
FT                   EISEAIAQEYWEHMFAKVNSASDSLGAAANGAGALHEGSKSLQGGINKLADGSNKLSQS
FT                   LQKLQGGLGELQKGANTLTEANARSKEGAQYLAQKTQDLANGAQQLSEGTQRLSAATSE
FT                   FYEGAQKLAASSNELEEHVKAGNAETKAQITGLLMQAQNPAVTKEDVLANLQRLAEGLG
FT                   ENSNLLETNLSALSAGADKLSAGSLQIKGGAEALMQGMEKVNVGSDKLVAGTNKLADGL
FT                   AQVSNGSEKLNSGVNEAAQGSAKIVNGSDQLNSGAKKLSDNTPKLVDGTKKLHDGLKDA
FT                   QKSGKVNGIVQKSKMMSAPVSLEEHEYSHVENYGTGFAPYFISIALWVGALMTTFVLRV
FT                   MDRRAILNGMNPLKSALISLTPFVIMGVSQAIILMGVVQGALKFQIDNVGAFYALGILA
FT                   SIVFMAIMQMIMVVFRMPGRIVAIVLLMLQITSSAGTFPVQMTPAFFRAVHPYLPMTYS
FT                   IMGLRQAMSGKNSGEIVSGIGMLVLFGVIAIAITSIAFRMKRTVKMFDLHPVITLDA"
FT   gene            complement(606851..607984)
FT                   /locus_tag="HMPREF0424_0561"
FT   CDS_pept        complement(606851..607984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0561"
FT                   /product="alcohol dehydrogenase, iron-dependent"
FT                   /EC_number="1.1.1.1"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13999"
FT                   /db_xref="GOA:D2RAG3"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAG3"
FT                   /protein_id="ADB13999.1"
FT                   /translation="MKQLSIKPTIHKFENARDFAQEFKLSKGDLVITNQYIWEPYFGDL
FT                   NLDCDVIFQEKYGKGEPSDAMVDAIVSDIHTTPKRVIGIGGGTVLDISKVCALKQTSPL
FT                   EDLVDGKIPAQKGADLILVPTTCGTGSEVTNVAVFSLTRRNTKKGLANDACYATDAVLI
FT                   PELLKSLPDYVFATSSIDALTHSIESALSPIATELTKMFSYKACGLILQSYMRVVKEGS
FT                   SAKSQVVSDLVSASLYAGIAFGNAGCGCVHAMAYPLGGTFHVAHGETNAALLTSVLRYY
FT                   AKHDTKNSTSAENTELSKLFDFMANILECQKADVLDKLDEVLNTILPKHKLHEYGMTED
FT                   MIQSWAASVVKEQQRLLKNSYMHMDEAAIAEVYASTF"
FT   gene            complement(608171..609511)
FT                   /gene="noxE"
FT                   /locus_tag="HMPREF0424_0562"
FT   CDS_pept        complement(608171..609511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="noxE"
FT                   /locus_tag="HMPREF0424_0562"
FT                   /product="NADH oxidase"
FT                   /EC_number="1.6.99.3"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF02852; match to protein
FT                   family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14164"
FT                   /db_xref="GOA:D2RAG4"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAG4"
FT                   /protein_id="ADB14164.1"
FT                   /translation="MTKIIQIGANHAGTACANTILSYPGNELTIYDQNSNISFLGCGMA
FT                   LWIGKQIQSSDGLFYQKPEDFVKKGAKVNLESKVLDIDYAKKEVTVELKDGTVIHDSYD
FT                   KLVLATGSLPNKPRIKGIDLENVQMVKLFQNAQTVIAKLQERDFRNVVVLGGGYIGVEL
FT                   AEAFERLNKNVTLIDMEDHILNGYFDPEFSNNLKQIMENKGIKFELGQTVEEIVGDTEV
FT                   KAVKTSKGTYEADMVICAIGFHPNVALGKDHLKQYANGAFLVDKKQQTSDPDVYAIGDC
FT                   ATIYDNARDRVNYIALATNAVRSGLIAGHNVCGTPVETEGVQGSSAMMIYDYKLVCTGL
FT                   SLTAAQKEGMDVDYVDFEDTQKPAFMEVENPKVKIRIVYKKDTKVIVGCQLASNYDMSA
FT                   AIHLFSLAIQKKVTIKELALCDIFFMPHFNQPYNYITMAAYTALLKG"
FT   gene            609846..610451
FT                   /locus_tag="HMPREF0424_0563"
FT   CDS_pept        609846..610451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0563"
FT                   /product="putative pyroglutamyl-peptidase I"
FT                   /note="identified by match to protein family HMM PF01470"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14319"
FT                   /db_xref="GOA:D2RAG5"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAG5"
FT                   /protein_id="ADB14319.1"
FT                   /translation="MRILITGFTPFDNESINPSWEIAQSVHAPEGVELVRLHIPTEFNK
FT                   GAQEVIEKIEEVHPNAVLSLGQFGGSACFNVEYVGINCRAARIPDNSGYKPWYEPVVQD
FT                   GDVAYKATLPVINIVEALNKAKLPASVSFSAGAYVCNDVLYSVCYYCHTRKLPIKSGFI
FT                   HVPYLPEQVLDKPSTSSMSLADMLRGIEVALQVIADDC"
FT   gene            complement(610514..610957)
FT                   /locus_tag="HMPREF0424_0564"
FT   CDS_pept        complement(610514..610957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0564"
FT                   /product="toxin-antitoxin system, antitoxin component, HicB
FT                   family"
FT                   /note="identified by match to protein family HMM PF05534"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13623"
FT                   /db_xref="GOA:D2RAG6"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAG6"
FT                   /protein_id="ADB13623.1"
FT                   /translation="MTKTNKSSKNISHKNKSKTLTNKRLSYYMSLPYKLEIVKDPDEGG
FT                   FVSYYPDLPGCISSGDSEQEAAANAQDAKHAWFEAALESKINIKEPSYHELNDYSGQFK
FT                   LRLPKELHRQLAEQSQAEGISMNQYCVYLLSQNNAIERVLERA"
FT   gene            611142..611288
FT                   /pseudo
FT                   /locus_tag="HMPREF0424_0565"
FT                   /note="conserved domain protein; this region contains one
FT                   or more premature stops and/or frameshifts"
FT   gene            611663..612529
FT                   /locus_tag="HMPREF0424_0566"
FT   CDS_pept        611663..612529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14209"
FT                   /db_xref="InterPro:IPR021352"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAG7"
FT                   /protein_id="ADB14209.1"
FT                   /translation="MIGYYYCSLSTFLNIIKNKSIYLSDPLKMNDNLEIKWYIDKLNDE
FT                   RNNSNDGFKASGSLYHGMTNRSCLDFTCEELMQILESKGQNSVYICCFSEESDMLSQWK
FT                   GYADDGKGVSIGFNLEKLTKFDNLLFKKVIYTDSVVHDDIESDVECVADTINTVISEQN
FT                   ITKREEKIEVFLHELIPELVKYKNPAFAEEKEIRLIYCDDLKFEKIVNNHDAFTERLSL
FT                   KSLEHDFRIIGNDNITEFVKLNFTPDIIEKICIGPKCLLNKSDVRNITKKLLGIEISTI
FT                   ESKCSYR"
FT   gene            612701..613492
FT                   /locus_tag="HMPREF0424_0567"
FT   CDS_pept        612701..613492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0567"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13984"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAG8"
FT                   /protein_id="ADB13984.1"
FT                   /translation="MLKLAKPPLMLKVWYKSLMFSKRAITIFAAAVVTALTLGTLSACE
FT                   PQGKAVGSTGRAGDIIHDGIDINDIHLLVIGSKLAALDDEVMKHCKTSKLSASYVPLSN
FT                   VVNPNEAAQQAIRAASEQPVSLILIDALDVTGVDDLHNDNNQPNIKENNKLNNSTRNKQ
FT                   NESKAWISALQYVRYAGVPVALINPVKAPKDATLYAATLYFDSDGSGIGKNIHESYLSK
FT                   NSESLNNKSKKSKFERSSLLSIVRAIIDNTPHSREVIINDK"
FT   gene            613482..616082
FT                   /locus_tag="HMPREF0424_0568"
FT   CDS_pept        613482..616082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0568"
FT                   /product="E1-E2 ATPase"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14669"
FT                   /db_xref="GOA:D2RAG9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAG9"
FT                   /protein_id="ADB14669.1"
FT                   /translation="MTNNEQNAMASTEISKNNAIAVLPKVEVSGLSTEEVAQAVSCGDV
FT                   NITSKQTSRSLMDIVRANVFTLFNAIIFTAMVVVLATGSWKDAVFGVVILVNTGIGIVT
FT                   ELKAKRTLDRLSILVASYAMVRRGGKNIEIPHKDIVLGDVLWLRAGEQVPADVEVLESW
FT                   GLEMDESMLTGESATVRKAKGDNVYSGSTAVSGMALTRVTAVGEHSYAAKLAAQAKVYT
FT                   KTISDLSRGINTILKYMTMVVVPLCVLLVWSQMHKVGGFVEAWQTGAWRGAVVSAVAGV
FT                   VGMIPEGLVLLTSLNFAVAAMRLARKQTLVQELESVETLARVDCLNLDKTGTITDGGIA
FT                   FVGVENLDNSGAEISLQTNLQTNQALFDLSNEENPNATGVAIMEGLGSKGVAASQHVSN
FT                   RLPFSSARKWSAVQYVQSSGERATWYMGAPEVLLSAIDYANTNELLAKVNSYAELGERV
FT                   LLLAKVSSDSSSVSSVTETDKTFGDSPTICVNAHPIALVRCSERIRDDARKTLKWFREQ
FT                   GVRCRVISGDNPTTVAAVAAKVGLTGDRKPAAMDARKLPEDINELAKVLENVDVLGRVL
FT                   PHQKKAIVQALHTQGHVVAMTGDGVNDTLALKEADLGVAMGNAAPAAKAVAQVVLVDSR
FT                   FSHLPDVVARGRQVMANMERVAGLFLVKTVYSALISAGVVLLALHFPYLPRHITYIGSL
FT                   TIGIPAFLLALAPNTRRYIPGFLKRVVRFAVPSGFAIAASVLATAVIAPRVLGLNLDDV
FT                   VANNLIASRFIVSNVQALVTTRSICSVIVFVLGILVLASVAKPLRSWRGIMVALFAAAG
FT                   VAGAFIPFTAKFFEIHVPTAGSAFTVMLIAVVLAVILWFVCVSLANLLSKQSKK"
FT   gene            616111..617688
FT                   /locus_tag="HMPREF0424_0569"
FT   CDS_pept        616111..617688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0569"
FT                   /product="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /note="identified by match to protein family HMM PF03313;
FT                   match to protein family HMM PF03315; match to protein
FT                   family HMM TIGR00720"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13979"
FT                   /db_xref="GOA:D2RAH0"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAH0"
FT                   /protein_id="ADB13979.1"
FT                   /translation="MCRRELNDAYNRYVFSILEMFSVGVGPSSSHTVGPMRAACSFVSS
FT                   LKKSGSLANVAHVSVTLYGSLSLTGLGHGTDRACVAGLEGNLPDNVDTDHMLTIRQECK
FT                   KTGTLTLAGEHTIAFDYDKDVIFEKWMRMVVHPNGMRFVATDSDGNKIDEQVWYSIGGG
FT                   FIRQGCADDAMVGLHERVTEQDENNANKNGVSENNSESNSESNNGNSSDNAASSSNQTK
FT                   DSTVPYPFTSCDELINICREKYMSISDVVWQNELALHEGDADYVRNYLLHVWKVMSKCV
FT                   ENGCNSKQPILPGGLDVPRRAPHMYERLAANSDMLRNNRRRSDAALESSDSAWVNLFAL
FT                   AVSEENAGGGRIVTAPTNGSAGIIPAVLQYYWRFVDSANEDGVVRFLLAAGAVGYLFKR
FT                   NASISGAEVGCQGEVGSACSMAAAGLCEVLGGTPEQVENAAEIGIEHHLGLTCDPVGGL
FT                   VQIPCIERNAMAANTAINAVRMAMLGDGSHMVSLDKAIKTMKETGHDMMSKYRETSKGG
FT                   LAVNVVEC"
FT   gene            617969..618376
FT                   /locus_tag="HMPREF0424_0570"
FT   CDS_pept        617969..618376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0570"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
FT                   /note="identified by match to protein family HMM PF00254"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14185"
FT                   /db_xref="GOA:D2RAH1"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAH1"
FT                   /protein_id="ADB14185.1"
FT                   /translation="MAQDMPEVIAEFGTTPTVTFPESEPPAGLKVVELVEGNGPVVRAG
FT                   DTVTVNYHGVVWGSDKPFDSSFARHTPASFGIGVGQVIQGWDRTVPGHNVGSRLLISIP
FT                   PEYGYGSRGIPQAGIGGGDTLVFVVDIISTR"
FT   gene            618448..618927
FT                   /locus_tag="HMPREF0424_0571"
FT   CDS_pept        618448..618927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0571"
FT                   /product="prokaryotic transcription elongation factor,
FT                   GreA/GreB domain protein"
FT                   /note="identified by match to protein family HMM PF01272;
FT                   match to protein family HMM PF03449"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13835"
FT                   /db_xref="GOA:D2RAH2"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAH2"
FT                   /protein_id="ADB13835.1"
FT                   /translation="MAEEKTILLTQEAYDKLKEELAHREGEYREEITERIAAARAEGDL
FT                   SENGGYQAAREEQGKNEGRINELIVKLRNAKILEAPKDGTVGNGSLVTLELAGREMTYV
FT                   LGSRDIAVATDYDVISPESPIGAAIMGAHAGDTVSYAAPNGREISVTIKDSHPLA"
FT   gene            complement(619055..619789)
FT                   /gene="lexA"
FT                   /locus_tag="HMPREF0424_0572"
FT   CDS_pept        complement(619055..619789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /locus_tag="HMPREF0424_0572"
FT                   /product="repressor LexA"
FT                   /EC_number="3.4.21.88"
FT                   /note="identified by match to protein family HMM PF00717;
FT                   match to protein family HMM PF01726; match to protein
FT                   family HMM TIGR00498"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14376"
FT                   /db_xref="GOA:D2RAH3"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAH3"
FT                   /protein_id="ADB14376.1"
FT                   /translation="MNNDGTNNDNNGINASDISAMSLTDRQRNIINAIQNNIKIHGFPP
FT                   SFREIGEAVGLRSPSSVKHQLRTLEDKGILRINANKGRAIEILDNSIVEKNSNNKINKN
FT                   SSRVANISAYESDSVINSRDVPLVGRIAAGAPITAEQHIEDVMRLPERLTGTGNLFMLE
FT                   VHGDSMIDAAICDGDYVVVREQHEAVNGDIVAALLDNEATVKTFRNDHGHVWLIPHNPA
FT                   YSPIDGSHATIMGKVVTVLRKI"
FT   gene            619947..620324
FT                   /locus_tag="HMPREF0424_0573"
FT   CDS_pept        619947..620324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0573"
FT                   /product="LysM domain protein"
FT                   /note="identified by match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13687"
FT                   /db_xref="GOA:D2RAH4"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAH4"
FT                   /protein_id="ADB13687.1"
FT                   /translation="MSTSLIRSGREVRVGMQENTYLIRKRCVSNKHARKTRVFRVTVLL
FT                   MTAITFCTLFMPKTAVSAIPERVVTYTVRPGDTLWNYAATITPKNGDISDNVERLMALN
FT                   HLSSEDLVIGQSINVPLNDAQ"
FT   gene            620361..620486
FT                   /locus_tag="HMPREF0424_0574"
FT   CDS_pept        620361..620486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0574"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14203"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAH5"
FT                   /protein_id="ADB14203.1"
FT                   /translation="MRRENITIFEIETDELSFTENDDVIFSVFYGVFRIMDNKIV"
FT   gene            620557..621012
FT                   /gene="nrdR"
FT                   /locus_tag="HMPREF0424_0575"
FT   CDS_pept        620557..621012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdR"
FT                   /locus_tag="HMPREF0424_0575"
FT                   /product="transcriptional regulator NrdR"
FT                   /note="identified by match to protein family HMM PF03477"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13449"
FT                   /db_xref="GOA:D2RAH6"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAH6"
FT                   /protein_id="ADB13449.1"
FT                   /translation="MHCPFCKNSDTKVIDTRISEDGYSIRRRRECQVCGNRFTTVETTQ
FT                   LLVMKRSGSIEPFDRAKVVAGVSKACQGRPINAEALKTIGMRVEADLRARGLAQVTSEE
FT                   VGKAILKPLRELDEVAYLRFASVYQNFAGLEDFEHAIEDLKRSKTEK"
FT   gene            complement(621074..623350)
FT                   /locus_tag="HMPREF0424_0576"
FT   CDS_pept        complement(621074..623350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14064"
FT                   /db_xref="GOA:D2RAH7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAH7"
FT                   /protein_id="ADB14064.1"
FT                   /translation="MSTYSSQLSEEQQAVDRAYSRLDDLRNTIRARLDAVRASGSHGSP
FT                   TQRTERDSFATMYEDRLTQLRAVEDRLVFGRLDNTEGIRRYIGRIGLLSENHDPILTDW
FT                   RAEAARPFYEATPSHHGDIVMRRHITLRFRDVIGVEDEVLDIHSDEIGKASQQGTLTGE
FT                   GALLASLGSRRTGKMTDIVATIQAEQDRIIRAPLDHTIVVQGGPGTGKTAVALHRAAYL
FT                   LYTHRRKLERSGVLIVGPSSAFLRYIDQVLPSLGETGVVSRTIPDLIPGICATDEDSPY
FT                   AAKLKGMYRMRTVIANAIAARIRVPKNLPTIHVGGFSIPLLKEDIEIAQSDAQRTHQPH
FT                   NQARNTFIKTVLSILKNRYLEKLDYVPDQAELNDITSQLRLDDKLRITLNLAWLPMTGE
FT                   WLIDQLFAKPDKLRTYAPWLSDEDINSLTRPKGSPLTRSDIPLLDEAMELLGPDPKLDA
FT                   QRSAAQAKKLEEQQFAADTLAQAGIGNGIVTADMLLDNLQGDDAGMLARKAASDREWTY
FT                   GHVVVDEAQELTAMDWRMLIRRCPSRSFTIVGDVAQTSALGGTHRWQKNMNSLFGEPNW
FT                   DLYELTINYRNPSEVSEAASKVATDSGLYISTVHAVRSVPDSLVSQTVESQDELDTALA
FT                   ESCTKLFEKFVSDDGSGRIAIITPNSMVSHAKKVVNQALEHALPEKLWNQLNKQNADDC
FT                   QCSVCTAEEVKGLEYDAVIVLQPSQIEQEAASRLTAAANLYVAMTRPTQKLHIIRTADD
FT                   ANFEK"
FT   gene            623692..624648
FT                   /locus_tag="HMPREF0424_0577"
FT   CDS_pept        623692..624648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0577"
FT                   /product="Inosine-uridine preferring nucleoside hydrolase"
FT                   /note="identified by match to protein family HMM PF01156"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14413"
FT                   /db_xref="GOA:D2RAH8"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAH8"
FT                   /protein_id="ADB14413.1"
FT                   /translation="MKKLILDLDTGVDDTLAISYALGSPEVELIGITGTYGNVLMEQGV
FT                   RNALAITDLFGHPEVKVYRGLPHASKKDSFEVLSISAFIHGDNGIGDVVIPDSKREAES
FT                   EPAVDFIIDSVKTYGKDLIYVPTGPMTNIAAALHKAPEIKDEIGKIVLMGGALTIHGNV
FT                   TPWMEANISQDPDAADVLFRSGAPVTMVGLDVTLQTLLTYKETQQWRDLGTKAGKFLAD
FT                   MTDFYIKAYETTAPHLGGCGLHDPLAVAVAVDPTLVTTLPINMQVDVEGPTRGRTIGDV
FT                   TRLNDPVKTMQVAVGVDVPRFLNEFMTRISGLAKIAG"
FT   gene            624779..626182
FT                   /locus_tag="HMPREF0424_0578"
FT   CDS_pept        624779..626182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0578"
FT                   /product="transporter, major facilitator family protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13752"
FT                   /db_xref="GOA:D2RAH9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAH9"
FT                   /protein_id="ADB13752.1"
FT                   /translation="MTEIAKFSAVDPYEDPKTRDKVAIYSLILLLITFILGTLCLQGFN
FT                   LVFDQIGKAVGAPNQASLITSLPIIVLGIVCFIYGSLGDFVSLRRLITIGLVTLFVGSL
FT                   FGFIANFFFTPNLWTVIIARILQTAGEQVAGSSFLVIATKYLRNDLKVIFFGLFTAAYQ
FT                   LSASIGVFAAGALSSIAWQYLFLIPAITILFLPVLVKCLPTKNGIGGKIDKLGFTVFGI
FT                   AVALLTLFFSYKAWGLLLGSIVLFVVFAGYIMKAKNPFVTPAFFKNKRWLSGIVLIFIF
FT                   YFTNYCMPPIYNVIGGALYHMSTEAVSSYLVWAFVVAAVFGTCSGTIIGFIGRKAGIII
FT                   AAVLMILGWVGAAVFINCGFLVLTLCACVYYAGCGLMYSPIVSTVLSALPVEESGRGCG
FT                   MNDLVMNVTASIGISIFSGFFGGNLLKGFSFAGIQGLGAGYSNLLMMGAIVAFIGLVVY
FT                   IARSLMVKE"
FT   gene            complement(626604..627530)
FT                   /locus_tag="HMPREF0424_0579"
FT   CDS_pept        complement(626604..627530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13519"
FT                   /db_xref="GOA:D2RAI0"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAI0"
FT                   /protein_id="ADB13519.1"
FT                   /translation="MVQRRKKHDSIHVNLNSGHNSGAHHNKNNSSLKHKFYSNKILRNI
FT                   IIAVIGIAIIIPVVQWIRWEQTVSNLRNKQEQLVSRFDFNPGNIISDSQFFDDNAMSKD
FT                   EVRNFIRKKGAKCTGKNCLKNAYFNTHTIPADSLCSKYQSVSKESSADIIYKSAKACHI
FT                   SQRVLLTMLQKEQHLVTDTDPSDFQYKSAMGLDCPDDSHCNPRFAGFFKQVIGSARRYR
FT                   YYLLHNDQYNYHPNTINTIQYSPNKSCGSSNVYIENKATALLYIYTPYQPNIESLKAGY
FT                   GEGNSCSAYGNRNFSLIYSAWFGDPRK"
FT   gene            627782..629227
FT                   /locus_tag="HMPREF0424_0580"
FT   CDS_pept        627782..629227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0580"
FT                   /product="transporter, major facilitator family protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14351"
FT                   /db_xref="GOA:D2RAI1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAI1"
FT                   /protein_id="ADB14351.1"
FT                   /translation="MMIGTKRFDCSSVDPYDDPEKRDKVAVRALILLLITFVISTLCLQ
FT                   GFNLVYKQVGIDVKAVDQAPLITGLPGIILGIVCFIYGSLGDFVSLKKLVTIGLTSLFI
FT                   GSVFGFVANSCFEPNLWTVIAARIMQTTGEQVAGSSFLVIATKYLRNDLKVIFFGLFTA
FT                   SYQLSACIGVFSAGLLSSIAWQYLFLIPALTILILPALLHYLPTKNGNGKKIDVVGFTV
FT                   FGFAVASLTLFISYRNLLMLISAIILFIIFGIYISKAKEPFVTPAFFKNIRWLSGIILM
FT                   GIIYFTNYCISPLFNRVGKTLYNMTTSQVASYLVWAFIVAAIFGSCSGLIISRIGRKTG
FT                   LLLAILFILCGWIGIAVLINSGFLAIALCACIYYAGCGMVYSPLASTILSSLPVEESGR
FT                   GCGMNDLVISVSASVGVVIFDGILDKNMLSGNSITGASGISSGFANISLMCAAVALLGI
FT                   IVFTFRNFITKESNAIEVNEDQE"
FT   gene            complement(629382..633467)
FT                   /gene="hrpA"
FT                   /locus_tag="HMPREF0424_0581"
FT   CDS_pept        complement(629382..633467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpA"
FT                   /locus_tag="HMPREF0424_0581"
FT                   /product="ATP-dependent helicase HrpA"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM PF04408; match to protein
FT                   family HMM PF07717; match to protein family HMM TIGR01967"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13997"
FT                   /db_xref="GOA:D2RAI2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010222"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAI2"
FT                   /protein_id="ADB13997.1"
FT                   /translation="MKFDYPAELPICAAHDEIIEAIKSSQVVIVSGQTGSGKTTQIPKM
FT                   VLELGRGGRGKQIVHTQPRRLAARTVAERIANEMEVKLGEEIGYQVRFTDESSPKTKLR
FT                   IVTDGILLAQIQRDPLLTKYDTIIIDEAHERSLNIDFLLGYLTTLLPQRRDLKLIITSA
FT                   TIDSAKFREHFEQALHTKVPVIEVSGRTYPVRVLYEPLGSAPSLMQHVPGFADITMDEE
FT                   TVAESQSNESNRDDITDEDMTSAVTRACAQLVIHSNHEQGARDIMVFASGERDIREFEA
FT                   GLRSYFGTRASDMKRADAIEIVPLFARLSAKDQHRVFEHHSHQRIVIATNVAETSLTVP
FT                   GIRYVVDPGFARISRYSKSAKVQRLPIEPISQASANQRSGRCGRIADGIAIRLYSREDY
FT                   ETRPRFTDPEILRTSLGAVVLHMLSVGVAKTGEDITNFGFIDPPDIKAVSDGFNELNEL
FT                   GAISRKTGFITLTHIGRELSKLPIDIRLGRMIIEAARKTTPNTLAAVLVIVAFLSLQDP
FT                   RERPEEQREEANRLHNRYADETSDFLTALNIWDYIFQADGNMSNNALRKLCKAEFFHFL
FT                   RLKQWKDLVNQLQDLCKELHYKVGEPIPSKRVSLEIRQLPNNQQAAHSLCCSWDSQGIH
FT                   SSMLAGLLSMLGMQVVREPKASDFANLHGSAKIRAMKRAQKMAKNDYQGARGGRFAIFP
FT                   ASSVSKTTPSWVMCTQLVETSRLWARYCAQVDPAWAEPLAKNLTRITYSDAHWSASKGA
FT                   AVAKSKVLLYGLPIVQDRTVQWTRVNPYEARMIMIRQGLVEADVQQRFAHDEFIVNNHN
FT                   VLEDADNQANRTRQISETVNDEDLFTFYDTRIPQEATTIAALAKWWKDNREENPHKLDF
FT                   NPDEVERLQTTQSTDLADYPDHWDTVGTDGQIIRLRLSYVYDPANPLDGVTVHVPLYVL
FT                   SRLTPEEFTWNVPGLLDELIIGMIKSLPKALRVQFVPAPDTAQKIRSWIDEHYDELPGT
FT                   GETESNIKSEWQDFREVFTKAAICVVGAQIHPEVFDEEQISRLSPYLRMTFSVEERKAN
FT                   ENRNKPAGRNKYSNRVKPTILGTDKSLIALQQRFAKEAQESAREVVNFKANKAAQAGNV
FT                   IERADLLHKSGATNLSRAQMVWQSALNMLHLDNKRITSRWLGAESLMLAAAPYSTSNAL
FT                   AEDLQMAAVKRLIADTDNITDDNLLRETVANVSEIYEDTVYDIAHDVIAILKRQAESSK
FT                   AVSGKTDLPLLSVLQSIREHTASLVYGGFIAKTPSDSLPRIERYLHADVIRLTKAKADK
FT                   NRDVRWAWQADEAHKLVVKAQEDAQKIPSGPAHDESQIIAEKLRWMCEEFYVSLWAQEL
FT                   GTAYPISIQRMRKMIGGR"
FT   gene            complement(633530..634228)
FT                   /locus_tag="HMPREF0424_0582"
FT   CDS_pept        complement(633530..634228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0582"
FT                   /product="methyltransferase small domain protein"
FT                   /note="identified by match to protein family HMM PF05175"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13822"
FT                   /db_xref="GOA:D2RAI3"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAI3"
FT                   /protein_id="ADB13822.1"
FT                   /translation="MDSHQQFKQYDKTKSPKSEKTQKISGEQYFSATPSSCDERRTLHV
FT                   TLRNHETVVQVSNGVFSASKLDLGTSVLLKHAPKPPENGKFLDIGCGWGPISIAMGLES
FT                   PEAEIVAVDVNERALELTELNAKNAGLKHIRTSLVDDALKENNTLEFNNFDLIWSNPPI
FT                   RVGKEMLHDILMTWIPRLKVGGAAYLVVQKNLGSDSLIPWLAENLGENYIVEKYASSKG
FT                   YRIIEVIKTK"
FT   gene            634409..635947
FT                   /gene="hflX"
FT                   /locus_tag="HMPREF0424_0583"
FT   CDS_pept        634409..635947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="HMPREF0424_0583"
FT                   /product="GTP-binding protein HflX"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR03156"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14688"
FT                   /db_xref="GOA:D2RAI4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAI4"
FT                   /protein_id="ADB14688.1"
FT                   /translation="MADSNVASGRDDVLNSNDFSSLENDSNNMNEHNLTNNAVLYAHSD
FT                   VLLDTTSDSEKHDEVWQERESRNALKRVAGLGELQDVTEVEYRKLRLERVVLVGVWSSA
FT                   KGTLAQAEESLRELAALAQTAGAVVCDGMLQQRYRPDAATYVGSGKARELAAVVAQHDA
FT                   DTIIVDDDLPPSQRRALEDATKVKVVDRTAVILDIFAQHATSREGKAQVELAQLQYMLP
FT                   RLRGWGAALSRQAGGRAAGDAGIGSRGPGETKIEMDRRAIRNRISKLRHDIANMAPARD
FT                   VKRGSRRRQDIPTVAVVGYTNAGKSSIINRLTGSQELVENALFATLDTAVRRSQTQDGR
FT                   SYTLVDTVGFVRRLPTQLVEAFKSTLEEVGQADVILHVVDGSHPDPISQINAVNEVLAN
FT                   ISGVEDIPQIMALNKSDMMSDAARERFSSLYSDAVIVSAFSGENLQILRNRLEELLPSP
FT                   RVRVDVTLPYEFGGLLSKVRENGVVEKAEYVDSGVELIAWVGPSLAAKLMKVAL"
FT   gene            636091..637053
FT                   /locus_tag="HMPREF0424_0584"
FT   CDS_pept        636091..637053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0584"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /note="identified by match to protein family HMM PF00056;
FT                   match to protein family HMM PF02866; match to protein
FT                   family HMM TIGR01771"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13785"
FT                   /db_xref="GOA:D2RAI5"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAI5"
FT                   /protein_id="ADB13785.1"
FT                   /translation="MVSSQVKPTKLAIIGAGAVGSTLAFAAAQRGVAREIVLEDIAKER
FT                   VEAEVLDMQHGSSFYPAVSIAGSDDVEICRDADMVVITAGARQKPGQTRLELAGATINI
FT                   MKSIIPNVVKVAPNAIYMLITNPVDVVTHVSMKLSGLPANQMFGSGTNLDSARLRFLIA
FT                   QHTGVNVKNVHAYIAGEHGDSEVPLWASATIGGVPMCDWNALPGHEPLDAAKREEIHQE
FT                   VVNAAYKIINGKGATNYAIAMSGVDIVEAVLRDTNRILPVSSLLDDFHGISDVCMSVPT
FT                   LLNRNGVNSRLNTPVSDRELAALKRSAETLRETAAKFGF"
FT   gene            637179..638663
FT                   /locus_tag="HMPREF0424_0585"
FT   CDS_pept        637179..638663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0585"
FT                   /product="ATPase/histidine kinase/DNA gyrase B/HSP90 domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02518;
FT                   match to protein family HMM PF07568; match to protein
FT                   family HMM PF08448"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14522"
FT                   /db_xref="GOA:D2RAI6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR022066"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAI6"
FT                   /protein_id="ADB14522.1"
FT                   /translation="MADFSNILATRPDFNDSDREWLHHLVVDWQVIADLSFADLLLIIQ
FT                   NGDGDYVVAEQCRPSTAITLRTDDLLGKKLDDSLVPELNEAMKSETSFHSSTLRSIGRA
FT                   TVCYVYAPVRHRGKTLGLVMRETNLATRESNGRYETESINAGKTLFDMIPREQFPYRES
FT                   VLNQRHNARVSDGFIVLEDDGIVRYASPNAISCFRRLGGLNTMQGEYLSEFGTRLLHTN
FT                   DNVPESLPLVLTGKADVDCELEANHSIVSMRSLPLWGPNNRVGAVVLCRDVTEVLRREQ
FT                   ELRTKNATISEIHHRVKNNLQAVSALLRLQARKTKSIEVRKELEEAQRRVQTIALVHEG
FT                   LSQTADEIVDFDKVISSLLKMSIELASQNQNIDIDFVGKFGRLAAQDATPLSLVLTELV
FT                   TNAVEHGFEGREKGHIRIAVGRGGDNLNIVVEDDGDGIDSESSHGMAKPSGSGLGTQII
FT                   NTFVTNDFGGTVRWSPRREGGTRVVLDIKLRVSGIE"
FT   gene            638850..639122
FT                   /locus_tag="HMPREF0424_0586"
FT   CDS_pept        638850..639122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0586"
FT                   /product="transcription factor WhiB"
FT                   /note="identified by match to protein family HMM PF02467"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13500"
FT                   /db_xref="GOA:D2RAI7"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAI7"
FT                   /protein_id="ADB13500.1"
FT                   /translation="MSNSFDWRTTAACSDKDPELFFPLGSAGTAVQQLEEAKAVCRSCD
FT                   VATECLKCALETNQDYGVWGGLSEDERRTLKRRAMRARKNQDASL"
FT   gene            complement(639129..640952)
FT                   /locus_tag="HMPREF0424_0587"
FT   CDS_pept        complement(639129..640952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0587"
FT                   /product="FtsK/SpoIIIE family protein"
FT                   /note="identified by match to protein family HMM PF01580"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14336"
FT                   /db_xref="GOA:D2RAI8"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAI8"
FT                   /protein_id="ADB14336.1"
FT                   /translation="MAWMQDNWMMLTMIIPSIMMYIASLIPQIFQYISEKNSVQNVQQN
FT                   QQIQLLNTTQSSNNVTYNQQTVESLPDTITPVSLETLLMRRNAISNTQHHWKEVLQTWL
FT                   KNAGTYDIKNKSNSMKENLNTNIYNYLPNSKTKHLIAPLGISNNGYCYLDLINNGPHAL
FT                   VAGTTGSGKSVLLTTWCLALAFQYGPQQLRFVFMDFKGGATFDILSKLPHTMGNVGDLN
FT                   LKHAIRALKGLELELNRRERLVAHHGCNNIAQVTPAEPSLLIVIDEFHALKDQLPDYMP
FT                   RLIRIASVGRSLGMHIIAGTQNPLAQVSADMKANISINICLRVRDGMQSQELLGTAHAA
FT                   RISPNTPGAAYYNIGEGVEALRCAQSSNPAHLVRAIQLAGRFCHHDHSPELFSKPLPSI
FT                   LSAKQLAEYSNNYKYKNSEQKISQSLRTQEFYTKHIIIGLQDDTIHLYPALLPIHLGNI
FT                   AVIGSRKQGKTTILKIISKTLNLPIYSGKSLYEQNINNIYNENTPIIIDDADELLDPLN
FT                   TKQTAIAFQKRLNSKQCPVIMSTSTSRYLRLPEQAPVRIIFPTGDVGTDTMLGIPSALS
FT                   KSFDIEDYQLPGRCVLITPGSASLTQIVHLE"
FT   gene            complement(641188..642486)
FT                   /locus_tag="HMPREF0424_0588"
FT   CDS_pept        complement(641188..642486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0588"
FT                   /product="cell envelope-like function transcriptional
FT                   attenuator common domain protein"
FT                   /note="identified by match to protein family HMM PF03816;
FT                   match to protein family HMM TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13463"
FT                   /db_xref="GOA:D2RAI9"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAI9"
FT                   /protein_id="ADB13463.1"
FT                   /translation="MNSRLYEDPSEDNINPPIFTPSHNNDSSNSNVPPSFTPKRVKRGK
FT                   IESNALPSQAPSFAPTTQRTRILKSPEQCSSRPVSYTSQLQPRPAPRTSSISQMRIPTT
FT                   INKAVGSTAKILPHKPHRILHAFIAFFVVLAIGVTGFGVYSWNWVDSRINRTTWLTSTP
FT                   STQGKAWLILGSDQREGEEAKEITGFRTDTILVLTKPSNGHSSLISIPRDSLVSLNGEQ
FT                   VKINSVAQAAGNKALTAAIEKITGHRIDHVAEIRFGGLTNVVNAIDGIDLCYNRTVSDK
FT                   FSGLNWTSGCHHVDGNTALAFSRMRYADPESDFGRAARQRMVIAAIMKKALDHNTLLNF
FT                   GKVKKLAETGLASVIFDEKTNPGTLWEMAQAFKEATGPSGISGTVYWTNPDYQVPGVGS
FT                   SVLLDDAKNLDLFNQLASGTHKPGSVGTLAEQQ"
FT   gene            complement(642591..644087)
FT                   /locus_tag="HMPREF0424_0589"
FT   CDS_pept        complement(642591..644087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0589"
FT                   /product="cell envelope-like function transcriptional
FT                   attenuator common domain protein"
FT                   /note="identified by match to protein family HMM PF03816;
FT                   match to protein family HMM TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14322"
FT                   /db_xref="GOA:D2RAJ0"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAJ0"
FT                   /protein_id="ADB14322.1"
FT                   /translation="MTKEMILPQPKRLLIIEKEGTMTTSRYPEGMRYQPGEDWNSTPHH
FT                   SLGYRMINRTRKILCMFVISVLTFFSTIIAAVWLDFSSAVSNRVINVISKDPEANQTLD
FT                   INAGKPVTFLVLGQDSRDGNNQSFTHDGETGDHQSDTTMVVQISADRSYMNIVSIPRDS
FT                   MVNAPACDTTKGHIPARKHVMFNSIFALGYAQGGDLASAASCSLKAVNSLTGLNIHHFI
FT                   VADFSGLSNMIDAVGGVSVCIPTATRDAYTGVNFKQGMQHLNGRLATQYARMRHDTASD
FT                   GSDIMRTTRQQYLIKQLLHQALSKNLFTQTSELYQLAKASLGALNISEGLANPTTLVGL
FT                   ALSMRKLDSSHIYARTTPVIPDPYDPNRVVWSDEANNIWDLMRENKPLSLNHKTNGTNK
FT                   KNANNSSKNTNNQDNEDTDDDNNINENDKLNKTTDPKKMGRVDPKTGLIKNSQGQLIDP
FT                   NTGGIVNPENGTIHNPQTGQYVGFADKYANNVLCAVPRKK"
FT   gene            644347..647748
FT                   /locus_tag="HMPREF0424_0590"
FT   CDS_pept        644347..647748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0590"
FT                   /product="putative ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14598"
FT                   /db_xref="GOA:D2RAJ1"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAJ1"
FT                   /protein_id="ADB14598.1"
FT                   /translation="MDSITAHNLTFEDEVLQVLSSAKDAHPHDVDSSIMAMMCVERDTR
FT                   FYADTLHAVLSQSILPGTLVIVDCASRVKQTMQTNLQIKINSSKLAGAINTRKSLLQNA
FT                   NNIDSNNAIDSDSKYRPNTNRVNNTRVNNSENKSVHIIIIPISYAHSFGDAIEKSLRKI
FT                   LPCAGVSALWLLHDDSRPADFHCLEYLRETWRNTPTASVLGAKQVDWQGNILHNVGMYA
FT                   WRHGVHTLTVDGEPDQEQYDGRGDVYAVSLAGALVTLTAWQTLRGTQPWMTTFGESRDF
FT                   CRRVCLSGGRVVVVPSARIAHRRARLEGIRTRNGDARNHNNSGSKYGVAASLVAKQRYK
FT                   YTDISIFLWPLIWILSLPACFVGALHSLFAKHPYIAWIRLLLPWLAIMQLPRAVFARRR
FT                   VARNTRVPLKRLVPLIADRHQVARWRDRSSAFQAQQHFVLLSPLAKRHLHIRVLRRWSA
FT                   VILASLLLFAVILNLYGSPWREILSGASWNAQQWLPTGADFNQLWNSAIGAWVPDDGFG
FT                   PAIPPAPWLSIWAIASIVVGANPLLAVTLMFFLAAPAMCLSFWALAGVFTRSDTVRVCA
FT                   GICWTMIAIAFGLFARGDLPMLMTMAFLPAAFAFAFHAVGMYVTEDPVRPVKSTQCAAC
FT                   AALCFMVPVAAEPQLVLPLIVIFIASFIMVRSHRIMFALMPIPSIIVLLPTIGSAIRYG
FT                   ESGMWRQLFSSMALPLRSVQGAPRVSDYADVLLHAFNMASPNVEINMPLMSLRTIIMVI
FT                   FAILAVVMAVTSLTLPFALRVSRMMWVVIISGMLLSLIAARVVVASDISGPVAASVLPG
FT                   VALSTVGILSCMCMVAGQAVRRFEPLRTSKESESQIFDNYKTRASRRAAMRRSAAQLLQ
FT                   RIIRIARAVLASSMLTMAVLLGLFAVLSGPATSICANNNELPMVVSDYLRKDDTRRILA
FT                   LRAQSSHDLSISIMRTSKGDAIDESPALRVRQVMFGDSSSNKAIYRASAQLLSHADNGA
FT                   ISTLKQLGIGGIYIVNSSENKQVSHKTSMSIQQLLHPSVQTVSNVNKEATEQLIAHVNA
FT                   SDGTQLVVSSPQGTYCRFDGVPDSKSLSSTSPYYRSRPLAWRVPWIIVSSMVLLLYCIV
FT                   AVPRFGGHAMIERSDDRHEEELDELA"
FT   gene            647735..649321
FT                   /locus_tag="HMPREF0424_0591"
FT   CDS_pept        647735..649321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0591"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14184"
FT                   /db_xref="GOA:D2RAJ2"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAJ2"
FT                   /protein_id="ADB14184.1"
FT                   /translation="MNWHKNPHEGSKHGEVNADVDINRKNKIVSIVSLAIFSAIILIAS
FT                   ACVVALCLPMSHFVDNPNTPSSGVISSVGSTRLQTICPIRLSLPDLTQYGDSEYNESEG
FT                   DLQSSARYGAFGDVYSSSLRNIRDNNDQSITLNSKSTDDDTSAFIANNNVNHDAQVLEG
FT                   HLSRVGSGTGISASMVSWATKGDVKGLSATTCSMPSMKQTFLVPESADGISIRLEAFNA
FT                   ASKSTVVRVRAWSAEHGSNQLNLSTGSASTVPARSHAYFDLAAASPKTSGLYVQVESEQ
FT                   TPIASFVKVVHMSGLSVKGVDIVHELSTQSNTNILSGISEGDQSKLYVWPNKDGNVTLS
FT                   WMNDTGSKEVKNLTLKAHHLQVVDLGKVPEHANALSVSGDVPTQVMMSITKDGKDNQSD
FT                   VAFITPSNVQGSGAIVSPVSANETALYLSSSSDKDTAVRLQGFDLNGVLAATKNVTIPA
FT                   NASLRIPVSEISHDAVMFIAKSHSKVALSARIHKDEIDKAGIAGISWLSAQSLEPQEMK
FT                   VYVKTDNHIVQ"
FT   gene            complement(649398..649826)
FT                   /locus_tag="HMPREF0424_0592"
FT   CDS_pept        complement(649398..649826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13791"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAJ3"
FT                   /protein_id="ADB13791.1"
FT                   /translation="MTGLIWEERHYRNRHGRGLRAPIFGTRLPQYRTASGMFDAMVAAQ
FT                   IRRLNSAWQALTKDVQFAVEDVPPSQPLLWEQNRRILSQAFPASRGMQSRIVLYRLPLC
FT                   THVSSRSELQYAIRDELVQCLAELYGRRPEEIDPDWGL"
FT   gene            649946..650767
FT                   /locus_tag="HMPREF0424_0593"
FT   CDS_pept        649946..650767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0593"
FT                   /product="HAD hydrolase, family IIB"
FT                   /note="identified by match to protein family HMM PF03332;
FT                   match to protein family HMM PF08282; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14629"
FT                   /db_xref="GOA:D2RAJ4"
FT                   /db_xref="InterPro:IPR005002"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAJ4"
FT                   /protein_id="ADB14629.1"
FT                   /translation="MLKPIVHDWNEFNLDLSIAKSSLIAFDLDNTLACSKKPMLKSMAE
FT                   SLSKLIDIIPVAVITGGCLELVKKQILNMLTIGTNLKNIHIMPTNGTSYYRVNNDMSLQ
FT                   SVYEHTIDFKQAQCVIDAIHKCAKNIGVWKEPGDPMLWGEQIENRGSQITFSALGQLAP
FT                   IEYKKTWDPSGCLKAQLAQSISQALPNFAVRAGGDTSIDIYRRGDDKAQALRMLSQYCD
FT                   VNIEKITFIGDRMYPGGNDYPTAFTGALIIKVSNPSDTLELCNKVLNILEI"
FT   gene            650859..651752
FT                   /locus_tag="HMPREF0424_0595"
FT   CDS_pept        650859..651752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14516"
FT                   /db_xref="GOA:D2RAJ5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAJ5"
FT                   /protein_id="ADB14516.1"
FT                   /translation="MVGRRKVINHQNKKKYRSVTSHGGLACHASVPCGVCENKDVDFIN
FT                   WRFASWKNVAIALFNLFLPRACAGCDTPDYILCENCKKALQCWKRAPFARTVCGYRYAC
FT                   GSYSTVVRRSILLWKDHFDIACDKIFGELIGDLVVEVISKFLRSHSCYISEKPIFVIPV
FT                   PSSKHSSRHRGRKHMLPVANCVAKRLCNSGIRAYVLDIVSMDARITAKSVQTFGFRGRS
FT                   NRISKAFSIDFKELRKQKFENQREYKAIVLDDIVTTGSTMNSCVSTLQNSGITVLACFS
FT                   LACVCNKDNRTANYKC"
FT   gene            complement(651749..652924)
FT                   /locus_tag="HMPREF0424_0594"
FT   CDS_pept        complement(651749..652924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0594"
FT                   /product="ATPase/histidine kinase/DNA gyrase B/HSP90 domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13644"
FT                   /db_xref="GOA:D2RAJ6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAJ6"
FT                   /protein_id="ADB13644.1"
FT                   /translation="MVLENKIDNANSEQYKNTKQRNLLNKNSNAQLKNKSKMRFTNSSV
FT                   KHNYPNRPVGFFSSLKIELSAIIVFATAIAFVMAWFLLKTGLNGWIAMPLTLIVALGIT
FT                   YIFSRGLTAPLRQMKNAAEAMADGDYSVRVAVENRRDEVGKLTLAFNEMAEELEHADQM
FT                   RRELIANVSHELRTPVSALQAMLENLADGVVDPTPSNMEAILNQTHRLADLITFLLDLS
FT                   RVEAGAESLNITSFNFTDFIDEIIEPLEIADSGHNHNIEVQINDEIELTGDQARLSQLF
FT                   TNIISNALKHSDDGTRVLISAHINHSQNSVICNVVNFGEQIPQEDRADIFRRFVKGNQR
FT                   IGTESGGTGLGLSIARWAAQLHHGTVKVVDDKRGPNFEIALPLNYSNTIAN"
FT   gene            complement(653012..653764)
FT                   /locus_tag="HMPREF0424_0596"
FT   CDS_pept        complement(653012..653764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0596"
FT                   /product="response regulator receiver domain protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14602"
FT                   /db_xref="GOA:D2RAJ7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAJ7"
FT                   /protein_id="ADB14602.1"
FT                   /translation="MLNAPSASVNARTILVVEDEPDLATAIAQRITAQGWRARVATDGA
FT                   SAVRAAEQLKPDLIIMDIMLPIMDGIEATRRIISKMPVPILMLTARDAEADKIVGLSAG
FT                   ADDYMTKPFSPRELIARCAALLRRVERASQIAKTMEHERTINFGSLIIRPRQRLVTLND
FT                   KEVHFTPTEFDLLATLARHPHTVFKREKLLEEVWDWPDASGTRTVDSHIKSLRHKIGSE
FT                   WIRTVHGIGYAFEPPISDYDKVLQSQVS"
FT   gene            complement(653781..656066)
FT                   /gene="glgB"
FT                   /locus_tag="HMPREF0424_0597"
FT   CDS_pept        complement(653781..656066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgB"
FT                   /locus_tag="HMPREF0424_0597"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM PF02806; match to protein
FT                   family HMM PF02922; match to protein family HMM TIGR01515"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13584"
FT                   /db_xref="GOA:D2RAJ8"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAJ8"
FT                   /protein_id="ADB13584.1"
FT                   /translation="MIVSMSTVTNINEDAVAVPVRQDVLAAVSNAEYYNPHEVLGGHLG
FT                   TGKGADTVTVRVLRPMAKKVVILTKNGEYEAKHEYNGIFTAVIPAVKHTKTKSWSVPSY
FT                   RVYTVEIDGSESTDDDPYRYLPQVGELDMYLFGEGRHERLWEALGAHVKTITDSWGLIS
FT                   PETGKMVKKVTGTAFSVWAPNARAVRVVGNFNYWNGRRHAMRSLGSSGIWELFIPGVTA
FT                   GEVYKYEILTQSGNWIMKADPMERSHEVPPNTGSVVVDSEFKWHDTDWMDERAKTDAHN
FT                   GPISIYEVQANSWNRDLGNYRELADHLVDYVQREGFTHVEFMPLTQYPFSGSWGYQVTG
FT                   YYAVDSRLGSPDDFKYLVDKLHKAGIGVIMDWVPAHFPKDDFALGRFDGTALYEDPDPM
FT                   RGEHPDWGTYIFNFGRHEVRNFLVANACFWLDEYHVDALRVDAVSSMLYLDYSREAGQW
FT                   RPNIYGGRENLEAIDFIKEANATAYKNNPGIMMIAEESTAYQGVTAPTDMGGLGFGLKW
FT                   NMGWMHDTLQYLKEEPINRRWHHNEITFSMVYAYSEHYVLPLSHDEVVYGKGSLLGKMP
FT                   GDEWQQFAGLRALLAYQWSHPGKNLLFMGGEIGQSSEWNFNTSLNWNELQWPFHQGVQK
FT                   LVADLNTLYKSSRAFWSQDFTPDGFQWLTSDDSDHNTLSYMRIGDDGEEIVVVVNFSGQ
FT                   AWQDYQVALPKDGQWEEILTTDDAKYCGSNIHNGTFTATAAEYHSRPYSARITVPALGA
FT                   VFLKPVQH"
FT   gene            656189..656785
FT                   /locus_tag="HMPREF0424_0598"
FT   CDS_pept        656189..656785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0598"
FT                   /product="CarD-like protein"
FT                   /note="identified by match to protein family HMM PF02559"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13448"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAJ9"
FT                   /protein_id="ADB13448.1"
FT                   /translation="MEYQVGDMVVYPRHGAARVEEISERTVKGVTRQYLRLVVLSSDGL
FT                   EINVPVDNVKKVGVRDIVGAQEVAKVFEILRTPIVEKEMNWSRRYKLNVEKIATGDVNN
FT                   IAEVVRDLSQRDVDEHGLSAGEKRMLARARSILISEIALSEKIDEIEAERLLDVNLGYK
FT                   EPQEGDENHHTVAPEEPASRTLALLEERSKKSKKK"
FT   gene            complement(656999..658051)
FT                   /locus_tag="HMPREF0424_0599"
FT   CDS_pept        complement(656999..658051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0599"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF01297"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14311"
FT                   /db_xref="GOA:D2RAK0"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAK0"
FT                   /protein_id="ADB14311.1"
FT                   /translation="MRTVLCAVKKFGKTAITCLIASAVILGFAACGKTEEKPKEKPKAA
FT                   TNISVVSTVDTWGSLAQEIGGSDVKVESVMTGSDTDISSFKPSSKDLKNMQNAQVLVTN
FT                   GAGYDDWANKVHPAKAEVLSAAGTVGALNGDNPYLWFSHDARDAMASAMADTFSKVLPS
FT                   KKQAFSKRLAQWQEKEKKLTTYLSDFSKENGNAKYASTSPILFWLMSDANLKDSSPKEY
FT                   VDAVNNNNEPEHSSVEEFQKLIEGRKIDVLISDSQQGNDVLNLLSGIAGRSYTSTVRVS
FT                   ELMPKYAEQLDKWIMKICDDLHNAVKATKDMRKDIDDKEPQKKPITEKPHVAKNTNPKN
FT                   SNQGQQDPGK"
FT   gene            658173..659057
FT                   /gene="folD"
FT                   /locus_tag="HMPREF0424_0600"
FT   CDS_pept        658173..659057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="HMPREF0424_0600"
FT                   /product="tetrahydrofolate dehydrogenase/cyclohydrolase,
FT                   NAD(P)-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00763;
FT                   match to protein family HMM PF02882"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13636"
FT                   /db_xref="GOA:D2RAK1"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAK1"
FT                   /protein_id="ADB13636.1"
FT                   /translation="MTIVLDGKALASKIKKDLAARVAILHKKGINPGLGTLLVGSDPGS
FT                   LKYVAGKHRDCEEVGINSIRCDLPEDATEDEILAALQKLNNDPLCTGFIVQLPLPKGID
FT                   AQKVISSIDPAKDCDGMHPYNLGELVTHISGNITTPLPCTPRGILALLDEYGIELSGKE
FT                   VCVLGRGITVGRTIGLLLTRRGVDATVTLCHTHTRNVQEIMRRSDVIIAAMGCAGFVKP
FT                   EDIKPGVVLVDVGVSRVFDEEAGRYRVKGDVDSACREIAGAYSPNPGGVGPMTRAMLLA
FT                   NVVDMAERAANCK"
FT   gene            659204..660706
FT                   /gene="rpsA"
FT                   /locus_tag="HMPREF0424_0601"
FT   CDS_pept        659204..660706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="HMPREF0424_0601"
FT                   /product="30S ribosomal protein S1"
FT                   /note="identified by match to protein family HMM PF00575"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13901"
FT                   /db_xref="GOA:D2RAK2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAK2"
FT                   /protein_id="ADB13901.1"
FT                   /translation="MAENNNEVAKVAINDIGTEEDFIKAVDSTIKNFDDGDLVEGTVVK
FT                   IDHDEVLLDIGYKTEGVIPSRELSIKKDVDPDDVVEVGDTIEALVVTKEDKEGRLILSK
FT                   KRAQYERAWGDIEKIKDADGIVEGTVIEAVKGGLIVDIGLRGFLPASLVEMRRVRDLSP
FT                   YIGQKIKAKILELDKNRNNVVLSRRQFLEETQSEVRETFLSQLKKGQIREGVVSSIVNF
FT                   GAFVDLGGVDGLIHVSELSWKHIDHPSEVVKVGDKVTVEVLDVDLDRERISLSLKATQE
FT                   DPWQRFARTHVPGQVVKGKVTKIVQFGVFISVEDGIEGLVHISELANRHVENPETVVKG
FT                   GEEVFVKVIDVDLDRRRISLSLKQATEAVDPNSEDFDPALYGMPAEYDAEGNYKYPEGF
FT                   DPNTNEWMVGYEQQREEWEAQYAAAHQLWEEHKAFAAKELAAAAESAAADGQSEEAEKK
FT                   PAKEEKKEEVASNYSSEATSEGALADSDQLAALREQLLNEKK"
FT   gene            660957..661286
FT                   /locus_tag="HMPREF0424_0602"
FT   CDS_pept        660957..661286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0602"
FT                   /product="TM2 domain protein"
FT                   /note="identified by match to protein family HMM PF05154"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13800"
FT                   /db_xref="GOA:D2RAK3"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAK3"
FT                   /protein_id="ADB13800.1"
FT                   /translation="MNTLENNQQNAQFPSYDGNSEENTKATLVSSRKKIVAGLLAIFLG
FT                   TLGIHNFYLGFKGKAIAQLLISVLSFGFLLIITGIWALVEGILILCSKPGSKWHKDADG
FT                   AELKD"
FT   gene            661357..661476
FT                   /locus_tag="HMPREF0424_0603"
FT   CDS_pept        661357..661476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0603"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14643"
FT                   /db_xref="GOA:D2RAK4"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAK4"
FT                   /protein_id="ADB14643.1"
FT                   /translation="MTMMRIAVKGGIAAGKSTVVNHLRSLGAFAIDYDVLARE"
FT   gene            661697..662269
FT                   /locus_tag="HMPREF0424_0604"
FT   CDS_pept        661697..662269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0604"
FT                   /product="TM2 domain protein"
FT                   /note="identified by match to protein family HMM PF05154"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13954"
FT                   /db_xref="GOA:D2RAK5"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAK5"
FT                   /protein_id="ADB13954.1"
FT                   /translation="MIIVSDLDNQTGDYSGSDGQTQYGQPQYNDQSQQYNQAQPQYNNQ
FT                   SQYGAQHQYNAQPQYGQTQYDQNSYAQPQYNAQPQYGQYSQSTPQYNQASSYSNYGSNY
FT                   SSNTYRSSRNKIAAGLLAIFLGALGVHNFYLGFKGKAVAQLLISILSFGLLAFVSGIWA
FT                   FIEGICILCSQPGSKWHKDADGAELQD"
FT   gene            662339..663043
FT                   /gene="coaE"
FT                   /locus_tag="HMPREF0424_0605"
FT   CDS_pept        662339..663043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="HMPREF0424_0605"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="identified by match to protein family HMM PF01121;
FT                   match to protein family HMM TIGR00152"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14153"
FT                   /db_xref="GOA:D2RAK6"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAK6"
FT                   /protein_id="ADB14153.1"
FT                   /translation="MTMMRIAVTGGIAAGKSTVVNHLRSLGAFVIDYDVLSREVVKPGG
FT                   YVFQQIVSIFGENVVLNDGSLNREFIAKHVFGYSDESCANRKKLELLIHPAIYDCAKLL
FT                   ESKYESEYISKISKENRNVLDSINSVIVHDIPLLAQVIDSIPFSFDHIITVEAPQEIRV
FT                   KRMISERNMTEDQALARINSQLPSKMRKNIADFVVDSTKPMESMLNSVDNTLKSWLCDA
FT                   NNKSAEMTKLGK"
FT   gene            663064..665178
FT                   /gene="uvrB"
FT                   /locus_tag="HMPREF0424_0606"
FT   CDS_pept        663064..665178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="HMPREF0424_0606"
FT                   /product="excinuclease ABC, B subunit"
FT                   /EC_number="3.1.25.-"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM PF02151; match to protein
FT                   family HMM PF04851; match to protein family HMM TIGR00631"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14078"
FT                   /db_xref="GOA:D2RAK7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAK7"
FT                   /protein_id="ADB14078.1"
FT                   /translation="MSNKIQRTNKPFVVKAPYKPSGDQPQAIDELANRIENGENDVVLM
FT                   GATGTGKTATTAWLIERLQRPTLIIEPNKTLAAQLCAEFRELMPDNAVSYFVSYYDYYQ
FT                   PEAYIPQTDTYIEKDSNINDDVERLRHAATANLLTRRDCVVVATVSCIYGLGTPEEYAE
FT                   RMLMLSVGEQLERDDLLRQFVSMQYKRNDIAFTRGTFRVRGDTVEIIPVYEELAVRIEF
FT                   FGDEIDRITMLHPLTGEVIRQESSVHIFPASHYIAGPERMERALEAIEKERDERVAQLK
FT                   KQNKLLEAQRLEMRTTYDLEMLRQVGVCPGVENYSRHFDGRDAGTPPHTLLDFFPDDFL
FT                   LVLDESHVTVPQIGAMYEGDASRKRTLVEHGFRLPSAMDNRPLKWKEFLEHVGQTVYLS
FT                   ATPGDYELGLSDGVVEQIIRPTGLLDPKIEVRPVEGQVDDLLAEIKERVAKDERVLVTT
FT                   LTKKMAEDLTDYFLELGIKVEYLHSDVDTLRRVELLRELREGKIDVIVGINLLREGLDL
FT                   PEVSLVAILDADKEGFLRSYRSLIQTIGRAARNVSGTVLMYADTVTDAMSKAISETERR
FT                   REKQIAYNKAHGIDPKPLRKKISDVNDMLAKEDVDTQTLLAGGYRNANKAGNSHYGVPK
FT                   EPNLGQQSKEKRMANVSELPQDDIMSLIKNLSEQMHVAAEQLQFELAARLRDEIRDLKK
FT                   ELRQISDAQS"
FT   gene            665414..666853
FT                   /gene="pyk"
FT                   /locus_tag="HMPREF0424_0607"
FT   CDS_pept        665414..666853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyk"
FT                   /locus_tag="HMPREF0424_0607"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="identified by match to protein family HMM PF00224;
FT                   match to protein family HMM PF02887; match to protein
FT                   family HMM TIGR01064"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14409"
FT                   /db_xref="GOA:D2RAK8"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAK8"
FT                   /protein_id="ADB14409.1"
FT                   /translation="MRKAKIVDTIGPATESLEGITKLVEAGMDVARLNRSHGTPEDHLR
FT                   VYNNVRAASKSTGRNVAALVDLQGPKIRCGWFKKNAEGEDKVYLEEGQEFIITTDDVEG
FT                   DEHRTSTTFKGLPGDCHAGDPILIDDGKVRLEVTKVEGNDVHTKVIVAGPVSSHKGINL
FT                   PGVAVSLPALTEKDEADLRWAIRTGADIIAMSFVRFATDIDRAHEIMDEEGRRIPIVAK
FT                   IEKPQAVENLEEIVKTFDGIMVARGDMAVEMPLEEVPLVTKRCIELSRRYAKPVIVATE
FT                   VLGTMVNSPVPTRAEASDCANAVLDGADATMTSNETAVGKYPDVTVKTMSRISQYATEH
FT                   GYDRIPAVELDMSSTGAVSSAAVDLADKLNAKAIVAYTQTGRTVHRISRERPTAPIFGL
FT                   TNNEHTYRWLALSWGTEGFLIDEDYHDMNRHDLMIFTDKVLREAGKVSDGDQIVILSTA
FT                   QGERQAGRTDSIYVHTVGACD"
FT   gene            667086..667159
FT                   /locus_tag="HMPREF0424_1377"
FT   tRNA            667086..667159
FT                   /locus_tag="HMPREF0424_1377"
FT                   /product="tRNA-Leu"
FT   gene            667296..668951
FT                   /locus_tag="HMPREF0424_0609"
FT   CDS_pept        667296..668951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0609"
FT                   /product="alpha amylase, catalytic domain protein"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM PF02806"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13796"
FT                   /db_xref="GOA:D2RAK9"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031319"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAK9"
FT                   /protein_id="ADB13796.1"
FT                   /translation="MIHSAQLQVSERKKSNYACELIDNYKRNVMCSFTAIAAVATVLMC
FT                   IFAIVPNSSAFASTKSTDGLPPKGVIVTAFQQNWKSIAKECKQTYGPEGVSYVQVSPPQ
FT                   DHIKGTAWWTSYQPVSYNLNSKLGTEDEFKNMITTCKAAGVGIVVDAVINHTTGDGNKD
FT                   TVGVGDSKYDAANQSYPDAGYTKDDFHQIDKDIYTYKDAQVVWNYRLVGLLDLDTSKPH
FT                   VQKILGNYFAKLLKMGVAGFRVDAAKHMCPEDVKGIKEAAAKAAGTKPENIWWMQETIG
FT                   FPEQDPKIQPDQYVGTGEVDEFEYSYRLRNYFYGSIENLSHITDQLIPNKKAAIFVTNW
FT                   DTERDNSTRVLTYKDGAKYELANAFMLAYPYGTPNIYSGYKFTQRDDGAPGATDTHIPD
FT                   VKCGKNSKWQCAQRWTSIRGMIGFYNAVKGTKVTQWQDDNDNNIAFSRENKGFLAINNT
FT                   DKPKNVSYKTDLPDGEYCNVYASRKCFSTVTVNGGKVETTIPAYSAIALHVKAVEHFGS
FT                   TSTFSTVTMIVIVFAVLLIELALILRKNKAGSNK"
FT   gene            669211..674877
FT                   /gene="pulA"
FT                   /locus_tag="HMPREF0424_0610"
FT   CDS_pept        669211..674877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulA"
FT                   /locus_tag="HMPREF0424_0610"
FT                   /product="pullulanase, type I"
FT                   /EC_number="3.2.1.41"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM PF02806; match to protein
FT                   family HMM PF02922; match to protein family HMM PF03423;
FT                   match to protein family HMM TIGR02104"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14280"
FT                   /db_xref="GOA:D2RAL0"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR005085"
FT                   /db_xref="InterPro:IPR005323"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR011840"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031319"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAL0"
FT                   /protein_id="ADB14280.1"
FT                   /translation="MVAIVASVAMLVTGFAVTISANAVTSGESSNSKETSSNVTLKGKG
FT                   VIVTAFQQNWKSIAQECTKTYGPEGVKYVQISPSQDHIKGKAWWTSYQPVSYKLDSKLG
FT                   TEAEFKDMIKTCKAAKVGIIADAVINHMAGADNKDTVGVGGSKYDVSTQTFEDAGYKKD
FT                   DFHQDNRNIEHYNIAEEVWNRRLVGLLDLDTSKPHVQQVLGKYFADLLKLGVAGFRVDA
FT                   VKHISPEDMSGIKASAIKQYNEGIDDSKKINDIWWMQETIGNPSEAQQIQPAAHLNEGE
FT                   VNEFGYSYQLMQSFKGSLMKASKPLNKVQDGMVKSDKAAIFVTNWDTERGNSVLTYKDG
FT                   RRYALANAFMLAWPYGTPNVYSGYKFDKNDDGAPGATETSVPEVTCDANSKWQCTQRWT
FT                   SIRGMIGFYNAVQGAKVTDWQDDGDNNIAFSREKKGFLAINNSLDEKEVSYKTDLPDGE
FT                   YCNVYAAGDCSKTVKVEKGEVRTKIGAREAVALHVNATKANPPAGSAADTSDPQYGEEK
FT                   PDAGMPEDPTTTIYFKPDEKFNGKKVYVHYGIGSSWTQAPGDEMQKACDSWYKKTIRTN
FT                   GKVYEAVFNDGKGYWYHEGDNNNFKIPAHTDSYVAQDHKGSVGVNPCPVAYNPKTTVRI
FT                   HYKPKAGDTRDIGVYLWGKDKDGKDLPGAWHKFNGTDKFGKVFETTVDGSFENKSLSFI
FT                   TTTKDWNKDGGDRAIENCASGLAEAWVTGGSDTTQFAAPDNLKKKPKELKVTVHYRRNA
FT                   GDYEGWNMWTWNDGTGGTARYFTSHDDYGKVATFTAKNDAGIDSVGFKVRKSTPINAWD
FT                   QQDPSNRSIPNNAIKLDANNPNKGSAEVWLMQDDMTVYLNATMPQLTAHVMSADIAGLK
FT                   KLVVKVSGDVSSVKDSDVTLLDTSENPSKKVEIASAKANGSEITIETKNDLNIKHKYEL
FT                   SIKGLATGIKLSASSKTGASVIRTDEFDKKYAYNGDDLGAVYSASSTTFKLWAPTATEV
FT                   KLITYKSTAEKAEKDKETAMKAEDRGVWSVKLEGDKANTAYAYEVHFADGTVNVSADPY
FT                   AKAAVVNGERSVVLADKDAGSAGNRMPKFTNPSDATIAEMDVRDFSINPNSGISDAHRG
FT                   KYLGVVEEGTKTKDKQNVSGFDYLKSLGVTHVQIMPMYDFGSVNETGDLSYGKQGAQNW
FT                   GYDPQNYNVPEGSYSTNPANPTTRVQEAKQMIAGLHKAGLRVIMDVVYNHVYNAQNHSF
FT                   NKTVPGYYFRYKDGALNGNSGCGNDTASERQMMRKYILDSVKYWATHYNLDGFRFDLMG
FT                   LIDLKTMQEVRAELNKIDPSIIVLGEGWDMNELLPKSESTIQPNAYKIPGVAFFNDSFR
FT                   DSVKGSVFAAKGTGFVNGNTDKGVKALLEHNLLGCQFGTSSTVKCWNGNAETHFADAGQ
FT                   IVQYVEAHDNLSLYDKLKVSAPNDTEDVRLKRVKLANSMILLSRGMPFIQLGQEFLRTK
FT                   NGNDNSYNAGDKDNALDWNRAADKSDSVNYFKGLLKLRKSIKSLRDFDYATINKNMKMI
FT                   DGTPDGVIAYTLNDADKQYVVVFNANNAETQVKIPAGKYSALVANGKVNDTAQDATVAD
FT                   DGTYKIAPVSTAVLLSKDKESKPIPPDAKPGDEPGKQPENPSEPGEKPGEKPKPGEDPS
FT                   KKPEKPKPDQPGTKPAPAPKPGEHQQVPAPAPKPTPSESSEQSKPSKPSVPSEKPVPSE
FT                   KTEKPAPADSAKPAPAKPAESAPVPVAPETVQQLNPELKGTLSVGNNNVATAGVVNSVR
FT                   INVVNKEFTERLQRDGVVYAYAYIYSSPRLLKGADGSKFVTVRMVNGKPQFDAQFPAGY
FT                   TGKHTVVLVDEKGNQVAWTEITVVNNAVKKNVHALSSTGSSVAQIAFIIAILLPVAGAF
FT                   LIKVRRSKHLSCNY"
FT   gene            675547..676173
FT                   /locus_tag="HMPREF0424_0611"
FT   CDS_pept        675547..676173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13758"
FT                   /db_xref="GOA:D2RAL1"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAL1"
FT                   /protein_id="ADB13758.1"
FT                   /translation="MAQEINETVKEAYNNGANATTDAAAAMMQNVKVKNHALDITSLVL
FT                   VAVLFAAGCILDFTVAKSLSIGNIQPEFVIASFCLSILLVRPKIYQGAIIGALAATLIQ
FT                   FNTSIPFLEYACDIPAAIIMTAILIGYIRVFPKDAARKVSVFPFIATFITTVISGCIFA
FT                   LIAAFFILHSPNMVMVMLPIILGTAVFNAVVVEVLYAPIRLVLHK"
FT   gene            676317..676898
FT                   /locus_tag="HMPREF0424_0612"
FT   CDS_pept        676317..676898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14118"
FT                   /db_xref="GOA:D2RAL2"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAL2"
FT                   /protein_id="ADB14118.1"
FT                   /translation="MNQEISEHADSMINAVSIKKHALDITSLVLVAVLFAAGCILDFTA
FT                   AKALSIGNIKPNFLIASFCLAILLVRPNVIQGAIIGALAATLMQFNASIPGLNYVCDIP
FT                   AAIVMTLMIMAYVRVFPKDAARKFSIFPLIATFITTVVSGLIFASTASFFVLHSPKTIF
FT                   VMLPIIFGTAVFNAVVVEVLYTPIRLVLHK"
FT   gene            677118..679001
FT                   /locus_tag="HMPREF0424_0613"
FT   CDS_pept        677118..679001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0613"
FT                   /product="cobalt ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF02463"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13599"
FT                   /db_xref="GOA:D2RAL3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAL3"
FT                   /protein_id="ADB13599.1"
FT                   /translation="MPLLELKDVSFKYVNRNKDDSLDSSKAQDSTFALKDVSLSVESGE
FT                   FVGIIGPSGSGKTTLASLFSGAIPHHYSGELLGSVKIAGQDTNNLALTNIACLVGSVIQ
FT                   DIDAQMVAANVEDEILFGLENFGVAHSEIPSRIDEALQIVGISDLRNRDLDTLSGGQKQ
FT                   KVAIAAILALKPKVMVLDEPTCALDPVSSKMIFSILKDLNKNFGITVVVIEQKVALLSE
FT                   YCKRLVVLSNGILSLDLPVSQALKNMDLLYSIGINYPRTTHLVNDLQRENICSKSDLPV
FT                   SVEDTVNTIVNTINSEKSLTSHVDSHSEFDNRECDSNKSALACDFSHESQVSTQSYAQN
FT                   KSKNDSPCLSLKNVSFLYQSGVSALKNVSFEAYAGELVTLVGRNGAGKTTITKIINGLL
FT                   KPTEGNVTIDGVDTKSLRISQIAKYVSTLFQNPDRQLCKETVLEEVTLSCILIGQNEDE
FT                   AKAHAMEIIDELELDSEASPFMLSRGQRQMVALAATVVTNPKILLLDEPTCGLDYKECM
FT                   RIMQVVERLRKNGCCVIMVCHDMEVVLDYATRLITINDGKLIIDGSAYDVFEKPEVCSA
FT                   AALYPPLLCSVSQGLVAHGFNKCNGLYVREELVEALRGEKITKQTVQNQQN"
FT   gene            679061..679834
FT                   /locus_tag="HMPREF0424_0614"
FT   CDS_pept        679061..679834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0614"
FT                   /product="cobalt transport protein"
FT                   /note="identified by match to protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13919"
FT                   /db_xref="GOA:D2RAL4"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAL4"
FT                   /protein_id="ADB13919.1"
FT                   /translation="MKTRLLTYQPGNTFLHRTNPIAKLILATSVVISVFIAKQYSALIA
FT                   LAAIIFIGMAFTRVVKTLSGLIKAMLIISCVMFLLQTVIAQSGNYIFLWFTLHGIDIGA
FT                   KAALRLFCFAFPLVTVLTVTKLNDLANAVVQYLHIPYCYAFTVTTAVRFVPIFAQEMSQ
FT                   ITEAQMARGVEYDSKNPFKKLKLMMPLIVPLLVSSVRKADSSALAAEERGFYLRTRKSS
FT                   YYKYPFGWRGFLSLVISALIIALPICTSIFLPNLV"
FT   gene            679889..680974
FT                   /gene="menA"
FT                   /locus_tag="HMPREF0424_0615"
FT   CDS_pept        679889..680974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="HMPREF0424_0615"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /EC_number="2.5.-.-"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR00751"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14676"
FT                   /db_xref="GOA:D2RAL5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAL5"
FT                   /protein_id="ADB14676.1"
FT                   /translation="MKSVKIWLKGARIYTLPIGLVPVVMAFAVSFRMIRFSYFEEPVMH
FT                   LEQCFIQFFLCCMVAAFIQIAVNYANDYCDGLNGLDENRSLRALSSNNSKPLCDVSWRL
FT                   ANAGISAKSVLKAVIISAFISCIFGLIIVLRTGIYWFILLGIACLAAAWFYAGGKHPYG
FT                   YKGWGEVSAFVFFGPVPFIGSLCAITYGIGIPETSIFINNRQRILACVLISCIPGAYSA
FT                   CLMMVNNLRDIKSDKEHGKITAMVRIGERNGRRLCAAMSIVSAVLLIAYSILIIVLPSA
FT                   VPSIWRFYSVEVFLSFSAIVCNASWHLFFAAFQWLLLLVIVIKAYRFTKCVLIGDYKNA
FT                   FPMCVAQAILGALAVLLSAII"
FT   gene            681246..681995
FT                   /locus_tag="HMPREF0424_0616"
FT   CDS_pept        681246..681995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0616"
FT                   /product="response regulator receiver domain protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF03861"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14217"
FT                   /db_xref="GOA:D2RAL6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAL6"
FT                   /protein_id="ADB14217.1"
FT                   /translation="MPEVLTDDELRKAADDEAVQREAKEKKANHIRTVVVAEDESVNRM
FT                   DLVAMLEDNGYQVIGQAANGQEAIELTRENHPDVVCMDVKMPVMDGITAAATICDENIA
FT                   PVVMLTAFSQSDLVKQATGAGAMAYVTKPYEESKLLPALEVAMGRFSEINDLLDSVERA
FT                   ENKLHDAEDQLKKTEEKLKKAEDTLEERKLVDRAKGLLMDKAGFSEQGAFRWIQKTSMD
FT                   QRIPKKRLAMAIIAKYSDDKVESSSEN"
FT   gene            682074..685151
FT                   /gene="polA"
FT                   /locus_tag="HMPREF0424_0617"
FT   CDS_pept        682074..685151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="HMPREF0424_0617"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00476;
FT                   match to protein family HMM PF01367; match to protein
FT                   family HMM PF02739; match to protein family HMM TIGR00593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13621"
FT                   /db_xref="GOA:D2RAL7"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAL7"
FT                   /protein_id="ADB13621.1"
FT                   /translation="MNTDIVEEHSSELKNEKGTLLVVDGHSLAFRAFFAISADNFSTRS
FT                   GQATNSIWGFITMLSQVVKKEKPDRLAIAFDVKGGTFRNTMLPQYKGTRDAAPQELLSQ
FT                   LPIIQQMLKALGVTYIEKPGYEGDDVIGTLAVMGSNAGYRTLVLSGDRDAFQLIDDNIT
FT                   VLYPGQHFKDLKEMDKNAVYEKYHVTPKQYPDLAALRGETADNIPGVPGVGDGYAAKWI
FT                   NQFGSLENIIEHSNEISGKKGEALRENIDQVRLNRKVNALVCDLDLGVTVDDLCFGDVD
FT                   AAKLGILLSQLEFGELKKRKILKTFSNGMQQSIENNMRIMFSSTYEGDANDDKLAQSAQ
FT                   SNIDAENFQEMLAGIDLHHVKTVEDFIDWENSVSSLLYTKIKKDSKNTEDTFDQVSSEE
FT                   ENFEELNSEKIINNSRKCAEPILKNQEVVIYAHECNKNSKHHFELIADCLIILIANKAA
FT                   ILYTTDLQSSDQALLEMLRKFLQKNSSITVLHDYKKHLGLLKSLKLFDSNNSFGTPLLD
FT                   TRLASYLLEPDFRAETLENMAEHYLDIQSVEDNLGENEAKQGELDLLIDNEVSSSEEET
FT                   NEKQTQAREAKFLKTALLIRLLALHFASTLDDRKQTGLMTDLEMPISRVLRGMEDVGAA
FT                   VDMQRLSGMLKQFSADAEFAQNMAWKVAGSSVNLQSPKQLQQILFEHFGLKPTRRTKNG
FT                   SYTTNAEALQAMYVKLDPEEPASQFLGALLKHRETNKLKQIVQSLIDAAHYDDRRIHTT
FT                   FEQTIAATGRLSSADPNLQNIPNRNAAGREIRAAFIPGEEFEYLMSCDYSQVELRIMAH
FT                   ASHDKTLIEAFRSGVDFHKYVASLVYKIPVEQVTPDQRSHVKAMSYGLAYGLSTYGLAK
FT                   QLSISPAEAEMLKNKYFDTFGNVHDYLESLVSKAKELGYTETMFGRRRYFPQLSSNNRA
FT                   SREAAERGALNAPIQGTAADIMKLAMLRVDLGLREAKVRSRVILQIHDELILEISHGEQ
FT                   AQVENIVRKAMENAVHLDVPLSVSTGVGVDWQLAAH"
FT   gene            685173..686057
FT                   /locus_tag="HMPREF0424_0618"
FT   CDS_pept        685173..686057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0618"
FT                   /product="dinuclear metal center protein, YbgI family"
FT                   /note="identified by match to protein family HMM PF01784;
FT                   match to protein family HMM TIGR00486"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13833"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAL8"
FT                   /protein_id="ADB13833.1"
FT                   /translation="MIRLSKVIEAIETLYPLSFAEEWDEPGLIVGDLNSQIQRIVCVSD
FT                   STISAVDRALSMGANLLVTHHPLFFKAVHGVSNETVRGEIVQRLISNNCALWVGHTNAD
FT                   VAWRGVAHAAAEYFGLHNLRPIVVSKQIDSAGRNIGLGRIGVLDVPISLRDFAQNVFNV
FT                   LPHTKVGVQVAGNLDAKVSTVAVLPGSGESLLDEVRREKVDVYVTSDLRHHPALDAIER
FT                   AKYESKLRLSSGEDYIQHTYPMIINTSHSAIESLWFTYAINDIADCIEEMYGERPEVAW
FT                   LGEACDPWNYVIN"
FT   gene            686139..688268
FT                   /gene="glgX"
FT                   /locus_tag="HMPREF0424_0619"
FT   CDS_pept        686139..688268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgX"
FT                   /locus_tag="HMPREF0424_0619"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /EC_number="3.2.1.-"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM PF02922; match to protein
FT                   family HMM TIGR02100"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14520"
FT                   /db_xref="GOA:D2RAL9"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAL9"
FT                   /protein_id="ADB14520.1"
FT                   /translation="MHIRPGSMYPLGANYDGAGVNFALFSEVAKRVELCLFDEHDNETR
FT                   IDMTEQNSYVWHNYVSGIQPGQRYGYRVHGPYDPSHGLWCNPHKLLLDPYAKAIEGNID
FT                   GDESLFSYWFDNPDDISAMNTLDSADHTMKAAVINPYFDWGNDQHPMIPYHDSVIYEAH
FT                   VRGMTNLDKRVPPDIRGTYAGLAHPSVISYLRKLGVTAIELMPIHQFVNDSFLQNKGLS
FT                   NYWGYNTIGFFAPQNSYSSSGQRGEQVNEFKSMVKAYHAAGMEVILDVVYNHTAEGNDR
FT                   GPTLSFRGIDNRAYYRLVDNDQRHYFDTTGTGNSLLMRSPKALRLITDSLRYWVTEMHV
FT                   DGFRFDLAATLARQFQEVDKLSAFFDIIEQDPIISSVKLIAEPWDIGVGGYQVGGFPPS
FT                   WSEWNGRYRDCVRDFWRSQPSTLPEFASRLMGSSDLYEQNGRKPVASVNFITAHDGFTM
FT                   NDLVSYNEKHNEANKEGNCDGANDNRSWNCGVEGPTNIHDVNELRERQIRNLFSTLLMS
FT                   QGIPMICAGDEVMRTQKGNNNAYCQDNAISWISWDYNETQRDMFDFVSKLIHLRLKHPV
FT                   LHRRRFFTGRSAGDDVSDIPQVEWLDHNGTVMDMEDWSNTHALSVMIYLNGSDIPETDW
FT                   YGTRMVDNDFILIFNAHYEPITFTLPDKRYGEKWKLIVDTYNPKGPELLYEAGFNIVAQ
FT                   SRSFLLLMSEHKPEH"
FT   gene            complement(688375..689478)
FT                   /locus_tag="HMPREF0424_0620"
FT   CDS_pept        complement(688375..689478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13988"
FT                   /db_xref="GOA:D2RAM0"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAM0"
FT                   /protein_id="ADB13988.1"
FT                   /translation="MGRFQRTEAMGLISFIVCAACGMIIMRMYMVTMPAFWQISQRLFL
FT                   TASTIVSLCSVGAFIVGYLRTNKKVISHHLIRVAKHAFEITALSTIYGATMFLMSFALL
FT                   SIINSIIGRAAMNSYLPVLCSALSGIVGYATLIQAELLEAKTVASLLPLFVISGAATAG
FT                   LTTDDPYWYNNNFSQLGDRTTFAASMFNATLVLSGICIIITSYFAITEFVATQHEMLQH
FT                   NSQKLIKYFKMRTTVMAALLILGGISFIGIGTFRYTPHPFLHDLCARGVTGLICTMLVC
FT                   LPWLAPKLSRTFYIASDLAVILTAWAGNQWIHGNNTLTNVEALSCLLFLGWIIVFSRQV
FT                   AAMQSDRLQSKINQALVLNRSSKAQIE"
FT   gene            689664..689737
FT                   /locus_tag="HMPREF0424_1378"
FT   tRNA            689664..689737
FT                   /locus_tag="HMPREF0424_1378"
FT                   /product="tRNA-Pro"
FT   gene            689796..691181
FT                   /gene="aroA"
FT                   /locus_tag="HMPREF0424_0622"
FT   CDS_pept        689796..691181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="HMPREF0424_0622"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="identified by match to protein family HMM PF00275;
FT                   match to protein family HMM TIGR01356"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14644"
FT                   /db_xref="GOA:D2RAM1"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAM1"
FT                   /protein_id="ADB14644.1"
FT                   /translation="MLIDSIHSMSDINDIADCTTPWKAPYANHQLKAYIEVPGSKSLSN
FT                   RYLILAALGTKSVVLQGLLRSRDTELMINALSTFGVRCESLNEDGTKLRVIPPEDGIFR
FT                   VPDNAEVYCGLAGTVMRFVAALALFANKAVRFDGDKQAYARPMKPVLDGLEQLGARVKY
FT                   HEEEGFLPFTITPPSVEFKINNFSEKIVQIDSSSSSQFISALLLIGSRIPGGLELKHIG
FT                   DTLPSMPHIRMTMDDICKAGGIVNMTSNAMWHVKESKINLANVVTIEPDLSNAAPFLGA
FT                   SLIAGGSVSIPNWPFSSTQPGGLLPGILETMCAKVSFEKTSDDAGIMHVESDGAIKAIP
FT                   YLDLSAAGEIAPSIAAILAFADGPSELHGIAHLRGHETNRLQALVNELNRVGIGAKELE
FT                   DGIRIEPSNHMHGEVMETYADHRMATFAAMLGLRIENIRIKNISTTRKTIPDFPGMWHK
FT                   MLE"
FT   gene            complement(691262..692491)
FT                   /gene="ackA"
FT                   /locus_tag="HMPREF0424_0623"
FT   CDS_pept        complement(691262..692491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="HMPREF0424_0623"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="identified by match to protein family HMM PF00871;
FT                   match to protein family HMM TIGR00016"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13959"
FT                   /db_xref="GOA:D2RAM2"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAM2"
FT                   /protein_id="ADB13959.1"
FT                   /translation="MAKTVLVINSGSSSIKYQLVDLESGEGIASGIVEKIGEPVDGHYK
FT                   HVFNGEKHEFDEPVHDHEQGLKRVLGFFEEYGPKLSESGIVAVGHRVVQGGLTFPKPAL
FT                   VNEKTINKVKDLAVLAPLHNGPEAVGAEVMTELLPDVPQIMVFDSSFFHDLPQVAATYA
FT                   LNKEIADRYHIRRYGAHGTSHEYIGSVVPSVIGKPAEGLKQIVLHIGNGASASAQISGK
FT                   PVETSMGLTPLEGLMMGGRTGDIDPAVVFHLIRNAHMNVDELDTLFNKRSGMMGMTGHG
FT                   DLRDIHKLIAEGDENAKLALGVYVHRIVGYIGNYTAQMGGVDVITFTAGVGENDEIVRA
FT                   RVCEKLEPFGVKLDKEKNLVRSKEPRVISTPDSSVIIAVIPTNEELAIARKAAAIAEAG
FT                   EDSYGNKFKH"
FT   gene            complement(692643..694349)
FT                   /gene="pta"
FT                   /locus_tag="HMPREF0424_0624"
FT   CDS_pept        complement(692643..694349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="HMPREF0424_0624"
FT                   /product="phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /note="identified by match to protein family HMM PF01515;
FT                   match to protein family HMM TIGR00651"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14673"
FT                   /db_xref="GOA:D2RAM3"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAM3"
FT                   /protein_id="ADB14673.1"
FT                   /translation="MSHINVTIIGNEDMYGRNAVAFGITHILSNNYSTTVFRPCAQPND
FT                   TFTKQLLGIANTSTKLEQVIATTPEIVRTNKDTVRGDIVARYNELLQATSAQASIIVSS
FT                   DANPAYDPELFSFDATVAADLASPVFLTVSAQGRNSQQILQTIDSANACVLKSCTQVLG
FT                   VFVTNCDPELGAELMRDYSSRNYANSNDEASRVSQTPLWVLPPIDEETKNSSLETFVNC
FT                   VRENDVLNALHQPFKVPTTPYAFQYSLLGKAKENKKTIVLPEGEEDRILKAANYLLERD
FT                   IVNLIIIGERESILARAEELNLNSLCKASFQSMHDEAMLSHMITKLCELRAKKGMTEKQ
FT                   AREQLTDASYFGTMLVVLGQADGLVSGSVNSTANTVRPALQVIKTKPGSKLVSGAFLMC
FT                   FKDHVSVFADCAINPNPSAEQLADIAIQSAHTAETFGLNPKVGMLSYSTLGSGKGPDVD
FT                   TVEEATRIAKEKAPDLAIVGSIQFDAAWSPTVAAAKAKNNSIAGHVNVFVFPDLCAGNI
FT                   AYKAVQRSSGALAVGPILQGLNKPVNDLSRGALVQDIINTVALTALEAQSE"
FT   gene            complement(694637..697132)
FT                   /gene="xfp"
FT                   /locus_tag="HMPREF0424_0625"
FT   CDS_pept        complement(694637..697132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xfp"
FT                   /locus_tag="HMPREF0424_0625"
FT                   /product="D-xylulose 5-phosphate/D-fructose 6-phosphate
FT                   phosphoketolase"
FT                   /note="identified by match to protein family HMM PF03894;
FT                   match to protein family HMM PF09363; match to protein
FT                   family HMM PF09364"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13558"
FT                   /db_xref="GOA:D2RAM4"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR023962"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAM4"
FT                   /protein_id="ADB13558.1"
FT                   /translation="MSTGVHMTSPVIGTPWKKLNAPVSEAAIEGVDKYWRVANYLAIGQ
FT                   IYLRSNPLMKEPFTREDVKHRLVGHWGTTPGLNFLIGHINRFIADHQQNTVIIMGPGHG
FT                   GPAGTAQSYLDGTYTEYYPKITKDEAGLQKFFRQFSYPGGIPSHFAPETPGSIHEGGEL
FT                   GYALSHAYGAVMNNPSLFVPAIVGDGEAETGPLATGWQSNKLVNPRTDGIVLPILHLNG
FT                   YKIANPTILSRISDEELHEFFHGMGYEPYEFVAGFDDEDHMSIHRRFADMFETIFDEIC
FT                   DIKAEAQTNDVTRPYYPMIIFRTPKGWTCPKFIDGKKTEGSWRAHQVPLASARDTEAHF
FT                   EVLKNWMKSYKPEELFDEKGAVKEDVLSFMPKGELRIGENPNANGGRIREDLKLPKLDD
FT                   YEVKEVKEFGHGWGQLEATRRLGVYTRDIIKNNPDSFRIFGPDETASNRLQAAYEVTNK
FT                   QWDAGYLSGLVDEHMAVTGQVTEQLSEHQMEGFLEGYLLTGRHGIWSSYESFVHVIDSM
FT                   LNQHAKWLEATVREIPWRKPISSVNLLVSSHVWRQDHNGFSHQDPGVTSVLLNKTFNND
FT                   HVIGIYFPVDSNMLLAVAEKAYKSTNMINAIFAGKQPAATWLTLDEAREELEKGAAEWK
FT                   WASNAKNNDEVQVVLAGVGDVPQQELMAAADKLNKLGVKFKVVNVVDLLKLQSAKENNE
FT                   ALTDEEFTELFTADKPVLFAYHSYAHDVRGLIYDRPNHDNFNVHGYKEQGSTTTPYDMV
FT                   RVNDMDRYELTAEALRMVDAAKYADEIKELEDFRLEAFQYAVDKGLDHPDYTDWVWPGV
FT                   KTDKPGAVTATAATAGDNE"
FT   gene            697516..699078
FT                   /gene="guaA"
FT                   /locus_tag="HMPREF0424_0626"
FT   CDS_pept        697516..699078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="HMPREF0424_0626"
FT                   /product="GMP synthase (glutamine-hydrolyzing) domain
FT                   protein"
FT                   /EC_number="6.3.5.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00958; match to protein
FT                   family HMM TIGR00884; match to protein family HMM
FT                   TIGR00888"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13620"
FT                   /db_xref="GOA:D2RAM5"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAM5"
FT                   /protein_id="ADB13620.1"
FT                   /translation="MAKGPVLVVDFGAQYAQLIARRVREANVYSELVPHSMPVDEMLAK
FT                   DPQAIILSGGPASVYEPGAPDIDPKIFEAGVPVLGICYGFQVMAHELGGDVDKAALGEY
FT                   GKTAATIDDSEGLLSGSPSAQNTWMSHGVAVKRAPEGFTVLAHTEGAPVAAMQDESRKL
FT                   YGVQWHPEVKHTPLGQELISTFLHKCAGLNNNWNPSNIIEDQVAKIRAEVGNAQVICGL
FT                   SGGVDSAVAAALVHKAIGNQLTCVFVDHGLLRKGEVEQVKHDFVEATGIKLIAVDAEDD
FT                   FLNALKGVSEPERKRKIIGEKFIRTFEKAQRQVIEEAGKTGAEVKFLVQGTLYPDVVES
FT                   GGGDGAANIKSHHNVGGLPKDLKFKLIEPLRTLFKDEVRAIGTELGLPDEIVWRQPFPG
FT                   PGLGIRIVGEITRERLAVLREADAIAREELSKAGLDRDIWQCPVVLLADVHSVGVQGDE
FT                   RTYGSPIVLRPVSSEDAMTADWSRVPYDVLANISTRITNECRQINRVVLDVTSKPPATI
FT                   EWE"
FT   gene            699665..699874
FT                   /locus_tag="HMPREF0424_0627"
FT   CDS_pept        699665..699874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14365"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAM6"
FT                   /protein_id="ADB14365.1"
FT                   /translation="MRIILFRHLKWLLSNATNNINQIAKTTNTTGVIYKKDIDYMREKI
FT                   EKLAKEIWQIHSPLLNKLKESSGD"
FT   gene            700078..700563
FT                   /locus_tag="HMPREF0424_0628"
FT   CDS_pept        700078..700563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0628"
FT                   /product="copper transport repressor, CopY/TcrY family"
FT                   /note="identified by match to protein family HMM PF03965;
FT                   match to protein family HMM TIGR02698"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13802"
FT                   /db_xref="GOA:D2RAM7"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR014071"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAM7"
FT                   /protein_id="ADB13802.1"
FT                   /translation="MFTSVNDEVERKMSTIELNTYITDAEWEVMRVVWANERVTSKKVI
FT                   SVLQEKMDWTHSTIKTILGRLVEKGVLNTEQEGRKFIYTANIEEKEAVRDYAEDIFNRI
FT                   CKKKVGNVIGNIIEDHVLSFDDIDRLERILEMKKAFAVEEVDCNCPEGQCECHLHHH"
FT   gene            700583..702679
FT                   /locus_tag="HMPREF0424_0629"
FT   CDS_pept        700583..702679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0629"
FT                   /product="copper-exporting ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01511; match to protein family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14468"
FT                   /db_xref="GOA:D2RAM8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAM8"
FT                   /protein_id="ADB14468.1"
FT                   /translation="MNNNNKHSSHSHHNHGDMDHSKHEHVSTDEHGDHNNQHQEHHAGH
FT                   DHSGHSGHDHHHHGNFKELFLKSLPLGIIIMLLSPMAGFDLPFQFTFPYSDIVVAILST
FT                   ILIIYGGRPFYQGAVDEFKQKEPGMMALVSLGLSVSYLYSIYTVIASYVTGEQIMDFFF
FT                   EFASLLLIMLLGHWIEMKAIGEAGDAQAELAKLVPKDAHVVLEDDSIETRPVADLKVGD
FT                   LIRVQAGENVPADGTIERGESRLNEALLTGESKAVKKGPGDEVIGGSTNGEGVLYIKVN
FT                   ETGDQSFISQVQTLISQAQSQPSRAENIAQKVAGWLFYIAVIVALIAFVVWTLIADIPT
FT                   AVKFAITTLVIACPHALGLAIPLVTARSTSLGASRGLLVKDRESLEIAQDADVMILDKT
FT                   GTLTTGEFKVLDVELFNEKYTKEEIISLLAGIEGGSSHPIAQSIISFAEQQDIRPVSFD
FT                   SIDVISGAGVEGKANGHQYQLISQKEYGRNLDIDIPKGATLSVLVENDDAIGAVALGDE
FT                   LKATSKELIKALKNNNIEPIMATGDNEKAAQGAAEDLEIEYRSNQSPQDKYELVKTLKE
FT                   EGKKVIMVGDGVNDAPSLALADVGIAVGAGTQVALDSADVILTQSDPGDIESFIELAHK
FT                   TTRKMKQNLFWGAGYNFIAIPLAAGILAPFGFTLSPAVGAILMSVSTVIVAINAILLKL
FT                   DPKK"
FT   gene            complement(702981..703334)
FT                   /pseudo
FT                   /locus_tag="HMPREF0424_0630"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(703258..703380)
FT                   /pseudo
FT                   /locus_tag="HMPREF0424_0631"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(703722..703862)
FT                   /pseudo
FT                   /locus_tag="HMPREF0424_0632"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            704689..706077
FT                   /locus_tag="HMPREF0424_0633"
FT   CDS_pept        704689..706077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0633"
FT                   /product="putative sugar-specific permease, SgaT/UlaA"
FT                   /note="identified by match to protein family HMM PF04215"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14590"
FT                   /db_xref="GOA:D2RAM9"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAM9"
FT                   /protein_id="ADB14590.1"
FT                   /translation="MDGILSVLLDIFRQPSVIVALISFIGLAVQRKKFSDILQGSIRTL
FT                   VGFLVLAAGSGVITEALNPFGKMFQYAFHVQGVVPNNEAIIGTVLLKYGSESALIFFFG
FT                   MIVNIILSITSRFKFIYLTGHVAFYMASMLAVIFNVAGFSMWEVLLWGSIAQGLFTTIS
FT                   PALVQPFMKKASGKDDVALGHPAGTGVALGALIAKLTASKKRPSKSTEDIKFPAALGFL
FT                   RDTTVLITLSMAVIYIVVALFAGSSYVETHLSNSQNFIVFVMLKAATFAAGVYIILAGV
FT                   QIVLDEIVPAFKGISEKLVKNARPALDAPMTFGFAPNAVLIGFLASFFGGLLGMTLMAI
FT                   LGTTIIIPGIVAHFMAGGAAGVFGNGQGGIRGCLTASFINGLFITFLPLFLLPVLGDLG
FT                   SANSTYSDADYGVFGVILGHANIVGGRTVLISVILIALILFYSVSILMNKRDSNNFEKV
FT                   EEIK"
FT   gene            706292..707023
FT                   /gene="frlR"
FT                   /locus_tag="HMPREF0424_0634"
FT   CDS_pept        706292..707023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frlR"
FT                   /locus_tag="HMPREF0424_0634"
FT                   /product="HTH-type transcriptional regulator FrlR"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14315"
FT                   /db_xref="GOA:D2RAN0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAN0"
FT                   /protein_id="ADB14315.1"
FT                   /translation="MVEGVPKYIAVRDNLRARIDSMEANEQLPPEIELCKQYNVSRITL
FT                   RHAVDNLITEGLLVREQGRGTFRASSIIPSYSQEVISDRAQGFYEQTYSNDAKIRIKVI
FT                   ENDVIHDEDAAARLGLDPVDELICLKRLRYVDDVLSRYSVLYLPASRFPKILTHDFSDE
FT                   SLSDFLLKAYAVQLVENEVSVHIENLCDRLAAVLNLEVGTPAITAYSTVKDKFGTIIAF
FT                   GASVYAPNSGEIRFHLHSNAA"
FT   gene            complement(707115..707205)
FT                   /locus_tag="HMPREF0424_1379"
FT   tRNA            complement(707115..707205)
FT                   /locus_tag="HMPREF0424_1379"
FT                   /product="tRNA-Leu"
FT   gene            complement(707320..709266)
FT                   /locus_tag="HMPREF0424_0636"
FT   CDS_pept        complement(707320..709266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0636"
FT                   /product="succinate dehydrogenase or fumarate reductase,
FT                   flavoprotein subunit"
FT                   /note="identified by match to protein family HMM PF00890;
FT                   match to protein family HMM PF01266; match to protein
FT                   family HMM PF02910"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13494"
FT                   /db_xref="GOA:D2RAN1"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAN1"
FT                   /protein_id="ADB13494.1"
FT                   /translation="MQSSEYYDVIIVGAGAAGLSAALGLIKSEEYACMKKEGKTPSILV
FT                   ISKVPALRSHTGSAEGGIAASLGNVEHDKWQWHYYDTVHGGDWLSDQDAAKLLAKEAPK
FT                   TVIQLEHDGVAFSRTQNGYINQRRFGGHTANFGKNPIERAAFAADRIGHQILHSLWQQC
FT                   VSENIVFAEDCYVTDVAINDQTMSVEGIVAFDLSAGDLRAIKSRFLLLATGGSGRLFAT
FT                   TSNSWDLTGDGMALALKAGLQLEDCEFIQFHPTGLAHTGILLSEAARAEGGVLRNSNGE
FT                   AFMKKYDEAHADLAPRDVVSRAIAQEIREGRGVNDSTTTQQSNSHNDCVWLDMTHISRE
FT                   NMLEYLPQVTETIEKYAHLDPTCDLVPIRPTAHYTMGGIPITLDGKVYRWQNNNQTIVY
FT                   GLYAAGECSCVGVHGANRLGGNSLLDACLFGNRAGATIAKELKNLNKDDETNSNKTNET
FT                   NETNKTFSNNTALQVLYKQRNNELNQLMETSAKQATDFTNNSYNDESSQIEEDNPYKLF
FT                   ADLGKIMENAVAISCDEQSIKKALNDIQEFIDPKIQSLHIHSNNLVFNQEITAIWEIKN
FT                   MSLLAKAALQSSLARHESRGAFFRRDYPKHDISSLPQHSFIDFDGNLAKKSVNIIDFKQ
FT                   DSKGDFYTENSII"
FT   gene            complement(709307..710851)
FT                   /gene="dprA"
FT                   /locus_tag="HMPREF0424_0637"
FT   CDS_pept        complement(709307..710851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dprA"
FT                   /locus_tag="HMPREF0424_0637"
FT                   /product="DNA protecting protein DprA"
FT                   /note="identified by match to protein family HMM PF02481;
FT                   match to protein family HMM TIGR00732"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14233"
FT                   /db_xref="GOA:D2RAN2"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAN2"
FT                   /protein_id="ADB14233.1"
FT                   /translation="MNTKSINNTDNTKETISTSSDFSSPDEETISRAILTFCLEGADAI
FT                   MYTLLLGSKSAKEIVSLLKTIVKNYTKQQSACSAQQMQLPIISEVADQENDANSKTFTS
FT                   RKRNKNQELVSTMLSFIKKHKELALLENYFKKGLTAWGYHNNNAPKSLEVLHNSISTWC
FT                   VRLLHLPTWNSESLCQWFTCGGKQWIIAPHSKYWPKQLQDLAFQSHFSPPLCLWGVGNP
FT                   QTLTQCHNPLAIVGSRSCTDYGRELAYQFAYDCASKGHTVISGGAYGIDAAAHWGALDA
FT                   QDIDENKPTGKTIAVFAGGLNHMGPRCNYQLFEQIIAKGGVCISELCPDTTPVGHRFLL
FT                   RNRIIAALASKIIVAQARLQSGALNTATWATDLNRELYAIPGDINQPNNAGCNKLIHDS
FT                   QAIILCSTQDIDILFPQSHHYFAYSQPKPEKLSIDYKNYDNTQKLIIDAITTCKRKHEL
FT                   ANVDRIYEIIKTSYKEKQLDYIPSIAEISGKIALLELEGIIVQNKENLTLSQQKVA"
FT   gene            complement(710848..712491)
FT                   /locus_tag="HMPREF0424_0638"
FT   CDS_pept        complement(710848..712491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0638"
FT                   /product="Mg chelatase-like protein"
FT                   /note="identified by match to protein family HMM PF01078;
FT                   match to protein family HMM PF07728; match to protein
FT                   family HMM TIGR00368"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13705"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAN3"
FT                   /protein_id="ADB13705.1"
FT                   /translation="MHIGNATSIGLIGLKAFTIQLQAFISGNMPNFSIIGLPDTSLSEA
FT                   RERVKSAHFALHCKWPEGRVTVNLSPASMPKSGASYDLAIAASILSAEKYIPLTELENT
FT                   IILGELNLDGTVLPIQGILPIALYAKKMHFKRMIIPQENLAEAQLVDGIESIGIHHILD
FT                   LVTQLHGSLSEESLKLIEEDPAYKHMQVLERNGNYNNGEEDYNPSIHEESTSPLQIEPK
FT                   HEIGDMSEVIGQEHTKWALQVAAAGGHHVMMIGPPGSGKTMLASRIPSIMCPLNEQEQL
FT                   EVASIRSLCGTLPYYGISNIPPFEAPHHTASAASLIGGGTGVAKPGIITRAHCGVLFMD
FT                   EAPEFSPRVLQTLREPLESGHIAISRSKGTTLYPAKFQLVVAANPCPCGYAYGNGERCT
FT                   CKERERARYFSRLSGPILDRIDIQMDVPPVERIIISNHHHDNAQNSVKNTYLNSKTMRD
FT                   NVIEARKIARDRFIKQGWDCNAQASGTWLRKYTSQQAVGLINRALEKHQLSLRGADRAL
FT                   RLAWTLADLSGHTSPDMTDIAQAISLRTRI"
FT   gene            complement(712491..713039)
FT                   /locus_tag="HMPREF0424_0639"
FT   CDS_pept        complement(712491..713039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0639"
FT                   /product="putative TIGR00252 family protein"
FT                   /note="identified by match to protein family HMM PF02021"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14638"
FT                   /db_xref="GOA:D2RAN4"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAN4"
FT                   /protein_id="ADB14638.1"
FT                   /translation="MITQKHIIDDEIISLDEIDDAETAQVFLQEKLEQVSNELQDDSLE
FT                   SKELGKLGETYATLRLIQKGWHVIDQNWHCRNGELDLVMITPEQKLVFVEVKTRRSVRC
FT                   GTPLEAITQEKRSKLRTTGMKWLEEFGSDIPHYRIRFDAVSILIINKYTYPDSAYELQS
FT                   LEEIEDNSSIQFKHVQGAF"
FT   gene            713291..714682
FT                   /locus_tag="HMPREF0424_0640"
FT   CDS_pept        713291..714682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0640"
FT                   /product="O-acetylhomoserine
FT                   aminocarboxypropyltransferase/cysteine synthase"
FT                   /note="identified by match to protein family HMM PF01041;
FT                   match to protein family HMM PF01053; match to protein
FT                   family HMM PF01212; match to protein family HMM TIGR01326"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13927"
FT                   /db_xref="GOA:D2RAN5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAN5"
FT                   /protein_id="ADB13927.1"
FT                   /translation="MDAQSKLKQTNLLFKKSQNWRGIMSDIEETQGKYHFETLQLHVGQ
FT                   EQADPATDSRAVPIYQTTSYVFHDFDHAAARFDLRDAGNIYGRLTNSTQDVFERRIAAL
FT                   EGGTAALAVASGAAAVDYAIRNITQQGDHIVSSKNVYGGTYNLLRHTLPRDGVTTTFVD
FT                   PKNPQNFEDAIQPNTKLVYFETFGNPNADLPDFEAISEIAHRHNIPVFVDNTFATPYLF
FT                   RPLEHGADIIVESATKFIGGHGTTLGGIIVEGGNFDWAKVPGKFPTLTEADPSYHGLNF
FT                   YEALGPVAFVTRIRAIILRDTGACISPFAAFLLLQGTETLSLRVERHVDNALKVVQYLQ
FT                   TVPEVESVSHPSIEGRSDHELYKRYFPNGGGSIFTFDIKGGRDAARVFIDNLQLFSLLA
FT                   NVADVKSLVIHPASTTHSQETPEELEDQGIHEGTIRLSIGTEHIDDILADLQRGFDAVR
FT                   KAGLA"
FT   gene            714952..715791
FT                   /locus_tag="HMPREF0424_0641"
FT   CDS_pept        714952..715791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0641"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14566"
FT                   /db_xref="GOA:D2RAN6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAN6"
FT                   /protein_id="ADB14566.1"
FT                   /translation="MNSPYETSSYEQENALDFRADFNQNLIGETAVAALHVVKDFGKGA
FT                   GIVHALRDVSVSFERGKFTAIMGPSGSGKSTLMHSLAGLDSVNSGKVLVDGLDITGMSD
FT                   KQLTLMRREMVGFIFQSFNLLPMFSAEQNILMPLTLAGKKPDKQWFNTLVLTLGLQNRL
FT                   HHRPAELSGGQRQRVAIARALISKPSVVFADEPTGNLDSASSSEVLHFLKKSVTELGQT
FT                   VIMVTHDAVAASYADRAIVFADGQIVEDVQNPTAEGMSKMLMERSEAGISNQSAQLQ"
FT   gene            715809..718502
FT                   /locus_tag="HMPREF0424_0642"
FT   CDS_pept        715809..718502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0642"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14031"
FT                   /db_xref="GOA:D2RAN7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAN7"
FT                   /protein_id="ADB14031.1"
FT                   /translation="MWKIALKLMRKSVRMLIASGIAILIGSMFMSATLLFVNSVDDLMV
FT                   RNATEEFHSANYAISSKSSNSSPNSGIHYKDLHLDEISKMPGVNGIRSDDATALVGVEK
FT                   GDKSVTSIAWSSGLYGNLPVYKSTEGRDPQKIGEITLIKSIAKSIHANIGDTITLVKVD
FT                   EAGGNKEKSYDVRVVGLVDDGEHSQIPISNRGTYLGGITNDFCAKLNNLKNFDNQVVQS
FT                   KVYMSIDESKINDLSPKINALLPEQFSLMSRHEVGVRAVRSVSNGTNFVTMFLLSFGVL
FT                   ALLISSLVIANTFQVLVAQRRRTLALLRVIGAQSHQLYTAVLLEAAILGVISAAIGVLC
FT                   AIGFMGAISNLNINSGPLSKIPLIVSLPAIVWPIVIGAIVTVLASMGAARSATKVTPME
FT                   ALRPMDLMKDKRASIIRAVFGVLFIVVGILFTALSSTSLASMIAQQSPNAGADSWRTLI
FT                   GAVFGCALVFIGIIITATFWMPFAMKATGAVMALCGPASKVANANVQRNPRRVAATGTA
FT                   LLIGVTLVSTVVTGAICGKATLKGVVDDRYSVDIIIQGKNVDESLAADISKISGIKHTE
FT                   LLPAVPMTFKNAKGKTEYAMAAGVDNVNQLRNVMHTDLDGVNINKDSVLLPKFNDEGGE
FT                   PFDLKKGSLNLQAYVEKYSSGETDSDNITPFTGMNTDSSNNDKSITVKQVQFKKYRNVG
FT                   VYSNNTAFVSKSYFNNYLKPTTHILLISVDSSKANLVDIAKNIRNVTSSYAEVVSTGSV
FT                   FERAKWESTIDAMMMALVGLIAVAVVIALIGVANTLSLSVIERTKESATLRAIGMTRGQ
FT                   VRRSLALEATLISLTSTVSGLIVGTAFGWIGSYMVFSTIGKVPFVVDWTIYAVLALIAL
FT                   LAALLSSVLPARRAVKSSPVVALAED"
FT   gene            718888..720855
FT                   /locus_tag="HMPREF0424_0643"
FT   CDS_pept        718888..720855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0643"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13548"
FT                   /db_xref="GOA:D2RAN8"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAN8"
FT                   /protein_id="ADB13548.1"
FT                   /translation="MVTVKKKSAAAIAGFVLFLQGPMPAWAQEAAEVVQNTQAQTEVTA
FT                   KASTENKLLQVEHNIEELKSKIDEQTKNLEDVVNKLNKTIENINTFTKGIAKKEKELDG
FT                   INKVIGTDLAQAQAVLKDLKKKKQLKEVELKSLEIQKEQSKDNYEKSKNELDSLISLES
FT                   EESSKKDSYEKIYKNYENKMQNLNSDIKVLSEEIEKDRAALLKLSAKVDEDAKALEDAE
FT                   HQDNADFDKLRSNLENADKEFNSLNQEIGVKKLKLSDMNSSLTQLEPKFNEAVKSFEEQ
FT                   SKQLESIKQDLDIAKQDTEDKLKDLNDKTSSIENIKEELSAIEVDINSYELSNNESERN
FT                   KKIEGLRTNIAVLKDLLKNFQVQKVDNEKAKKNLEDTLNDLKNQHSLALAELDALKASQ
FT                   SEKKKSSESDSTSPVPKRNNSDSQTQSNDSERRIAPNNPQSSVNSKDNADSSMHPKVST
FT                   PSDVETSGAPSVKHSGTSSKTPSEAPSSATKETSSSSESYVPPVTAVEEQKQNENISQE
FT                   QPAAQSSNPVRTVAVKDIVSEDAADKQSKPVESKTVESAKPSAKTSESNVAKENAKTAE
FT                   STETAENDDVQDRPANETDEKISDTVSEKPKTQASATSENKSSGNMLSNIMLGVLGVLT
FT                   ISGAAAAGVTVMRHRRLPRA"
FT   gene            complement(720938..721723)
FT                   /locus_tag="HMPREF0424_0644"
FT   CDS_pept        complement(720938..721723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0644"
FT                   /product="response regulator receiver domain protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196; match to protein
FT                   family HMM PF04545; match to protein family HMM PF04967;
FT                   match to protein family HMM PF08281"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14361"
FT                   /db_xref="GOA:D2RAN9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAN9"
FT                   /protein_id="ADB14361.1"
FT                   /translation="MENMENNEVIRVAIADDQELVRAGFAMVINSQQDMHVVSQTSNGS
FT                   QIVELSKSQNPDIILMDVRMPVMDGLEATRKILQQKTNENTKIIILTTFDLDEYVMAAI
FT                   HAGASGFLLKDTEPETLLNSIRTVYQGNAIIAPTATKRLIENMIQQGKVATNTTENSAA
FT                   NYTANYAAQESYDVQANPAAQATQSCAYTNSAITELTDREREVLVEIAHGLSNQEIADK
FT                   LFISLPTVKTHVAHILGKIGARDRVQAVVFAYENGLVKP"
FT   gene            complement(721736..724285)
FT                   /locus_tag="HMPREF0424_0645"
FT   CDS_pept        complement(721736..724285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0645"
FT                   /product="histidine kinase"
FT                   /note="identified by match to protein family HMM PF07730"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14556"
FT                   /db_xref="GOA:D2RAP0"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAP0"
FT                   /protein_id="ADB14556.1"
FT                   /translation="MKISHTFNSCIQRLRTELTLNDILWGIIPFILFMLSSDRYVISNV
FT                   DGFLTQGSLITVTLINIVVALLLSVRKLWPEQSATIFIVICIVQVAFGSTQLFADFFGF
FT                   VLLVNAIARGNPEHSKAFVIAAYVTTVLSCAIISWNIVMGPIYGNNHSKASYTCSVQNI
FT                   NSSNIKNCVSNILNFAIPSIIFAIITTTITVIIGYWQRTHVHTIQLLQDHNNAIRAYRK
FT                   KAQHIAVTAERARIARDMHDIVAHTLSIIIVQADGGRYAATKDISLAKKTMHIIKNEAE
FT                   RAVHDMRRLLEALTDAPSGQLDFNHVPSLIEQAKIASPKNIFWHTVDGINSQNRLNADA
FT                   QTVAYRVVQESLTNIRKHAGDGIKINIHEQWKNQGLTLKITNEINKLEANQEQNSGAPH
FT                   KNGYGLIGMKERIENLHGTLDYGKMNDGTFSIVAFIPYSYSADQSNSTASVLNSIHNVT
FT                   HKNAKVNNQAEAQTKPENANVSTSSEVSTNVLPYVLPEANTSKNRIEKVSQWFEQHWLI
FT                   GDIIYASPWVVMMLFLPTYDFIVGVGMSSQYSNSLSLQILYKVFTLTTMVPFMFRRKAP
FT                   TACAIVAAVFSAIQLILLPNILFANFFIPNIIYAAVLYGKKRAWQWVSAVVLAESAIFA
FT                   VKIGISSKNIPQTETPIRFFTSNIATTNFYDFMQFASVGLVFGFIVALICFAAIAFAYS
FT                   RRNDDNNLLILKARRTELEQEQKQLEVLAANAERQRLSSNIQQKVAITLHKVIDAANSG
FT                   IDMLNKYEKTNSNAENRKLSEPKQSQEQSEEISKAFKNIGDEGRSALKYMRKLLGVLRE
FT                   TGSSVHSANNAANVTEIAIRPAAPLDEQIQHNALNKQ"
FT   gene            724403..725785
FT                   /locus_tag="HMPREF0424_0646"
FT   CDS_pept        724403..725785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0646"
FT                   /product="hydrolase, alpha/beta domain protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13855"
FT                   /db_xref="GOA:D2RAP1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAP1"
FT                   /protein_id="ADB13855.1"
FT                   /translation="MALLTSYYVPGLHIEERAIDVPLDWEGNTPGGAIKGETIRLFCRV
FT                   VCAPEHVHDDLPLLVFLQGGPGGQCPRPLSPSSDGWIQEAIKHFRVVLPDQRGVGRSSR
FT                   VDASTMKRMLDDGVSVERQAWYLKRFLADSIIRDFEHLRLTEFDAKPWVSLGQSYGGFL
FT                   TLTYLSLSPQGLIASFTTGGIPHVPANAREVYEHTFPRMARKTEQFYERYPQDVARAAA
FT                   IADRIAQGDVMLPNGEKLTVERFQMLGSSFGMKPSFERVHWLLDSAFSDGDGSLKAFKH
FT                   AGGSVAGSLSDEFVYGVMDATASSPLYWPLQEFIYADGELEHPILWAAQQVRETMPEFS
FT                   GSARPLLFTGEAMFPWMFDQEKALQPFLPAVDCLMSDKQFGKIYDQEQLANNEVPLQSA
FT                   VYFDDMYVDSGLQLDTLSRIANSHYWTTNEFEHDGLHGDVVFRHLFDEALNRGDLEGIY
FT                   KR"
FT   gene            725912..726715
FT                   /gene="proC"
FT                   /locus_tag="HMPREF0424_0647"
FT   CDS_pept        725912..726715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="HMPREF0424_0647"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="identified by match to protein family HMM PF03807;
FT                   match to protein family HMM TIGR00112"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADB13849"
FT                   /db_xref="GOA:D2RAP2"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAP2"
FT                   /protein_id="ADB13849.1"
FT                   /translation="MGTCVSGTVGFIGYGNMAQAIAKGALNAGVLQGENIVACAHNFEK
FT                   LERNTSLIGARAMRTAQEVCEASDVIIIAVKPYQVAEVLKPVCEVINERGIAVISVAAG
FT                   WTLERYMELLGKNAHVQCIIPNTPIAVCQGVTLAETTHTLSDSQLSMFSALFEPISLVE
FT                   RVNSDHMNIAMCISSCAPAFTAMYMEALGDAGVKYGLQRDCAYRLAAKMIEGVGALYMD
FT                   SRTHPGIMKDAVCSPGGTTIRGVAELESRGFRGDVIAAVDAIENK"
FT   gene            726770..727858
FT                   /gene="ychF"
FT                   /locus_tag="HMPREF0424_0648"
FT   CDS_pept        726770..727858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychF"
FT                   /locus_tag="HMPREF0424_0648"
FT                   /product="GTP-binding protein YchF"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF06071; match to protein
FT                   family HMM TIGR00092"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14398"
FT                   /db_xref="GOA:D2RAP3"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAP3"
FT                   /protein_id="ADB14398.1"
FT                   /translation="MSLTIGIVGLPNVGKSTMFNALTRNNVLAENYPFATIEPNTGIVP
FT                   LPDHRLPVLAKLVNTEKIVPATVTFVDIAGIVKGASEGEGLGNKFLANIREADAICEVV
FT                   RAFNDDDIVHVNGKVDPADDIDTINTELILADMQTIDNALPKLEKDLRGKKVTQEYVDA
FT                   VNKAKEILESGKTIDQAHNEKLIDKNDVYDLHLLTAKPFIYVFNVDDSELADEDLKSKL
FT                   SASVAPAKAIFLNAQFESELTELDEADAREMLEDAGLKESGLDQLARVGFDILGLQTYL
FT                   TAGVKEVHAWQIHKGWTAPQAAGVIHTDFERGFIKAEIVSYDDFVAADGSMAKIKEEGK
FT                   LRLEGRDYVMQDGDIVEFKFNV"
FT   gene            728005..728790
FT                   /locus_tag="HMPREF0424_0649"
FT   CDS_pept        728005..728790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0424_0649"
FT                   /product="ErfK/YbiS/YcfS/YnhG"
FT                   /note="identified by match to protein family HMM PF03734"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0424_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADB14339"
FT                   /db_xref="GOA:D2RAP4"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D2RAP4"
FT                   /protein_id="ADB14339.1"
FT                   /translation="MQFIRNIMNDIKKCIRIAAKMRNWWRRSSKAARITSSVLLASLLI
FT                   AWLCFIIFETVNMVSYSSRYSAKLQNSVLIQREKNAYSNNLGNKNNEVADNKSFEKYFD
FT                   KYCKQKLDKSTVNHVFWKHPTGGEYPNLSGAKVSDLKVNVDLKKQRVHILANGKTVYTM
FT                   IMSSGMDDSTPHGDYHINMRGKHFFNHEEKVGADYWVGFIGGEYLFHSVPTRYNFGEYI
FT                   PSEGMKLGKPASHGCVRLSVADAKWFYKNIPDGTAVHIR"
FT   gene            complement(728893..729954)
FT                   /locus_tag="HMPREF0424_0650"
FT   CDS_pept        complement(728893..729954)
FT                   /codon_start=